BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF003A06

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011070985.1|  PREDICTED: cytochrome P450 704B1                   310   9e-100   Sesamum indicum [beniseed]
ref|NP_177109.3|  cytochrome P450, family 704, subfamily B, polyp...    302   6e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389448.1|  PREDICTED: cytochrome P450 704B1                   303   6e-97    Malus domestica [apple tree]
ref|XP_002887239.1|  oxygen binding protein                             301   1e-96    Arabidopsis lyrata subsp. lyrata
ref|XP_010415594.1|  PREDICTED: cytochrome P450 704B1-like              300   7e-96    Camelina sativa [gold-of-pleasure]
ref|XP_006302101.1|  hypothetical protein CARUB_v10020091mg             300   1e-95    
ref|XP_009105494.1|  PREDICTED: cytochrome P450 704B1                   299   1e-95    Brassica rapa
ref|XP_006391009.1|  hypothetical protein EUTSA_v10018405mg             299   2e-95    Eutrema salsugineum [saltwater cress]
emb|CDY40931.1|  BnaC06g30690D                                          298   4e-95    Brassica napus [oilseed rape]
gb|EYU28779.1|  hypothetical protein MIMGU_mgv1a004727mg                296   8e-95    Erythranthe guttata [common monkey flower]
ref|XP_010683141.1|  PREDICTED: cytochrome P450 704B1                   296   2e-94    Beta vulgaris subsp. vulgaris [field beet]
gb|KFK41374.1|  hypothetical protein AALP_AA2G122000                    296   2e-94    Arabis alpina [alpine rockcress]
ref|XP_002312255.2|  cytochrome P450 family protein                     295   2e-94    
ref|XP_010651872.1|  PREDICTED: cytochrome P450 704B1                   296   2e-94    Vitis vinifera
ref|XP_010511987.1|  PREDICTED: cytochrome P450 704B1                   296   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_011017522.1|  PREDICTED: cytochrome P450 704B1                   296   2e-94    Populus euphratica
ref|XP_010551418.1|  PREDICTED: cytochrome P450 704B1                   295   4e-94    
ref|XP_010102176.1|  Cytochrome P450 704C1                              295   1e-93    
ref|XP_007225718.1|  hypothetical protein PRUPE_ppa004298mg             293   1e-93    
ref|XP_010470937.1|  PREDICTED: cytochrome P450 704B1-like              293   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_004138991.1|  PREDICTED: cytochrome P450 704C1-like              294   2e-93    Cucumis sativus [cucumbers]
ref|XP_009758170.1|  PREDICTED: cytochrome P450 704B1                   293   3e-93    Nicotiana sylvestris
ref|XP_003528679.1|  PREDICTED: cytochrome P450 704C1-like              292   4e-93    Glycine max [soybeans]
gb|KGN61391.1|  hypothetical protein Csa_2G108690                       293   4e-93    Cucumis sativus [cucumbers]
ref|XP_007046038.1|  Cytochrome P450, family 704, subfamily B, po...    293   5e-93    
ref|XP_007046039.1|  Cytochrome P450, family 704, subfamily B, po...    293   5e-93    
gb|AJD25236.1|  cytochrome P450 CYP704B37                               291   7e-93    Salvia miltiorrhiza [Chinese salvia]
ref|XP_003611900.1|  Cytochrome P450                                    292   1e-92    Medicago truncatula
ref|XP_008221727.1|  PREDICTED: cytochrome P450 704B1                   291   2e-92    Prunus mume [ume]
ref|XP_007135410.1|  hypothetical protein PHAVU_010G126900g             290   3e-92    Phaseolus vulgaris [French bean]
ref|XP_010258425.1|  PREDICTED: cytochrome P450 704B1                   291   3e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010044484.1|  PREDICTED: cytochrome P450 704B1                   291   3e-92    Eucalyptus grandis [rose gum]
ref|XP_003609660.1|  Cytochrome P450                                    290   4e-92    Medicago truncatula
ref|XP_002522465.1|  cytochrome P450, putative                          290   6e-92    Ricinus communis
ref|XP_004298418.1|  PREDICTED: cytochrome P450 704B1                   290   7e-92    Fragaria vesca subsp. vesca
ref|XP_004510551.1|  PREDICTED: cytochrome P450 704C1-like              290   8e-92    
ref|XP_006827309.1|  hypothetical protein AMTR_s00010p00266280          285   3e-91    
gb|KHN01450.1|  Cytochrome P450 704C1                                   287   3e-91    Glycine soja [wild soybean]
ref|XP_009629443.1|  PREDICTED: cytochrome P450 704B1                   287   3e-91    Nicotiana tomentosiformis
ref|XP_008441698.1|  PREDICTED: cytochrome P450 704B1                   288   6e-91    Cucumis melo [Oriental melon]
gb|KJB50631.1|  hypothetical protein B456_008G180000                    286   1e-90    Gossypium raimondii
gb|EPS61936.1|  hypothetical protein M569_12857                         285   2e-90    Genlisea aurea
gb|KDP41226.1|  hypothetical protein JCGZ_15633                         285   4e-90    Jatropha curcas
ref|XP_006651077.1|  PREDICTED: cytochrome P450 704C1-like              280   4e-90    Oryza brachyantha
gb|KDO80235.1|  hypothetical protein CISIN_1g035880mg                   285   5e-90    Citrus sinensis [apfelsine]
ref|XP_006475855.1|  PREDICTED: cytochrome P450 704C1-like              285   5e-90    
ref|XP_006366710.1|  PREDICTED: cytochrome P450 704C1-like              284   9e-90    Solanum tuberosum [potatoes]
ref|XP_004228374.1|  PREDICTED: cytochrome P450 704B1                   283   2e-89    Solanum lycopersicum
emb|CDP00359.1|  unnamed protein product                                283   3e-89    Coffea canephora [robusta coffee]
ref|XP_006450915.1|  hypothetical protein CICLE_v10010274mg             282   4e-89    
gb|EAZ25728.1|  hypothetical protein OsJ_09563                          280   2e-88    Oryza sativa Japonica Group [Japonica rice]
gb|EAY88702.1|  hypothetical protein OsI_10177                          280   3e-88    Oryza sativa Indica Group [Indian rice]
gb|AAL84318.1|AC073556_35  putative plant cytochrome P-450 protein      280   3e-88    Oryza sativa Japonica Group [Japonica rice]
gb|ACD10924.1|  cytochrome P450                                         278   1e-87    Capsicum annuum
ref|XP_004985563.1|  PREDICTED: cytochrome P450 704C1-like isofor...    278   2e-87    Setaria italica
ref|XP_004985564.1|  PREDICTED: cytochrome P450 704C1-like isofor...    278   2e-87    Setaria italica
gb|ACG35470.1|  cytochrome P450 CYP704B12v2                             278   3e-87    Zea mays [maize]
ref|NP_001130648.1|  male sterile26                                     278   3e-87    Zea mays [maize]
ref|XP_002465796.1|  hypothetical protein SORBIDRAFT_01g045960          278   4e-87    Sorghum bicolor [broomcorn]
dbj|BAK08270.1|  predicted protein                                      276   2e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008778343.1|  PREDICTED: cytochrome P450 704B1                   275   3e-86    
ref|XP_003558727.1|  PREDICTED: cytochrome P450 704B1                   275   6e-86    Brachypodium distachyon [annual false brome]
gb|EMT08626.1|  Cytochrome P450 704C1                                   275   3e-85    
gb|EMS55452.1|  Cytochrome P450 86B1                                    268   3e-84    Triticum urartu
gb|ADG34845.1|  cytochrome P450 protein                                 262   3e-81    Vanda hybrid cultivar
ref|XP_009413465.1|  PREDICTED: cytochrome P450 704B1                   261   5e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001049092.2|  Os03g0168600                                       245   6e-79    
dbj|BAC43393.1|  unknown protein                                        249   6e-77    Arabidopsis thaliana [mouse-ear cress]
gb|ABK28457.1|  unknown                                                 249   7e-77    Arabidopsis thaliana [mouse-ear cress]
emb|CBI31936.3|  unnamed protein product                                245   2e-75    Vitis vinifera
gb|KCW86574.1|  hypothetical protein EUGRSUZ_B03209                     244   8e-75    Eucalyptus grandis [rose gum]
ref|XP_010917078.1|  PREDICTED: cytochrome P450 704B1                   223   1e-66    
ref|XP_001764611.1|  predicted protein                                  212   4e-62    
ref|XP_002978645.1|  hypothetical protein SELMODRAFT_418431             202   2e-58    
ref|XP_002979701.1|  hypothetical protein SELMODRAFT_111270             200   2e-57    
ref|XP_002988354.1|  hypothetical protein SELMODRAFT_127881             197   3e-56    
ref|XP_001764503.1|  predicted protein                                  196   4e-56    
ref|XP_001768338.1|  predicted protein                                  186   2e-52    
ref|XP_002963764.1|  hypothetical protein SELMODRAFT_80659              182   5e-51    
ref|XP_002974848.1|  hypothetical protein SELMODRAFT_101765             181   5e-51    
ref|XP_002982626.1|  hypothetical protein SELMODRAFT_116539             172   3e-47    
ref|XP_002981144.1|  hypothetical protein SELMODRAFT_113735             171   6e-47    
gb|ACN41008.1|  unknown                                                 167   4e-45    Picea sitchensis
ref|XP_007052008.1|  Cytochrome P450 family protein                     159   2e-42    
sp|Q50EK3.1|C04C1_PINTA  RecName: Full=Cytochrome P450 704C1; Alt...    159   2e-42    Pinus taeda
ref|XP_010054889.1|  PREDICTED: cytochrome P450 704C1-like              157   5e-42    
ref|XP_010042417.1|  PREDICTED: cytochrome P450 704C1-like              156   5e-42    
gb|KJB41138.1|  hypothetical protein B456_007G092700                    153   6e-42    Gossypium raimondii
ref|XP_002980994.1|  hypothetical protein SELMODRAFT_113847             157   7e-42    
gb|KJB41139.1|  hypothetical protein B456_007G092700                    153   7e-42    Gossypium raimondii
ref|XP_011093193.1|  PREDICTED: cytochrome P450 704C1-like              157   1e-41    Sesamum indicum [beniseed]
ref|XP_007052011.1|  Cytochrome P450 family protein isoform 3           154   1e-41    
ref|XP_010053880.1|  PREDICTED: cytochrome P450 704C1-like              156   3e-41    Eucalyptus grandis [rose gum]
gb|KJB41141.1|  hypothetical protein B456_007G092700                    153   7e-41    Gossypium raimondii
gb|KCW44361.1|  hypothetical protein EUGRSUZ_L02168                     155   8e-41    Eucalyptus grandis [rose gum]
ref|XP_002982474.1|  hypothetical protein SELMODRAFT_116579             155   8e-41    
gb|KDO85884.1|  hypothetical protein CISIN_1g010681mg                   150   9e-41    Citrus sinensis [apfelsine]
dbj|BAG88047.1|  unnamed protein product                                152   2e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006339516.1|  PREDICTED: cytochrome P450 704C1-like              154   2e-40    
gb|AAZ39646.1|  cytochrome P450 monooxygenase                           153   2e-40    Petunia x hybrida [garden petunia]
ref|XP_007052009.1|  Cytochrome P450 family protein isoform 1           153   3e-40    
ref|XP_010041418.1|  PREDICTED: cytochrome P450 704C1-like              152   3e-40    
ref|XP_002976944.1|  hypothetical protein SELMODRAFT_151517             152   6e-40    
ref|XP_007052012.1|  Cytochrome P450 family protein                     152   7e-40    
gb|KJB41140.1|  hypothetical protein B456_007G092700                    152   8e-40    Gossypium raimondii
gb|KJB41137.1|  hypothetical protein B456_007G092700                    152   9e-40    Gossypium raimondii
ref|XP_010054890.1|  PREDICTED: cytochrome P450 704C1-like              152   9e-40    Eucalyptus grandis [rose gum]
ref|XP_006445218.1|  hypothetical protein CICLE_v10019805mg             150   1e-39    
gb|KDO85883.1|  hypothetical protein CISIN_1g010681mg                   150   1e-39    Citrus sinensis [apfelsine]
ref|XP_008669003.1|  PREDICTED: cytochrome P450 704C1-like              151   1e-39    
gb|EAY95236.1|  hypothetical protein OsI_17053                          151   1e-39    Oryza sativa Indica Group [Indian rice]
ref|NP_001053615.1|  Os04g0573900                                       151   1e-39    
gb|ABZ80831.1|  CYP86A32 fatty acid omega-hydroxylase                   151   1e-39    Quercus suber [cork oak]
ref|XP_006652670.1|  PREDICTED: cytochrome P450 704C1-like              151   1e-39    Oryza brachyantha
gb|KDP27731.1|  hypothetical protein JCGZ_19708                         151   2e-39    Jatropha curcas
gb|EAZ31703.1|  hypothetical protein OsJ_15852                          150   2e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011034689.1|  PREDICTED: cytochrome P450 704C1-like isofor...    150   3e-39    Populus euphratica
gb|KJB19906.1|  hypothetical protein B456_003G123900                    150   4e-39    Gossypium raimondii
gb|KDO85881.1|  hypothetical protein CISIN_1g010681mg                   149   5e-39    Citrus sinensis [apfelsine]
ref|XP_002320072.1|  hypothetical protein POPTR_0014s06790g             149   7e-39    Populus trichocarpa [western balsam poplar]
gb|KDO85879.1|  hypothetical protein CISIN_1g010681mg                   149   8e-39    Citrus sinensis [apfelsine]
gb|KDO85882.1|  hypothetical protein CISIN_1g010681mg                   149   8e-39    Citrus sinensis [apfelsine]
gb|KDO85880.1|  hypothetical protein CISIN_1g010681mg                   149   9e-39    Citrus sinensis [apfelsine]
ref|XP_006445219.1|  hypothetical protein CICLE_v10019805mg             149   9e-39    
ref|XP_002270673.2|  PREDICTED: cytochrome P450 704C1                   149   1e-38    Vitis vinifera
emb|CAN60189.1|  hypothetical protein VITISV_002118                     149   1e-38    Vitis vinifera
ref|XP_002980688.1|  hypothetical protein SELMODRAFT_112911             149   1e-38    
emb|CBI38797.3|  unnamed protein product                                149   1e-38    Vitis vinifera
ref|XP_002529550.1|  cytochrome P450, putative                          147   2e-38    
ref|XP_009776441.1|  PREDICTED: cytochrome P450 704C1-like isofor...    148   2e-38    Nicotiana sylvestris
ref|XP_009776440.1|  PREDICTED: cytochrome P450 704C1-like isofor...    148   2e-38    Nicotiana sylvestris
gb|KCW78247.1|  hypothetical protein EUGRSUZ_D02436                     145   4e-38    Eucalyptus grandis [rose gum]
ref|XP_002963351.1|  hypothetical protein SELMODRAFT_80855              147   5e-38    
ref|XP_002974639.1|  hypothetical protein SELMODRAFT_101746             147   6e-38    
ref|XP_004133898.1|  PREDICTED: cytochrome P450 704C1-like              146   8e-38    Cucumis sativus [cucumbers]
ref|XP_004155805.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    146   9e-38    
ref|XP_010277455.1|  PREDICTED: cytochrome P450 704C1-like              146   9e-38    Nelumbo nucifera [Indian lotus]
ref|XP_008438128.1|  PREDICTED: cytochrome P450 704C1-like              146   1e-37    Cucumis melo [Oriental melon]
ref|XP_009389623.1|  PREDICTED: cytochrome P450 704C1-like              146   1e-37    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ91929.1|  predicted protein                                      142   1e-37    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003581548.1|  PREDICTED: cytochrome P450 704C1-like              146   1e-37    Brachypodium distachyon [annual false brome]
ref|XP_010692303.1|  PREDICTED: cytochrome P450 704C1-like              146   1e-37    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006848139.1|  hypothetical protein AMTR_s00029p00225720          144   1e-37    
ref|XP_002974847.1|  hypothetical protein SELMODRAFT_414990             145   2e-37    
ref|XP_002963763.1|  hypothetical protein SELMODRAFT_405166             145   2e-37    
ref|XP_011091066.1|  PREDICTED: cytochrome P450 704C1-like              145   2e-37    Sesamum indicum [beniseed]
ref|XP_004294257.2|  PREDICTED: cytochrome P450 86A1                    145   2e-37    Fragaria vesca subsp. vesca
ref|XP_010043449.1|  PREDICTED: cytochrome P450 86A1                    145   2e-37    Eucalyptus grandis [rose gum]
gb|ACU18763.1|  unknown                                                 140   2e-37    Glycine max [soybeans]
gb|KJB41136.1|  hypothetical protein B456_007G092600                    145   2e-37    Gossypium raimondii
emb|CBI38796.3|  unnamed protein product                                145   2e-37    Vitis vinifera
ref|XP_010650931.1|  PREDICTED: cytochrome P450 86A1                    145   2e-37    Vitis vinifera
gb|KHG09033.1|  Cytochrome P450 protein                                 145   3e-37    Gossypium arboreum [tree cotton]
ref|XP_008232728.1|  PREDICTED: uncharacterized protein LOC103331840    148   3e-37    
