BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF003C10

Length=507
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004240685.1|  PREDICTED: aspartic proteinase Asp1                120   6e-29   
ref|XP_009631909.1|  PREDICTED: aspartic proteinase Asp1                119   1e-28   Nicotiana tomentosiformis
emb|CDP04854.1|  unnamed protein product                                118   3e-28   Coffea canephora [robusta coffee]
ref|XP_006346815.1|  PREDICTED: aspartic proteinase Asp1-like           118   3e-28   Solanum tuberosum [potatoes]
ref|XP_010674354.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     117   5e-28   
ref|XP_010674353.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     117   5e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS67652.1|  hypothetical protein M569_07122                         116   1e-27   Genlisea aurea
gb|EYU20602.1|  hypothetical protein MIMGU_mgv1a007047mg                116   2e-27   Erythranthe guttata [common monkey flower]
ref|XP_002273988.1|  PREDICTED: aspartic proteinase Asp1                115   2e-27   Vitis vinifera
ref|XP_011099684.1|  PREDICTED: aspartic proteinase Asp1                115   4e-27   Sesamum indicum [beniseed]
ref|XP_009766881.1|  PREDICTED: aspartic proteinase Asp1                115   5e-27   Nicotiana sylvestris
ref|XP_008227592.1|  PREDICTED: aspartic proteinase Asp1                113   2e-26   Prunus mume [ume]
dbj|BAD80835.1|  nucellin-like protein                                  112   3e-26   Daucus carota [carrots]
ref|XP_008361087.1|  PREDICTED: aspartic proteinase Asp1-like           112   6e-26   
ref|XP_007211687.1|  hypothetical protein PRUPE_ppa005961mg             112   7e-26   Prunus persica
ref|XP_002310541.2|  hypothetical protein POPTR_0007s04800g             111   7e-26   
ref|XP_011022861.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    111   9e-26   Populus euphratica
ref|XP_010111255.1|  Aspartic proteinase Asp1                           111   1e-25   Morus notabilis
ref|XP_007048531.1|  Aspartyl protease family protein isoform 2         110   1e-25   
ref|XP_003532363.2|  PREDICTED: aspartic proteinase Asp1-like           110   1e-25   Glycine max [soybeans]
ref|XP_007048530.1|  Eukaryotic aspartyl protease family protein ...    110   2e-25   
ref|XP_011468243.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     110   2e-25   Fragaria vesca subsp. vesca
ref|XP_011468246.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     109   3e-25   Fragaria vesca subsp. vesca
ref|XP_007159874.1|  hypothetical protein PHAVU_002G275100g             109   4e-25   Phaseolus vulgaris [French bean]
gb|KHG06665.1|  Asparticase Asp1                                        108   7e-25   Gossypium arboreum [tree cotton]
gb|KJB40494.1|  hypothetical protein B456_007G066800                    108   7e-25   Gossypium raimondii
ref|XP_006412352.1|  hypothetical protein EUTSA_v10025289mg             108   8e-25   Eutrema salsugineum [saltwater cress]
ref|XP_002307058.2|  nucellin family protein                            108   8e-25   
gb|ABK95151.1|  unknown                                                 108   8e-25   Populus trichocarpa [western balsam poplar]
ref|XP_006382886.1|  hypothetical protein POPTR_0005s07070g             108   9e-25   
ref|XP_009355861.1|  PREDICTED: aspartic proteinase Asp1-like           108   1e-24   Pyrus x bretschneideri [bai li]
gb|KEH20923.1|  eukaryotic aspartyl protease family protein             107   2e-24   Medicago truncatula
ref|XP_010025734.1|  PREDICTED: aspartic proteinase Asp1-like           107   2e-24   Eucalyptus grandis [rose gum]
ref|XP_004163385.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    107   3e-24   
ref|XP_004147327.1|  PREDICTED: aspartic proteinase Asp1-like           107   3e-24   
ref|XP_008460822.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     107   3e-24   Cucumis melo [Oriental melon]
ref|XP_009350136.1|  PREDICTED: aspartic proteinase Asp1-like           107   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_008460823.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     107   3e-24   Cucumis melo [Oriental melon]
ref|XP_003524315.1|  PREDICTED: aspartic proteinase Asp1-like           107   3e-24   Glycine max [soybeans]
ref|XP_011031099.1|  PREDICTED: aspartic proteinase Asp1-like           107   3e-24   Populus euphratica
gb|KEH20924.1|  eukaryotic aspartyl protease family protein             106   4e-24   Medicago truncatula
emb|CAN73001.1|  hypothetical protein VITISV_037997                     106   4e-24   Vitis vinifera
ref|XP_009355862.1|  PREDICTED: aspartic proteinase Asp1-like           106   5e-24   Pyrus x bretschneideri [bai li]
ref|XP_003630348.1|  Aspartic proteinase Asp1                           106   5e-24   Medicago truncatula
emb|CDX68982.1|  BnaC01g04710D                                          106   5e-24   
emb|CDX75359.1|  BnaA01g03430D                                          106   6e-24   
ref|XP_009121783.1|  PREDICTED: aspartic proteinase Asp1                106   6e-24   Brassica rapa
ref|XP_004502990.1|  PREDICTED: aspartic proteinase Asp1-like           105   8e-24   Cicer arietinum [garbanzo]
ref|XP_003522473.1|  PREDICTED: aspartic proteinase Asp1-like           105   9e-24   Glycine max [soybeans]
gb|EEE52860.1|  hypothetical protein OsJ_35411                          105   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003602685.1|  Aspartic proteinase Asp1                           105   1e-23   
gb|EEC68949.1|  hypothetical protein OsI_37668                          105   1e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_001066301.1|  Os12g0177500                                       105   1e-23   
ref|XP_004503902.1|  PREDICTED: aspartic proteinase Asp1-like           105   1e-23   Cicer arietinum [garbanzo]
gb|AES72936.2|  eukaryotic aspartyl protease family protein             105   1e-23   Medicago truncatula
gb|ABA96612.2|  Eukaryotic aspartyl protease family protein, expr...    105   2e-23   Oryza sativa Japonica Group [Japonica rice]
emb|CAB38807.1|  nucellin-like protein                                  104   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190905.1|  aspartyl protease family protein                   104   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867175.1|  hypothetical protein ARALYDRAFT_328390             104   3e-23   Arabidopsis lyrata subsp. lyrata
ref|NP_567922.2|  aspartyl protease family protein                      104   3e-23   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43357.1|  putative nucellin                                      104   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KDP24798.1|  hypothetical protein JCGZ_25323                         104   3e-23   Jatropha curcas
ref|XP_010025733.1|  PREDICTED: aspartic proteinase Asp1-like           104   3e-23   Eucalyptus grandis [rose gum]
ref|XP_010527074.1|  PREDICTED: aspartic proteinase Asp1-like           103   4e-23   Tarenaya hassleriana [spider flower]
ref|XP_003528065.1|  PREDICTED: aspartic proteinase Asp1-like           104   4e-23   Glycine max [soybeans]
ref|XP_010268980.1|  PREDICTED: aspartic proteinase Asp1-like           103   5e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010447234.1|  PREDICTED: aspartic proteinase Asp1-like           103   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010547875.1|  PREDICTED: aspartic proteinase Asp1                103   6e-23   Tarenaya hassleriana [spider flower]
ref|XP_007137749.1|  hypothetical protein PHAVU_009G152700g             103   6e-23   Phaseolus vulgaris [French bean]
ref|XP_010437756.1|  PREDICTED: aspartic proteinase Asp1-like           103   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_011074834.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     102   8e-23   
ref|XP_011074835.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     102   9e-23   
gb|ACR35418.1|  unknown                                                 100   9e-23   Zea mays [maize]
gb|KFK29973.1|  hypothetical protein AALP_AA7G201200                    102   1e-22   Arabis alpina [alpine rockcress]
ref|XP_004977227.1|  PREDICTED: aspartic proteinase Asp1-like iso...    102   2e-22   
ref|XP_006282959.1|  hypothetical protein CARUB_v10007649mg             102   2e-22   Capsella rubella
ref|XP_010432554.1|  PREDICTED: aspartic proteinase Asp1-like           101   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010238658.1|  PREDICTED: aspartic proteinase Asp1-like           102   3e-22   Brachypodium distachyon [annual false brome]
ref|XP_002522918.1|  nucellin, putative                                 101   3e-22   Ricinus communis
ref|XP_006380399.1|  nucellin family protein                            101   3e-22   
ref|XP_010664194.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     101   3e-22   Vitis vinifera
ref|XP_004977226.1|  PREDICTED: aspartic proteinase Asp1-like iso...    101   4e-22   Setaria italica
ref|XP_002285867.2|  PREDICTED: aspartic proteinase Asp1 isoform X1     101   4e-22   Vitis vinifera
emb|CBI18999.3|  unnamed protein product                                100   5e-22   Vitis vinifera
gb|KDO52229.1|  hypothetical protein CISIN_1g015972mg                   100   5e-22   Citrus sinensis [apfelsine]
ref|XP_002441914.1|  hypothetical protein SORBIDRAFT_08g004800          100   6e-22   
gb|KDO52227.1|  hypothetical protein CISIN_1g015972mg                 99.4    6e-22   Citrus sinensis [apfelsine]
gb|KDO52226.1|  hypothetical protein CISIN_1g015972mg                 99.8    6e-22   Citrus sinensis [apfelsine]
ref|XP_010265185.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     102   7e-22   Nelumbo nucifera [Indian lotus]
gb|KDO52225.1|  hypothetical protein CISIN_1g015972mg                   100   7e-22   Citrus sinensis [apfelsine]
emb|CDO98445.1|  unnamed protein product                                102   7e-22   Coffea canephora [robusta coffee]
ref|XP_010265186.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     102   7e-22   Nelumbo nucifera [Indian lotus]
ref|XP_009802241.1|  PREDICTED: aspartic proteinase Asp1                100   1e-21   Nicotiana sylvestris
gb|KDO52221.1|  hypothetical protein CISIN_1g013774mg                 99.8    1e-21   Citrus sinensis [apfelsine]
ref|XP_010930726.1|  PREDICTED: aspartic proteinase Asp1-like         99.8    2e-21   
ref|XP_006464925.1|  PREDICTED: aspartic proteinase Asp1-like         99.8    2e-21   Citrus sinensis [apfelsine]
ref|XP_006432088.1|  hypothetical protein CICLE_v10001122mg           99.8    2e-21   
ref|XP_009611015.1|  PREDICTED: aspartic proteinase Asp1              99.0    2e-21   Nicotiana tomentosiformis
dbj|BAJ86250.1|  predicted protein                                      100   2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011069472.1|  PREDICTED: aspartic proteinase Asp1 isoform X2   99.0    2e-21   
gb|EYU31770.1|  hypothetical protein MIMGU_mgv1a006482mg              98.6    3e-21   Erythranthe guttata [common monkey flower]
gb|ACN34727.1|  unknown                                                 100   3e-21   Zea mays [maize]
emb|CDP10935.1|  unnamed protein product                              99.0    3e-21   Coffea canephora [robusta coffee]
ref|XP_006656867.1|  PREDICTED: aspartic proteinase Asp1-like         98.6    3e-21   
gb|EMT28382.1|  Aspartic proteinase Asp1                              99.0    4e-21   
gb|AFW56223.1|  hypothetical protein ZEAMMB73_420944                  97.8    4e-21   
ref|XP_009420564.1|  PREDICTED: aspartic proteinase Asp1-like         98.6    4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011069464.1|  PREDICTED: aspartic proteinase Asp1 isoform X1   98.6    4e-21   Sesamum indicum [beniseed]
ref|XP_002452609.1|  hypothetical protein SORBIDRAFT_04g028990        99.8    4e-21   Sorghum bicolor [broomcorn]
ref|XP_003570503.1|  PREDICTED: aspartic proteinase Asp1-like         99.8    4e-21   Brachypodium distachyon [annual false brome]
ref|NP_001152116.1|  aspartic proteinase Asp1 precursor               98.2    4e-21   
gb|EYU31771.1|  hypothetical protein MIMGU_mgv1a006482mg              98.6    4e-21   Erythranthe guttata [common monkey flower]
ref|XP_006432093.1|  hypothetical protein CICLE_v10001115mg           98.2    5e-21   
ref|NP_001131929.1|  uncharacterized protein LOC100193320 precursor   98.2    5e-21   
ref|XP_009393816.1|  PREDICTED: aspartic proteinase Asp1-like         98.2    5e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACR34528.1|  unknown                                               98.2    5e-21   Zea mays [maize]
ref|XP_010243511.1|  PREDICTED: aspartic proteinase Asp1              98.6    5e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006432092.1|  hypothetical protein CICLE_v10001115mg           98.6    5e-21   
ref|XP_006464928.1|  PREDICTED: aspartic proteinase Asp1-like iso...  97.8    6e-21   
ref|XP_004240544.1|  PREDICTED: aspartic proteinase Asp1 isoform X2   97.8    7e-21   Solanum lycopersicum
ref|NP_001048015.1|  Os02g0730700                                     99.4    7e-21   
gb|EEC73939.1|  hypothetical protein OsI_08807                        99.4    7e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_006464927.1|  PREDICTED: aspartic proteinase Asp1-like iso...  98.2    8e-21   
ref|XP_011022860.1|  PREDICTED: aspartic proteinase Asp1-like         97.4    9e-21   Populus euphratica
ref|XP_004240543.1|  PREDICTED: aspartic proteinase Asp1 isoform X1   97.4    9e-21   
ref|XP_009596730.1|  PREDICTED: aspartic proteinase Asp1-like         97.8    9e-21   Nicotiana tomentosiformis
ref|XP_004953813.1|  PREDICTED: aspartic proteinase Asp1-like         98.2    9e-21   
ref|XP_010265187.1|  PREDICTED: aspartic proteinase Asp1 isoform X3   97.8    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_008661408.1|  PREDICTED: uncharacterized protein LOC100193...  97.4    1e-20   Zea mays [maize]
ref|XP_010025732.1|  PREDICTED: aspartic proteinase Asp1-like         97.1    1e-20   Eucalyptus grandis [rose gum]
ref|XP_006355804.1|  PREDICTED: aspartic proteinase Asp1-like iso...  96.3    2e-20   Solanum tuberosum [potatoes]
ref|XP_009404862.1|  PREDICTED: aspartic proteinase Asp1-like         96.7    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001057353.1|  Os06g0268700                                     97.4    2e-20   
gb|EAZ00454.1|  hypothetical protein OsI_22475                        97.4    2e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_009758779.1|  PREDICTED: aspartic proteinase Asp1-like         96.3    3e-20   Nicotiana sylvestris
ref|XP_006588295.1|  PREDICTED: lysine-specific histone demethyla...  98.6    4e-20   
ref|XP_008781591.1|  PREDICTED: aspartic proteinase Asp1-like         96.3    4e-20   Phoenix dactylifera
gb|KHG03472.1|  Asparticase Asp1                                      97.1    4e-20   Gossypium arboreum [tree cotton]
ref|XP_006365534.1|  PREDICTED: aspartic proteinase Asp1-like         95.5    5e-20   Solanum tuberosum [potatoes]
ref|NP_001146721.1|  uncharacterized protein LOC100280323             96.3    7e-20   Zea mays [maize]
ref|XP_002449121.1|  hypothetical protein SORBIDRAFT_05g005400        94.0    9e-20   
ref|XP_006662788.1|  PREDICTED: aspartic proteinase Asp1-like         94.4    1e-19   Oryza brachyantha
ref|XP_010930728.1|  PREDICTED: aspartic proteinase Asp1-like         94.4    1e-19   Elaeis guineensis
ref|XP_004242040.1|  PREDICTED: aspartic proteinase Asp1 isoform X1   94.7    1e-19   Solanum lycopersicum
ref|XP_008813298.1|  PREDICTED: aspartic proteinase Asp1              95.5    1e-19   Phoenix dactylifera
ref|XP_010094778.1|  Aspartic proteinase Asp1                         95.5    1e-19   
gb|KDO41979.1|  hypothetical protein CISIN_1g008104mg                 93.6    3e-19   Citrus sinensis [apfelsine]
ref|XP_008669793.1|  PREDICTED: aspartic proteinase Asp1              93.2    3e-19   
gb|ACG42043.1|  aspartic proteinase Asp1 precursor                    93.2    3e-19   Zea mays [maize]
emb|CBI15437.3|  unnamed protein product                              94.0    3e-19   Vitis vinifera
gb|KJB39310.1|  hypothetical protein B456_007G006200                  94.4    3e-19   Gossypium raimondii
gb|EPS72688.1|  hypothetical protein M569_02067                       92.8    3e-19   Genlisea aurea
gb|KDO41978.1|  hypothetical protein CISIN_1g008104mg                 93.6    5e-19   Citrus sinensis [apfelsine]
ref|XP_010025731.1|  PREDICTED: aspartic proteinase Asp1-like         92.8    5e-19   
ref|XP_006440945.1|  hypothetical protein CICLE_v10019473mg           94.0    5e-19   Citrus clementina [clementine]
ref|XP_010908260.1|  PREDICTED: aspartic proteinase Asp1              94.0    5e-19   Elaeis guineensis
gb|KDO41977.1|  hypothetical protein CISIN_1g008104mg                 94.0    5e-19   Citrus sinensis [apfelsine]
gb|KJB39309.1|  hypothetical protein B456_007G006200                  93.6    6e-19   Gossypium raimondii
gb|KJB39307.1|  hypothetical protein B456_007G006200                  93.6    6e-19   Gossypium raimondii
ref|XP_010663584.1|  PREDICTED: aspartic proteinase Asp1              93.2    8e-19   Vitis vinifera
ref|XP_006826817.1|  hypothetical protein AMTR_s00010p00056950        92.8    1e-18   Amborella trichopoda
ref|XP_003577760.1|  PREDICTED: aspartic proteinase Asp1-like         91.7    1e-18   Brachypodium distachyon [annual false brome]
gb|KHN32026.1|  Aspartic proteinase Asp1                              92.8    1e-18   Glycine soja [wild soybean]
ref|XP_006485774.1|  PREDICTED: aspartic proteinase Asp1-like         92.4    2e-18   Citrus sinensis [apfelsine]
gb|KJB39311.1|  hypothetical protein B456_007G006200                  90.9    2e-18   Gossypium raimondii
ref|XP_004512995.1|  PREDICTED: lysine-specific histone demethyla...  93.6    2e-18   
ref|NP_001065913.1|  Os11g0183900                                     90.9    2e-18   
sp|A2ZC67.2|ASP1_ORYSI  RecName: Full=Aspartic proteinase Asp1; S...  90.9    2e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_002511959.1|  protein with unknown function                    92.0    2e-18   Ricinus communis
gb|EEC67807.1|  hypothetical protein OsI_35373                        90.9    2e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_007152781.1|  hypothetical protein PHAVU_004G159200g           91.7    3e-18   Phaseolus vulgaris [French bean]
ref|XP_011097005.1|  PREDICTED: aspartic proteinase Asp1              91.3    4e-18   Sesamum indicum [beniseed]
ref|XP_009406648.1|  PREDICTED: aspartic proteinase Asp1              91.3    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002520345.1|  nucellin, putative                               90.1    4e-18   
ref|XP_007152782.1|  hypothetical protein PHAVU_004G159200g           91.3    4e-18   Phaseolus vulgaris [French bean]
ref|XP_007036501.1|  Eukaryotic aspartyl protease family protein,...  90.9    5e-18   
ref|XP_004978884.1|  PREDICTED: aspartic proteinase Asp1-like         89.7    5e-18   Setaria italica
ref|XP_007036500.1|  Eukaryotic aspartyl protease family protein,...  90.9    6e-18   
gb|KCW48539.1|  hypothetical protein EUGRSUZ_K02213                   90.5    6e-18   Eucalyptus grandis [rose gum]
gb|KJB39308.1|  hypothetical protein B456_007G006200                  90.1    6e-18   Gossypium raimondii
ref|XP_009776622.1|  PREDICTED: aspartic proteinase Asp1              90.1    1e-17   Nicotiana sylvestris
gb|KDP20103.1|  hypothetical protein JCGZ_05872                       90.1    1e-17   Jatropha curcas
ref|XP_006354730.1|  PREDICTED: aspartic proteinase Asp1-like         89.7    1e-17   Solanum tuberosum [potatoes]
gb|AAK81698.1|  aspartyl proteinase                                   88.6    1e-17   Oryza sativa [red rice]
gb|AAK81699.1|  aspartyl proteinase                                   88.6    2e-17   Oryza sativa [red rice]
ref|XP_008457584.1|  PREDICTED: aspartic proteinase Asp1 isoform X2   89.4    2e-17   Cucumis melo [Oriental melon]
ref|XP_008457519.1|  PREDICTED: aspartic proteinase Asp1 isoform X1   89.4    2e-17   Cucumis melo [Oriental melon]
gb|KDP32842.1|  hypothetical protein JCGZ_12134                       88.6    2e-17   Jatropha curcas
gb|KEH27052.1|  eukaryotic aspartyl protease family protein           89.0    3e-17   Medicago truncatula
gb|KEH27053.1|  eukaryotic aspartyl protease family protein           88.6    3e-17   Medicago truncatula
ref|XP_004137470.1|  PREDICTED: aspartic proteinase Asp1-like         89.0    3e-17   Cucumis sativus [cucumbers]
ref|NP_001065918.1|  Os11g0184800                                     87.8    3e-17   
ref|XP_010036874.1|  PREDICTED: aspartic proteinase Asp1              89.0    3e-17   Eucalyptus grandis [rose gum]
gb|KHN20716.1|  Aspartic proteinase Asp1                              88.6    3e-17   Glycine soja [wild soybean]
gb|KDP38263.1|  hypothetical protein JCGZ_05797                       84.7    4e-17   Jatropha curcas
ref|XP_010027413.1|  PREDICTED: aspartic proteinase Asp1-like         87.8    4e-17   
ref|XP_004241624.1|  PREDICTED: aspartic proteinase Asp1              88.6    4e-17   
ref|XP_006583400.1|  PREDICTED: aspartic proteinase Asp1-like         88.2    4e-17   Glycine max [soybeans]
gb|ABR18371.1|  unknown                                               87.0    6e-17   Picea sitchensis
dbj|BAJ99780.1|  predicted protein                                    87.0    7e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006662787.1|  PREDICTED: aspartic proteinase Asp1-like         86.7    7e-17   Oryza brachyantha
ref|XP_004502512.1|  PREDICTED: aspartic proteinase Asp1-like         86.3    9e-17   Cicer arietinum [garbanzo]
ref|XP_010063407.1|  PREDICTED: aspartic proteinase Asp1 isoform X2   86.3    1e-16   Eucalyptus grandis [rose gum]
gb|EMT29613.1|  Aspartic proteinase Asp1                              86.3    1e-16   
ref|XP_004502513.1|  PREDICTED: aspartic proteinase Asp1-like         86.3    1e-16   Cicer arietinum [garbanzo]
ref|XP_010063406.1|  PREDICTED: aspartic proteinase Asp1 isoform X1   86.3    1e-16   Eucalyptus grandis [rose gum]
ref|XP_010680865.1|  PREDICTED: aspartic proteinase Asp1-like         86.3    1e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO37005.1|  hypothetical protein CISIN_1g019849mg                 84.3    2e-16   Citrus sinensis [apfelsine]
ref|XP_010095410.1|  Aspartic proteinase Asp1                         85.5    3e-16   
ref|XP_006472808.1|  PREDICTED: aspartic proteinase Asp1-like iso...  84.3    5e-16   Citrus sinensis [apfelsine]
ref|XP_011458802.1|  PREDICTED: aspartic proteinase Asp1 isoform X2   84.3    5e-16   Fragaria vesca subsp. vesca
ref|XP_011003438.1|  PREDICTED: aspartic proteinase Asp1-like         84.3    6e-16   Populus euphratica
ref|XP_004290889.1|  PREDICTED: aspartic proteinase Asp1 isoform X1   84.3    6e-16   Fragaria vesca subsp. vesca
ref|XP_006434233.1|  hypothetical protein CICLE_v10003265mg           84.3    6e-16   Citrus clementina [clementine]
ref|XP_001783556.1|  predicted protein                                84.0    7e-16   
ref|XP_006472807.1|  PREDICTED: aspartic proteinase Asp1-like iso...  84.3    7e-16   Citrus sinensis [apfelsine]
gb|EMS62785.1|  Aspartic proteinase Asp1                              83.6    8e-16   Triticum urartu
ref|XP_009621932.1|  PREDICTED: aspartic proteinase Asp1              84.7    8e-16   Nicotiana tomentosiformis
dbj|BAJ98705.1|  predicted protein                                    84.3    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006663866.1|  PREDICTED: aspartic proteinase Asp1-like         82.8    1e-15   
gb|KFK42141.1|  hypothetical protein AALP_AA2G216700                  83.6    1e-15   Arabis alpina [alpine rockcress]
ref|XP_003563970.2|  PREDICTED: aspartic proteinase Asp1-like         83.6    1e-15   
gb|EEC67810.1|  hypothetical protein OsI_35379                        83.2    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_004171754.1|  PREDICTED: aspartic proteinase Asp1-like         83.2    2e-15   
ref|XP_007019119.1|  Eukaryotic aspartyl protease family protein ...  82.8    2e-15   Theobroma cacao [chocolate]