ref|XP_009593544.1|  PREDICTED: cytochrome P450 704C1-like isofor...    145   3e-37    
ref|XP_010326134.1|  PREDICTED: cytochrome P450 704C1-like isofor...    144   3e-37    Solanum lycopersicum
ref|XP_002270628.3|  PREDICTED: cytochrome P450 704C1-like              145   3e-37    Vitis vinifera
ref|XP_009593543.1|  PREDICTED: cytochrome P450 704C1-like isofor...    145   3e-37    
ref|XP_006339778.1|  PREDICTED: cytochrome P450 704C1-like              145   3e-37    Solanum tuberosum [potatoes]
gb|KJB55751.1|  hypothetical protein B456_009G092900                    145   3e-37    Gossypium raimondii
emb|CAN80040.1|  hypothetical protein VITISV_037194                     145   3e-37    Vitis vinifera
ref|XP_010056272.1|  PREDICTED: cytochrome P450 704C1-like              145   3e-37    Eucalyptus grandis [rose gum]
ref|XP_002275806.1|  PREDICTED: cytochrome P450 86A7                    145   3e-37    Vitis vinifera
ref|XP_007016155.1|  Cytochrome P450, family 86, subfamily A, pol...    144   4e-37    
ref|XP_004231178.1|  PREDICTED: cytochrome P450 704C1-like isofor...    145   4e-37    Solanum lycopersicum
ref|XP_003544876.2|  PREDICTED: cytochrome P450 86A1-like               144   4e-37    Glycine max [soybeans]
ref|XP_008457385.1|  PREDICTED: cytochrome P450 86A1                    144   6e-37    Cucumis melo [Oriental melon]
ref|XP_006339779.1|  PREDICTED: cytochrome P450 704C1-like              144   6e-37    
gb|ABK94777.1|  unknown                                                 144   6e-37    Populus trichocarpa [western balsam poplar]
ref|XP_004510930.1|  PREDICTED: cytochrome P450 704C1-like              144   6e-37    Cicer arietinum [garbanzo]
ref|XP_002270594.3|  PREDICTED: cytochrome P450 704C1                   144   6e-37    Vitis vinifera
emb|CBI38795.3|  unnamed protein product                                144   7e-37    Vitis vinifera
ref|XP_002320074.1|  hypothetical protein POPTR_0014s06820g             144   7e-37    Populus trichocarpa [western balsam poplar]
ref|XP_011034662.1|  PREDICTED: cytochrome P450 704C1-like              143   9e-37    Populus euphratica
dbj|BAJ89249.1|  predicted protein                                      142   9e-37    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009379287.1|  PREDICTED: cytochrome P450 704C1-like              143   1e-36    Pyrus x bretschneideri [bai li]
ref|XP_010092871.1|  Cytochrome P450 704C1                              143   1e-36    
ref|XP_010056271.1|  PREDICTED: cytochrome P450 704C1-like              143   1e-36    Eucalyptus grandis [rose gum]
ref|XP_010056273.1|  PREDICTED: cytochrome P450 704C1-like              143   1e-36    Eucalyptus grandis [rose gum]
ref|XP_004164591.1|  PREDICTED: cytochrome P450 86A1-like               142   2e-36    
ref|XP_004150627.1|  PREDICTED: cytochrome P450 86A1-like               142   2e-36    Cucumis sativus [cucumbers]
ref|XP_009389611.1|  PREDICTED: cytochrome P450 704C1-like              142   2e-36    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP17799.1|  unnamed protein product                                142   3e-36    Coffea canephora [robusta coffee]
ref|XP_003521549.1|  PREDICTED: cytochrome P450 704C1-like isoform 1    142   3e-36    Glycine max [soybeans]
gb|EYU25719.1|  hypothetical protein MIMGU_mgv1a024571mg                142   3e-36    Erythranthe guttata [common monkey flower]
ref|XP_003528922.1|  PREDICTED: cytochrome P450 704C1 isoform 1         142   3e-36    Glycine max [soybeans]
ref|XP_010685596.1|  PREDICTED: cytochrome P450 86A1                    142   4e-36    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010033023.1|  PREDICTED: cytochrome P450 86A1-like               142   4e-36    Eucalyptus grandis [rose gum]
ref|XP_008343023.1|  PREDICTED: cytochrome P450 704C1-like              141   4e-36    
ref|XP_009797232.1|  PREDICTED: cytochrome P450 86A8-like               142   5e-36    Nicotiana sylvestris
ref|XP_004252175.2|  PREDICTED: cytochrome P450 704C1-like              141   5e-36    
ref|XP_010262795.1|  PREDICTED: cytochrome P450 86A1                    141   5e-36    Nelumbo nucifera [Indian lotus]
gb|AFN53663.1|  cytochrome P450                                         141   6e-36    Linum usitatissimum
ref|XP_006339781.1|  PREDICTED: cytochrome P450 704C1-like              141   6e-36    Solanum tuberosum [potatoes]
ref|XP_004976569.1|  PREDICTED: cytochrome P450 704C1-like              141   6e-36    Setaria italica
ref|XP_004490585.1|  PREDICTED: cytochrome P450 86A1-like               141   7e-36    Cicer arietinum [garbanzo]
ref|XP_003636830.1|  Cytochrome P450 monooxygenase CYP704G7             141   7e-36    
ref|XP_003627669.1|  Cytochrome P450 monooxygenase CYP704G7             141   8e-36    
ref|XP_010272641.1|  PREDICTED: cytochrome P450 704C1-like              141   8e-36    Nelumbo nucifera [Indian lotus]
ref|XP_009629836.1|  PREDICTED: cytochrome P450 86A8                    141   8e-36    Nicotiana tomentosiformis
ref|XP_010053250.1|  PREDICTED: cytochrome P450 86A7                    141   9e-36    Eucalyptus grandis [rose gum]
gb|EYU45975.1|  hypothetical protein MIMGU_mgv1a025576mg                140   9e-36    Erythranthe guttata [common monkey flower]
ref|XP_006339777.1|  PREDICTED: cytochrome P450 704C1-like              140   9e-36    Solanum tuberosum [potatoes]
ref|XP_009374269.1|  PREDICTED: cytochrome P450 86A1                    140   1e-35    Pyrus x bretschneideri [bai li]
ref|XP_004229915.2|  PREDICTED: cytochrome P450 704C1-like              140   1e-35    
ref|XP_002446967.1|  hypothetical protein SORBIDRAFT_06g026000          140   1e-35    
ref|XP_002525608.1|  cytochrome P450, putative                          140   1e-35    Ricinus communis
gb|EPS61958.1|  hypothetical protein M569_12832                         140   1e-35    Genlisea aurea
ref|XP_002446966.1|  hypothetical protein SORBIDRAFT_06g025990          140   2e-35    Sorghum bicolor [broomcorn]
ref|XP_010473620.1|  PREDICTED: cytochrome P450 86A7-like               140   2e-35    Camelina sativa [gold-of-pleasure]
gb|EMT31268.1|  Cytochrome P450 704C1                                   140   2e-35    
ref|XP_002299820.2|  Cytochrome P450 86A1 family protein                140   2e-35    
ref|XP_008803291.1|  PREDICTED: cytochrome P450 704C1-like              140   2e-35    Phoenix dactylifera
ref|XP_006576393.1|  PREDICTED: cytochrome P450 704C1-like              139   2e-35    Glycine max [soybeans]
ref|XP_011082379.1|  PREDICTED: cytochrome P450 86A1                    139   2e-35    Sesamum indicum [beniseed]
ref|XP_010418406.1|  PREDICTED: cytochrome P450 86A7-like               139   2e-35    Camelina sativa [gold-of-pleasure]
ref|XP_006348042.1|  PREDICTED: cytochrome P450 704C1-like              139   3e-35    
emb|CBI34653.3|  unnamed protein product                                142   4e-35    Vitis vinifera
gb|KDP46522.1|  hypothetical protein JCGZ_08494                         139   4e-35    Jatropha curcas
ref|XP_007219038.1|  hypothetical protein PRUPE_ppa004579mg             139   4e-35    Prunus persica
gb|ABD97099.1|  cytochrome P450 monooxygenase CYP94D24                  137   4e-35    Glycine max [soybeans]
ref|XP_010430476.1|  PREDICTED: cytochrome P450 86A7                    139   4e-35    Camelina sativa [gold-of-pleasure]
ref|XP_006827573.1|  hypothetical protein AMTR_s00009p00227030          139   5e-35    
ref|XP_006300436.1|  hypothetical protein CARUB_v10020100mg             139   5e-35    Capsella rubella
ref|XP_004976553.1|  PREDICTED: cytochrome P450 704C1-like              139   5e-35    Setaria italica
emb|CDO99497.1|  unnamed protein product                                138   6e-35    Coffea canephora [robusta coffee]
gb|KCW78251.1|  hypothetical protein EUGRSUZ_D02439                     137   6e-35    Eucalyptus grandis [rose gum]
ref|XP_004229925.2|  PREDICTED: cytochrome P450 704C1-like              138   6e-35    Solanum lycopersicum
ref|XP_006339587.1|  PREDICTED: cytochrome P450 86A2-like               138   6e-35    Solanum tuberosum [potatoes]
gb|EMT32710.1|  Cytochrome P450 704C1                                   138   7e-35    
ref|XP_002270428.2|  PREDICTED: cytochrome P450 704C1-like isofor...    138   7e-35    Vitis vinifera
ref|XP_010662358.1|  PREDICTED: cytochrome P450 704C1-like isofor...    138   7e-35    
gb|KCW78252.1|  hypothetical protein EUGRSUZ_D02439                     137   7e-35    Eucalyptus grandis [rose gum]
ref|XP_010662357.1|  PREDICTED: cytochrome P450 704C1-like isofor...    138   8e-35    Vitis vinifera
ref|XP_010662355.1|  PREDICTED: cytochrome P450 704C1-like isofor...    138   8e-35    Vitis vinifera
ref|XP_010255320.1|  PREDICTED: cytochrome P450 86A8                    138   8e-35    Nelumbo nucifera [Indian lotus]
ref|XP_009763725.1|  PREDICTED: cytochrome P450 86A1                    138   8e-35    Nicotiana sylvestris
ref|XP_010104672.1|  Cytochrome P450 86A1                               138   8e-35    Morus notabilis
ref|XP_004955136.1|  PREDICTED: cytochrome P450 86A2-like               137   9e-35    
ref|XP_010662354.1|  PREDICTED: cytochrome P450 704C1-like isofor...    138   9e-35    Vitis vinifera
ref|XP_009630929.1|  PREDICTED: cytochrome P450 86A1                    138   9e-35    Nicotiana tomentosiformis
ref|XP_010933914.1|  PREDICTED: cytochrome P450 704C1-like isofor...    138   9e-35    Elaeis guineensis
gb|KHF99845.1|  Cytochrome P450 protein                                 138   9e-35    Gossypium arboreum [tree cotton]
gb|KJB08946.1|  hypothetical protein B456_001G115100                    138   9e-35    Gossypium raimondii
ref|XP_011035187.1|  PREDICTED: cytochrome P450 86A1-like               138   1e-34    Populus euphratica
emb|CBI24485.3|  unnamed protein product                                137   1e-34    Vitis vinifera
ref|XP_010662356.1|  PREDICTED: cytochrome P450 704C1-like isofor...    137   1e-34    
gb|AAM65207.1|  putative cytochrome P450                                137   1e-34    Arabidopsis thaliana [mouse-ear cress]
ref|NP_176558.1|  cytochrome P450, family 86, subfamily A, polype...    137   1e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004229934.1|  PREDICTED: cytochrome P450 86A8-like               137   1e-34    Solanum lycopersicum
ref|XP_006857967.1|  hypothetical protein AMTR_s00069p00176780          137   1e-34    Amborella trichopoda
gb|EMT18793.1|  Cytochrome P450 704C1                                   137   1e-34    
gb|ACG33785.1|  cytochrome P450 CYP86A36                                137   1e-34    Zea mays [maize]
ref|NP_001275219.1|  CYP86A33 fatty acid omega-hydroxylase              137   1e-34    Solanum tuberosum [potatoes]
ref|XP_008809790.1|  PREDICTED: cytochrome P450 704C1 isoform X2        137   1e-34    Phoenix dactylifera
ref|XP_008809789.1|  PREDICTED: cytochrome P450 704C1 isoform X1        137   2e-34    
ref|XP_004309257.2|  PREDICTED: cytochrome P450 704C1-like              137   2e-34    Fragaria vesca subsp. vesca
gb|KHN04083.1|  Cytochrome P450 704C1                                   137   2e-34    Glycine soja [wild soybean]
emb|CDP12038.1|  unnamed protein product                                137   2e-34    Coffea canephora [robusta coffee]
ref|XP_010544373.1|  PREDICTED: cytochrome P450 704C1-like isofor...    137   2e-34    Tarenaya hassleriana [spider flower]
emb|CDP03436.1|  unnamed protein product                                137   2e-34    Coffea canephora [robusta coffee]
ref|XP_008338834.1|  PREDICTED: cytochrome P450 86A8                    137   2e-34    Malus domestica [apple tree]
gb|AFW72704.1|  putative cytochrome P450 superfamily protein            137   2e-34    
emb|CDM81559.1|  unnamed protein product                                137   2e-34    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004500237.1|  PREDICTED: cytochrome P450 86A1-like               137   2e-34    Cicer arietinum [garbanzo]
ref|NP_001183394.1|  uncharacterized protein LOC100501810               137   2e-34    
ref|XP_010056270.1|  PREDICTED: cytochrome P450 704C1-like              137   2e-34    Eucalyptus grandis [rose gum]
ref|NP_001130939.1|  uncharacterized protein LOC100192044               137   2e-34    
ref|XP_004970620.1|  PREDICTED: cytochrome P450 86A1-like               137   3e-34    Setaria italica
ref|XP_010275632.1|  PREDICTED: cytochrome P450 86A8-like               137   3e-34    Nelumbo nucifera [Indian lotus]
ref|XP_007134454.1|  hypothetical protein PHAVU_010G048700g             136   3e-34    Phaseolus vulgaris [French bean]
ref|XP_004241175.1|  PREDICTED: cytochrome P450 86A1                    136   3e-34    Solanum lycopersicum
ref|XP_010933916.1|  PREDICTED: cytochrome P450 704C1-like isofor...    136   3e-34    Elaeis guineensis
ref|XP_003627663.1|  Cytochrome P450 monooxygenase CYP704G7             136   3e-34    
gb|ACN27732.1|  unknown                                                 136   3e-34    Zea mays [maize]
gb|ACG38359.1|  cytochrome P450 CYP86A35                                136   3e-34    Zea mays [maize]
ref|XP_006425039.1|  hypothetical protein CICLE_v10030097mg             136   3e-34    Citrus clementina [clementine]
gb|EYU23445.1|  hypothetical protein MIMGU_mgv1a026937mg                136   4e-34    Erythranthe guttata [common monkey flower]
gb|AET02139.2|  cytochrome P450 family protein                          136   4e-34    Medicago truncatula
ref|XP_003538284.1|  PREDICTED: cytochrome P450 86A1-like isoform 1     136   4e-34    
ref|XP_010933917.1|  PREDICTED: cytochrome P450 704C1-like isofor...    136   4e-34    
ref|XP_006391721.1|  hypothetical protein EUTSA_v10023410mg             136   4e-34    
ref|XP_010255770.1|  PREDICTED: cytochrome P450 704C1-like isofor...    136   4e-34    
ref|XP_010255771.1|  PREDICTED: cytochrome P450 704C1-like isofor...    136   4e-34    
ref|XP_007134455.1|  hypothetical protein PHAVU_010G048800g             136   4e-34    
ref|XP_003521105.1|  PREDICTED: cytochrome P450 94A1                    135   4e-34    
ref|XP_002452782.1|  hypothetical protein SORBIDRAFT_04g032410          136   5e-34    
ref|XP_002509820.1|  cytochrome P450, putative                          136   5e-34    
ref|XP_009593545.1|  PREDICTED: cytochrome P450 704C1-like              135   5e-34    
ref|XP_007146731.1|  hypothetical protein PHAVU_006G065000g             135   5e-34    
gb|KHN12182.1|  Cytochrome P450 94A1                                    135   5e-34    
ref|XP_009397933.1|  PREDICTED: cytochrome P450 86A2-like               135   6e-34    
ref|XP_006348044.1|  PREDICTED: cytochrome P450 704C1-like              135   6e-34    
gb|KHN47607.1|  Cytochrome P450 86A1                                    135   6e-34    
gb|EPS59487.1|  hypothetical protein M569_15318                         135   6e-34    
ref|XP_007143336.1|  hypothetical protein PHAVU_007G063800g             135   6e-34    
ref|XP_009402078.1|  PREDICTED: cytochrome P450 86A8-like               135   7e-34    
ref|XP_003627566.1|  Cytochrome P450 fatty acid omega-hydroxylase       135   7e-34    
ref|XP_008355259.1|  PREDICTED: cytochrome P450 86A1                    135   8e-34    
emb|CDY18885.1|  BnaC04g04650D                                          135   8e-34    
gb|KDP25417.1|  hypothetical protein JCGZ_20573                         135   8e-34    
ref|XP_010934572.1|  PREDICTED: cytochrome P450 704C1-like              135   9e-34    
ref|XP_009143197.1|  PREDICTED: cytochrome P450 86A8                    135   9e-34    
emb|CDX74778.1|  BnaA05g05240D                                          135   9e-34    
ref|NP_001182854.1|  putative cytochrome P450 superfamily protein       134   9e-34    
ref|XP_010087951.1|  Cytochrome P450 86A2                               135   9e-34    
ref|XP_002456654.1|  hypothetical protein SORBIDRAFT_03g040250          135   1e-33    
gb|ABC59095.1|  cytochrome P450 monooxygenase CYP704G7                  135   1e-33    
gb|ACG34921.1|  cytochrome P450 CYP86A34                                135   1e-33    
ref|XP_008220520.1|  PREDICTED: cytochrome P450 86A1                    135   1e-33    
gb|AHD25487.1|  cytochrome-P450 monooxygenase CYP86                     135   1e-33    
ref|XP_006647656.1|  PREDICTED: cytochrome P450 86A2-like               134   1e-33    
ref|XP_008343043.1|  PREDICTED: cytochrome P450 704C1                   134   1e-33    
ref|XP_002314117.1|  Cytochrome P450 86A1 family protein                134   1e-33    
gb|KFK30625.1|  hypothetical protein AALP_AA6G006200                    134   1e-33    
ref|XP_009375001.1|  PREDICTED: cytochrome P450 86A8                    134   2e-33    
gb|ACL53124.1|  unknown                                                 134   2e-33    
ref|NP_001141372.1|  uncharacterized protein LOC100273463               134   2e-33    
ref|XP_009394066.1|  PREDICTED: cytochrome P450 94B3-like               134   2e-33    
ref|XP_011094593.1|  PREDICTED: cytochrome P450 704C1                   134   2e-33    
ref|XP_009393311.1|  PREDICTED: cytochrome P450 704C1-like isofor...    134   2e-33    
ref|XP_009776442.1|  PREDICTED: cytochrome P450 704C1-like              134   2e-33    
gb|AJD25208.1|  cytochrome P450 CYP86A92                                134   2e-33    
gb|KHN04093.1|  Cytochrome P450 704C1                                   134   2e-33    
ref|XP_002886391.1|  predicted protein                                  134   2e-33    
ref|XP_010541445.1|  PREDICTED: cytochrome P450 86A1-like               134   2e-33    
ref|XP_008358971.1|  PREDICTED: cytochrome P450 86A1-like               134   2e-33    
ref|XP_001760399.1|  predicted protein                                  134   2e-33    
ref|XP_009379286.1|  PREDICTED: cytochrome P450 704C1-like              134   2e-33    
ref|XP_004510774.1|  PREDICTED: cytochrome P450 86A2-like               134   2e-33    
ref|XP_009393320.1|  PREDICTED: cytochrome P450 704C1-like isofor...    134   2e-33    
ref|XP_010533650.1|  PREDICTED: cytochrome P450 86A7                    134   2e-33    
ref|XP_008363170.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    133   2e-33    
ref|XP_008373994.1|  PREDICTED: cytochrome P450 86A8-like               134   3e-33    
gb|EMS65497.1|  Cytochrome P450 86A1                                    133   3e-33    
ref|XP_002519477.1|  cytochrome P450, putative                          134   3e-33    
ref|XP_003615606.1|  Cytochrome P450                                    134   3e-33    
gb|KCW78249.1|  hypothetical protein EUGRSUZ_D02437                     133   3e-33    
ref|XP_003564640.2|  PREDICTED: cytochrome P450 86A1                    134   3e-33    
gb|KJB07840.1|  hypothetical protein B456_001G047200                    134   3e-33    
gb|KJB07843.1|  hypothetical protein B456_001G047200                    134   3e-33    
ref|XP_004301072.2|  PREDICTED: cytochrome P450 94B3-like               129   3e-33    
ref|NP_182121.1|  cytochrome P450, family 86, subfamily A, polype...    134   3e-33    
ref|XP_007051775.1|  Cytochrome P450, family 86, subfamily A, pol...    134   3e-33    
emb|CDM81564.1|  unnamed protein product                                135   3e-33    
ref|XP_004306891.2|  PREDICTED: cytochrome P450 704C1-like isofor...    134   3e-33    
ref|XP_006397782.1|  hypothetical protein EUTSA_v10001389mg             134   3e-33    
ref|XP_009118821.1|  PREDICTED: cytochrome P450 86A4                    134   3e-33    
ref|XP_008437294.1|  PREDICTED: cytochrome P450 86A7                    134   3e-33    
gb|KJB07838.1|  hypothetical protein B456_001G047200                    134   3e-33    
ref|XP_004143898.1|  PREDICTED: cytochrome P450 86A2-like               134   3e-33    
ref|XP_010934568.1|  PREDICTED: cytochrome P450 704C1-like              134   3e-33    
ref|XP_011032144.1|  PREDICTED: cytochrome P450 86A1                    133   3e-33    
ref|XP_011469122.1|  PREDICTED: cytochrome P450 704C1-like isofor...    133   3e-33    
ref|XP_002882043.1|  CYP86A8                                            133   3e-33    
gb|KJB07841.1|  hypothetical protein B456_001G047200                    133   4e-33    
ref|XP_003561125.1|  PREDICTED: cytochrome P450 704C1-like              133   4e-33    
gb|KJB07842.1|  hypothetical protein B456_001G047200                    134   4e-33    
ref|XP_007142224.1|  hypothetical protein PHAVU_008G262600g             133   4e-33    
ref|XP_002988642.1|  medium chain fatty acid hydroxylase                133   4e-33    
ref|NP_001044838.1|  Os01g0854800                                       133   5e-33    
ref|XP_004309256.1|  PREDICTED: cytochrome P450 704C1-like              133   5e-33    
emb|CDX90044.1|  BnaA10g00380D                                          133   5e-33    
ref|XP_003528924.1|  PREDICTED: cytochrome P450 704C1-like              133   5e-33    
ref|XP_009119710.1|  PREDICTED: cytochrome P450 86A4                    133   5e-33    
ref|XP_007208647.1|  hypothetical protein PRUPE_ppa020227mg             133   5e-33    
gb|KHN04574.1|  Cytochrome P450 704C1                                   133   5e-33    
dbj|BAJ86471.1|  predicted protein                                      133   5e-33    
gb|EMT01938.1|  Cytochrome P450 86A2                                    132   6e-33    
ref|XP_006645037.1|  PREDICTED: cytochrome P450 86A1-like               133   6e-33    
ref|XP_010111205.1|  Cytochrome P450 94A2                               132   6e-33    
ref|XP_006339520.1|  PREDICTED: cytochrome P450 704C1-like              132   6e-33    
ref|XP_008238919.1|  PREDICTED: cytochrome P450 86A8                    132   6e-33    
ref|XP_008244638.1|  PREDICTED: cytochrome P450 86A8-like               133   6e-33    
ref|XP_003570074.1|  PREDICTED: cytochrome P450 86A2-like               132   6e-33    
ref|XP_003525390.1|  PREDICTED: cytochrome P450 86A8                    132   7e-33    
ref|XP_007218993.1|  hypothetical protein PRUPE_ppa004034mg             132   7e-33    
ref|XP_001781706.1|  predicted protein                                  132   7e-33    
ref|XP_004306772.1|  PREDICTED: cytochrome P450 86A8-like               132   7e-33    
ref|XP_010506590.1|  PREDICTED: cytochrome P450 86A8-like isoform X1    132   8e-33    
ref|XP_010520223.1|  PREDICTED: cytochrome P450 86A1                    132   8e-33    
gb|AJD25207.1|  cytochrome P450 CYP86A91                                132   8e-33    
gb|EMT14997.1|  Cytochrome P450 86A2                                    132   8e-33    
ref|XP_006293977.1|  hypothetical protein CARUB_v10022968mg             132   8e-33    
ref|XP_010061882.1|  PREDICTED: cytochrome P450 704C1-like              132   9e-33    
dbj|BAJ88802.1|  predicted protein                                      132   9e-33    
gb|AAG17470.1|AF123610_9  cytochrome P450                               132   9e-33    
emb|CBH32594.1|  cytochrome P450, expressed                             132   9e-33    
ref|XP_002979336.1|  hypothetical protein SELMODRAFT_110688             132   9e-33    
ref|XP_007135090.1|  hypothetical protein PHAVU_010G099900g             132   9e-33    
ref|XP_002961706.1|  hypothetical protein SELMODRAFT_76541              132   1e-32    
ref|XP_011040725.1|  PREDICTED: cytochrome P450 94A1                    132   1e-32    
ref|XP_002964775.1|  medium chain fatty acid hydroxylase                132   1e-32    
gb|KCW90796.1|  hypothetical protein EUGRSUZ_A02863                     132   1e-32    
ref|XP_003592376.1|  Cytochrome P450 monooxygenase CYP704G9             132   1e-32    
ref|XP_008777681.1|  PREDICTED: cytochrome P450 704C1-like isofor...    132   1e-32    
gb|KDP29172.1|  hypothetical protein JCGZ_16561                         130   1e-32    
ref|XP_009128484.1|  PREDICTED: cytochrome P450 86A2                    132   1e-32    
ref|XP_008342161.1|  PREDICTED: cytochrome P450 86A8                    132   1e-32    
gb|EEC73748.1|  hypothetical protein OsI_08390                          132   1e-32    
gb|KDO86201.1|  hypothetical protein CISIN_1g009235mg                   132   1e-32    
ref|XP_011036497.1|  PREDICTED: cytochrome P450 86A8-like               132   1e-32    
ref|NP_001047674.1|  Os02g0666500                                       132   1e-32    
ref|XP_002320802.1|  cytochrome P450 family protein                     132   1e-32    
ref|XP_006445018.1|  hypothetical protein CICLE_v10019633mg             132   1e-32    
ref|XP_008777680.1|  PREDICTED: cytochrome P450 704C1-like isofor...    132   1e-32    
ref|XP_011092582.1|  PREDICTED: cytochrome P450 86A8-like               132   1e-32    
ref|XP_010518254.1|  PREDICTED: cytochrome P450 86A8-like               132   1e-32    
ref|XP_002985393.1|  hypothetical protein SELMODRAFT_122098             131   1e-32    
ref|XP_010508082.1|  PREDICTED: cytochrome P450 86A8                    132   2e-32    
gb|AGT16154.1|  hypothetical protein SHCRBa_046_L16_R_150               131   2e-32    
ref|XP_004976552.1|  PREDICTED: cytochrome P450 704C1-like              131   2e-32    
gb|KFK37382.1|  hypothetical protein AALP_AA4G249700                    131   2e-32    
emb|CDY66201.1|  BnaA09g51710D                                          132   2e-32    
emb|CDM81563.1|  unnamed protein product                                131   2e-32    
ref|XP_004298810.1|  PREDICTED: cytochrome P450 86A7                    131   2e-32    
ref|XP_006857997.1|  hypothetical protein AMTR_s00069p00186770          130   2e-32    
emb|CBI24223.3|  unnamed protein product                                129   2e-32    
emb|CDY15167.1|  BnaC05g00460D                                          131   2e-32    
ref|XP_006652635.1|  PREDICTED: cytochrome P450 86A4-like               131   2e-32    
gb|KEH34209.1|  cytochrome P450 family-dependent fatty acid hydro...    131   2e-32    
ref|XP_008777559.1|  PREDICTED: cytochrome P450 704C1-like isofor...    131   2e-32    
ref|XP_007160078.1|  hypothetical protein PHAVU_002G290700g             131   2e-32    
ref|XP_007209896.1|  hypothetical protein PRUPE_ppa004078mg             131   2e-32    
ref|XP_008777682.1|  PREDICTED: cytochrome P450 704C1-like              131   2e-32    
ref|XP_008777558.1|  PREDICTED: cytochrome P450 704C1-like isofor...    131   2e-32    
gb|KDO53671.1|  hypothetical protein CISIN_1g038353mg                   127   3e-32    
ref|XP_002875027.1|  CYP86A2                                            131   3e-32    
ref|XP_010089087.1|  Cytochrome P450 86A2                               131   3e-32    
ref|XP_010053722.1|  PREDICTED: cytochrome P450 86A8-like               131   3e-32    
ref|XP_011072860.1|  PREDICTED: cytochrome P450 86A7                    130   3e-32    
ref|XP_006839068.1|  hypothetical protein AMTR_s00090p00093060          130   3e-32    
ref|XP_006396237.1|  hypothetical protein EUTSA_v10028550mg             131   3e-32    
gb|KCW78083.1|  hypothetical protein EUGRSUZ_D02303                     131   3e-32    
ref|XP_006339519.1|  PREDICTED: cytochrome P450 704C1-like              130   4e-32    
emb|CDY38015.1|  BnaCnng08760D                                          130   4e-32    
ref|XP_008661694.1|  PREDICTED: putative cytochrome P450 superfam...    130   4e-32    
ref|XP_010544737.1|  PREDICTED: cytochrome P450 86A8                    130   4e-32    
ref|XP_007162039.1|  hypothetical protein PHAVU_001G118600g             130   4e-32    
ref|XP_009111490.1|  PREDICTED: cytochrome P450 86A2                    130   4e-32    
ref|XP_004306890.1|  PREDICTED: cytochrome P450 704C1-like              130   5e-32    
gb|KFK27415.1|  hypothetical protein AALP_AA8G379800                    130   5e-32    
ref|XP_004496648.1|  PREDICTED: cytochrome P450 704C1-like              130   5e-32    
ref|NP_001143079.1|  putative cytochrome P450 superfamily protein       130   5e-32    
ref|NP_001065110.2|  Os10g0524700                                       127   5e-32    
gb|KJB41354.1|  hypothetical protein B456_007G100300                    130   5e-32    
ref|XP_010934570.1|  PREDICTED: cytochrome P450 704C1-like              130   6e-32    
ref|XP_003627676.1|  Cytochrome P450                                    130   6e-32    
ref|XP_006655746.1|  PREDICTED: cytochrome P450 704C1-like              130   6e-32    
ref|XP_006421783.1|  hypothetical protein CICLE_v10004720mg             130   6e-32    
ref|XP_002883546.1|  cytochrome P450                                    130   6e-32    
ref|XP_010419577.1|  PREDICTED: cytochrome P450 86A2-like isoform X1    130   6e-32    
ref|XP_006401031.1|  hypothetical protein EUTSA_v10013214mg             130   6e-32    
ref|XP_006468806.1|  PREDICTED: cytochrome P450 704C1-like isofor...    130   6e-32    
ref|XP_009407544.1|  PREDICTED: cytochrome P450 86A1                    130   6e-32    
ref|XP_011041380.1|  PREDICTED: cytochrome P450 94A1-like               130   6e-32    
ref|XP_006583288.1|  PREDICTED: cytochrome P450 86A8-like               130   6e-32    
ref|XP_009132026.1|  PREDICTED: cytochrome P450 86A1-like               130   7e-32    
gb|ABC68403.1|  cytochrome P450 monooxygenase CYP86A24                  130   7e-32    
ref|XP_010426970.1|  PREDICTED: cytochrome P450 86A2                    130   7e-32    
emb|CDY07223.1|  BnaCnng02380D                                          130   7e-32    
gb|KJB52139.1|  hypothetical protein B456_008G247600                    130   7e-32    
ref|XP_001782495.1|  predicted protein                                  130   7e-32    
ref|XP_006490954.1|  PREDICTED: cytochrome P450 704C1-like isofor...    129   7e-32    
ref|NP_001168221.1|  uncharacterized protein LOC100381980 precursor     129   8e-32    
ref|XP_008810187.1|  PREDICTED: cytochrome P450 94A1-like               129   8e-32    
ref|XP_002892051.1|  CYP86A4                                            130   8e-32    
gb|KJB24757.1|  hypothetical protein B456_004G159000                    129   8e-32    
gb|KDP28614.1|  hypothetical protein JCGZ_14385                         130   8e-32    
ref|XP_002979685.1|  medium chain fatty acid hydroxylase                129   9e-32    
ref|XP_010247156.1|  PREDICTED: cytochrome P450 94B3-like               129   1e-31    
emb|CDP08799.1|  unnamed protein product                                129   1e-31    
ref|XP_010109079.1|  Cytochrome P450 704C1                              129   1e-31    
gb|ABC59094.1|  cytochrome P450 monooxygenase CYP704G9                  129   1e-31    
tpg|DAA38877.1|  TPA: putative cytochrome P450 superfamily protein      129   1e-31    
ref|NP_191946.1|  cytochrome P450 86A2                                  129   1e-31    
gb|AAL75903.1|  AT4g00360/A_IG005I10_21                                 129   1e-31    
ref|XP_002307954.2|  putative cytochrome P450 family protein            129   1e-31    
emb|CDY02846.1|  BnaC02g10430D                                          128   1e-31    
emb|CDY32676.1|  BnaA02g07380D                                          128   1e-31    
ref|XP_003521880.1|  PREDICTED: cytochrome P450 86A8-like               129   1e-31    
gb|AGT16153.1|  hypothetical protein SHCRBa_046_L16_R_20                129   1e-31    
tpg|DAA38876.1|  TPA: putative cytochrome P450 superfamily protein      129   1e-31    
ref|XP_010443636.1|  PREDICTED: cytochrome P450 86A1                    129   1e-31    
ref|XP_010926207.1|  PREDICTED: cytochrome P450 86A1-like               129   1e-31    
ref|XP_006373690.1|  cytochrome P450 family protein                     129   1e-31    
ref|XP_006418437.1|  hypothetical protein EUTSA_v10007350mg             129   1e-31    
emb|CDX67652.1|  BnaA07g16920D                                          129   2e-31    
ref|XP_002509524.1|  cytochrome P450, putative                          129   2e-31    
ref|XP_006482029.1|  PREDICTED: cytochrome P450 94A1-like               129   2e-31    
ref|XP_006280320.1|  hypothetical protein CARUB_v10026242mg             129   2e-31    
ref|XP_010934571.1|  PREDICTED: cytochrome P450 704C1-like              129   2e-31    
ref|XP_004976485.1|  PREDICTED: cytochrome P450 86A2-like               129   2e-31    
ref|XP_004309261.1|  PREDICTED: cytochrome P450 704C1-like isofor...    128   2e-31    
gb|AJD25235.1|  cytochrome P450 CYP704A99                               128   2e-31    
ref|XP_010483494.1|  PREDICTED: cytochrome P450 86A1-like               128   2e-31    
ref|XP_002862636.1|  cytochrome P450                                    128   2e-31    
ref|XP_008232704.1|  PREDICTED: cytochrome P450 704C1                   128   2e-31    
ref|XP_004299232.1|  PREDICTED: cytochrome P450 94B3-like               128   2e-31    
ref|XP_002322606.2|  hypothetical protein POPTR_0016s03160g             128   2e-31    