ref|XP_004149806.1|  PREDICTED: aspartic proteinase Asp1-like         82.8    2e-15   Cucumis sativus [cucumbers]
ref|XP_007019120.1|  Eukaryotic aspartyl protease family protein ...  82.8    2e-15   
gb|EMT31650.1|  Aspartic proteinase Asp1                              83.2    2e-15   
gb|EMS52520.1|  Aspartic proteinase Asp1                              82.4    3e-15   Triticum urartu
gb|AJA74410.1|  aspartic protease                                     82.8    3e-15   Cicer arietinum [garbanzo]
ref|XP_002306645.2|  hypothetical protein POPTR_0005s20210g           82.0    3e-15   
emb|CDX88370.1|  BnaC06g38140D                                        82.0    4e-15   
ref|NP_177872.3|  aspartyl protease                                   82.0    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850981.1|  aspartyl protease                                   82.0    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011012697.1|  PREDICTED: aspartic proteinase Asp1              82.4    4e-15   Populus euphratica
emb|CDX87518.1|  BnaA07g33550D                                        82.0    5e-15   
ref|XP_010471942.1|  PREDICTED: aspartic proteinase Asp1-like         82.0    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010416691.1|  PREDICTED: aspartic proteinase Asp1-like         82.0    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002889144.1|  hypothetical protein ARALYDRAFT_476912           82.0    5e-15   
ref|XP_004498348.1|  PREDICTED: aspartic proteinase Asp1-like         81.6    5e-15   Cicer arietinum [garbanzo]
ref|XP_006302228.1|  hypothetical protein CARUB_v10020249mg           82.0    5e-15   Capsella rubella
ref|XP_010428825.1|  PREDICTED: aspartic proteinase Asp1-like         82.0    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004142705.1|  PREDICTED: aspartic proteinase Asp1-like         81.3    6e-15   Cucumis sativus [cucumbers]
ref|XP_009106403.1|  PREDICTED: aspartic proteinase Asp1              81.6    6e-15   Brassica rapa
ref|XP_006355850.1|  PREDICTED: aspartic proteinase Asp1-like         80.9    7e-15   
ref|XP_006856698.1|  hypothetical protein AMTR_s00054p00157640        80.9    8e-15   
ref|XP_006393742.1|  hypothetical protein EUTSA_v10011529mg           80.9    8e-15   Eutrema salsugineum [saltwater cress]
gb|EMT17344.1|  Aspartic proteinase Asp1                              78.6    8e-15   
ref|XP_006390086.1|  hypothetical protein EUTSA_v10018497mg           81.3    9e-15   Eutrema salsugineum [saltwater cress]
gb|KHG10363.1|  Asparticase Asp1                                      80.9    9e-15   Gossypium arboreum [tree cotton]
gb|KEH40514.1|  eukaryotic aspartyl protease family protein           80.5    1e-14   Medicago truncatula
ref|XP_010479334.1|  PREDICTED: aspartic proteinase Asp1-like         81.3    1e-14   Camelina sativa [gold-of-pleasure]
gb|KJB29195.1|  hypothetical protein B456_005G089000                  79.3    1e-14   Gossypium raimondii
gb|KJB29191.1|  hypothetical protein B456_005G089000                  79.3    1e-14   Gossypium raimondii
ref|XP_010500446.1|  PREDICTED: aspartic proteinase Asp1-like         81.3    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003526637.1|  PREDICTED: aspartic proteinase Asp1-like         80.5    1e-14   Glycine max [soybeans]
emb|CDY41786.1|  BnaC02g13700D                                        80.5    1e-14   Brassica napus [oilseed rape]
gb|EMT29612.1|  Aspartic proteinase Asp1                              80.1    2e-14   
ref|XP_001766321.1|  predicted protein                                79.7    2e-14   
gb|KEH40515.1|  eukaryotic aspartyl protease family protein           80.1    2e-14   Medicago truncatula
gb|AFW86305.1|  hypothetical protein ZEAMMB73_151223                  80.1    2e-14   
ref|XP_010521265.1|  PREDICTED: aspartic proteinase Asp1 isoform X2   80.1    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_008444185.1|  PREDICTED: aspartic proteinase Asp1-like         79.7    2e-14   Cucumis melo [Oriental melon]
ref|XP_004977228.1|  PREDICTED: aspartic proteinase Asp1-like iso...  79.7    2e-14   
ref|XP_001782061.1|  predicted protein                                79.7    2e-14   
ref|XP_007223384.1|  hypothetical protein PRUPE_ppa005622mg           79.7    2e-14   Prunus persica
ref|XP_010521264.1|  PREDICTED: aspartic proteinase Asp1 isoform X1   80.1    2e-14   Tarenaya hassleriana [spider flower]
gb|AAY23265.1|  Similar to probable aspartic proteinase (EC 3.4.2...  75.5    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010549131.1|  PREDICTED: aspartic proteinase Asp1              80.5    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_007223385.1|  hypothetical protein PRUPE_ppa005622mg           79.7    2e-14   Prunus persica
ref|XP_003523437.1|  PREDICTED: aspartic proteinase Asp1-like         79.7    2e-14   
gb|KJB29190.1|  hypothetical protein B456_005G089000                  79.7    3e-14   Gossypium raimondii
ref|XP_008658519.1|  PREDICTED: uncharacterized protein LOC100280...  80.1    3e-14   
gb|KJB29189.1|  hypothetical protein B456_005G089000                  79.3    3e-14   Gossypium raimondii
gb|EMT12274.1|  Aspartic proteinase Asp1                              79.3    3e-14   
ref|XP_008466731.1|  PREDICTED: aspartic proteinase Asp1-like         79.3    3e-14   Cucumis melo [Oriental melon]
ref|XP_006393315.1|  hypothetical protein EUTSA_v10011346mg           80.1    3e-14   Eutrema salsugineum [saltwater cress]
ref|XP_002893981.1|  hypothetical protein ARALYDRAFT_314121           78.2    4e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_011027498.1|  PREDICTED: aspartic proteinase Asp1-like iso...  78.6    5e-14   Populus euphratica
ref|XP_008460824.1|  PREDICTED: aspartic proteinase Asp1 isoform X3   78.6    5e-14   
ref|XP_011027497.1|  PREDICTED: aspartic proteinase Asp1-like iso...  78.6    5e-14   
ref|XP_002302227.1|  nucellin family protein                          78.6    6e-14   
gb|AAG51657.1|AC010704_1  nucellin-like protein; 27671-25467          78.6    6e-14   
gb|KGN62238.1|  hypothetical protein Csa_2G338820                     78.2    6e-14   
ref|XP_002891474.1|  aspartyl protease family protein                 79.3    6e-14   
gb|KHN20610.1|  Aspartic proteinase Asp1                              78.6    6e-14   
ref|XP_011027496.1|  PREDICTED: aspartic proteinase Asp1-like iso...  78.6    6e-14   
ref|XP_006304522.1|  hypothetical protein CARUB_v10011364mg           79.3    6e-14   
ref|XP_006386369.1|  hypothetical protein POPTR_0002s08190g           78.6    7e-14   
ref|NP_175079.1|  aspartyl protease family protein                    78.2    7e-14   
ref|XP_003605080.1|  Aspartic proteinase Asp1                         78.2    7e-14   
gb|KJB29186.1|  hypothetical protein B456_005G088900                  77.0    7e-14   
ref|XP_011027495.1|  PREDICTED: aspartic proteinase Asp1-like iso...  78.6    7e-14   
ref|XP_010461710.1|  PREDICTED: aspartic proteinase Asp1-like         79.0    8e-14   
ref|XP_006355805.1|  PREDICTED: aspartic proteinase Asp1-like iso...  77.4    8e-14   
ref|XP_008219614.1|  PREDICTED: aspartic proteinase Asp1-like iso...  78.2    9e-14   
gb|KHN20145.1|  Aspartic proteinase Asp1                              78.2    1e-13   
ref|XP_006596210.1|  PREDICTED: aspartic proteinase Asp1-like iso...  78.2    1e-13   
ref|XP_004965200.1|  PREDICTED: aspartic proteinase Asp1-like         78.6    1e-13   
ref|XP_007137426.1|  hypothetical protein PHAVU_009G126200g           77.8    1e-13   
emb|CDY12535.1|  BnaC06g00610D                                        77.4    1e-13   
emb|CDY14973.1|  BnaA10g08830D                                        77.8    1e-13   
ref|XP_008219613.1|  PREDICTED: aspartic proteinase Asp1-like iso...  77.8    1e-13   
emb|CDY10133.1|  BnaC05g03760D                                        77.8    1e-13   
ref|XP_009123049.1|  PREDICTED: aspartic proteinase Asp1              77.4    1e-13   
gb|KHG10362.1|  Asparticase Asp1                                      77.8    1e-13   
gb|KJB29188.1|  hypothetical protein B456_005G088900                  77.4    1e-13   
gb|KJB29187.1|  hypothetical protein B456_005G088900                  77.4    1e-13   
ref|XP_007019123.1|  Eukaryotic aspartyl protease family protein,...  77.8    1e-13   
ref|NP_564539.1|  aspartyl protease                                   78.2    1e-13   
gb|KJB29181.1|  hypothetical protein B456_005G088900                  77.8    1e-13   
gb|KJB29182.1|  hypothetical protein B456_005G088900                  77.8    2e-13   
gb|KHN47012.1|  Aspartic proteinase Asp1                              76.6    2e-13   
ref|XP_003523438.1|  PREDICTED: aspartic proteinase Asp1-like         76.6    2e-13   
ref|XP_010322933.1|  PREDICTED: aspartic proteinase Asp1 isoform X2   76.6    3e-13   
gb|AES87275.2|  eukaryotic aspartyl protease family protein           76.6    3e-13   
ref|XP_003605078.1|  Aspartic proteinase Asp1                         76.3    3e-13   
gb|AAM76716.1|  nucellin-like aspartic protease                       75.9    3e-13   
ref|XP_006303534.1|  hypothetical protein CARUB_v10010968mg           76.3    4e-13   
ref|XP_010532199.1|  PREDICTED: aspartic proteinase Asp1              75.9    5e-13   
ref|XP_007161478.1|  hypothetical protein PHAVU_001G072500g           75.9    5e-13   
gb|KFK36042.1|  hypothetical protein AALP_AA4G070400                  76.3    6e-13   
ref|XP_010479040.1|  PREDICTED: aspartic proteinase Asp1              75.5    7e-13   
ref|XP_002888605.1|  hypothetical protein ARALYDRAFT_475850           75.1    9e-13   
ref|XP_008444184.1|  PREDICTED: aspartic proteinase Asp1-like         74.7    1e-12   
gb|EMT27436.1|  Aspartic proteinase Asp1                              74.7    1e-12   
ref|XP_009144992.1|  PREDICTED: aspartic proteinase Asp1              75.1    1e-12   
ref|XP_002449122.1|  hypothetical protein SORBIDRAFT_05g005410        74.3    1e-12   
ref|XP_007019121.1|  Eukaryotic aspartyl protease family protein      74.3    2e-12   
ref|XP_006434231.1|  hypothetical protein CICLE_v10001860mg           72.4    3e-12   
gb|EMT01144.1|  Aspartic proteinase Asp1                              73.2    4e-12   
gb|EMT27437.1|  Aspartic proteinase Asp1                              73.2    4e-12   
ref|XP_004142630.1|  PREDICTED: aspartic proteinase Asp1-like         72.8    5e-12   
gb|KDO80579.1|  hypothetical protein CISIN_1g014185mg                 72.8    6e-12   
emb|CDY60079.1|  BnaA05g36440D                                        73.2    6e-12   
gb|EMS61228.1|  Aspartic proteinase Asp1                              72.4    7e-12   
ref|XP_002449123.1|  hypothetical protein SORBIDRAFT_05g005430        72.0    9e-12   
emb|CDY04326.1|  BnaC05g25880D                                        72.4    1e-11   
gb|EMS61227.1|  Aspartic proteinase Asp1                              71.2    1e-11   
ref|XP_006472803.1|  PREDICTED: aspartic proteinase Asp1-like iso...  71.2    2e-11   
gb|EMT28907.1|  Aspartic proteinase Asp1                              70.1    2e-11   
gb|EEE51772.1|  hypothetical protein OsJ_33215                        72.0    2e-11   
ref|XP_004980239.1|  PREDICTED: aspartic proteinase Asp1-like         70.9    2e-11   
gb|EMT23418.1|  Aspartic proteinase Asp1                              67.0    9e-11   
dbj|BAK05301.1|  predicted protein                                    69.3    9e-11   
gb|AAB96882.1|  nucellin                                              68.9    1e-10   
gb|EMS63812.1|  Aspartic proteinase Asp1                              68.9    1e-10   
gb|AAB97155.1|  EEA1                                                  68.6    2e-10   
ref|XP_006374352.1|  aspartyl protease family protein                 67.0    9e-10   
ref|XP_007203973.1|  hypothetical protein PRUPE_ppa025075mg           62.4    1e-08   
ref|XP_002961719.1|  hypothetical protein SELMODRAFT_64161            62.0    2e-08   
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  61.2    6e-08   
gb|KDO80582.1|  hypothetical protein CISIN_1g014185mg                 60.5    6e-08   
ref|XP_006434232.1|  hypothetical protein CICLE_v10001860mg           59.7    6e-08   
gb|KDO80580.1|  hypothetical protein CISIN_1g014185mg                 60.5    7e-08   
ref|XP_002964789.1|  hypothetical protein SELMODRAFT_82470            60.5    7e-08   
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  60.1    1e-07   
ref|NP_001077691.1|  aspartyl protease                                59.7    1e-07   
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  59.7    1e-07   
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  60.1    2e-07   
ref|XP_006472802.1|  PREDICTED: aspartic proteinase Asp1-like iso...  59.3    2e-07   
ref|XP_010551288.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  59.3    2e-07   
gb|EYU19035.1|  hypothetical protein MIMGU_mgv1a021892mg              58.9    3e-07   
ref|XP_007225636.1|  hypothetical protein PRUPE_ppa003917mg           58.9    4e-07   
ref|XP_004229588.1|  PREDICTED: aspartic proteinase CDR1-like         58.2    4e-07   
emb|CBI29230.3|  unnamed protein product                              58.5    5e-07   
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                  58.2    6e-07   
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  58.2    6e-07   
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660        57.8    7e-07   
ref|XP_010527532.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  57.8    7e-07   
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  57.8    7e-07   
ref|XP_006361599.1|  PREDICTED: uncharacterized protein LOC102600310  58.2    8e-07   
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  57.4    9e-07   
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  57.4    1e-06   
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg           57.4    1e-06   
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504            57.4    1e-06   
gb|KDP20100.1|  hypothetical protein JCGZ_05869                       57.4    1e-06   
ref|XP_008791253.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  57.4    1e-06   
ref|XP_008359997.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  57.4    1e-06   
ref|XP_009103072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  57.0    1e-06   
emb|CDY51131.1|  BnaA07g37140D                                        57.0    1e-06   
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  57.0    1e-06   
emb|CDY24395.1|  BnaCnng04620D                                        57.0    1e-06   
ref|XP_010244232.1|  PREDICTED: aspartic proteinase CDR1-like         56.6    2e-06   
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048            56.6    2e-06   
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  56.6    2e-06   
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  56.6    2e-06   
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  56.6    2e-06   
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  56.6    2e-06   
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  56.6    2e-06   
gb|EPS61272.1|  hypothetical protein M569_13524                       56.6    2e-06   
ref|XP_009398943.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  56.6    2e-06   
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  56.2    2e-06   
ref|XP_002458414.1|  hypothetical protein SORBIDRAFT_03g033075        56.2    2e-06   
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg           56.2    2e-06   
gb|KDO70057.1|  hypothetical protein CISIN_1g0117491mg                55.1    2e-06   
ref|XP_002985015.1|  hypothetical protein SELMODRAFT_121417           56.2    3e-06   
ref|XP_006354667.1|  PREDICTED: aspartic proteinase CDR1-like         55.8    3e-06   
gb|EAZ40114.1|  hypothetical protein OsJ_24557                        55.8    3e-06   
gb|EAZ04167.1|  hypothetical protein OsI_26309                        55.8    3e-06   
ref|XP_001784204.1|  predicted protein                                55.5    3e-06   
ref|NP_001059857.1|  Os07g0533600                                     55.8    3e-06   
ref|XP_010246375.1|  PREDICTED: aspartic proteinase-like protein 2    55.8    3e-06   
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.8    4e-06   
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein      55.5    4e-06   
ref|XP_009361461.1|  PREDICTED: aspartic proteinase CDR1-like         55.8    4e-06   
ref|XP_010695864.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.5    4e-06   
ref|XP_009345583.1|  PREDICTED: aspartic proteinase CDR1-like         55.5    4e-06   
gb|KEH27070.1|  aspartic protease in GUARD CELL-like protein          55.5    4e-06   
ref|XP_009336599.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.5    4e-06   
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.5    4e-06   
ref|XP_002890686.1|  aspartyl protease family protein                 55.5    4e-06   
emb|CDP20730.1|  unnamed protein product                              55.5    5e-06   
ref|XP_008389306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.5    5e-06   
ref|XP_004972145.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.1    5e-06   
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  55.5    5e-06   
ref|XP_006361595.1|  PREDICTED: aspartic proteinase CDR1-like         55.1    5e-06   
ref|XP_006303624.1|  hypothetical protein CARUB_v10011499mg           55.1    5e-06   
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                     55.1    6e-06   
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.1    6e-06   
ref|XP_006367587.1|  PREDICTED: aspartic proteinase-like protein ...  54.7    6e-06   
ref|XP_006847614.1|  hypothetical protein AMTR_s00014p00246430        55.1    6e-06   
emb|CDY53740.1|  BnaAnng12680D                                        54.7    6e-06   
ref|XP_006363880.1|  PREDICTED: uncharacterized protein LOC102587886  55.1    7e-06   
ref|XP_010499694.1|  PREDICTED: probable aspartic protease At2g35615  54.7    7e-06   
ref|XP_006437718.1|  hypothetical protein CICLE_v10031364mg           54.7    8e-06   
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.7    8e-06   
ref|XP_010480892.1|  PREDICTED: probable aspartic protease At2g35615  54.3    8e-06   
ref|XP_006484425.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.7    8e-06   
ref|XP_004244684.1|  PREDICTED: aspartic proteinase CDR1-like         54.3    8e-06   
ref|XP_010911344.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.3    8e-06   
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039            54.7    9e-06   
ref|XP_010549135.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.3    9e-06   
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g           54.3    9e-06   
gb|EYU27191.1|  hypothetical protein MIMGU_mgv1a017795mg              54.3    9e-06   
gb|KDP29378.1|  hypothetical protein JCGZ_18299                       54.3    9e-06   
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g           54.3    9e-06   
ref|XP_007146932.1|  hypothetical protein PHAVU_006G083000g           54.3    9e-06   
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.3    1e-05   
ref|XP_003637421.1|  Aspartic proteinase nepenthesin-1                53.9    1e-05   
emb|CDY03848.1|  BnaC07g10730D                                        54.3    1e-05   
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.3    1e-05   
ref|NP_174430.1|  aspartyl protease-like protein                      54.3    1e-05   
ref|XP_002514831.1|  Aspartic proteinase Asp1 precursor, putative     54.3    1e-05   
gb|AEX12632.1|  hypothetical protein 2_5918_01                        51.6    1e-05   
ref|XP_010677970.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.3    1e-05   
ref|XP_008221090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.3    1e-05   
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630        54.3    1e-05   
ref|XP_006857555.1|  hypothetical protein AMTR_s00061p00053670        53.9    1e-05   
gb|AEX12643.1|  hypothetical protein 2_5918_01                        51.6    1e-05   
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.9    1e-05   
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein          53.9    1e-05   
ref|XP_002865165.1|  predicted protein                                51.6    1e-05   
gb|EYU26817.1|  hypothetical protein MIMGU_mgv1a006622mg              53.9    1e-05   
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.9    1e-05   
ref|XP_007227097.1|  hypothetical protein PRUPE_ppa025647mg           53.9    1e-05   
gb|EYU26818.1|  hypothetical protein MIMGU_mgv1a006622mg              53.9    1e-05   
ref|XP_006354732.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.9    1e-05   
ref|XP_008460202.1|  PREDICTED: uncharacterized protein LOC103499087  53.9    1e-05   
ref|XP_010241480.1|  PREDICTED: aspartic proteinase-like protein 2    53.9    1e-05   
ref|XP_008675097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.5    2e-05   
ref|XP_011008360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.5    2e-05   
ref|XP_003617399.1|  60S ribosomal protein L18a                       53.9    2e-05   
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.5    2e-05   
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750        53.5    2e-05   
ref|XP_004305337.1|  PREDICTED: aspartic proteinase CDR1-like         53.5    2e-05   
ref|XP_002891144.1|  predicted protein                                53.5    2e-05   
gb|AET00358.2|  eukaryotic aspartyl protease family protein           53.5    2e-05   
emb|CBI27051.3|  unnamed protein product                              52.8    2e-05   
gb|KHG26838.1|  hypothetical protein F383_06861                       53.5    2e-05   
ref|XP_008807681.1|  PREDICTED: aspartic proteinase Asp1-like         53.1    2e-05   
ref|XP_002281973.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.5    2e-05   
ref|XP_008453383.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.1    2e-05   
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.1    2e-05   
ref|XP_004239840.1|  PREDICTED: aspartic proteinase-like protein 2    53.1    2e-05   
ref|NP_173922.1|  aspartyl protease family protein                    53.1    2e-05   
gb|KJB75144.1|  hypothetical protein B456_012G026600                  53.1    2e-05   
ref|XP_009608744.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.1    2e-05   
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971            53.1    2e-05   
ref|XP_002986201.1|  hypothetical protein SELMODRAFT_234982           53.1    2e-05   
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.1    2e-05   
ref|XP_008340423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.1    2e-05   
gb|KJB52970.1|  hypothetical protein B456_008G285900                  53.1    2e-05   
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...  53.1    3e-05   
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966            52.8    3e-05   
emb|CDP11850.1|  unnamed protein product                              52.8    3e-05   
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                 53.1    3e-05   
ref|XP_002266461.1|  PREDICTED: aspartic proteinase CDR1              52.8    3e-05   
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.1    3e-05   
ref|XP_008452153.1|  PREDICTED: probable aspartic protease At2g35615  52.8    3e-05   
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg           52.8    3e-05   
ref|XP_008375679.1|  PREDICTED: aspartic proteinase CDR1-like         52.8    3e-05   
ref|XP_002266498.1|  PREDICTED: aspartic proteinase CDR1              52.8    3e-05   
gb|KDP26966.1|  hypothetical protein JCGZ_22200                       53.1    3e-05   
ref|XP_002879121.1|  predicted protein                                53.1    3e-05   
ref|XP_010688898.1|  PREDICTED: aspartic proteinase nepenthesin-1     52.8    3e-05   
gb|KJB75146.1|  hypothetical protein B456_012G026600                  52.8    3e-05   
ref|XP_011080810.1|  PREDICTED: aspartic proteinase CDR1-like         52.8    3e-05   
gb|KJB75145.1|  hypothetical protein B456_012G026600                  52.8    3e-05   
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  52.8    3e-05   



>ref|XP_004240685.1| PREDICTED: aspartic proteinase Asp1 [Solanum lycopersicum]
Length=427

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 71/106 (67%), Gaps = 17/106 (16%)
 Frame = +2

Query  188  RHQKWWKWpspgsdgassssssssssssssspvvsrggpssIVLPLYGNVYPNGFYFAQV  367
            + QKWWKW S  S    +   SSS                 IVLPLYGNVYP G+Y+ Q+
Sbjct  30   QQQKWWKWMSSTSAAMVNPVVSSS-----------------IVLPLYGNVYPLGYYYVQL  72

Query  368  DIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLV  505
            +IG P RP+F+DPDTGSDLTWLQCDAPCV CT APHP YKPNNDLV
Sbjct  73   NIGQPSRPFFLDPDTGSDLTWLQCDAPCVRCTTAPHPFYKPNNDLV  118



>ref|XP_009631909.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
Length=431

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPLYGNVYP G+Y+ Q++IG P +PYF+DPDTGSDLTWLQCDAPCV CT+APHP YKP
Sbjct  58   IVLPLYGNVYPIGYYYVQLNIGQPSKPYFLDPDTGSDLTWLQCDAPCVRCTRAPHPFYKP  117

Query  491  NNDLV  505
            NNDLV
Sbjct  118  NNDLV  122



>emb|CDP04854.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 82/113 (73%), Gaps = 15/113 (13%)
 Frame = +2

Query  167  GSPDRLDRHQKWWKWpspgsdgassssssssssssssspvvsrggpssIVLPLYGNVYPN  346
            GS D+L   QKW KW S  S  ASSS ++  SS SS            I+  LYGNV+P+
Sbjct  5    GSRDQL---QKWCKWKSRVSTEASSSEANPVSSYSS------------ILFKLYGNVHPD  49

Query  347  GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLV  505
            G+YFAQV++G PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHPLY+P NDLV
Sbjct  50   GYYFAQVNVGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTEAPHPLYRPTNDLV  102



>ref|XP_006346815.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=437

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPLYGNVYP G+Y+ Q++IG P RP+F+DPDTGSDLTWLQCDAPCV CT APHP YKP
Sbjct  64   IVLPLYGNVYPLGYYYVQLNIGQPSRPFFLDPDTGSDLTWLQCDAPCVRCTTAPHPFYKP  123

Query  491  NNDLV  505
            NNDLV
Sbjct  124  NNDLV  128



>ref|XP_010674354.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674355.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=393

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+LP+YGNVYP GFY+  V +G+PPRPYF+DPDTGSDLTWLQCDAPCV CT+APHPLYKP
Sbjct  20   IILPVYGNVYPRGFYYVPVLVGDPPRPYFLDPDTGSDLTWLQCDAPCVRCTRAPHPLYKP  79

Query  491  NNDLV  505
            ++DL+
Sbjct  80   SSDLI  84



>ref|XP_010674353.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=437

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+LP+YGNVYP GFY+  V +G+PPRPYF+DPDTGSDLTWLQCDAPCV CT+APHPLYKP
Sbjct  64   IILPVYGNVYPRGFYYVPVLVGDPPRPYFLDPDTGSDLTWLQCDAPCVRCTRAPHPLYKP  123

Query  491  NNDLV  505
            ++DL+
Sbjct  124  SSDLI  128



>gb|EPS67652.1| hypothetical protein M569_07122 [Genlisea aurea]
Length=401

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+LP+YGNVYP+GFYF QV +G PPRPYF+DPDTGSDLTWLQCDAPCV CT+  HPLY+P
Sbjct  26   IMLPVYGNVYPDGFYFVQVYLGYPPRPYFLDPDTGSDLTWLQCDAPCVRCTEGFHPLYRP  85

Query  491  NNDLV  505
            +NDLV
Sbjct  86   SNDLV  90



>gb|EYU20602.1| hypothetical protein MIMGU_mgv1a007047mg [Erythranthe guttata]
Length=422

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ PLYGNVYPNGFYF QV +G PP+PYF+DPDTGSDLTWLQCDAPCV CT   HPLY+P
Sbjct  51   IIFPLYGNVYPNGFYFVQVYLGYPPKPYFLDPDTGSDLTWLQCDAPCVRCTTGFHPLYRP  110

Query  491  NNDLV  505
            +NDLV
Sbjct  111  SNDLV  115



>ref|XP_002273988.1| PREDICTED: aspartic proteinase Asp1 [Vitis vinifera]
 emb|CBI21613.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PLYGNVYP G+Y+  + IG PP+PYF+DPDTGSDL+WLQCDAPCV CTKAPHPLY+P
Sbjct  53   VVFPLYGNVYPLGYYYVSLSIGQPPKPYFLDPDTGSDLSWLQCDAPCVRCTKAPHPLYRP  112

Query  491  NNDLV  505
            NN+LV
Sbjct  113  NNNLV  117



>ref|XP_011099684.1| PREDICTED: aspartic proteinase Asp1 [Sesamum indicum]
Length=422

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ PLYGNVYPNGFYF QV +G PP+PYF+DPDTGSDLTWLQCDAPCV CT   HPLY+P
Sbjct  50   IIFPLYGNVYPNGFYFVQVYLGYPPKPYFLDPDTGSDLTWLQCDAPCVRCTTGFHPLYRP  109