>ref|XP_011070985.1| PREDICTED: cytochrome P450 704B1 [Sesamum indicum]
Length=529

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
            ++ T ++ L +++F W+FIHRL QR   GP++WP +GA++EQ+ NY RMHDW+V YL+ S
Sbjct  7    NLSTFIITLSIMLFSWIFIHRLKQRNSKGPKTWPFLGAAIEQLVNYDRMHDWMVEYLSQS  66

Query  194  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  373
             +VVVPMPFTTYTYIA P NVEHVL+TNF NYPKGEVYHSYMEVLLGDGIFNADGELWRK
Sbjct  67   RTVVVPMPFTTYTYIADPANVEHVLRTNFSNYPKGEVYHSYMEVLLGDGIFNADGELWRK  126

Query  374  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  553
            QRKTAS EFASKNLRDFSTVVFR+YSLKLF IL  AS  NQ++DMQ+LLMRMTLDSICKV
Sbjct  127  QRKTASFEFASKNLRDFSTVVFREYSLKLFDILCHASYSNQEIDMQELLMRMTLDSICKV  186

Query  554  GFGV  565
            GFGV
Sbjct  187  GFGV  190



>ref|NP_177109.3| cytochrome P450, family 704, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
 sp|Q9C788.1|C70B1_ARATH RecName: Full=Cytochrome P450 704B1 [Arabidopsis thaliana]
 gb|AAG60111.1|AC073178_22 cytochrome P450, putative [Arabidopsis thaliana]
 gb|AEE34933.1| cytochrome P450, family 704, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
Length=524

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            +L L +  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDWLV YL NS +V
Sbjct  2    SLCLVIACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
            VVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62   VVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            TAS EFASKNLRDFSTVVF++YSLKLFTIL+QAS   QQVDMQ+LLMRMTLDSICKVGFG
Sbjct  122  TASFEFASKNLRDFSTVVFKEYSLKLFTILSQASFKEQQVDMQELLMRMTLDSICKVGFG  181