Query  491  NNDLV  505
            +N+LV
Sbjct  110  SNELV  114



>ref|XP_009766881.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
Length=433

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
            LPLYGN+YP G+Y+ Q++IG P +PYF+DPDTGSDLTWLQCDAPCV CT+APHP YKPNN
Sbjct  62   LPLYGNIYPIGYYYVQLNIGQPSKPYFLDPDTGSDLTWLQCDAPCVRCTRAPHPFYKPNN  121

Query  497  DLV  505
            DLV
Sbjct  122  DLV  124



>ref|XP_008227592.1| PREDICTED: aspartic proteinase Asp1 [Prunus mume]
Length=435

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLP++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHPLY+P
Sbjct  60   IVLPVHGNVYPIGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTEAPHPLYRP  119

Query  491  NNDLV  505
            NNDLV
Sbjct  120  NNDLV  124



>dbj|BAD80835.1| nucellin-like protein [Daucus carota]
Length=426

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
            LPLYGNVYP+G+Y  Q +IG PP+PYF+DPDTGSDLTWLQCDAPC+ CT APHPLY+P N
Sbjct  55   LPLYGNVYPSGYYHVQFNIGQPPKPYFLDPDTGSDLTWLQCDAPCIQCTPAPHPLYQPTN  114

Query  497  DLV  505
            DLV
Sbjct  115  DLV  117



>ref|XP_008361087.1| PREDICTED: aspartic proteinase Asp1-like [Malus domestica]
Length=430

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLP++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  54   IVLPVHGNVYPTGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTQAPHPYYRP  113

Query  491  NNDLV  505
            NNDLV
Sbjct  114  NNDLV  118



>ref|XP_007211687.1| hypothetical protein PRUPE_ppa005961mg [Prunus persica]
 gb|EMJ12886.1| hypothetical protein PRUPE_ppa005961mg [Prunus persica]
Length=435

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLP++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  60   IVLPVHGNVYPIGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTEAPHPFYRP  119

Query  491  NNDLV  505
            NNDLV
Sbjct  120  NNDLV  124



>ref|XP_002310541.2| hypothetical protein POPTR_0007s04800g [Populus trichocarpa]
 gb|EEE90991.2| hypothetical protein POPTR_0007s04800g [Populus trichocarpa]
Length=430

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYP GFY   ++IG P +PYF+D DTGSDLTWLQCDAPCVHCT+APHP YKP
Sbjct  56   IVLPLHGNVYPTGFYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVHCTEAPHPYYKP  115

Query  491  NNDLV  505
            +N+LV
Sbjct  116  SNNLV  120



>ref|XP_011022861.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase Asp1-like 
[Populus euphratica]
Length=429

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYP GFY   ++IG P +PYF+D DTGSDLTWLQCDAPCV CT+APHP YKP
Sbjct  56   IVLPLHGNVYPTGFYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVQCTEAPHPYYKP  115

Query  491  NNDLV  505
            +NDLV
Sbjct  116  SNDLV  120



>ref|XP_010111255.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXC30733.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=432

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+ PHPLY+P
Sbjct  56   VVFPIHGNVYPIGFYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVQCTETPHPLYRP  115

Query  491  NNDLV  505
            +NDLV
Sbjct  116  SNDLV  120



>ref|XP_007048531.1| Aspartyl protease family protein isoform 2 [Theobroma cacao]
 gb|EOX92688.1| Aspartyl protease family protein isoform 2 [Theobroma cacao]
Length=339

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ P++GNVYP G+Y   + IG PP+PYF+D DTGSDLTWLQCDAPCVHC +APHPLY+P
Sbjct  47   ILFPIHGNVYPTGYYNVTISIGQPPKPYFLDLDTGSDLTWLQCDAPCVHCVEAPHPLYRP  106

Query  491  NNDLV  505
             NDLV
Sbjct  107  TNDLV  111



>ref|XP_003532363.2| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN16936.1| Aspartic proteinase Asp1 [Glycine soja]
Length=431

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPLYGNVYP GFY   ++IG P RPYF+D DTGSDLTWLQCDAPC HC++ PHPLY+P
Sbjct  57   IVLPLYGNVYPVGFYNVTLNIGQPARPYFLDVDTGSDLTWLQCDAPCTHCSETPHPLYRP  116

Query  491  NNDLV  505
            +ND V
Sbjct  117  SNDFV  121



>ref|XP_007048530.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX92687.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=421

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ P++GNVYP G+Y   + IG PP+PYF+D DTGSDLTWLQCDAPCVHC +APHPLY+P
Sbjct  47   ILFPIHGNVYPTGYYNVTISIGQPPKPYFLDLDTGSDLTWLQCDAPCVHCVEAPHPLYRP  106

Query  491  NNDLV  505
             NDLV
Sbjct  107  TNDLV  111



>ref|XP_011468243.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=402

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLP++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  53   VVLPVHGNVYPIGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTEAPHPYYRP  112

Query  491  NNDLV  505
            NNDLV
Sbjct  113  NNDLV  117



>ref|XP_011468246.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=400

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLP++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  53   VVLPVHGNVYPIGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTEAPHPYYRP  112

Query  491  NNDLV  505
            NNDLV
Sbjct  113  NNDLV  117



>ref|XP_007159874.1| hypothetical protein PHAVU_002G275100g [Phaseolus vulgaris]
 gb|ESW31868.1| hypothetical protein PHAVU_002G275100g [Phaseolus vulgaris]
Length=431

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V+PL+GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC HC++ PHPLY+P
Sbjct  57   VVIPLHGNVYPVGFYNVTLNIGQPPRPYFLDVDTGSDLTWLQCDAPCTHCSETPHPLYRP  116

Query  491  NNDLV  505
            +ND V
Sbjct  117  SNDFV  121



>gb|KHG06665.1| Asparticase Asp1 [Gossypium arboreum]
Length=383

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ P++GNVYP G+Y   ++IG+PP+PYF+D DTGSDLTWLQC+APCVHC +APHPLY+P
Sbjct  51   ILFPIHGNVYPTGYYNVTINIGHPPKPYFLDLDTGSDLTWLQCNAPCVHCIEAPHPLYQP  110

Query  491  NNDLV  505
            +NDLV
Sbjct  111  SNDLV  115



>gb|KJB40494.1| hypothetical protein B456_007G066800 [Gossypium raimondii]
Length=426

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ P++GNVYP G+Y   ++IG+PP+PYF+D DTGSDLTWLQC+APCVHC +APHPLY+P
Sbjct  51   ILFPIHGNVYPTGYYNVTINIGHPPKPYFLDLDTGSDLTWLQCNAPCVHCIEAPHPLYQP  110

Query  491  NNDLV  505
            +NDLV
Sbjct  111  SNDLV  115



>ref|XP_006412352.1| hypothetical protein EUTSA_v10025289mg [Eutrema salsugineum]
 dbj|BAJ34094.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53805.1| hypothetical protein EUTSA_v10025289mg [Eutrema salsugineum]
Length=424

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCVHC +APHPLY+P
Sbjct  43   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVHCLEAPHPLYQP  102

Query  491  NNDLV  505
            +NDL+
Sbjct  103  SNDLI  107



>ref|XP_002307058.2| nucellin family protein [Populus trichocarpa]
 gb|EEE94054.2| nucellin family protein [Populus trichocarpa]
Length=394

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYPNG+Y   ++IG P +PYF+D DTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  20   IVLPLHGNVYPNGYYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVQCTEAPHPYYRP  79

Query  491  NNDLV  505
             N+LV
Sbjct  80   RNNLV  84



>gb|ABK95151.1| unknown [Populus trichocarpa]
Length=393

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYPNG+Y   ++IG P +PYF+D DTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  20   IVLPLHGNVYPNGYYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVQCTEAPHPYYRP  79

Query  491  NNDLV  505
             N+LV
Sbjct  80   RNNLV  84



>ref|XP_006382886.1| hypothetical protein POPTR_0005s07070g [Populus trichocarpa]
 gb|ERP60683.1| hypothetical protein POPTR_0005s07070g [Populus trichocarpa]
Length=393

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYPNG+Y   ++IG P +PYF+D DTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  20   IVLPLHGNVYPNGYYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVQCTEAPHPYYRP  79

Query  491  NNDLV  505
             N+LV
Sbjct  80   RNNLV  84



>ref|XP_009355861.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=430

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  54   IVFPVHGNVYPTGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVSCTQAPHPYYRP  113

Query  491  NNDLV  505
            +NDLV
Sbjct  114  SNDLV  118



>gb|KEH20923.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=310

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P+YGNVYP GFY   ++IG PPRPYF+D DTGS+LTWLQCDAPC  C++ PHPLYKP
Sbjct  60   IVFPIYGNVYPVGFYNVTLNIGQPPRPYFLDVDTGSELTWLQCDAPCSQCSETPHPLYKP  119

Query  491  NNDLV  505
            +ND +
Sbjct  120  SNDFI  124



>ref|XP_010025734.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62453.1| hypothetical protein EUGRSUZ_H05088 [Eucalyptus grandis]
Length=436

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL+GNV+P G Y   + IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+ PHPLY+P
Sbjct  62   VVFPLHGNVFPTGSYNTTLFIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTQTPHPLYRP  121

Query  491  NNDLV  505
             NDLV
Sbjct  122  TNDLV  126



>ref|XP_004163385.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase Asp1-like 
[Cucumis sativus]
Length=418

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL GNVYPNGFY   + +G PP+PYF+DPDTGSDLTWLQCDAPC  CT+  HPLY+P
Sbjct  43   IVLPLQGNVYPNGFYNVTLYVGQPPKPYFLDPDTGSDLTWLQCDAPCQQCTETLHPLYQP  102

Query  491  NNDLV  505
            +NDLV
Sbjct  103  SNDLV  107



>ref|XP_004147327.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
Length=418

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL GNVYPNGFY   + +G PP+PYF+DPDTGSDLTWLQCDAPC  CT+  HPLY+P
Sbjct  43   IVLPLQGNVYPNGFYNVTLYVGQPPKPYFLDPDTGSDLTWLQCDAPCQQCTETLHPLYQP  102

Query  491  NNDLV  505
            +NDLV
Sbjct  103  SNDLV  107



>ref|XP_008460822.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Cucumis melo]
Length=433

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL GNVYPNGFY   + +G PP+PYF+DPDTGSDLTWLQCDAPC  CT+  HPLY+P
Sbjct  54   IVLPLQGNVYPNGFYNVTLYVGQPPKPYFLDPDTGSDLTWLQCDAPCQQCTETLHPLYQP  113

Query  491  NNDLV  505
            +NDLV
Sbjct  114  SNDLV  118



>ref|XP_009350136.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=430

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  54   IVFPVHGNVYPIGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVKCTQAPHPYYRP  113

Query  491  NNDLV  505
            +NDLV
Sbjct  114  SNDLV  118



>ref|XP_008460823.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Cucumis melo]
Length=429

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL GNVYPNGFY   + +G PP+PYF+DPDTGSDLTWLQCDAPC  CT+  HPLY+P
Sbjct  54   IVLPLQGNVYPNGFYNVTLYVGQPPKPYFLDPDTGSDLTWLQCDAPCQQCTETLHPLYQP  113

Query  491  NNDLV  505
            +NDLV
Sbjct  114  SNDLV  118



>ref|XP_003524315.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN17403.1| Aspartic proteinase Asp1 [Glycine soja]
Length=431

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV PLYGNVYP GFY   ++IG P RPYF+D DTGSDLTWLQCDAPC HC++ PHPL++P
Sbjct  57   IVFPLYGNVYPVGFYNVTLNIGQPARPYFLDVDTGSDLTWLQCDAPCTHCSETPHPLHRP  116

Query  491  NNDLV  505
            +ND V
Sbjct  117  SNDFV  121



>ref|XP_011031099.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
 ref|XP_011016209.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=432

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYPNG+Y   ++IG P +PYF+D DTGSDLTWLQCDAPCV C +APHP Y+P
Sbjct  56   IVLPLHGNVYPNGYYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVQCLEAPHPYYRP  115

Query  491  NNDLV  505
            +N+LV
Sbjct  116  SNNLV  120



>gb|KEH20924.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=410

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P+YGNVYP GFY   ++IG PPRPYF+D DTGS+LTWLQCDAPC  C++ PHPLYKP
Sbjct  60   IVFPIYGNVYPVGFYNVTLNIGQPPRPYFLDVDTGSELTWLQCDAPCSQCSETPHPLYKP  119

Query  491  NNDLV  505
            +ND +
Sbjct  120  SNDFI  124



>emb|CAN73001.1| hypothetical protein VITISV_037997 [Vitis vinifera]
Length=424

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PLYGNVYP G+Y+  + IG PP PYF+DP TGSDL+WLQCDAPCV CTKA H LY+P
Sbjct  53   VVFPLYGNVYPLGYYYVSLSIGQPPXPYFLDPXTGSDLSWLQCDAPCVRCTKAXHXLYRP  112

Query  491  NNDLV  505
            NN+LV
Sbjct  113  NNNLV  117



>ref|XP_009355862.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=428

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  54   IVFPVHGNVYPTGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVSCTQAPHPYYRP  113

Query  491  NNDLV  505
            + DLV
Sbjct  114  SKDLV  118



>ref|XP_003630348.1| Aspartic proteinase Asp1 [Medicago truncatula]
 gb|AET04824.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=435

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P+YGNVYP GFY   ++IG PPRPYF+D DTGS+LTWLQCDAPC  C++ PHPLYKP
Sbjct  60   IVFPIYGNVYPVGFYNVTLNIGQPPRPYFLDVDTGSELTWLQCDAPCSQCSETPHPLYKP  119

Query  491  NNDLV  505
            +ND +
Sbjct  120  SNDFI  124



>emb|CDX68982.1| BnaC01g04710D [Brassica napus]
Length=430

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  49   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  108

Query  491  NNDLV  505
            +NDL+
Sbjct  109  SNDLI  113



>emb|CDX75359.1| BnaA01g03430D [Brassica napus]
Length=429

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  48   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  107

Query  491  NNDLV  505
            +NDL+
Sbjct  108  SNDLI  112



>ref|XP_009121783.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=427

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLV  505
            +NDL+
Sbjct  106  SNDLI  110



>ref|XP_004502990.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=434

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  60   VVFPVHGNVYPVGFYNVTLNIGQPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  119

Query  491  NNDLV  505
            +NDLV
Sbjct  120  SNDLV  124



>ref|XP_003522473.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
Length=440

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  65   VVFPVHGNVYPVGFYNVTLNIGQPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  124

Query  491  NNDLV  505
            +NDLV
Sbjct  125  SNDLV  129



>gb|EEE52860.1| hypothetical protein OsJ_35411 [Oryza sativa Japonica Group]
Length=395

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PLYG+VYP+G Y+  + IGNPPRPYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P 
Sbjct  45   VFPLYGDVYPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPT  104

Query  494  -NDLV  505
             N LV
Sbjct  105  KNKLV  109



>ref|XP_003602685.1| Aspartic proteinase Asp1 [Medicago truncatula]
Length=440

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  71   VVFPVHGNVYPVGFYNVTINIGYPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  130

Query  491  NNDLV  505
            +NDLV
Sbjct  131  SNDLV  135



>gb|EEC68949.1| hypothetical protein OsI_37668 [Oryza sativa Indica Group]
Length=421

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PLYG+VYP+G Y+  + IGNPPRPYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P 
Sbjct  45   VFPLYGDVYPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPT  104

Query  494  -NDLV  505
             N LV
Sbjct  105  KNKLV  109



>ref|NP_001066301.1| Os12g0177500 [Oryza sativa Japonica Group]
 gb|ABA96613.2| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29320.1| Os12g0177500 [Oryza sativa Japonica Group]
 dbj|BAG89196.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PLYG+VYP+G Y+  + IGNPPRPYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P 
Sbjct  45   VFPLYGDVYPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPT  104

Query  494  -NDLV  505
             N LV
Sbjct  105  KNKLV  109



>ref|XP_004503902.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=437

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP GFY   ++IG PPRPYF D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  62   IVFPVFGNVYPVGFYNVTLNIGQPPRPYFFDVDTGSDLTWLQCDAPCSQCSETPHPLYRP  121

Query  491  NNDLV  505
            +ND V
Sbjct  122  SNDFV  126



>gb|AES72936.2| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=445

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  71   VVFPVHGNVYPVGFYNVTINIGYPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  130

Query  491  NNDLV  505
            +NDLV
Sbjct  131  SNDLV  135



>gb|ABA96612.2| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
Length=451

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PLYG+VYP+G Y+  + IGNPPRPYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P 
Sbjct  45   VFPLYGDVYPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPT  104

Query  494  -NDLV  505
             N LV
Sbjct  105  KNKLV  109



>emb|CAB38807.1| nucellin-like protein [Arabidopsis thaliana]
 emb|CAB80066.1| nucellin-like protein [Arabidopsis thaliana]
Length=420

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  24   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  83

Query  491  NNDLV  505
            ++DL+
Sbjct  84   SSDLI  88



>ref|NP_001190905.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAM64443.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AEE86234.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=425

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLV  505
            ++DL+
Sbjct  106  SSDLI  110



>ref|XP_002867175.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43434.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLV  505
            ++DL+
Sbjct  106  SSDLI  110



>ref|NP_567922.2| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AEE86233.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=401

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  43   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  102

Query  491  NNDLV  505
            ++DL+
Sbjct  103  SSDLI  107



>dbj|BAC43357.1| putative nucellin [Arabidopsis thaliana]
Length=413

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  34   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  93

Query  491  NNDLV  505
            ++DL+
Sbjct  94   SSDLI  98



>gb|KDP24798.1| hypothetical protein JCGZ_25323 [Jatropha curcas]
Length=424

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL+GNVYP G+Y   ++IG P +PYF+D DTGSDLTWLQCDAPC  CT+APHPLY+P
Sbjct  52   LVFPLHGNVYPAGYYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCRQCTEAPHPLYRP  111

Query  491  NNDLV  505
            +N+LV
Sbjct  112  SNNLV  116



>ref|XP_010025733.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62452.1| hypothetical protein EUGRSUZ_H05087 [Eucalyptus grandis]
Length=434

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLPL+GNVYP G Y   V IG PP+PYF+DPDTGSDLTWLQC+APCV CT  PHPLY P
Sbjct  60   VVLPLHGNVYPTGSYNVTVYIGQPPKPYFLDPDTGSDLTWLQCNAPCVRCTPTPHPLYPP  119

Query  491  NNDLV  505
            ++DLV
Sbjct  120  SDDLV  124



>ref|XP_010527074.1| PREDICTED: aspartic proteinase Asp1-like [Tarenaya hassleriana]
Length=420

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP G+Y   +++G P RPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  42   IVFPVHGNVYPVGYYNVTINVGQPSRPYYLDLDTGSDLTWLQCDAPCVRCVEAPHPLYEP  101

Query  491  NNDLV  505
            +NDL+
Sbjct  102  SNDLI  106



>ref|XP_003528065.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN09648.1| Aspartic proteinase Asp1 [Glycine soja]
Length=438

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  63   VVFPVHGNVYPVGFYNVTLNIGQPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  122

Query  491  NNDLV  505
            +ND V
Sbjct  123  SNDFV  127



>ref|XP_010268980.1| PREDICTED: aspartic proteinase Asp1-like [Nelumbo nucifera]
 ref|XP_010268981.1| PREDICTED: aspartic proteinase Asp1-like [Nelumbo nucifera]
Length=457

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP+G Y+  + IG PP+PYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P
Sbjct  58   VVFPVRGNVYPDGLYYVTLFIGQPPKPYFLDIDTGSDLTWLQCDAPCVRCSKVPHPLYRP  117

Query  491  NNDLV  505
             N+LV
Sbjct  118  KNNLV  122



>ref|XP_010447234.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   + IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTIHIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLV  505
            ++DL+
Sbjct  106  SSDLI  110



>ref|XP_010547875.1| PREDICTED: aspartic proteinase Asp1 [Tarenaya hassleriana]
Length=425

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP G+Y   ++IG P RPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  43   IVFPVHGNVYPVGYYNVTINIGQPSRPYYLDLDTGSDLTWLQCDAPCVRCVEAPHPLYEP  102

Query  491  NNDLV  505
            ++DL+
Sbjct  103  SSDLI  107



>ref|XP_007137749.1| hypothetical protein PHAVU_009G152700g [Phaseolus vulgaris]
 gb|ESW09743.1| hypothetical protein PHAVU_009G152700g [Phaseolus vulgaris]
Length=438

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V  ++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  63   VVFAVHGNVYPVGFYNVTLNIGQPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  122

Query  491  NNDLV  505
            +NDLV
Sbjct  123  SNDLV  127



>ref|XP_010437756.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   + IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTIHIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLV  505
            ++DL+
Sbjct  106  SSDLI  110



>ref|XP_011074834.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Sesamum indicum]
Length=403

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ PL GNVYP G+Y+  ++IG PP+PYF+D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  35   VIFPLSGNVYPEGYYYVTINIGRPPKPYFLDIDTGSDLTWLQCDAPCKKCTPAPHNLYKP  94

Query  491  NNDLV  505
            N +L+
Sbjct  95   NRNLI  99



>ref|XP_011074835.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Sesamum indicum]
Length=372

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ PL GNVYP G+Y+  ++IG PP+PYF+D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  35   VIFPLSGNVYPEGYYYVTINIGRPPKPYFLDIDTGSDLTWLQCDAPCKKCTPAPHNLYKP  94

Query  491  NNDLV  505
            N +L+
Sbjct  95   NRNLI  99



>gb|ACR35418.1| unknown [Zea mays]
Length=205

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  77   LLPIKGNVFPDGQYYTSIFIGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPA  136

Query  494  NDLV  505
             + +
Sbjct  137  KEKI  140



>gb|KFK29973.1| hypothetical protein AALP_AA7G201200 [Arabis alpina]
Length=422

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PP+PY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  43   VVFPVHGNVYPLGYYNVTINIGQPPKPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  102

Query  491  NNDLV  505
            ++DL+
Sbjct  103  SSDLI  107



>ref|XP_004977227.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Setaria 
italica]
Length=422

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            + PLYG+VYP+G Y+  ++IGNP RPYF+D DTGSDLTWLQCDAPCV C K PHPLY+P 
Sbjct  45   IFPLYGDVYPHGLYYVSMNIGNPSRPYFLDVDTGSDLTWLQCDAPCVSCNKVPHPLYRPI  104

Query  491  NNDLV  505
             N LV
Sbjct  105  KNKLV  109



>ref|XP_006282959.1| hypothetical protein CARUB_v10007649mg [Capsella rubella]
 gb|EOA15857.1| hypothetical protein CARUB_v10007649mg [Capsella rubella]
Length=425

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+Y   + IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVNGNVYPLGYYNVTIHIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLV  505
            ++DL+
Sbjct  106  SSDLI  110



>ref|XP_010432554.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   + IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTIHIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLV  505
            + DL 
Sbjct  106  SGDLT  110



>ref|XP_010238658.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=451

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  LYG+VYP+G Y+  + IGNPPRPYF+D DTGSDLTWLQCDAPCV C K PHPLY+P 
Sbjct  45   VFQLYGDVYPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCNKVPHPLYRPT  104

Query  494  NDLV  505
             + +
Sbjct  105  KNKI  108



>ref|XP_002522918.1| nucellin, putative [Ricinus communis]
 gb|EEF39461.1| nucellin, putative [Ricinus communis]
Length=433

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL+GNVYP G+Y   + IG P +PYF+D DTGSDLTWLQCDAPC  C +APHPLY+P
Sbjct  57   LVFPLHGNVYPAGYYNVTLSIGQPAKPYFLDVDTGSDLTWLQCDAPCRQCIEAPHPLYRP  116

Query  491  NNDLV  505
            +N+LV
Sbjct  117  SNNLV  121



>ref|XP_006380399.1| nucellin family protein [Populus trichocarpa]
 gb|ERP58196.1| nucellin family protein [Populus trichocarpa]
Length=387

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYP GFY   ++IG P +PYF+D DTGSDLTWLQCD P   CT+APHP YKP
Sbjct  14   IVLPLHGNVYPTGFYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDVPRAQCTEAPHPYYKP  73

Query  491  NNDLV  505
            +N+LV
Sbjct  74   SNNLV  78



>ref|XP_010664194.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Vitis vinifera]
Length=423

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP GFY   + IGNPP+PY +D D+GSDLTWLQCDAPCV CTKAPHP YKP
Sbjct  54   VVFPLQGNVYPQGFYSVSLRIGNPPKPYTLDIDSGSDLTWLQCDAPCVSCTKAPHPPYKP  113

Query  491  NN  496
            N 
Sbjct  114  NK  115



>ref|XP_004977226.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Setaria 
italica]
Length=451

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            + PLYG+VYP+G Y+  ++IGNP RPYF+D DTGSDLTWLQCDAPCV C K PHPLY+P 
Sbjct  45   IFPLYGDVYPHGLYYVSMNIGNPSRPYFLDVDTGSDLTWLQCDAPCVSCNKVPHPLYRPI  104

Query  491  NNDLV  505
             N LV
Sbjct  105  KNKLV  109



>ref|XP_002285867.2| PREDICTED: aspartic proteinase Asp1 isoform X1 [Vitis vinifera]
Length=453

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP GFY   + IGNPP+PY +D D+GSDLTWLQCDAPCV CTKAPHP YKP
Sbjct  54   VVFPLQGNVYPQGFYSVSLRIGNPPKPYTLDIDSGSDLTWLQCDAPCVSCTKAPHPPYKP  113

Query  491  NN  496
            N 
Sbjct  114  NK  115



>emb|CBI18999.3| unnamed protein product [Vitis vinifera]
Length=390

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP GFY   + IGNPP+PY +D D+GSDLTWLQCDAPCV CTKAPHP YKP
Sbjct  21   VVFPLQGNVYPQGFYSVSLRIGNPPKPYTLDIDSGSDLTWLQCDAPCVSCTKAPHPPYKP  80

Query  491  NN  496
            N 
Sbjct  81   NK  82



>gb|KDO52229.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=380

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  ++GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  37   LLFQVHGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  96

Query  491  NNDLV  505
            +NDLV
Sbjct  97   SNDLV  101



>ref|XP_002441914.1| hypothetical protein SORBIDRAFT_08g004800 [Sorghum bicolor]
 gb|EES15752.1| hypothetical protein SORBIDRAFT_08g004800 [Sorghum bicolor]
Length=429

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  53   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDTGSDLTWLQCDAPCRSCNKVPHPLYRPT  112

Query  494  -NDLV  505
             N LV
Sbjct  113  KNKLV  117



>gb|KDO52227.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
 gb|KDO52228.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=255

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  ++GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  54   LLFQVHGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  113

Query  491  NNDLV  505
            +NDLV
Sbjct  114  SNDLV  118



>gb|KDO52226.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=305

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  ++GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  54   LLFQVHGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  113

Query  491  NNDLV  505
            +NDLV
Sbjct  114  SNDLV  118



>ref|XP_010265185.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Nelumbo nucifera]
Length=585

 Score =   102 bits (253),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GN+YP+G Y+A + +G+PP+PY++D DTGSDLTW+QCDAPC+ C K PHPLYKP+
Sbjct  190  VFPVRGNIYPDGLYYASIYVGSPPKPYYLDMDTGSDLTWIQCDAPCISCAKGPHPLYKPS  249



>gb|KDO52225.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=397

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  ++GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  54   LLFQVHGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  113

Query  491  NNDLV  505
            +NDLV
Sbjct  114  SNDLV  118



>emb|CDO98445.1| unnamed protein product [Coffea canephora]
Length=568

 Score =   102 bits (253),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 40/59 (68%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            VLPL GN+YP+G Y+  V +G PPRPYF+D DTGSDLTW+QCDAPC  C K  HP YKP
Sbjct  185  VLPLKGNIYPDGLYYTYVLVGTPPRPYFLDMDTGSDLTWIQCDAPCTSCAKGAHPFYKP  243



>ref|XP_010265186.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Nelumbo nucifera]
Length=574

 Score =   102 bits (253),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GN+YP+G Y+A + +G+PP+PY++D DTGSDLTW+QCDAPC+ C K PHPLYKP+
Sbjct  190  VFPVRGNIYPDGLYYASIYVGSPPKPYYLDMDTGSDLTWIQCDAPCISCAKGPHPLYKPS  249



>ref|XP_009802241.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802242.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802243.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802244.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
Length=417

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  48   LVFPLAGNVYPKGYYQVTLNVGQPPKPYFLDIDTGSDLTWLQCDAPCAKCTPAPHSLYKP  107

Query  491  NNDLV  505
            N ++V
Sbjct  108  NKNIV  112



>gb|KDO52221.1| hypothetical protein CISIN_1g013774mg [Citrus sinensis]
 gb|KDO52222.1| hypothetical protein CISIN_1g013774mg [Citrus sinensis]
Length=436

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   V +G PP+PYF+D DTGSDL WLQCDAPCV C +APHPLY+P
Sbjct  63   LLFRVQGNVYPTGYYNVTVYVGQPPKPYFLDLDTGSDLIWLQCDAPCVQCVEAPHPLYRP  122

Query  491  NNDLV  505
            +NDLV
Sbjct  123  SNDLV  127



>ref|XP_010930726.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=429

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            V P+YG+VYP+G Y+A ++IGNPP+PYF+D DTGSD+TWLQCDAPC  C+K PHPLY+P
Sbjct  57   VFPVYGDVYPHGIYYATMNIGNPPKPYFMDVDTGSDITWLQCDAPCQRCSKVPHPLYQP  115



>ref|XP_006464925.1| PREDICTED: aspartic proteinase Asp1-like [Citrus sinensis]
Length=436

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   V +G PP+PYF+D DTGSDL WLQCDAPCV C +APHPLY+P
Sbjct  63   LLFRVQGNVYPTGYYNVTVYVGQPPKPYFLDLDTGSDLIWLQCDAPCVQCVEAPHPLYRP  122

Query  491  NNDLV  505
            +NDLV
Sbjct  123  SNDLV  127



>ref|XP_006432088.1| hypothetical protein CICLE_v10001122mg [Citrus clementina]
 gb|ESR45328.1| hypothetical protein CICLE_v10001122mg [Citrus clementina]
Length=451

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   V +G PP+PYF+D DTGSDL WLQCDAPCV C +APHPLY+P
Sbjct  78   LLFRVQGNVYPTGYYNVTVYVGQPPKPYFLDLDTGSDLIWLQCDAPCVQCVEAPHPLYRP  137

Query  491  NNDLV  505
            +NDLV
Sbjct  138  SNDLV  142



>ref|XP_009611015.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
 ref|XP_009611017.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
Length=417

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPC  C  APH LYKP
Sbjct  48   LVFPLAGNVYPKGYYQVTINVGQPPKPYFLDIDTGSDLTWLQCDAPCAKCAPAPHSLYKP  107

Query  491  NNDLV  505
            N ++V
Sbjct  108  NKNIV  112



>dbj|BAJ86250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP
Sbjct  177  VLLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKP  236

Query  491  NNDLV  505
              + +
Sbjct  237  AKEKI  241



>ref|XP_011069472.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Sesamum indicum]
Length=408

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ P+ GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  39   VIFPVSGNVYPKGYYHVTINVGQPPKPYFLDIDTGSDLTWLQCDAPCTKCTPAPHSLYKP  98

Query  491  NNDLV  505
              +L+
Sbjct  99   KRNLI  103



>gb|EYU31770.1| hypothetical protein MIMGU_mgv1a006482mg [Erythranthe guttata]
Length=410

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ P+ GNVYP G+Y   + IG PP+PYF D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  41   VIFPVSGNVYPKGYYHVSISIGEPPKPYFFDIDTGSDLTWLQCDAPCTKCTPAPHSLYKP  100

Query  491  NNDLV  505
              +L+
Sbjct  101  KQNLI  105



>gb|ACN34727.1| unknown [Zea mays]
 gb|AFW63800.1| hypothetical protein ZEAMMB73_012138 [Zea mays]
Length=557

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  174  LLPIKGNVFPDGQYYTSIFIGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPA  233

Query  494  NDLV  505
             + +
Sbjct  234  KEKI  237



>emb|CDP10935.1| unnamed protein product [Coffea canephora]
Length=419

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ P+ GNVYP G+Y   V+IG PP+PYF+D DTGSDLTWLQCDAPC  CT APH  YKP
Sbjct  49   VIFPVSGNVYPKGYYQVTVNIGQPPKPYFLDIDTGSDLTWLQCDAPCAKCTPAPHSPYKP  108

Query  491  NNDLV  505
            N +LV
Sbjct  109  NKNLV  113



>ref|XP_006656867.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=410

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLP  GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC  C K PHPLYKP
Sbjct  17   VVLPTRGNVFPDGQYYTTMFIGNPPRPYFLDVDTGSDLTWIQCDAPCTSCAKGPHPLYKP  76



>gb|EMT28382.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=473

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C + PHPLYKP
Sbjct  95   VLLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAQGPHPLYKP  154

Query  491  NNDLV  505
              + +
Sbjct  155  AKEKI  159



>gb|AFW56223.1| hypothetical protein ZEAMMB73_420944 [Zea mays]
Length=383

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D D+GSDLTWLQCDAPC  C + PHPLY+P 
Sbjct  53   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDSGSDLTWLQCDAPCRSCNEVPHPLYRPT  112

Query  494  ND  499
              
Sbjct  113  KS  114



>ref|XP_009420564.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=433

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+YG+VYP+G Y+  + IG+PP+PYF+D DTGSDLTWLQCDAPCV C+K PHP Y+P
Sbjct  59   VVFPIYGDVYPHGLYYVAMSIGDPPKPYFLDIDTGSDLTWLQCDAPCVRCSKGPHPWYRP  118

Query  491  N-NDLV  505
              N LV
Sbjct  119  TRNKLV  124



>ref|XP_011069464.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Sesamum indicum]
Length=440

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ P+ GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  39   VIFPVSGNVYPKGYYHVTINVGQPPKPYFLDIDTGSDLTWLQCDAPCTKCTPAPHSLYKP  98

Query  491  NNDLV  505
              +L+
Sbjct  99   KRNLI  103



>ref|XP_002452609.1| hypothetical protein SORBIDRAFT_04g028990 [Sorghum bicolor]
 gb|EES05585.1| hypothetical protein SORBIDRAFT_04g028990 [Sorghum bicolor]
Length=557

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  174  LLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPT  233

Query  494  NDLV  505
             + +
Sbjct  234  KEKI  237



>ref|XP_003570503.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=564

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP
Sbjct  180  VLLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKP  239

Query  491  NNDLV  505
              + +
Sbjct  240  AKEKI  244



>ref|NP_001152116.1| aspartic proteinase Asp1 precursor [Zea mays]
 gb|ACG45850.1| aspartic proteinase Asp1 precursor [Zea mays]
Length=432

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D D+GSDLTWLQCDAPC  C + PHPLY+P 
Sbjct  51   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDSGSDLTWLQCDAPCRSCNEVPHPLYRPT  110

Query  494  ND  499
              
Sbjct  111  KS  112



>gb|EYU31771.1| hypothetical protein MIMGU_mgv1a006482mg [Erythranthe guttata]
Length=442

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ P+ GNVYP G+Y   + IG PP+PYF D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  41   VIFPVSGNVYPKGYYHVSISIGEPPKPYFFDIDTGSDLTWLQCDAPCTKCTPAPHSLYKP  100

Query  491  NNDLV  505
              +L+
Sbjct  101  KQNLI  105



>ref|XP_006432093.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
 ref|XP_006464929.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Citrus sinensis]
 gb|ESR45333.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
Length=408

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  35   LLFQVRGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  94