Query  563  V  565
            V
Sbjct  182  V  182



>ref|XP_008389448.1| PREDICTED: cytochrome P450 704B1 [Malus domestica]
Length=531

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +2

Query  11   SSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLAN  190
            SS + L + L +++  W+FIHR SQR   GP++WP++GA++EQ TNY RMHDWLV YL+ 
Sbjct  13   SSQDGLFMVLCMVL-SWIFIHRWSQRNKKGPKTWPLVGAAIEQFTNYDRMHDWLVKYLSE  71

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
            S SVVVPMPFTTYTYIA P NVEHVLKTNF NYPKGEVY SYMEVLLGDGIFN DGELWR
Sbjct  72   SNSVVVPMPFTTYTYIADPANVEHVLKTNFANYPKGEVYRSYMEVLLGDGIFNVDGELWR  131

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            KQRKTAS EFASKNLRDFSTVVFRDYSLKL +IL++AS   QQVDMQ+LLMRMTLDSICK
Sbjct  132  KQRKTASFEFASKNLRDFSTVVFRDYSLKLHSILSRASFQGQQVDMQELLMRMTLDSICK  191

Query  551  VGFGV  565
            VGFGV
Sbjct  192  VGFGV  196



>ref|XP_002887239.1| oxygen binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63498.1| oxygen binding protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            +L L +  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDWLV YL NS +V
Sbjct  2    SLCLVIACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
            VVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62   VVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            TAS EFASKNLRDFSTVVF++YSLKLF IL+QAS  NQQVDMQ+LL+RMTLDSICKVGFG
Sbjct  122  TASFEFASKNLRDFSTVVFKEYSLKLFNILSQASFKNQQVDMQELLLRMTLDSICKVGFG  181

Query  563  V  565
            V
Sbjct  182  V  182



>ref|XP_010415594.1| PREDICTED: cytochrome P450 704B1-like [Camelina sativa]
Length=522

 Score =   300 bits (767),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            ++ L +  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDWLV YL NS +V
Sbjct  2    SMCLVVACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
            VVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62   VVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            TAS EFASKNLRDFSTVVF++YSLKLF IL+QAS  +QQVDMQ+LLMRMTLDSICKVGFG
Sbjct  122  TASFEFASKNLRDFSTVVFKEYSLKLFNILSQASFKDQQVDMQELLMRMTLDSICKVGFG  181

Query  563  V  565
            V
Sbjct  182  V  182



>ref|XP_006302101.1| hypothetical protein CARUB_v10020091mg [Capsella rubella]
 gb|EOA34999.1| hypothetical protein CARUB_v10020091mg [Capsella rubella]
Length=549

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            +L L +  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDW+V YL  S +V
Sbjct  2    SLCLIVACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWIVEYLYESRTV  61

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
            VVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62   VVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            TAS EFASKNLRDFSTVVF+DYSLKLF+IL+QAS  +QQVDMQ+LLMRMTLDSICKVGFG
Sbjct  122  TASFEFASKNLRDFSTVVFKDYSLKLFSILSQASFRDQQVDMQELLMRMTLDSICKVGFG  181

Query  563  V  565
            V
Sbjct  182  V  182



>ref|XP_009105494.1| PREDICTED: cytochrome P450 704B1 [Brassica rapa]
 emb|CDX95930.1| BnaA07g28010D [Brassica napus]
Length=519

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            + L  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDWLV YL +S +VVVP
Sbjct  5    IVLACMLTSWIFLHRWGQRNKRGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYDSRTVVVP  64

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRKTAS
Sbjct  65   MPFTTYTYIADPINVEHVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRKTAS  124

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFSTVVF++YSLKLF+IL QAS  +QQVDMQ+LLMRMTLDSICKVGFGV
Sbjct  125  FEFASKNLRDFSTVVFKEYSLKLFSILCQASFKDQQVDMQELLMRMTLDSICKVGFGV  182



>ref|XP_006391009.1| hypothetical protein EUTSA_v10018405mg [Eutrema salsugineum]
 gb|ESQ28295.1| hypothetical protein EUTSA_v10018405mg [Eutrema salsugineum]
Length=519

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            + L  ++  W+F+HR  QRK  GP++WP++GA++EQ+TN+ RMHDWLV YL +S +VVVP
Sbjct  5    IVLACMVTSWIFLHRWGQRKQRGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYDSRTVVVP  64

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRKTAS
Sbjct  65   MPFTTYTYIADPINVEHVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRKTAS  124

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFSTVVF++YSLKLFTIL QAS  +QQVDMQ+LLMRMT DSICKVGFGV
Sbjct  125  FEFASKNLRDFSTVVFKEYSLKLFTILCQASFNDQQVDMQELLMRMTQDSICKVGFGV  182



>emb|CDY40931.1| BnaC06g30690D [Brassica napus]
Length=519

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            + L  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDWLV YL +S +VVVP
Sbjct  5    IVLACMVTSWIFLHRWGQRNKRGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYDSRTVVVP  64

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRKTAS
Sbjct  65   MPFTTYTYIADPINVEHVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRKTAS  124

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFSTVVF++YSLKLF+IL QAS  +QQVDMQ+LLMRMTLDSICKVGFGV
Sbjct  125  FEFASKNLRDFSTVVFKEYSLKLFSILCQASSKDQQVDMQELLMRMTLDSICKVGFGV  182



>gb|EYU28779.1| hypothetical protein MIMGU_mgv1a004727mg [Erythranthe guttata]
Length=512

 Score =   296 bits (759),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 162/183 (89%), Gaps = 1/183 (1%)
 Frame = +2

Query  17   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  196
            M+T+ + + +++  W+ IHR++QR+G GP++WP +GA++EQ+ NY RMHDW++ YL+ S 
Sbjct  1    MQTIAVFVCMLL-SWILIHRMNQRRGKGPKTWPFLGAALEQLINYDRMHDWILNYLSQSR  59

Query  197  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  376
            +VVVPMPFTTYTYIA P +VEHVLKTNF NYPKG+VYHSYMEVLLGDGIFN DGELWRKQ
Sbjct  60   TVVVPMPFTTYTYIADPADVEHVLKTNFSNYPKGDVYHSYMEVLLGDGIFNVDGELWRKQ  119

Query  377  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  556
            RKTAS EFASKNLRDFSTVVFR+YSLKL +IL+QASL N Q+DMQ+LLMRMTLDSICKVG
Sbjct  120  RKTASFEFASKNLRDFSTVVFREYSLKLSSILSQASLNNHQLDMQELLMRMTLDSICKVG  179

Query  557  FGV  565
            FGV
Sbjct  180  FGV  182



>ref|XP_010683141.1| PREDICTED: cytochrome P450 704B1 [Beta vulgaris subsp. vulgaris]
Length=539

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  26   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  205
            ++L    + F W+FIHRLSQR   GP++WP+IGA++EQ  NY  MHDWLV YL+   +VV
Sbjct  24   ILLVACCMGFSWLFIHRLSQRNKLGPKTWPLIGAALEQFMNYDNMHDWLVEYLSKCRTVV  83

Query  206  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  385
            VPMPFTTYTYIA P NVEHVLKTNF NYPKGEVY SYMEVLLGDGIFNADGE WRKQRKT
Sbjct  84   VPMPFTTYTYIADPSNVEHVLKTNFVNYPKGEVYQSYMEVLLGDGIFNADGESWRKQRKT  143

Query  386  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            AS EFASKNLRDFSTVVFR+YSLKLFTIL++AS  N+ VDMQ+LLMRMTLDSICKVGFGV
Sbjct  144  ASFEFASKNLRDFSTVVFREYSLKLFTILSEASFENRSVDMQELLMRMTLDSICKVGFGV  203



>gb|KFK41374.1| hypothetical protein AALP_AA2G122000 [Arabis alpina]
Length=517

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = +2

Query  26   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  205
            +++ L  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDW+V YL +S +VV
Sbjct  2    MLMVLACMLISWIFLHRWGQRNKRGPKTWPLVGAAIEQLTNFDRMHDWIVEYLYDSRTVV  61

Query  206  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  385
            VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN+DG+LWRKQRKT
Sbjct  62   VPMPFTTYTYIADPINVEHVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGDLWRKQRKT  121

Query  386  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            AS EFASKNLRDFSTVVF++YSL LF+IL QAS  +QQVDMQ+LLMRMTLDSICKVGFGV
Sbjct  122  ASFEFASKNLRDFSTVVFKEYSLMLFSILCQASFRDQQVDMQELLMRMTLDSICKVGFGV  181



>ref|XP_002312255.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE89622.2| cytochrome P450 family protein [Populus trichocarpa]
Length=482

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  26   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  205
            +VL L  ++  W+FIHR +QR+  GP++WP++GA++EQ  NY +MHDWLV YL+   +VV
Sbjct  21   MVLMLACMVLSWIFIHRWNQRQKRGPKTWPIVGAAIEQFMNYNQMHDWLVKYLSELRTVV  80

Query  206  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  385
            VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKT
Sbjct  81   VPMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKT  140

Query  386  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            AS EFAS+NLRDFSTVVFR+YSLKL +IL+QAS  NQ+V+MQ LLMRMTLDSICKVGFGV
Sbjct  141  ASFEFASRNLRDFSTVVFREYSLKLSSILSQASFHNQEVEMQGLLMRMTLDSICKVGFGV  200



>ref|XP_010651872.1| PREDICTED: cytochrome P450 704B1 [Vitis vinifera]
Length=529

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            +L L   +  W+ IHR SQR   GP++WP++GA++EQ+ NY RMHDWLV YL+ S +V V
Sbjct  16   ILMLACTVLTWIAIHRWSQRHTKGPKTWPLVGAAIEQLINYDRMHDWLVKYLSKSRTVAV  75

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
            PMPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWR+QRKTA
Sbjct  76   PMPFTTYTYIADPANVEHVLKTNFANYPKGEVYHSYMEVLLGDGIFNVDGELWRRQRKTA  135

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EFASKNLRDFST+VFR+YSLKL  IL++AS  N++VDMQDLLMRMTLDSICKVGFGV
Sbjct  136  SFEFASKNLRDFSTIVFREYSLKLSAILSEASFHNREVDMQDLLMRMTLDSICKVGFGV  194



>ref|XP_010511987.1| PREDICTED: cytochrome P450 704B1 [Camelina sativa]
Length=522

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            ++ L +  ++  W+F+H   QR   GP++WP++GA++EQ+TN+ RMHDWLV YL NS +V
Sbjct  2    SMCLVVACMVTSWIFLHIWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
            VVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62   VVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            TAS EFASKNLRDFSTVVF++YSLKLF IL+QAS  +QQVDMQ+LLMRMTLDSICKVGFG
Sbjct  122  TASFEFASKNLRDFSTVVFKEYSLKLFNILSQASFKDQQVDMQELLMRMTLDSICKVGFG  181

Query  563  V  565
            V
Sbjct  182  V  182



>ref|XP_011017522.1| PREDICTED: cytochrome P450 704B1 [Populus euphratica]
Length=534

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  26   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  205
            +VL L  ++  W+FIHR +QR+  GP++WP +GA++EQ  NY RMHDWLV YL+   +VV
Sbjct  19   MVLLLACMVLSWIFIHRWNQRQKKGPKTWPTVGAAIEQFMNYNRMHDWLVKYLSELRTVV  78

Query  206  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  385
            VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKT
Sbjct  79   VPMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKT  138

Query  386  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            AS EFAS+NLRDFSTVVFR+YSLKL +IL+QAS  NQ+V+MQ LLMRMTLDSICKVGFGV
Sbjct  139  ASFEFASRNLRDFSTVVFREYSLKLSSILSQASFHNQEVEMQGLLMRMTLDSICKVGFGV  198



>ref|XP_010551418.1| PREDICTED: cytochrome P450 704B1 [Tarenaya hassleriana]
 ref|XP_010551419.1| PREDICTED: cytochrome P450 704B1 [Tarenaya hassleriana]
Length=519

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = +2

Query  17   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  196
            M   V+   ++M  W+F+HR SQR   GP++WP++GA++EQ+ N+ RMHDWLV YL  S 
Sbjct  1    MSVFVVVACMVM-SWLFLHRWSQRNKKGPKTWPLVGAAIEQLINFDRMHDWLVEYLKVSR  59

Query  197  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  376
            +VVVPMPFTTYTYIA P NVEHVL+TNF NYPKGE YHSYMEVLLGDGIFN+DGE+W+KQ
Sbjct  60   TVVVPMPFTTYTYIADPINVEHVLRTNFSNYPKGETYHSYMEVLLGDGIFNSDGEIWKKQ  119

Query  377  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  556
            RKTAS EFASKNLRDFSTVVFR+YSLKLF+IL QAS  +QQVDMQ+LLMRMTLDSICKVG
Sbjct  120  RKTASFEFASKNLRDFSTVVFREYSLKLFSILCQASFTDQQVDMQELLMRMTLDSICKVG  179

Query  557  FGV  565
            FGV
Sbjct  180  FGV  182



>ref|XP_010102176.1| Cytochrome P450 704C1 [Morus notabilis]
 gb|EXB92426.1| Cytochrome P450 704C1 [Morus notabilis]
Length=565

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            VL +   +  W+ IHR SQR   GP++WP++GA++EQ+TNY RMHDW+V YL+ S SVVV
Sbjct  21   VLVIACAILSWILIHRWSQRNKKGPKTWPLVGAAIEQLTNYDRMHDWIVPYLSESKSVVV  80

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
            PMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKTA
Sbjct  81   PMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKTA  140

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EFASKNLRDFST+VFR+YS KL  IL+QAS   Q VDMQ+LLMRMTLDSICKVGFGV
Sbjct  141  SFEFASKNLRDFSTIVFREYSQKLHAILSQASFHGQVVDMQELLMRMTLDSICKVGFGV  199