Query  491  NNDLV  505
            +N+LV
Sbjct  95   SNNLV  99



>ref|NP_001131929.1| uncharacterized protein LOC100193320 precursor [Zea mays]
 gb|ACF80557.1| unknown [Zea mays]
Length=424

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D D+GSDLTWLQCDAPC  C + PHPLY+P 
Sbjct  44   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDSGSDLTWLQCDAPCRSCNEVPHPLYRPT  103

Query  494  ND  499
              
Sbjct  104  KS  105



>ref|XP_009393816.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P++G+VYP G Y+ +++IGNPP+PYF+D DTGSDLTW+QCDAPCV C+K PHP Y+P 
Sbjct  46   VFPIHGDVYPRGLYYVEMNIGNPPKPYFLDVDTGSDLTWIQCDAPCVRCSKGPHPWYRPK  105



>gb|ACR34528.1| unknown [Zea mays]
 gb|AFW56222.1| aspartic proteinase Asp1 [Zea mays]
Length=433

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D D+GSDLTWLQCDAPC  C + PHPLY+P 
Sbjct  53   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDSGSDLTWLQCDAPCRSCNEVPHPLYRPT  112

Query  494  ND  499
              
Sbjct  113  KS  114



>ref|XP_010243511.1| PREDICTED: aspartic proteinase Asp1 [Nelumbo nucifera]
Length=460

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G Y+  + IG  P+PY++D DTGSDLTWLQCDAPCV C++ PHPLY+P
Sbjct  58   VVFPVRGNVYPEGLYYVTLYIGQQPKPYYLDIDTGSDLTWLQCDAPCVSCSQVPHPLYRP  117

Query  491  NNDLV  505
             N+LV
Sbjct  118  KNNLV  122



>ref|XP_006432092.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
 gb|ESR45332.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
Length=453

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  80   LLFQVRGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  139

Query  491  NNDLV  505
            +N+LV
Sbjct  140  SNNLV  144



>ref|XP_006464928.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=427

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  54   LLFQVRGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  113

Query  491  NNDLV  505
            +N+LV
Sbjct  114  SNNLV  118



>ref|XP_004240544.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Solanum lycopersicum]
Length=418

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL+GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPCV C  APH  YKP
Sbjct  46   VVFPLFGNVYPKGYYQVTLNVGQPPKPYFLDIDTGSDLTWLQCDAPCVKCIPAPHSPYKP  105

Query  491  NNDLV  505
            N +++
Sbjct  106  NKNVI  110



>ref|NP_001048015.1| Os02g0730700 [Oryza sativa Japonica Group]
 dbj|BAD15929.1| putative nucellin-like aspartic protease [Oryza sativa Japonica 
Group]
 dbj|BAD16368.1| putative nucellin-like aspartic protease [Oryza sativa Japonica 
Group]
 dbj|BAF09929.1| Os02g0730700 [Oryza sativa Japonica Group]
 dbj|BAG91015.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57744.1| hypothetical protein OsJ_08261 [Oryza sativa Japonica Group]
Length=573

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  190  LLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPA  249

Query  494  NDLV  505
             + +
Sbjct  250  KEKI  253



>gb|EEC73939.1| hypothetical protein OsI_08807 [Oryza sativa Indica Group]
Length=574

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  191  LLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPA  250

Query  494  NDLV  505
             + +
Sbjct  251  KEKI  254



>ref|XP_006464927.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=459

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  86   LLFQVRGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  145

Query  491  NNDLV  505
            +N+LV
Sbjct  146  SNNLV  150



>ref|XP_011022860.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=429

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYP GFY   ++IG P +PYF+D DTGSDLT+LQCD P   CT+APHP YKP
Sbjct  56   IVLPLHGNVYPIGFYNVTLNIGQPSKPYFLDVDTGSDLTYLQCDTPRSQCTEAPHPYYKP  115

Query  491  NNDLV  505
            +N+LV
Sbjct  116  SNNLV  120



>ref|XP_004240543.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Solanum lycopersicum]
Length=426

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL+GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPCV C  APH  YKP
Sbjct  46   VVFPLFGNVYPKGYYQVTLNVGQPPKPYFLDIDTGSDLTWLQCDAPCVKCIPAPHSPYKP  105

Query  491  NNDLV  505
            N +++
Sbjct  106  NKNVI  110



>ref|XP_009596730.1| PREDICTED: aspartic proteinase Asp1-like [Nicotiana tomentosiformis]
Length=455

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV PL GNVYP G+Y   +++G PP+PY +D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  49   IVFPLAGNVYPKGYYQVTLEVGQPPKPYSLDIDTGSDLTWLQCDAPCAKCTPAPHSLYKP  108

Query  491  NNDLV  505
            N ++V
Sbjct  109  NENVV  113



>ref|XP_004953813.1| PREDICTED: aspartic proteinase Asp1-like [Setaria italica]
Length=473

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C   PHPLYKP 
Sbjct  119  LLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCANGPHPLYKPT  178

Query  494  NDLV  505
             + +
Sbjct  179  KEKI  182



>ref|XP_010265187.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Nelumbo nucifera]
Length=504

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GN+YP+G Y+A + +G+PP+PY++D DTGSDLTW+QCDAPC+ C K PHPLYKP+
Sbjct  190  VFPVRGNIYPDGLYYASIYVGSPPKPYYLDMDTGSDLTWIQCDAPCISCAKGPHPLYKPS  249

Query  494  N  496
             
Sbjct  250  K  250



>ref|XP_008661408.1| PREDICTED: uncharacterized protein LOC100193320 isoform X1 [Zea 
mays]
Length=471

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D D+GSDLTWLQCDAPC  C + PHPLY+P 
Sbjct  53   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDSGSDLTWLQCDAPCRSCNEVPHPLYRPT  112

Query  494  ND  499
              
Sbjct  113  KS  114



>ref|XP_010025732.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
Length=436

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLPL GNV+P G Y   + IG PP+PY++DPDT SDLTWLQCDAPCV CT+ PHPLY P
Sbjct  61   VVLPLDGNVFPIGSYNTTIYIGQPPKPYYLDPDTDSDLTWLQCDAPCVRCTRTPHPLYPP  120

Query  491  NNDLV  505
            +++LV
Sbjct  121  SDELV  125



>ref|XP_006355804.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Solanum 
tuberosum]
Length=418

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPCV C  APH  YKP
Sbjct  46   VVFPLVGNVYPKGYYQVTLNVGQPPKPYFLDIDTGSDLTWLQCDAPCVKCIPAPHSPYKP  105

Query  491  NNDLV  505
            N ++V
Sbjct  106  NKNVV  110



>ref|XP_009404862.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=452

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+YG+VYP+G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPCV C+K PHP Y+P
Sbjct  62   VVFPIYGDVYPHGLYYVVMNIGDPSKPYFLDVDTGSDLTWLQCDAPCVSCSKGPHPWYRP  121

Query  491  NND  499
               
Sbjct  122  KKS  124



>ref|NP_001057353.1| Os06g0268700 [Oryza sativa Japonica Group]
 dbj|BAD53531.1| putative nucellin-like aspartic protease [Oryza sativa Japonica 
Group]
 dbj|BAD54393.1| putative nucellin-like aspartic protease [Oryza sativa Japonica 
Group]
 dbj|BAF19267.1| Os06g0268700 [Oryza sativa Japonica Group]
 gb|EAZ36578.1| hypothetical protein OsJ_20919 [Oryza sativa Japonica Group]
 dbj|BAH00170.1| unnamed protein product [Oryza sativa Japonica Group]
Length=538

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  146  LLPIRGNVFPDGQYYTSMYIGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPE  205



>gb|EAZ00454.1| hypothetical protein OsI_22475 [Oryza sativa Indica Group]
Length=538

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  146  LLPIRGNVFPDGQYYTSMYIGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPE  205



>ref|XP_009758779.1| PREDICTED: aspartic proteinase Asp1-like [Nicotiana sylvestris]
Length=455

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
             V PL GNVYP G+Y   +++G PP+PY +D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  49   FVFPLAGNVYPKGYYQVTLEVGQPPKPYSLDIDTGSDLTWLQCDAPCAKCTPAPHSLYKP  108

Query  491  NNDLV  505
            N ++V
Sbjct  109  NKNVV  113



>ref|XP_006588295.1| PREDICTED: lysine-specific histone demethylase 1 homolog 1-like 
[Glycine max]
Length=1430

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            V P+ GNVYP+G YF  + +GNPP+ YF+D DTGSDLTW+QCDAPC+ C K  H LYKP
Sbjct  179  VFPVSGNVYPDGLYFTILRVGNPPKSYFLDVDTGSDLTWMQCDAPCISCGKGAHVLYKP  237



>ref|XP_008781591.1| PREDICTED: aspartic proteinase Asp1-like [Phoenix dactylifera]
Length=461

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            V  L GNVYPNG Y+  ++IGNPP+PY++D DTGSD+TWLQCDAPC  C+K PHPLYKP
Sbjct  59   VFRLRGNVYPNGAYYTTMNIGNPPKPYYMDVDTGSDITWLQCDAPCQRCSKVPHPLYKP  117



>gb|KHG03472.1| Asparticase Asp1 [Gossypium arboreum]
Length=575

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +LP+ GNVYP+G YF  + +GNP RPYF+D DTGSDLTW+QCDAPC  C K  +PLYKP
Sbjct  188  ILPVRGNVYPDGLYFTCMLLGNPQRPYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKP  246



>ref|XP_006365534.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=441

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   +++G PP+PYF D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  36   LVFPLAGNVYPIGYYQVTLEVGQPPKPYFFDIDTGSDLTWLQCDAPCAKCTPAPHHLYKP  95

Query  491  NNDLV  505
            + ++V
Sbjct  96   HRNVV  100



>ref|NP_001146721.1| uncharacterized protein LOC100280323 [Zea mays]
 gb|ACL54620.1| unknown [Zea mays]
Length=557

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC +  K PHPLYKP 
Sbjct  174  LLPIKGNVFPDGQYYTSIFIGNPPRPYFLDVDTGSDLTWIQCDAPCTNFAKGPHPLYKPA  233

Query  494  NDLV  505
             + +
Sbjct  234  KEKI  237



>ref|XP_002449121.1| hypothetical protein SORBIDRAFT_05g005400 [Sorghum bicolor]
 gb|EES08109.1| hypothetical protein SORBIDRAFT_05g005400 [Sorghum bicolor]
Length=358

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +  L GNVYP G Y+  ++IGNP +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  41   IFQLQGNVYPTGHYYVTMNIGNPAKPYFLDVDTGSDLTWLQCDAPCRSCNKVPHPLYRPT  100

Query  494  -NDLV  505
             N LV
Sbjct  101  ANSLV  105



>ref|XP_006662788.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=412

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VL L GNVYP G +F  ++IG+P +PY++D DTGS LTWLQCDAPC HC K PHPLYKP
Sbjct  27   VVLELQGNVYPTGHFFITMNIGDPAKPYYLDIDTGSILTWLQCDAPCQHCNKVPHPLYKP  86

Query  491  NND  499
               
Sbjct  87   TKS  89



>ref|XP_010930728.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=429

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PL G+VYPN  ++A ++IGNPP+PYF+  DTGSD+TWLQCDAPC  C+K PHPLYKP 
Sbjct  57   VFPLSGDVYPNEVFYATMNIGNPPKPYFMHVDTGSDITWLQCDAPCQKCSKVPHPLYKPK  116

Query  494  N  496
             
Sbjct  117  R  117



>ref|XP_004242040.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Solanum lycopersicum]
Length=441

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   +++G PP+PYF D DTGSDLTWLQCDAPC  C+ APH LYKP
Sbjct  36   LVFPLAGNVYPVGYYQVTLEVGRPPKPYFFDIDTGSDLTWLQCDAPCAKCSPAPHNLYKP  95

Query  491  NNDLV  505
            + ++V
Sbjct  96   HRNVV  100



>ref|XP_008813298.1| PREDICTED: aspartic proteinase Asp1 [Phoenix dactylifera]
Length=555

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
             P+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC  C K PHPLYKP  
Sbjct  171  FPVRGNVFPDGQYYTSILVGNPPRPYFLDVDTGSDLTWIQCDAPCSSCAKGPHPLYKPTK  230

Query  497  DLV  505
              +
Sbjct  231  GKI  233



>ref|XP_010094778.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXB56943.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=569

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G Y+ Q+ +GNPPRPY +D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  175  ILPVRGNVYPDGLYYTQILVGNPPRPYHLDMDTGSDLTWIQCDAPCTSCAKGANPLYKPT  234



>gb|KDO41979.1| hypothetical protein CISIN_1g008104mg [Citrus sinensis]
Length=455

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            + PL GN+YP+G YF  + +GNPPRPY++D DTGSDLTW+QCDAPC  C K  +PLYKP
Sbjct  189  IFPLRGNIYPDGLYFTYMIVGNPPRPYYLDMDTGSDLTWIQCDAPCSSCAKGANPLYKP  247



>ref|XP_008669793.1| PREDICTED: aspartic proteinase Asp1 [Zea mays]
 gb|ACL53484.1| unknown [Zea mays]
 gb|ACL54629.1| unknown [Zea mays]
 tpg|DAA38945.1| TPA: nucellin-like aspartic protease [Zea mays]
Length=415

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L G+VYP G Y+  ++IGNP +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  40   VFQLQGDVYPTGHYYVTMNIGNPAKPYFLDVDTGSDLTWLQCDAPCRSCNKVPHPLYRPT  99

Query  494  -NDLV  505
             N LV
Sbjct  100  ANRLV  104



>gb|ACG42043.1| aspartic proteinase Asp1 precursor [Zea mays]
Length=415

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L G+VYP G Y+  ++IGNP +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  40   VFQLQGDVYPTGHYYVTMNIGNPAKPYFLDVDTGSDLTWLQCDAPCRSCNKVPHPLYRPT  99

Query  494  -NDLV  505
             N LV
Sbjct  100  ANRLV  104



>emb|CBI15437.3| unnamed protein product [Vitis vinifera]
Length=473

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + P+ G+VYPNG YF  + +G+PPR YF+D DTGSDLTW+QCDAPC  C K P+PLYKP 
Sbjct  88   IFPVRGDVYPNGLYFTHIFVGSPPRRYFLDMDTGSDLTWIQCDAPCTSCAKGPNPLYKPK  147

Query  494  N  496
             
Sbjct  148  K  148



>gb|KJB39310.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
 gb|KJB39312.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
Length=538

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP
Sbjct  188  ILPVRGNVYPDGLYFTYMLLGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKP  246



>gb|EPS72688.1| hypothetical protein M569_02067 [Genlisea aurea]
Length=404

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
             P+ GN YPNG+Y+  ++IG P +PYF+D DTGSD+TWLQCDAPC  C  APHP YKP+ 
Sbjct  37   FPISGNAYPNGYYYVAINIGQPAKPYFLDIDTGSDITWLQCDAPCAKCQPAPHPPYKPSK  96

Query  497  DLV  505
             ++
Sbjct  97   SII  99



>gb|KDO41978.1| hypothetical protein CISIN_1g008104mg [Citrus sinensis]
Length=521

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            + PL GN+YP+G YF  + +GNPPRPY++D DTGSDLTW+QCDAPC  C K  +PLYKP
Sbjct  189  IFPLRGNIYPDGLYFTYMIVGNPPRPYYLDMDTGSDLTWIQCDAPCSSCAKGANPLYKP  247



>ref|XP_010025731.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62451.1| hypothetical protein EUGRSUZ_H05086 [Eucalyptus grandis]
Length=435

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLPL GNV+P G Y A V +G PP+PYF+DPDTGSDLTWLQCD P  HCT  PHP Y P
Sbjct  58   VVLPLDGNVHPIGSYNATVYVGQPPKPYFLDPDTGSDLTWLQCDVPGAHCTPTPHPRYPP  117

Query  491  NNDLV  505
            + D+V
Sbjct  118  SPDIV  122



>ref|XP_006440945.1| hypothetical protein CICLE_v10019473mg [Citrus clementina]
 gb|ESR54185.1| hypothetical protein CICLE_v10019473mg [Citrus clementina]
Length=577

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            + PL GN+YP+G YF  + +GNPPRPY++D DTGSDLTW+QCDAPC  C K  +PLYKP
Sbjct  189  IFPLRGNIYPDGLYFTYMIVGNPPRPYYLDMDTGSDLTWIQCDAPCSSCAKGANPLYKP  247



>ref|XP_010908260.1| PREDICTED: aspartic proteinase Asp1 [Elaeis guineensis]
Length=557

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
             P+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC  C + PHPLYKP+ 
Sbjct  173  FPVGGNVFPDGQYYTSILVGNPPRPYFLDVDTGSDLTWIQCDAPCSSCAQGPHPLYKPSK  232

Query  497  DLV  505
              +
Sbjct  233  GKI  235



>gb|KDO41977.1| hypothetical protein CISIN_1g008104mg [Citrus sinensis]
Length=577

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            + PL GN+YP+G YF  + +GNPPRPY++D DTGSDLTW+QCDAPC  C K  +PLYKP
Sbjct  189  IFPLRGNIYPDGLYFTYMIVGNPPRPYYLDMDTGSDLTWIQCDAPCSSCAKGANPLYKP  247



>gb|KJB39309.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
Length=575

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP
Sbjct  188  ILPVRGNVYPDGLYFTYMLLGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKP  246



>gb|KJB39307.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
Length=576

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP
Sbjct  188  ILPVRGNVYPDGLYFTYMLLGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKP  246



>ref|XP_010663584.1| PREDICTED: aspartic proteinase Asp1 [Vitis vinifera]
Length=573

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + P+ G+VYPNG YF  + +G+PPR YF+D DTGSDLTW+QCDAPC  C K P+PLYKP 
Sbjct  188  IFPVRGDVYPNGLYFTHIFVGSPPRRYFLDMDTGSDLTWIQCDAPCTSCAKGPNPLYKPK  247