>ref|XP_007225718.1| hypothetical protein PRUPE_ppa004298mg [Prunus persica]
 gb|EMJ26917.1| hypothetical protein PRUPE_ppa004298mg [Prunus persica]
Length=517

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 152/176 (86%), Gaps = 1/176 (1%)
 Frame = +2

Query  38   LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  217
            L  ++  W+ +HR SQ+   GP++WP++GA++EQ+ NY RMHDWLV YL+ S SVVVPMP
Sbjct  2    LVCMVLSWIIVHRWSQKNKKGPKTWPLVGAAIEQLMNYDRMHDWLVKYLSESNSVVVPMP  61

Query  218  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  397
            FTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS E
Sbjct  62   FTTYTYIADPANVEHVLKTNFANYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASFE  121

Query  398  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            FASKNLRDFSTVVFRDYSLKL  IL+QA    QQVDMQ+LLMRMTLDSICKVGFGV
Sbjct  122  FASKNLRDFSTVVFRDYSLKLHAILSQA-FEGQQVDMQELLMRMTLDSICKVGFGV  176



>ref|XP_010470937.1| PREDICTED: cytochrome P450 704B1-like [Camelina sativa]
Length=521

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            ++ L +  ++  W+F+H   QR   GP++WP++GA++EQ+TN+ RMHDWLV YL  S +V
Sbjct  2    SMCLVVACMVTSWIFLHIWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYKSRTV  61

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
            VVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62   VVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            TAS EFASKNLRDFSTVVF++YSLKLF IL+QAS  +QQVDMQ+LLMRMTLDSICKVGFG
Sbjct  122  TASFEFASKNLRDFSTVVFKEYSLKLFNILSQASFKDQQVDMQELLMRMTLDSICKVGFG  181

Query  563  V  565
            V
Sbjct  182  V  182



>ref|XP_004138991.1| PREDICTED: cytochrome P450 704C1-like [Cucumis sativus]
 ref|XP_004170943.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 704C1-like [Cucumis 
sativus]
Length=534

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 162/192 (84%), Gaps = 4/192 (2%)
 Frame = +2

Query  2    LKVSSMETLVLAL-GLIMFCWVFI-HRLSQRKG--GGPRSWPVIGASVEQMTNYGRMHDW  169
            L+ S +  LVL +  +I  CW+ I HR +QRK    GP++WP++GA++EQ  NY RMHDW
Sbjct  6    LRRSGVVALVLVMIAIISACWIIIVHRWNQRKKMRRGPKTWPIVGAAIEQFVNYHRMHDW  65

Query  170  LVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFN  349
            ++GYL    +VVVPMPFTTYTYIA P NV+H+LKTNF NYPKG+VYHSYMEVLLGDGIFN
Sbjct  66   ILGYLNLYRTVVVPMPFTTYTYIADPANVQHILKTNFANYPKGDVYHSYMEVLLGDGIFN  125

Query  350  ADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRM  529
             DGELWRKQRKTAS EFASKNLRDFST+VFRDY LKL TILT+ASLLNQQ+DMQ+LLMRM
Sbjct  126  VDGELWRKQRKTASFEFASKNLRDFSTLVFRDYGLKLSTILTRASLLNQQIDMQELLMRM  185

Query  530  TLDSICKVGFGV  565
            TLDSICKVGFGV
Sbjct  186  TLDSICKVGFGV  197



>ref|XP_009758170.1| PREDICTED: cytochrome P450 704B1 [Nicotiana sylvestris]
Length=519

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 153/183 (84%), Gaps = 1/183 (1%)
 Frame = +2

Query  17   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  196
            ME L L + LI+  W+FIH L QR   GP  WP+IGA +EQ  N+ RMHDWLV YLA S 
Sbjct  1    MEILTLFVCLIL-SWIFIHGLRQRNRKGPIHWPIIGAGLEQWVNFDRMHDWLVKYLAQSP  59

Query  197  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  376
            +VVVP   TTYTYIAHPDNVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWRKQ
Sbjct  60   TVVVPTWSTTYTYIAHPDNVEHVLKTNFDNYPKGEVYHSYMEVLLGDGIFNVDGELWRKQ  119

Query  377  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  556
            RKTAS EFASKNLRDF+TVVFRDY+LKLF IL QAS  N++VDMQDLLMRMTLDSICKVG
Sbjct  120  RKTASFEFASKNLRDFNTVVFRDYTLKLFNILIQASFNNKEVDMQDLLMRMTLDSICKVG  179

Query  557  FGV  565
            FGV
Sbjct  180  FGV  182



>ref|XP_003528679.1| PREDICTED: cytochrome P450 704C1-like [Glycine max]
Length=515

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 4/178 (2%)
 Frame = +2

Query  44   LIMFC----WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            +I+ C    W+FIHR SQR   GP++WP  GA++EQ+ NY RMHDWLV YL+ S ++VVP
Sbjct  5    MILICMVVSWMFIHRWSQRNKKGPKTWPFFGAAIEQLMNYDRMHDWLVNYLSKSKTIVVP  64

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGE W+KQRKTAS
Sbjct  65   MPFTTYTYIADPANVEHVLKTNFNNYPKGEVYHSYMEVLLGDGIFNVDGESWKKQRKTAS  124

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            LEFAS+NLRDFST VF++Y+LKL TIL+Q S LNQ++DMQ+LLMRMTLDSICKVGFGV
Sbjct  125  LEFASRNLRDFSTKVFKEYALKLSTILSQVSFLNQEIDMQELLMRMTLDSICKVGFGV  182



>gb|KGN61391.1| hypothetical protein Csa_2G108690 [Cucumis sativus]
Length=556

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 162/192 (84%), Gaps = 4/192 (2%)
 Frame = +2

Query  2    LKVSSMETLVLAL-GLIMFCWVFI-HRLSQRKG--GGPRSWPVIGASVEQMTNYGRMHDW  169
            L+ S +  LVL +  +I  CW+ I HR +QRK    GP++WP++GA++EQ  NY RMHDW
Sbjct  28   LRRSGVVALVLVMIAIISACWIIIVHRWNQRKKMRRGPKTWPIVGAAIEQFVNYHRMHDW  87

Query  170  LVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFN  349
            ++GYL    +VVVPMPFTTYTYIA P NV+H+LKTNF NYPKG+VYHSYMEVLLGDGIFN
Sbjct  88   ILGYLNLYRTVVVPMPFTTYTYIADPANVQHILKTNFANYPKGDVYHSYMEVLLGDGIFN  147

Query  350  ADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRM  529
             DGELWRKQRKTAS EFASKNLRDFST+VFRDY LKL TILT+ASLLNQQ+DMQ+LLMRM
Sbjct  148  VDGELWRKQRKTASFEFASKNLRDFSTLVFRDYGLKLSTILTRASLLNQQIDMQELLMRM  207

Query  530  TLDSICKVGFGV  565
            TLDSICKVGFGV
Sbjct  208  TLDSICKVGFGV  219



>ref|XP_007046038.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
1 [Theobroma cacao]
 gb|EOY01870.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
1 [Theobroma cacao]
Length=535

 Score =   293 bits (749),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            +L L  ++  W+F +R +QR   GP++WP IGAS+EQ  NY RMHDWLV YL+ S +VVV
Sbjct  21   MLMLACMVVSWIFTYRWNQRNRKGPKTWPFIGASIEQFMNYDRMHDWLVKYLSKSKTVVV  80

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
            PMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELW+KQRKTA
Sbjct  81   PMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWKKQRKTA  140

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EFASKNLRDFSTVVFR+YSLKL +IL QAS  N ++DMQDLLMRMTLDSICKVGFGV
Sbjct  141  SFEFASKNLRDFSTVVFREYSLKLHSILNQASFSNLEIDMQDLLMRMTLDSICKVGFGV  199



>ref|XP_007046039.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
2 [Theobroma cacao]
 gb|EOY01871.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
2 [Theobroma cacao]
Length=537

 Score =   293 bits (749),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            +L L  ++  W+F +R +QR   GP++WP IGAS+EQ  NY RMHDWLV YL+ S +VVV
Sbjct  21   MLMLACMVVSWIFTYRWNQRNRKGPKTWPFIGASIEQFMNYDRMHDWLVKYLSKSKTVVV  80

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
            PMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELW+KQRKTA
Sbjct  81   PMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWKKQRKTA  140

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EFASKNLRDFSTVVFR+YSLKL +IL QAS  N ++DMQDLLMRMTLDSICKVGFGV
Sbjct  141  SFEFASKNLRDFSTVVFREYSLKLHSILNQASFSNLEIDMQDLLMRMTLDSICKVGFGV  199



>gb|AJD25236.1| cytochrome P450 CYP704B37 [Salvia miltiorrhiza]
Length=506

 Score =   291 bits (746),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = +2

Query  17   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  196
            M+ LV+++  ++F W+FIHR+ QR   GP++WP +GA+VEQ+ NY  MHDW++ YL  S 
Sbjct  1    MQILVISV-CMLFAWLFIHRVKQRGCKGPKTWPFLGAAVEQLMNYNVMHDWILNYLTASR  59

Query  197  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  376
            +VVVPMPF+TYTYIAHP +VEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWRKQ
Sbjct  60   TVVVPMPFSTYTYIAHPADVEHVLKTNFNNYPKGEVYHSYMEVLLGDGIFNVDGELWRKQ  119

Query  377  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  556
            RKTAS EFASKNLRDFSTVVFR+Y LKL +IL+ AS  NQ VDMQ+LLMRMTLDSICKVG
Sbjct  120  RKTASFEFASKNLRDFSTVVFREYGLKLASILSHASCNNQVVDMQELLMRMTLDSICKVG  179

Query  557  FGV  565
            FGV
Sbjct  180  FGV  182



>ref|XP_003611900.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94858.1| cytochrome P450 family protein [Medicago truncatula]
Length=531

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = +2

Query  5    KVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL  184
            + ++M  LV+ + +I F W+F+HR SQR   GP++WP +GA++EQ+ NY RMHDWLV Y 
Sbjct  12   RYNNMGGLVILICMI-FSWIFLHRWSQRNKKGPKTWPFLGAAIEQLMNYDRMHDWLVQYF  70

Query  185  ANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGEL  364
            + S +VVVPMPFTTYTYIA P NVEHVLKTNF NYPKGEV+HSYMEVLLG GIFN DGEL
Sbjct  71   SMSKTVVVPMPFTTYTYIADPVNVEHVLKTNFSNYPKGEVFHSYMEVLLGHGIFNVDGEL  130

Query  365  WRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSI  544
            W++QRKTASLEFAS+NLRDFST VF++Y+LKL TIL+Q+S LNQQ+DMQ+LLMRMTLDSI
Sbjct  131  WKRQRKTASLEFASRNLRDFSTKVFKEYALKLSTILSQSSFLNQQIDMQELLMRMTLDSI  190

Query  545  CKVGFGV  565
            CKVGFGV
Sbjct  191  CKVGFGV  197



>ref|XP_008221727.1| PREDICTED: cytochrome P450 704B1 [Prunus mume]
Length=534

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = +2

Query  47   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT  226
            ++  W+ +HR SQ+   GP++WP++GA++EQ+ NY RMHDWLV YL+ S SVVVPMPFTT
Sbjct  28   MVLSWIIVHRWSQKNQKGPKTWPLVGAAIEQLMNYDRMHDWLVKYLSESNSVVVPMPFTT  87

Query  227  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  406
            YTYIA P NVEHVLK NF NYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS EFAS
Sbjct  88   YTYIADPANVEHVLKINFANYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASFEFAS  147

Query  407  KNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            KNLRDFSTVVFRDYSLKL  IL+QA    QQVDMQ+LLMRMTLDSICKVGFGV
Sbjct  148  KNLRDFSTVVFRDYSLKLHAILSQA-FEGQQVDMQELLMRMTLDSICKVGFGV  199



>ref|XP_007135410.1| hypothetical protein PHAVU_010G126900g [Phaseolus vulgaris]
 gb|ESW07404.1| hypothetical protein PHAVU_010G126900g [Phaseolus vulgaris]
Length=515

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            ++ L  ++  W+FIHR SQR   GP++WP  GA++EQ+ NY RMHDWLV YL+ S +VVV
Sbjct  4    LVVLICMVVSWMFIHRWSQRDKKGPKTWPFFGAAIEQLMNYDRMHDWLVNYLSMSKTVVV  63

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
            PMPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGE W+KQRKTA
Sbjct  64   PMPFTTYTYIADPANVEHVLKTNFNNYPKGEVYHSYMEVLLGDGIFNVDGEPWKKQRKTA  123

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            SLEFAS+NLR+FST VFR+Y LKL  IL+QAS+LNQ++DMQ+LLMRMTLDSICKVGFGV
Sbjct  124  SLEFASRNLREFSTKVFREYGLKLSAILSQASILNQEIDMQELLMRMTLDSICKVGFGV  182



>ref|XP_010258425.1| PREDICTED: cytochrome P450 704B1 [Nelumbo nucifera]
Length=534

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = +2

Query  47   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT  226
            ++  WVF+HR +QR   GP++WP++GA++EQ+ NY RMHDWLV YL+   +V VPMPFTT
Sbjct  26   MLISWVFVHRWNQRNMKGPKTWPLVGAAIEQLMNYNRMHDWLVEYLSELKTVTVPMPFTT  85

Query  227  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  406
            YTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN+DGELWRKQRKTAS EFAS
Sbjct  86   YTYIADPVNVEHVLKTNFANYPKGEVYHSYMEVLLGDGIFNSDGELWRKQRKTASFEFAS  145

Query  407  KNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            KNLRDFST+VFR+Y+LKL  IL+Q S  NQQVDMQ+LLMRMTLDSICKVGFGV
Sbjct  146  KNLRDFSTIVFREYALKLSYILSQTSAQNQQVDMQELLMRMTLDSICKVGFGV  198



>ref|XP_010044484.1| PREDICTED: cytochrome P450 704B1 [Eucalyptus grandis]
Length=533

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = +2

Query  47   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT  226
            ++  W+ IHR +QR   GP++WP++GA++EQ  NY RMHDWLV YL+   +VVVPMPFTT
Sbjct  25   VIVSWIIIHRWNQRNKNGPKTWPLVGAAIEQFMNYERMHDWLVEYLSKMRTVVVPMPFTT  84

Query  227  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  406
            YTYIA P+NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGE WRKQRKTAS EFAS
Sbjct  85   YTYIADPENVEHVLKTNFANYPKGEVYHSYMEVLLGDGIFNVDGESWRKQRKTASFEFAS  144

Query  407  KNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            KNLRDFSTVVFR+YSLKL +IL+QAS  N++VDMQ+LLMRMTLDSICKVGFGV
Sbjct  145  KNLRDFSTVVFREYSLKLSSILSQASFGNKEVDMQELLMRMTLDSICKVGFGV  197



>ref|XP_003609660.1| Cytochrome P450 [Medicago truncatula]
 gb|AES91857.1| cytochrome P450 family protein [Medicago truncatula]
Length=516

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 158/183 (86%), Gaps = 1/183 (1%)
 Frame = +2

Query  17   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  196
            M  LV+ + +I+  W+F+HR SQR   GP++WP +GA++EQ+ NY RMHDWLV Y + S 
Sbjct  1    MGGLVILICMIV-SWIFLHRWSQRNKKGPKTWPFLGAAIEQLMNYDRMHDWLVQYFSMSK  59

Query  197  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  376
            +VVVPMPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLG GIFN DGELW++Q
Sbjct  60   TVVVPMPFTTYTYIADPVNVEHVLKTNFNNYPKGEVYHSYMEVLLGHGIFNVDGELWKRQ  119

Query  377  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  556
            RKTASLEFAS+NLRDFST VF++Y+LKL TIL+Q+S LNQQ+DMQ+LLMRMTLDSICKVG
Sbjct  120  RKTASLEFASRNLRDFSTKVFKEYALKLSTILSQSSFLNQQIDMQELLMRMTLDSICKVG  179

Query  557  FGV  565
            FGV
Sbjct  180  FGV  182



>ref|XP_002522465.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39957.1| cytochrome P450, putative [Ricinus communis]
Length=536

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = +2

Query  26   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  205
            +VL +  ++  W+FI+R +QR   GP+SWP++GA++EQ+TNY RMHDWLV YL+   +VV
Sbjct  21   MVLMIACLVLSWMFIYRWTQRNKKGPKSWPIVGAAIEQLTNYDRMHDWLVEYLSELRTVV  80

Query  206  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  385
            VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DG+LWRKQRKT
Sbjct  81   VPMPFTTYTYIADPTNVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGDLWRKQRKT  140

Query  386  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            AS EFASKNLRDFST VFR+Y+LKL +IL+ AS  N+++DMQ+L MR+TLDSICKVGFGV
Sbjct  141  ASFEFASKNLRDFSTTVFREYTLKLSSILSHASFHNKEIDMQELFMRLTLDSICKVGFGV  200



>ref|XP_004298418.1| PREDICTED: cytochrome P450 704B1 [Fragaria vesca subsp. vesca]
Length=538

 Score =   290 bits (742),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            L L  ++  W+ IHR SQR   GP++WP++GA++EQ+ NY RMHDWLV YL+ S SVVVP
Sbjct  22   LMLACMVLSWIVIHRWSQRNRKGPKTWPLVGAAIEQLVNYHRMHDWLVKYLSESNSVVVP  81

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFTTYTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFN+DGE WRKQRKTAS
Sbjct  82   MPFTTYTYIADPANVEHVLKTNFANYPKGEVYQSYMQVLLGDGIFNSDGEHWRKQRKTAS  141

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFSTVVFRDYSLKL +IL++AS    QVD+Q+LLMRMTLDSICKVGFGV
Sbjct  142  FEFASKNLRDFSTVVFRDYSLKLHSILSRASFQGLQVDIQELLMRMTLDSICKVGFGV  199



>ref|XP_004510551.1| PREDICTED: cytochrome P450 704C1-like [Cicer arietinum]
Length=533

 Score =   290 bits (741),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 157/184 (85%), Gaps = 1/184 (1%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
            +M  LV+ + +++  W+ IHR SQR   GP++WP +GA++EQ+ NY RMHDWLV Y + S
Sbjct  18   NMGGLVILICMVV-SWILIHRWSQRNKKGPKTWPFLGAAIEQLMNYDRMHDWLVQYFSKS  76

Query  194  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  373
             ++VVPMPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLG GIFN DGELW+K
Sbjct  77   KTIVVPMPFTTYTYIADPVNVEHVLKTNFNNYPKGEVYHSYMEVLLGHGIFNVDGELWKK  136

Query  374  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  553
            QRKTASLEFAS+NLRDFST VF++Y+LKL +IL QAS LNQQ+DMQ+LLMRMTLDSICKV
Sbjct  137  QRKTASLEFASRNLRDFSTKVFKEYALKLSSILCQASFLNQQIDMQELLMRMTLDSICKV  196

Query  554  GFGV  565
            GFGV
Sbjct  197  GFGV  200



>ref|XP_006827309.1| hypothetical protein AMTR_s00010p00266280 [Amborella trichopoda]
 gb|ERM94546.1| hypothetical protein AMTR_s00010p00266280 [Amborella trichopoda]
Length=426

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            +L LAL  +   W+ +HR  QR   GP++WPV+G+++EQ+ NY RMHDWLV YL+   +V
Sbjct  15   SLGLALVCVFLSWILVHRWGQRNSKGPKTWPVVGSAIEQLMNYDRMHDWLVEYLSKERTV  74

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
            VV MPF +YTYIA P NVE+VLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGE W++QRK
Sbjct  75   VVRMPFASYTYIADPVNVEYVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGETWKQQRK  134

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            TAS EFASKNLRDFSTVVFRDY+LKL  IL+QAS    +VD+Q+LLMRMTLDSICKVGFG
Sbjct  135  TASFEFASKNLRDFSTVVFRDYALKLSNILSQASYCGHEVDIQELLMRMTLDSICKVGFG  194

Query  563  V  565
            V
Sbjct  195  V  195



>gb|KHN01450.1| Cytochrome P450 704C1 [Glycine soja]
Length=501

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  62   VFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIA  241
            +FIHR SQR   GP++WP  GA++EQ+ NY RMHDWLV YL+ S ++VVPMPFTTYTYIA
Sbjct  1    MFIHRWSQRNKKGPKTWPFFGAAIEQLMNYDRMHDWLVNYLSKSKTIVVPMPFTTYTYIA  60

Query  242  HPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD  421
             P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGE W+KQRKTASLEFAS+NLRD
Sbjct  61   DPANVEHVLKTNFNNYPKGEVYHSYMEVLLGDGIFNVDGEPWKKQRKTASLEFASRNLRD  120

Query  422  FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            FST VF++Y+LKL TIL+Q S LNQ++DMQ+LLMRMTLDSICKVGFGV
Sbjct  121  FSTKVFKEYALKLSTILSQVSFLNQEIDMQELLMRMTLDSICKVGFGV  168



>ref|XP_009629443.1| PREDICTED: cytochrome P450 704B1 [Nicotiana tomentosiformis]
Length=510

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 154/184 (84%), Gaps = 2/184 (1%)
 Frame = +2

Query  17   METLVLALGLIMFCWVFIHRLSQRKG-GGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
            ME L L + L++  W+FIH L Q+K   GP  WP+IGA +EQ  N+ RMHDWLV YLA S
Sbjct  1    MEILTLFVCLVL-SWIFIHGLRQQKNRKGPIHWPIIGAGLEQWVNFDRMHDWLVKYLAQS  59

Query  194  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  373
             +VVVP   TTYTYIAHPDNVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DG+LWRK
Sbjct  60   PTVVVPTWSTTYTYIAHPDNVEHVLKTNFDNYPKGEVYHSYMEVLLGDGIFNVDGDLWRK  119

Query  374  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  553
            QRKTAS EFASKNLRDF+TVVFRDY+LKLF IL QAS  N++VDMQDLLMRMTLDSICKV
Sbjct  120  QRKTASFEFASKNLRDFNTVVFRDYTLKLFNILIQASFNNKEVDMQDLLMRMTLDSICKV  179

Query  554  GFGV  565
            GFGV
Sbjct  180  GFGV  183



>ref|XP_008441698.1| PREDICTED: cytochrome P450 704B1 [Cucumis melo]
Length=556

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 154/176 (88%), Gaps = 3/176 (2%)
 Frame = +2

Query  47   IMFCWVFI-HRLSQRKG--GGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  217
            I+ CW+ I HR ++RK    GP++WP++GA++EQ  NY RMHDW++GYL    +VVVPMP
Sbjct  43   IVTCWIIIVHRWNERKKMRRGPKTWPIVGAAIEQFVNYHRMHDWILGYLNLYKTVVVPMP  102

Query  218  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  397
            FTTYTYIA P NV+H+LKTNF NYPKG+VYHSYMEVLLGDGIFN DGELWRKQRKTAS E
Sbjct  103  FTTYTYIADPANVQHILKTNFANYPKGDVYHSYMEVLLGDGIFNVDGELWRKQRKTASFE  162

Query  398  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            FASKNLRDFST+VFRDYSLKL TILT+ASLLNQQ+DMQ+LL RMTLDSICKVGFGV
Sbjct  163  FASKNLRDFSTLVFRDYSLKLSTILTRASLLNQQLDMQELLTRMTLDSICKVGFGV  218



>gb|KJB50631.1| hypothetical protein B456_008G180000 [Gossypium raimondii]
Length=534

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +2

Query  38   LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  217
            L  +   W+F++R +QR   GP++WP+IGA  EQ+ NY RMHDWLV YL+ S +VVVPMP
Sbjct  22   LACMFISWIFVYRWNQRNRKGPKTWPLIGAVFEQLINYDRMHDWLVEYLSASKTVVVPMP  81

Query  218  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  397
             TTYTYIA P NVEHVLKT F NYPKGE YHSYMEVLLGDGIFN DGELW+KQRKTAS E
Sbjct  82   CTTYTYIADPANVEHVLKTKFANYPKGETYHSYMEVLLGDGIFNVDGELWKKQRKTASFE  141

Query  398  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            FASKNLRDFSTVVFR+YSL+L +ILTQA   NQ+VDMQDLLMRMTLDSICKVGFGV
Sbjct  142  FASKNLRDFSTVVFREYSLQLHSILTQACFHNQEVDMQDLLMRMTLDSICKVGFGV  197



>gb|EPS61936.1| hypothetical protein M569_12857, partial [Genlisea aurea]
Length=502

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = +2

Query  47   IMFC-WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  223
            I FC W+ IHRL QR    P++WP+IGA++EQ+ NY RMHDWLV YLA S +VVV MPF 
Sbjct  2    IFFCSWILIHRLKQRNSKHPKTWPLIGAAIEQLLNYHRMHDWLVRYLAESSTVVVRMPFA  61

Query  224  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  403
            TYTY+AHP+NVEHVLKTNF NYPKG VYHSYMEVLLGDGIFN DGELWRKQRKTAS EFA
Sbjct  62   TYTYVAHPENVEHVLKTNFSNYPKGRVYHSYMEVLLGDGIFNVDGELWRKQRKTASFEFA  121

Query  404  SKNLRDFSTVVFRDYSLKLFTILTQASLLN-QQVDMQDLLMRMTLDSICKVGFGV  565
            SKNLRDFS+VVFR+YSLKL  IL ++S  + +QVDMQ+LLMRMTLDSICKVGFGV
Sbjct  122  SKNLRDFSSVVFREYSLKLHQILLRSSYEDRKQVDMQELLMRMTLDSICKVGFGV  176



>gb|KDP41226.1| hypothetical protein JCGZ_15633 [Jatropha curcas]
Length=516

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +2

Query  38   LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  217
            +  +    +F+H+  +R   GPR+WP+IGA++EQ  NY RMHDWLV YL+   +VVVPMP
Sbjct  6    IACLALSCIFLHQWRKRNKKGPRTWPIIGAAIEQFMNYDRMHDWLVAYLSELRTVVVPMP  65

Query  218  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  397
            FTTYTYIA P +VEHVLKTNF NYPKGE YHSYMEVLLGDGIFNADGELWR+QRKTAS E
Sbjct  66   FTTYTYIADPASVEHVLKTNFSNYPKGETYHSYMEVLLGDGIFNADGELWRRQRKTASFE  125

Query  398  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            FASKNLRDFST+VFR+YSLKL +IL+ AS  NQ++DMQ+LLMRMTLDSICKVGFGV
Sbjct  126  FASKNLRDFSTIVFREYSLKLSSILSNASFQNQEIDMQELLMRMTLDSICKVGFGV  181



>ref|XP_006651077.1| PREDICTED: cytochrome P450 704C1-like [Oryza brachyantha]
Length=350

 Score =   280 bits (715),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RMHDWLV YL+   +V V
Sbjct  25   LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTV  84

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
             MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM VLLGDGIFNADGE+WRKQRKTA
Sbjct  85   DMPFTSYTYIADPVNVEHVLKTNFTNYPKGEVYRSYMNVLLGDGIFNADGEMWRKQRKTA  144

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EFASKNLRDFSTVVFR+YSLKL +IL QA    + VDMQ+L MRMTLDSICKVGFGV
Sbjct  145  SFEFASKNLRDFSTVVFREYSLKLSSILNQACKAGRVVDMQELFMRMTLDSICKVGFGV  203