Query  494  N  496
             
Sbjct  248  K  248



>ref|XP_006826817.1| hypothetical protein AMTR_s00010p00056950 [Amborella trichopoda]
 gb|ERM94054.1| hypothetical protein AMTR_s00010p00056950 [Amborella trichopoda]
Length=545

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + P+ GNVYP+G Y+  + +GNP RPY++D DTGSDLTW+QC+APC +C K PHPLY P+
Sbjct  160  IFPVKGNVYPDGLYYISILVGNPRRPYYLDMDTGSDLTWIQCNAPCTNCAKGPHPLYNPS  219

Query  494  N  496
             
Sbjct  220  K  220



>ref|XP_003577760.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=413

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L G+VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHPLYKP 
Sbjct  39   VFQLNGDVYPTGHYYVTMNIGDPAKPYFLDIDTGSDLTWLQCDAPCQSCNKVPHPLYKPT  98

Query  494  -NDLV  505
             N LV
Sbjct  99   KNKLV  103



>gb|KHN32026.1| Aspartic proteinase Asp1 [Glycine soja]
Length=572

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP+G YF  + +GNPP+ YF+D DTGSDLTW+QCDAPC+ C K  H LYKP 
Sbjct  179  VFPVSGNVYPDGLYFTILRVGNPPKSYFLDVDTGSDLTWMQCDAPCISCGKGAHVLYKPT  238

Query  494  NDLV  505
               V
Sbjct  239  RSNV  242



>ref|XP_006485774.1| PREDICTED: aspartic proteinase Asp1-like [Citrus sinensis]
Length=577

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
              PL GNVYP+G YF  + +GNPPRPY++D DTGSDLTW+QCDAPC  C K  +PLYKP
Sbjct  189  TFPLRGNVYPDGLYFTYMIVGNPPRPYYLDMDTGSDLTWIQCDAPCSSCAKGANPLYKP  247



>gb|KJB39311.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
Length=393

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTYMLLGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247



>ref|XP_004512995.1| PREDICTED: lysine-specific histone demethylase 1 homolog 1-like 
[Cicer arietinum]
Length=1387

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            V P+ GNVYP+G Y+  V +GNPP+ YFVD DTGSDLTW+QCDAPC  C K  +  YKP
Sbjct  186  VFPISGNVYPDGLYYTHVRVGNPPKRYFVDVDTGSDLTWIQCDAPCRSCAKGANVPYKP  244



>ref|NP_001065913.1| Os11g0183900 [Oryza sativa Japonica Group]
 gb|AAY23257.1| nucellin-like aspartic protease [Oryza sativa Japonica Group]
 gb|ABA91814.1| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27758.1| Os11g0183900 [Oryza sativa Japonica Group]
 gb|EEE51770.1| hypothetical protein OsJ_33210 [Oryza sativa Japonica Group]
Length=418

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L G+VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  44   VFLLSGDVYPTGHYYVTMNIGDPAKPYFLDVDTGSDLTWLQCDAPCQSCNKVPHPLYRPT  103

Query  494  -NDLV  505
             N LV
Sbjct  104  KNKLV  108



>sp|A2ZC67.2|ASP1_ORYSI RecName: Full=Aspartic proteinase Asp1; Short=OSAP1; Short=OsAsp1; 
AltName: Full=Nucellin-like protein; Flags: Precursor 
[Oryza sativa Indica Group]
Length=410

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VL L+GNVYP G +F  ++IG+P +PYF+D DTGS LTWLQCD PC++C K PH LYKP
Sbjct  24   VVLELHGNVYPIGHFFVTMNIGDPAKPYFLDIDTGSTLTWLQCDYPCINCNKVPHGLYKP  83

Query  491  N  493
             
Sbjct  84   E  84



>ref|XP_002511959.1| protein with unknown function [Ricinus communis]
 gb|EEF50628.1| protein with unknown function [Ricinus communis]
Length=583

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP+G YF  + +GNPPRPY++D DT SDLTW+QCDAPC  C K  + LYKP 
Sbjct  195  VFPVRGNVYPDGLYFTYILVGNPPRPYYLDIDTASDLTWIQCDAPCTSCAKGANALYKPR  254

Query  494  ND  499
             D
Sbjct  255  RD  256



>gb|EEC67807.1| hypothetical protein OsI_35373 [Oryza sativa Indica Group]
Length=418

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L G+VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  44   VFLLSGDVYPTGHYYVTMNIGDPAKPYFLDVDTGSDLTWLQCDAPCQSCNKVPHPLYRPT  103

Query  494  -NDLV  505
             N LV
Sbjct  104  KNKLV  108



>ref|XP_007152781.1| hypothetical protein PHAVU_004G159200g [Phaseolus vulgaris]
 gb|ESW24775.1| hypothetical protein PHAVU_004G159200g [Phaseolus vulgaris]
Length=572

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNV+P+G YF  + +GNPPR YF+D DTGSDLTW+QCDAPC+ C K  H  YKP 
Sbjct  180  VFPVSGNVFPDGLYFTILRVGNPPRSYFLDVDTGSDLTWMQCDAPCISCGKGAHAQYKPT  239

Query  494  NDLV  505
               V
Sbjct  240  RSNV  243



>ref|XP_011097005.1| PREDICTED: aspartic proteinase Asp1 [Sesamum indicum]
Length=568

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            V+P+ GN+YP+G Y+  +  GNPPRPYF+D DTGS LTW+QCDAPC  C K  HP YKP
Sbjct  191  VIPVGGNIYPDGLYYTYLHFGNPPRPYFLDMDTGSALTWIQCDAPCTSCAKGAHPFYKP  249



>ref|XP_009406648.1| PREDICTED: aspartic proteinase Asp1 [Musa acuminata subsp. malaccensis]
Length=545

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            VLP+ GN++P+G Y+  + +G+ PRPY++D DTGSDLTW+QCDAPC  C K PHPLYKP 
Sbjct  161  VLPIGGNLFPDGQYYTTLFVGSSPRPYYLDVDTGSDLTWIQCDAPCASCAKGPHPLYKPR  220

Query  494  N  496
             
Sbjct  221  K  221



>ref|XP_002520345.1| nucellin, putative [Ricinus communis]
 gb|EEF42131.1| nucellin, putative [Ricinus communis]
Length=424

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLP++GNVYP G+Y   + IGNPP+ + +D DTGSDLTW+QCDAPC  CTK  H LYKP
Sbjct  53   LVLPVFGNVYPLGYYSVSLYIGNPPKLFELDIDTGSDLTWVQCDAPCTGCTKPLHHLYKP  112

Query  491  NNDLV  505
             N+L+
Sbjct  113  RNNLL  117



>ref|XP_007152782.1| hypothetical protein PHAVU_004G159200g [Phaseolus vulgaris]
 gb|ESW24776.1| hypothetical protein PHAVU_004G159200g [Phaseolus vulgaris]
Length=579

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNV+P+G YF  + +GNPPR YF+D DTGSDLTW+QCDAPC+ C K  H  YKP 
Sbjct  180  VFPVSGNVFPDGLYFTILRVGNPPRSYFLDVDTGSDLTWMQCDAPCISCGKGAHAQYKPT  239



>ref|XP_007036501.1| Eukaryotic aspartyl protease family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY21002.1| Eukaryotic aspartyl protease family protein, putative isoform 
2 [Theobroma cacao]
Length=520

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTYMLVGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247



>ref|XP_004978884.1| PREDICTED: aspartic proteinase Asp1-like [Setaria italica]
Length=419

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +2

Query  323  LYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            L+G+VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P
Sbjct  46   LHGDVYPTGHYYITMNIGDPAKPYFLDVDTGSDLTWLQCDAPCQSCNKVPHPLYRP  101



>ref|XP_007036500.1| Eukaryotic aspartyl protease family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY21001.1| Eukaryotic aspartyl protease family protein, putative isoform 
1 [Theobroma cacao]
Length=576

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTYMLVGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247



>gb|KCW48539.1| hypothetical protein EUGRSUZ_K02213 [Eucalyptus grandis]
Length=526

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +G PP+ YF+D DTGSDLTW+QCDAPC  C K  + LYKP 
Sbjct  183  ILPVTGNVYPDGLYFTSILVGTPPKRYFLDMDTGSDLTWIQCDAPCKSCGKGANALYKPK  242

Query  494  N  496
            +
Sbjct  243  S  243



>gb|KJB39308.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
Length=492

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTYMLLGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247



>ref|XP_009776622.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
Length=567

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
             P+ GN++ +G Y+  + +GNPP+PYFVD DTGSDL W+QCDAPC  C K  HPLYKP N
Sbjct  183  FPVKGNIHSDGLYYTYMLVGNPPKPYFVDIDTGSDLMWIQCDAPCTSCAKGAHPLYKPRN  242



>gb|KDP20103.1| hypothetical protein JCGZ_05872 [Jatropha curcas]
Length=574

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + P+ GNVYP+G YF  + +G+PPRPY++D DT SDLTW+QCDAPC  C K  + LYKP 
Sbjct  186  IFPVRGNVYPDGLYFTYILVGSPPRPYYLDVDTASDLTWIQCDAPCASCAKGANALYKPR  245

Query  494  ND  499
             D
Sbjct  246  RD  247



>ref|XP_006354730.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=558

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
             P+ GN++  G Y+  + +GNPPRPYF+D DTGSDL W+QCDAPC  C K  HPLYKP N
Sbjct  174  FPVRGNIHSEGLYYTYMLVGNPPRPYFLDIDTGSDLMWIQCDAPCTSCAKGAHPLYKPRN  233



>gb|AAK81698.1| aspartyl proteinase [Oryza sativa]
Length=410

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VL L+GNVYP G +F  ++I +P +PYF+D DTGS LTWLQCD PC++C K PH LYKP
Sbjct  24   VVLELHGNVYPIGHFFVTMNISDPAKPYFLDIDTGSTLTWLQCDYPCINCNKVPHGLYKP  83

Query  491  N  493
             
Sbjct  84   E  84



>gb|AAK81699.1| aspartyl proteinase [Oryza sativa]
Length=411

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VL L+GNVYP G +F  ++I +P +PYF+D DTGS LTWLQCD PC++C K PH LYKP
Sbjct  24   VVLELHGNVYPIGHFFVTMNISDPAKPYFLDIDTGSTLTWLQCDYPCINCNKVPHGLYKP  83

Query  491  N  493
             
Sbjct  84   E  84



>ref|XP_008457584.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Cucumis melo]
Length=570

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ G++YP+G Y+  + +G PPRPYF+D DTGSDLTW+QCDAPC  C K   PLYKP 
Sbjct  186  VFPVRGDIYPDGLYYTYIMVGEPPRPYFLDIDTGSDLTWVQCDAPCSSCGKGRSPLYKPR  245

Query  494  NDLV  505
             + V
Sbjct  246  REKV  249



>ref|XP_008457519.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Cucumis melo]
Length=609

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ G++YP+G Y+  + +G PPRPYF+D DTGSDLTW+QCDAPC  C K   PLYKP 
Sbjct  186  VFPVRGDIYPDGLYYTYIMVGEPPRPYFLDIDTGSDLTWVQCDAPCSSCGKGRSPLYKPR  245

Query  494  NDLV  505
             + V
Sbjct  246  REKV  249



>gb|KDP32842.1| hypothetical protein JCGZ_12134 [Jatropha curcas]
Length=478

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            VLP+ GNVYP G+Y   V+IGNPP+ + +D DTGSDLTW+QCDAPC  CTK    LYKP 
Sbjct  59   VLPISGNVYPLGYYSVSVNIGNPPKLFDLDIDTGSDLTWVQCDAPCTGCTKPVDHLYKPR  118

Query  494  NDLV  505
            N+LV
Sbjct  119  NNLV  122



>gb|KEH27052.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=569

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            V P+ GNVYP+G Y+  + +GNPP+ YFVD DTGSDLTW+QCDAPC  C K  + +YKP
Sbjct  179  VFPISGNVYPDGLYYTHLRVGNPPKRYFVDVDTGSDLTWIQCDAPCRSCAKGANAIYKP  237



>gb|KEH27053.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=506

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP+G Y+  + +GNPP+ YFVD DTGSDLTW+QCDAPC  C K  + +YKP 
Sbjct  179  VFPISGNVYPDGLYYTHLRVGNPPKRYFVDVDTGSDLTWIQCDAPCRSCAKGANAIYKPT  238



>ref|XP_004137470.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 ref|XP_004157418.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN64113.1| hypothetical protein Csa_1G042250 [Cucumis sativus]
Length=570

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ G++YP+G Y+  + +G PPRPYF+D DTGSDLTW+QCDAPC  C K   PLYKP 
Sbjct  186  VFPVRGDIYPDGLYYTYIMVGEPPRPYFLDIDTGSDLTWVQCDAPCSSCGKGRSPLYKPR  245

Query  494  NDLV  505
             + V
Sbjct  246  RENV  249



>ref|NP_001065918.1| Os11g0184800 [Oryza sativa Japonica Group]
 sp|Q0IU52.1|ASP1_ORYSJ RecName: Full=Aspartic proteinase Asp1; Short=OSAP1; Short=OsAsp1; 
AltName: Full=Nucellin-like protein; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAQ14543.1|AF308691_1 nucellin-like protein [Oryza sativa Japonica Group]
 gb|AAQ14544.1|AF308692_1 nucellin-like protein [Oryza sativa Japonica Group]
 gb|AAY23267.1| nucellin-like protein [Oryza sativa Japonica Group]
 gb|ABA91764.1| Aspartic proteinase Asp1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27763.1| Os11g0184800 [Oryza sativa Japonica Group]
 dbj|BAG99045.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71282.1| aspartic proteinase [Oryza sativa Japonica Group]
Length=410

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VL L+GNVYP G +F  ++IG+P + YF+D DTGS LTWLQCDAPC +C   PH LYKP
Sbjct  24   VVLELHGNVYPIGHFFITMNIGDPAKSYFLDIDTGSTLTWLQCDAPCTNCNIVPHVLYKP  83

Query  491  N  493
             
Sbjct  84   T  84



>ref|XP_010036874.1| PREDICTED: aspartic proteinase Asp1 [Eucalyptus grandis]
 gb|KCW48538.1| hypothetical protein EUGRSUZ_K02213 [Eucalyptus grandis]
Length=569

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +G PP+ YF+D DTGSDLTW+QCDAPC  C K  + LYKP 
Sbjct  183  ILPVTGNVYPDGLYFTSILVGTPPKRYFLDMDTGSDLTWIQCDAPCKSCGKGANALYKPK  242

Query  494  N  496
            +
Sbjct  243  S  243



>gb|KHN20716.1| Aspartic proteinase Asp1 [Glycine soja]
Length=575

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP+G YF  + +GNPP+ YF+D DTGSDLTW+QCDAPC  C K  H  YKP 
Sbjct  182  VFPVSGNVYPDGLYFTILRVGNPPKSYFLDVDTGSDLTWMQCDAPCRSCGKGAHVQYKPT  241

Query  494  NDLV  505
               V
Sbjct  242  RSNV  245



>gb|KDP38263.1| hypothetical protein JCGZ_05797 [Jatropha curcas]
Length=166

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP  472
            +V PL+GNVYP G+Y   ++IG P +PYF+D DTGSDLTWLQCDAPC  CT+AP
Sbjct  87   LVFPLHGNVYPAGYYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCRQCTEAP  140



>ref|XP_010027413.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
Length=435

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLPL+GNV+P G Y A V IG PP+PYF+DPDTGSDLTWLQC      CT  PHPLY P
Sbjct  61   VVLPLHGNVFPIGSYNATVYIGQPPKPYFLDPDTGSDLTWLQCKVRGARCT--PHPLYPP  118

Query  491  NNDLV  505
            +++LV
Sbjct  119  SDELV  123



>ref|XP_004241624.1| PREDICTED: aspartic proteinase Asp1 [Solanum lycopersicum]
Length=562

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
             P+ GN++  G Y+  + +GNPP+PYF+D DTGSDL W+QCDAPC  C K  HPLYKP N
Sbjct  178  FPVRGNIHSEGLYYTYMLVGNPPKPYFLDIDTGSDLMWIQCDAPCTSCAKGAHPLYKPRN  237



>ref|XP_006583400.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
Length=574

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP+G YF  + +GNPP+ YF+D DTGSDLTW+QCDAPC  C K  H  YKP 
Sbjct  181  VFPVSGNVYPDGLYFTILRVGNPPKSYFLDVDTGSDLTWMQCDAPCRSCGKGAHVQYKPT  240

Query  494  NDLV  505
               V
Sbjct  241  RSNV  244



>gb|ABR18371.1| unknown [Picea sitchensis]
Length=446

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYK  487
            +  L GNV P G Y+  + +GNP +PYF+D D+GS+LTW+QCDAPC+ C K PHPLYK
Sbjct  66   IFSLKGNVVPYGLYYVTMLVGNPSKPYFLDVDSGSELTWIQCDAPCISCAKGPHPLYK  123



>dbj|BAJ99780.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L G VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHP YKP 
Sbjct  60   VFQLQGAVYPIGHYYVTMNIGDPAKPYFLDVDTGSDLTWLQCDAPCQSCNKVPHPWYKPT  119

Query  494  NDLV  505
             + +
Sbjct  120  KNKI  123



>ref|XP_006662787.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=422

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L G+VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHP Y+P 
Sbjct  48   VFLLSGDVYPVGHYYVTMNIGDPAKPYFLDVDTGSDLTWLQCDAPCQSCNKVPHPWYRPT  107

Query  494  -NDLV  505
             N LV
Sbjct  108  KNKLV  112



>ref|XP_004502512.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=417

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +  + GNVYP GFY   ++IGNPP+PY +D DTGSD+TW+QCDAPC  CTK    LYKP+
Sbjct  50   IYSIQGNVYPLGFYTVTLNIGNPPKPYDLDIDTGSDITWIQCDAPCTGCTKPVEQLYKPH  109

Query  494  NDLV  505
            N++V
Sbjct  110  NNIV  113



>ref|XP_010063407.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Eucalyptus grandis]
 ref|XP_010063408.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Eucalyptus grandis]
 gb|KCW70627.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
 gb|KCW70628.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
Length=418

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            VLPL GNVYP G+Y   + IG+P + + +D DTGSDLTW+QCDAPC  CTK    LYKPN
Sbjct  48   VLPLSGNVYPLGYYSVSLSIGHPAKAFDLDIDTGSDLTWVQCDAPCTACTKPLDSLYKPN  107

Query  494  NDLV  505
            N+L+
Sbjct  108  NNLM  111



>gb|EMT29613.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=412

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L G VYP G Y+  ++IG+P +PYF+D DTGSDL+WLQCDAPC  C K PHP YKP 
Sbjct  42   VFQLQGAVYPIGHYYVTMNIGDPAKPYFLDVDTGSDLSWLQCDAPCQSCNKVPHPWYKPT  101

Query  494  NDLV  505
             + +
Sbjct  102  KNKI  105



>ref|XP_004502513.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=417

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +  + GNVYP GFY   ++IGNPP+PY +D DTGSD+TW+QCDAPC  CTK    LYKP+
Sbjct  50   IYSIQGNVYPLGFYTVTLNIGNPPKPYDLDIDTGSDITWIQCDAPCTGCTKPIEQLYKPH  109

Query  494  NDLV  505
            N++V
Sbjct  110  NNIV  113



>ref|XP_010063406.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Eucalyptus grandis]
 gb|KCW70626.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
Length=438

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            VLPL GNVYP G+Y   + IG+P + + +D DTGSDLTW+QCDAPC  CTK    LYKPN
Sbjct  48   VLPLSGNVYPLGYYSVSLSIGHPAKAFDLDIDTGSDLTWVQCDAPCTACTKPLDSLYKPN  107

Query  494  NDLV  505
            N+L+
Sbjct  108  NNLM  111



>ref|XP_010680865.1| PREDICTED: aspartic proteinase Asp1-like [Beta vulgaris subsp. 
vulgaris]
Length=437

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  + GNV+P+G+++  + IG PP+PY +D DTGSDLTWL CDAPCV+C K+PH  YKP 
Sbjct  44   VFRVQGNVFPDGYFYTTLSIGEPPKPYHLDIDTGSDLTWLHCDAPCVNCPKSPHEPYKPQ  103

Query  494  NDLV  505
            N+ +
Sbjct  104  NNAL  107



>gb|KDO37005.1| hypothetical protein CISIN_1g019849mg [Citrus sinensis]
Length=335

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QC+APC  CT  P  LY P 
Sbjct  50   VFPITGNVYPLGYYSVTLKIGNPPKLYELDIDTGSDLTWVQCNAPCTGCTLPPESLYHPK  109

Query  494  NDLV  505
            N+LV
Sbjct  110  NNLV  113



>ref|XP_010095410.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXB60102.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=458

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+YGNVYP G+Y   + IGNPP+ Y +D D+GSDLTW+QCDAPC  CTK    LYKP 
Sbjct  51   VFPIYGNVYPLGYYSVSLKIGNPPKVYDLDIDSGSDLTWVQCDAPCTGCTKPRDQLYKPK  110

Query  494  NDLV  505
            N+ +
Sbjct  111  NNTM  114



>ref|XP_006472808.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=418

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QC+APC  CT  P  LY P 
Sbjct  50   VFPITGNVYPLGYYSVTLKIGNPPKLYELDIDTGSDLTWVQCNAPCTGCTLPPESLYHPK  109

Query  494  NDLV  505
            N+LV
Sbjct  110  NNLV  113



>ref|XP_011458802.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458803.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=415

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PL GNVYP G+Y   + IGNP + + +D DTGSDLTW+QCDAPC  CTK    LYKP 
Sbjct  46   VFPLQGNVYPLGYYSVSLSIGNPGKRFDLDIDTGSDLTWVQCDAPCTGCTKPREHLYKPK  105

Query  494  NDLV  505
            N+LV
Sbjct  106  NNLV  109



>ref|XP_011003438.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=425

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +   + GNVYP G+Y   ++IGNPP+P+  D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  54   VFFRVTGNVYPTGYYSVILNIGNPPKPFDFDIDTGSDLTWVQCDAPCKGCTKPRDKLYKP  113

Query  491  NNDLV  505
             N+LV
Sbjct  114  KNNLV  118



>ref|XP_004290889.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=446

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PL GNVYP G+Y   + IGNP + + +D DTGSDLTW+QCDAPC  CTK    LYKP 
Sbjct  46   VFPLQGNVYPLGYYSVSLSIGNPGKRFDLDIDTGSDLTWVQCDAPCTGCTKPREHLYKPK  105

Query  494  NDLV  505
            N+LV
Sbjct  106  NNLV  109



>ref|XP_006434233.1| hypothetical protein CICLE_v10003265mg [Citrus clementina]
 gb|ESR47473.1| hypothetical protein CICLE_v10003265mg [Citrus clementina]
Length=459

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QC+APC  CT  P  LY P 
Sbjct  50   VFPITGNVYPLGYYSVTLKIGNPPKLYELDIDTGSDLTWVQCNAPCTGCTLPPESLYHPK  109

Query  494  NDLV  505
            N+LV
Sbjct  110  NNLV  113



>ref|XP_001783556.1| predicted protein [Physcomitrella patens]
 gb|EDQ51645.1| predicted protein [Physcomitrella patens]
Length=414

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  320  PLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND  499
            P+ GN+YP+G Y+  + IGNP + Y++D DTGSDLTWLQCDAPC  C   PH LY P   
Sbjct  20   PIGGNIYPDGLYYMAMRIGNPAKLYYLDMDTGSDLTWLQCDAPCRSCAVGPHGLYDPKRA  79

Query  500  LV  505
             V
Sbjct  80   RV  81



>ref|XP_006472807.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=458

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QC+APC  CT  P  LY P 
Sbjct  50   VFPITGNVYPLGYYSVTLKIGNPPKLYELDIDTGSDLTWVQCNAPCTGCTLPPESLYHPK  109

Query  494  NDLV  505
            N+LV
Sbjct  110  NNLV  113



>gb|EMS62785.1| Aspartic proteinase Asp1 [Triticum urartu]
Length=412

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L G VYP G Y   ++IG+P +PYF+D DTGSDL+WLQCDAPC  C K PHP YKP 
Sbjct  42   VFQLQGAVYPIGHYHVTMNIGDPAKPYFLDVDTGSDLSWLQCDAPCPSCNKVPHPWYKPT  101

Query  494  NDLV  505
             + +
Sbjct  102  KNKI  105



>ref|XP_009621932.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
Length=564

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
             P+  N++ +G Y+  + +GNPP+PYF+D DTGSDL W+QCDAPC  C K  HPLYKP N
Sbjct  180  FPVKCNIHLDGLYYTYMLVGNPPKPYFLDIDTGSDLMWIQCDAPCTSCAKGAHPLYKPRN  239



>dbj|BAJ98705.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  335  VYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND  499
            V P   Y+  ++IGNP RPYF+D DTGS LTW+QCDAPC +CTK PHPLYKP  +
Sbjct  123  VLPERQYYTSINIGNPARPYFLDVDTGSALTWIQCDAPCTNCTKGPHPLYKPAKE  177



>ref|XP_006663866.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=360

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  365  VDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN-NDLV  505
            + IGNPPRPYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P  N LV
Sbjct  1    MSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPTKNKLV  48



>gb|KFK42141.1| hypothetical protein AALP_AA2G216700 [Arabis alpina]
Length=461

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+YF  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  50   VVFPVSGNVYPLGYYFVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRASQYKP  109

Query  491  NNDLV  505
            N++ +
Sbjct  110  NHNTL  114



>ref|XP_003563970.2| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=496

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  335  VYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLV  505
            V P   Y+  ++IGNPPRPYF+D DTGSD TW+ CDAPC +CTK PHP+YKP    +
Sbjct  111  VVPERQYYTSINIGNPPRPYFLDIDTGSDFTWIHCDAPCTNCTKGPHPVYKPTEGKI  167



>gb|EEC67810.1| hypothetical protein OsI_35379 [Oryza sativa Indica Group]
Length=423

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 13/74 (18%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA-------  469
            +VL L+GNVYP G +F  ++IG+P +PYF+D DTGS LTWLQCD PC++C KA       
Sbjct  24   VVLELHGNVYPIGHFFVTMNIGDPAKPYFLDIDTGSTLTWLQCDYPCINCNKAHSLFYPR  83

Query  470  ------PHPLYKPN  493
                  PH LYKP 
Sbjct  84   LIGSFVPHGLYKPE  97



>ref|XP_004171754.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
Length=437

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   ++IG     +  D D+GSDLTW+QCDAPC HCTK    LYKP
Sbjct  41   VVFPLKGNVYPLGYYSVSINIGKGDEAFEFDIDSGSDLTWVQCDAPCTHCTKPREQLYKP  100

Query  491  NNDLV  505
            NN+ +
Sbjct  101  NNNAL  105



>ref|XP_007019119.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16344.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=408

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            + LP+ GNVYP G+Y  ++ IGNPP+P+ +D DTGSDLTW+QCDAPC  CT+    LYKP
Sbjct  38   VFLPVSGNVYPLGYYSVELKIGNPPKPFQLDIDTGSDLTWVQCDAPCTGCTQPRDRLYKP  97



>ref|XP_004149806.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN47712.1| hypothetical protein Csa_6G383000 [Cucumis sativus]
Length=437

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   ++IG     +  D D+GSDLTW+QCDAPC HCTK    LYKP
Sbjct  41   VVFPLKGNVYPLGYYSVSINIGKGDEAFEFDIDSGSDLTWVQCDAPCTHCTKPREQLYKP  100

Query  491  NNDLV  505
            NN+ +
Sbjct  101  NNNAL  105



>ref|XP_007019120.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOY16345.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=440

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            + LP+ GNVYP G+Y  ++ IGNPP+P+ +D DTGSDLTW+QCDAPC  CT+    LYKP
Sbjct  58   VFLPVSGNVYPLGYYSVELKIGNPPKPFQLDIDTGSDLTWVQCDAPCTGCTQPRDRLYKP  117



>gb|EMT31650.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=477

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  353  YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND  499
            YF  ++IGNP RPYF+D DTGS LTW+QCDAPC +CTK PHPLYKP  +
Sbjct  98   YFTSINIGNPARPYFLDIDTGSALTWIQCDAPCTNCTKGPHPLYKPAKE  146



>gb|EMS52520.1| Aspartic proteinase Asp1 [Triticum urartu]
Length=431

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  353  YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND  499
            Y+  V+IGNP RPYF+D DTGS LTW+QCDAPC +CTK PHPLYKP  +
Sbjct  52   YYTSVNIGNPARPYFLDIDTGSALTWIQCDAPCTNCTKGPHPLYKPAKE  100



>gb|AJA74410.1| aspartic protease [Cicer arietinum]
Length=479

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA  469
            V P+ GNVYP+G Y+  V +GNPP+ YFVD DTGSDLTW+QCDAPC  C K 
Sbjct  125  VFPISGNVYPDGLYYTHVRVGNPPKRYFVDVDTGSDLTWIQCDAPCRSCAKV  176



>ref|XP_002306645.2| hypothetical protein POPTR_0005s20210g [Populus trichocarpa]
 gb|EEE93641.2| hypothetical protein POPTR_0005s20210g [Populus trichocarpa]
Length=424

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +   + GNVYP G+Y   ++IGNPP+ +  D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  54   VFFRVTGNVYPTGYYSVILNIGNPPKAFDFDIDTGSDLTWVQCDAPCKGCTKPRDKLYKP  113

Query  491  NNDLV  505
             N+LV
Sbjct  114  KNNLV  118



>emb|CDX88370.1| BnaC06g38140D [Brassica napus]
Length=460

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  47   VVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRDSQYKP  106

Query  491  NNDLV  505
            N++ +
Sbjct  107  NHNTL  111



>ref|NP_177872.3| aspartyl protease [Arabidopsis thaliana]
 gb|AEE35983.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=432

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  53   VVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRAKQYKP  112

Query  491  NNDLV  505
            N++ +
Sbjct  113  NHNTL  117



>ref|NP_850981.1| aspartyl protease [Arabidopsis thaliana]
 gb|AAL32740.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AAN65112.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AEE35984.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=466

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  53   VVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRAKQYKP  112

Query  491  NNDLV  505
            N++ +
Sbjct  113  NHNTL  117



>ref|XP_011012697.1| PREDICTED: aspartic proteinase Asp1 [Populus euphratica]
Length=578

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            + P+ GN+YP+G YF  + +G+PP+PY++D DTGSDLTW+QCDAPC  C K  +  YKP
Sbjct  184  IFPVRGNLYPDGLYFTYMLVGSPPQPYYLDFDTGSDLTWIQCDAPCTSCAKGANAWYKP  242



>emb|CDX87518.1| BnaA07g33550D [Brassica napus]
Length=461

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  48   VVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRDSQYKP  107

Query  491  NNDLV  505
            N++ +
Sbjct  108  NHNTL  112



>ref|XP_010471942.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=463

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  54   VVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRAKQYKP  113

Query  491  NNDLV  505
            N++ +
Sbjct  114  NHNTL  118



>ref|XP_010416691.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=457

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  48   VVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRAKQYKP  107

Query  491  NNDLV  505
            N++ +
Sbjct  108  NHNTL  112



>ref|XP_002889144.1| hypothetical protein ARALYDRAFT_476912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65403.1| hypothetical protein ARALYDRAFT_476912 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  54   VVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRAKQYKP  113

Query  491  NNDLV  505
            N++ +
Sbjct  114  NHNTL  118



>ref|XP_004498348.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=444

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P++GNVYP G+Y   ++IG PP+ Y +D D+GSDLTW+QCDAPC  CTK    LYKP 
Sbjct  45   VFPVHGNVYPLGYYTVTLNIGYPPKLYDLDIDSGSDLTWVQCDAPCKGCTKPHDQLYKPK  104

Query  494  NDLV  505
            N+LV
Sbjct  105  NNLV  108



>ref|XP_006302228.1| hypothetical protein CARUB_v10020249mg [Capsella rubella]
 gb|EOA35126.1| hypothetical protein CARUB_v10020249mg [Capsella rubella]
Length=465

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  52   VVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRAKQYKP  111

Query  491  NNDLV  505
            N++ +
Sbjct  112  NHNTL  116



>ref|XP_010428825.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=463

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  53   VVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRAKQYKP  112

Query  491  NNDLV  505
            N++ +
Sbjct  113  NHNTL  117



>ref|XP_004142705.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 ref|XP_004161182.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN54551.1| hypothetical protein Csa_4G361850 [Cucumis sativus]
Length=410

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+LP+ GNVYP G +   V IGNPP+ + +D DTGSDLTW+QCDAPC  CT     LYKP
Sbjct  41   ILLPVKGNVYPLGHFTVSVTIGNPPKVFELDIDTGSDLTWVQCDAPCTGCTLPHDRLYKP  100

Query  491  NNDLV  505
            +N++V
Sbjct  101  HNNVV  105



>ref|XP_009106403.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=457

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  48   VIFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRDSQYKP  107

Query  491  NNDLV  505
            N++ +
Sbjct  108  NHNTL  112



>ref|XP_006355850.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=400

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V  L GNVYP G+Y   +++G PPRPYF+D DTGSDLTWLQCD P      APH  YKP
Sbjct  1    MVFLLDGNVYPKGYYQVVLNVGQPPRPYFLDVDTGSDLTWLQCDIPGAKNLPAPHHPYKP  60

Query  491  NNDLV  505
            N +LV
Sbjct  61   NKNLV  65



>ref|XP_006856698.1| hypothetical protein AMTR_s00054p00157640, partial [Amborella 
trichopoda]
 gb|ERN18165.1| hypothetical protein AMTR_s00054p00157640, partial [Amborella 
trichopoda]
Length=406

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +2

Query  353  YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN-NDLV  505
            Y+  +DIGNPP+PYF+  DTGSDLTWLQCDAPC  C+K PHP Y+P  N LV
Sbjct  2    YYVSIDIGNPPKPYFLHVDTGSDLTWLQCDAPCRSCSKGPHPFYRPTKNKLV  53



>ref|XP_006393742.1| hypothetical protein EUTSA_v10011529mg [Eutrema salsugineum]
 gb|ESQ31028.1| hypothetical protein EUTSA_v10011529mg [Eutrema salsugineum]
Length=411

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNV+P G+Y   + IG+PP+ +  D DTGSDLTW+QCDAPC  CT  P  LYKP
Sbjct  41   LVFPLSGNVFPLGYYSVSLQIGSPPKKFTFDIDTGSDLTWIQCDAPCTGCTLHPSLLYKP  100

Query  491  NNDLV  505
              + V
Sbjct  101  KANTV  105



>gb|EMT17344.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=191

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  365  VDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN-NDLV  505
            + IGNP +PYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P  N LV
Sbjct  1    MSIGNPAKPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPTKNKLV  48



>ref|XP_006390086.1| hypothetical protein EUTSA_v10018497mg [Eutrema salsugineum]
 gb|ESQ27372.1| hypothetical protein EUTSA_v10018497mg [Eutrema salsugineum]
Length=468

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct  55   IVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPLANQYKP  114

Query  491  NNDLV  505
            N + +
Sbjct  115  NRNTL  119



>gb|KHG10363.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10554.1| Asparticase Asp1 [Gossypium arboreum]
 gb|KHG10792.1| Asparticase Asp1 [Gossypium arboreum]
Length=426

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            + LP+ GNVYP G+Y   + IGNPP+P+ +D DTGSDLTW+QCDAPC  CT     LY P
Sbjct  57   VFLPVSGNVYPLGYYSVTIGIGNPPKPFQLDIDTGSDLTWVQCDAPCTGCTLRRDQLYNP  116

Query  491  NND  499
            + +
Sbjct  117  SKN  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510