>gb|KDO80235.1| hypothetical protein CISIN_1g035880mg [Citrus sinensis]
Length=530

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = +2

Query  29   VLALGLIMFCWVF-IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  205
            +L L   +  W+  IH  SQ+   GP++WP +GA++EQ+ NY RMHDWLV YL+   +VV
Sbjct  15   MLMLACTVLSWILLIHWWSQKNQRGPKTWPFVGAAIEQLMNYDRMHDWLVNYLSELKTVV  74

Query  206  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  385
            VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKT
Sbjct  75   VPMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKT  134

Query  386  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            AS EFASKNLRDFST VFR+YSLKL +ILTQAS  NQ++DMQ+LLMRMTLDSICKVGFGV
Sbjct  135  ASFEFASKNLRDFSTKVFREYSLKLSSILTQASCHNQEIDMQELLMRMTLDSICKVGFGV  194



>ref|XP_006475855.1| PREDICTED: cytochrome P450 704C1-like [Citrus sinensis]
Length=518

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = +2

Query  29   VLALGLIMFCWVF-IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  205
            +L L   +  W+  IH  SQ+   GP++WP +GA++EQ+ NY RMHDWLV YL+   +VV
Sbjct  3    MLMLACTVLSWILLIHWWSQKNQRGPKTWPFVGAAIEQLMNYDRMHDWLVNYLSELKTVV  62

Query  206  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  385
            VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKT
Sbjct  63   VPMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKT  122

Query  386  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            AS EFASKNLRDFST VFR+YSLKL +ILTQAS  NQ++DMQ+LLMRMTLDSICKVGFGV
Sbjct  123  ASFEFASKNLRDFSTKVFREYSLKLSSILTQASCHNQEIDMQELLMRMTLDSICKVGFGV  182



>ref|XP_006366710.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=513

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +2

Query  26   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  205
            L+  L  ++  W FI+   Q+   GP +WP++GA +EQ  N+ RMHDWLV YLA S +VV
Sbjct  3    LLTFLACLVLSWKFINTYRQKNKKGPINWPIVGAGLEQWVNFDRMHDWLVEYLAQSPTVV  62

Query  206  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  385
            VP   TTYTYIAHP NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWRKQRKT
Sbjct  63   VPAMTTTYTYIAHPTNVEHVLKTNFDNYPKGEVYHSYMEVLLGDGIFNVDGELWRKQRKT  122

Query  386  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            AS EFASKNLRDF+TVVFRDYSLKLF IL QAS  N+ VDMQDLLMRMTLDSICKVGFGV
Sbjct  123  ASFEFASKNLRDFNTVVFRDYSLKLFNILNQASFKNEHVDMQDLLMRMTLDSICKVGFGV  182



>ref|XP_004228374.1| PREDICTED: cytochrome P450 704B1 [Solanum lycopersicum]
Length=513

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +2

Query  56   CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTY  235
             W FI+   Q+   GP +WP++GA +EQ  N+ RMHDWLV YLA S +VVVP   TTYTY
Sbjct  13   SWKFINTYRQKNKKGPINWPIVGAGLEQWVNFDRMHDWLVEYLAQSPTVVVPAMTTTYTY  72

Query  236  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  415
            IAHP NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWRKQRKTAS EFASKNL
Sbjct  73   IAHPTNVEHVLKTNFDNYPKGEVYHSYMEVLLGDGIFNVDGELWRKQRKTASFEFASKNL  132

Query  416  RDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            RDF+TVVFRDYSLKLF IL QASL N+ VDMQDLLMRMTLDSICKVGFGV
Sbjct  133  RDFNTVVFRDYSLKLFNILNQASLKNEHVDMQDLLMRMTLDSICKVGFGV  182



>emb|CDP00359.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 156/185 (84%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   METLV-LALGLIMFCWVFIHRLSQRK-GGGPRSWPVIGASVEQMTNYGRMHDWLVGYLAN  190
            ME L+ +A  +I+  WV IHRL QR   G P++WP++GA++EQ+ NY +MHDW++ YLA 
Sbjct  1    MEILIFVACMVILVSWVLIHRLKQRNVKGCPKTWPLVGAAIEQLLNYDQMHDWILKYLAR  60

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
            S +VVVPMPFTTYTYIA P NVEHVLKTNF NYPKG+ YHSYMEVLLG+GIFN DGELWR
Sbjct  61   SRTVVVPMPFTTYTYIADPTNVEHVLKTNFGNYPKGDTYHSYMEVLLGNGIFNVDGELWR  120

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            KQRKTAS EFAS+NLRDFSTVVFR+YSLKL  IL++AS   Q++DMQ+LLMRMTLDSICK
Sbjct  121  KQRKTASFEFASRNLRDFSTVVFREYSLKLSEILSKASHQKQEIDMQELLMRMTLDSICK  180

Query  551  VGFGV  565
            VGFG 
Sbjct  181  VGFGA  185



>ref|XP_006450915.1| hypothetical protein CICLE_v10010274mg [Citrus clementina]
 gb|ESR64155.1| hypothetical protein CICLE_v10010274mg [Citrus clementina]
Length=514

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = +2

Query  38   LGLIMFCWVF-IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM  214
            +   +  W+  IH  SQ+   GP++WP +GA++EQ+ NY RMHDWLV YL+   +VVVPM
Sbjct  2    VACTVLSWILLIHWWSQKNQRGPKTWPFVGAAIEQLMNYDRMHDWLVNYLSELKTVVVPM  61

Query  215  PFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASL  394
            PFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKTAS 
Sbjct  62   PFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKTASF  121

Query  395  EFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            EFASKNLRDFST VFR+YSLKL +ILTQAS  NQ++DMQ+LLMRMTLDSICKVGFGV
Sbjct  122  EFASKNLRDFSTKVFREYSLKLSSILTQASCHNQEIDMQELLMRMTLDSICKVGFGV  178



>gb|EAZ25728.1| hypothetical protein OsJ_09563 [Oryza sativa Japonica Group]
Length=521

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RMHDWLV YL+   +V V
Sbjct  21   LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTV  80

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
             MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGE+WRKQRKTA
Sbjct  81   DMPFTSYTYIADPVNVEHVLKTNFTNYPKGEVYRSYMDVLLGDGIFNADGEMWRKQRKTA  140

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EFASKNLRDFSTVVFR+YSLKL +IL+QA    + VDMQ+L MRMTLDSICKVGFGV
Sbjct  141  SFEFASKNLRDFSTVVFREYSLKLSSILSQACKAGRVVDMQELFMRMTLDSICKVGFGV  199



>gb|EAY88702.1| hypothetical protein OsI_10177 [Oryza sativa Indica Group]
Length=540

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RMHDWLV YL+   +V V
Sbjct  21   LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTV  80

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
             MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGE+WRKQRKTA
Sbjct  81   DMPFTSYTYIADPVNVEHVLKTNFTNYPKGEVYRSYMDVLLGDGIFNADGEMWRKQRKTA  140

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EFASKNLRDFSTVVFR+YSLKL +IL+QA    + VDMQ+L MRMTLDSICKVGFGV
Sbjct  141  SFEFASKNLRDFSTVVFREYSLKLSSILSQACKAGRVVDMQELFMRMTLDSICKVGFGV  199



>gb|AAL84318.1|AC073556_35 putative plant cytochrome P-450 protein [Oryza sativa Japonica 
Group]
 gb|ABF94184.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
Length=544

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RMHDWLV YL+   +V V
Sbjct  25   LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTV  84

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
             MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGE+WRKQRKTA
Sbjct  85   DMPFTSYTYIADPVNVEHVLKTNFTNYPKGEVYRSYMDVLLGDGIFNADGEMWRKQRKTA  144

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EFASKNLRDFSTVVFR+YSLKL +IL+QA    + VDMQ+L MRMTLDSICKVGFGV
Sbjct  145  SFEFASKNLRDFSTVVFREYSLKLSSILSQACKAGRVVDMQELFMRMTLDSICKVGFGV  203



>gb|ACD10924.1| cytochrome P450 [Capsicum annuum]
Length=513

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +2

Query  56   CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTY  235
             W FI    Q+   GP +WP+IGA +EQ  N+ RMHDWLV YL+ S +VVVP   TTYTY
Sbjct  13   SWTFIKTFRQKIKKGPINWPIIGAGLEQWVNFDRMHDWLVEYLSQSPTVVVPSMTTTYTY  72

Query  236  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  415
            IAHP NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWRKQRKTAS EFASKNL
Sbjct  73   IAHPTNVEHVLKTNFYNYPKGEVYHSYMEVLLGDGIFNVDGELWRKQRKTASFEFASKNL  132

Query  416  RDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            RDF+T+VFRDYSLKLF IL QAS  ++QVDMQDLLMRMTLDSICKVGFGV
Sbjct  133  RDFNTIVFRDYSLKLFKILNQASFKSEQVDMQDLLMRMTLDSICKVGFGV  182



>ref|XP_004985563.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Setaria italica]
Length=542

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            +A+ L++  W+ +H+ S RK  GPRSWPVIGA+VEQ+ NY RMHDWLV YL+   SV V 
Sbjct  22   IAIFLVLLSWILVHKWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVEYLSKHRSVTVD  81

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFT+YTYIA P NVEHVLKTNF NYPKG+VY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  82   MPFTSYTYIADPVNVEHVLKTNFTNYPKGDVYRSYMDVLLGDGIFNADGELWRKQRKTAS  141

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFS +VFR+YSLKL  IL QAS   + VDMQ+L MRMTLDSICKVGFGV
Sbjct  142  FEFASKNLRDFSAIVFREYSLKLSGILRQASKAGKVVDMQELYMRMTLDSICKVGFGV  199



>ref|XP_004985564.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Setaria italica]
Length=541

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            +A+ L++  W+ +H+ S RK  GPRSWPVIGA+VEQ+ NY RMHDWLV YL+   SV V 
Sbjct  22   IAIFLVLLSWILVHKWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVEYLSKHRSVTVD  81

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFT+YTYIA P NVEHVLKTNF NYPKG+VY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  82   MPFTSYTYIADPVNVEHVLKTNFTNYPKGDVYRSYMDVLLGDGIFNADGELWRKQRKTAS  141

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFS +VFR+YSLKL  IL QAS   + VDMQ+L MRMTLDSICKVGFGV
Sbjct  142  FEFASKNLRDFSAIVFREYSLKLSGILRQASKAGKVVDMQELYMRMTLDSICKVGFGV  199



>gb|ACG35470.1| cytochrome P450 CYP704B12v2 [Zea mays]
Length=542

 Score =   278 bits (711),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            +AL L++  W+ + R S RK  GPRSWPVIGA+VEQ+ NY RMHDWLVGYL+   +V V 
Sbjct  24   IALLLVVLSWILVQRWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVGYLSRHRTVTVD  83

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFT+YTYIA P NVEHVLKTNF NYPKG VY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  84   MPFTSYTYIADPVNVEHVLKTNFTNYPKGIVYRSYMDVLLGDGIFNADGELWRKQRKTAS  143

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFS +VFR+YSLKL  IL+QAS   + VDMQ+L MRMTLDSICKVGFGV
Sbjct  144  FEFASKNLRDFSAIVFREYSLKLSGILSQASKAGKVVDMQELYMRMTLDSICKVGFGV  201



>ref|NP_001130648.1| male sterile26 [Zea mays]
 gb|AAK52956.1|AF366297_1 cytochrome P450-like protein [Zea mays]
 gb|ACN29205.1| unknown [Zea mays]
 tpg|DAA43588.1| TPA: male sterile26 [Zea mays]
Length=543

 Score =   278 bits (711),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            +AL L++  W+ + R S RK  GPRSWPVIGA+VEQ+ NY RMHDWLVGYL+   +V V 
Sbjct  24   IALLLVVLSWILVQRWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVGYLSRHRTVTVD  83

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFT+YTYIA P NVEHVLKTNF NYPKG VY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  84   MPFTSYTYIADPVNVEHVLKTNFTNYPKGIVYRSYMDVLLGDGIFNADGELWRKQRKTAS  143

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFS +VFR+YSLKL  IL+QAS   + VDMQ+L MRMTLDSICKVGFGV
Sbjct  144  FEFASKNLRDFSAIVFREYSLKLSGILSQASKAGKVVDMQELYMRMTLDSICKVGFGV  201



>ref|XP_002465796.1| hypothetical protein SORBIDRAFT_01g045960 [Sorghum bicolor]
 gb|EER92794.1| hypothetical protein SORBIDRAFT_01g045960 [Sorghum bicolor]
Length=538

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            +A+ L++  W  +HR S RK  GPRSWPVIGA++EQ+ NY RMHDWLVGYL+   +V V 
Sbjct  22   IAILLVVLSWALVHRWSLRKQKGPRSWPVIGATLEQLRNYHRMHDWLVGYLSRHKTVTVD  81

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFT+YTYIA P NVEHVLKTNF NYPKG+VY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  82   MPFTSYTYIADPVNVEHVLKTNFTNYPKGDVYRSYMDVLLGDGIFNADGELWRKQRKTAS  141

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFS  VFR+YSLKL  IL+QAS   + VDMQ+L MRMTLDSICKVGFGV
Sbjct  142  FEFASKNLRDFSANVFREYSLKLSGILSQASKAGKVVDMQELYMRMTLDSICKVGFGV  199



>dbj|BAK08270.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            +A+ L+   W+ +HR S RK  GPRSWPVIGA++EQ+ NY RMHDWLV YL+   +V V 
Sbjct  27   MAIFLVFLSWILVHRWSLRKQKGPRSWPVIGATLEQLRNYYRMHDWLVEYLSKYRTVTVD  86

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  87   MPFTSYTYIADPVNVEHVLKTNFNNYPKGEVYRSYMDVLLGDGIFNADGELWRKQRKTAS  146

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFST+VFR+YSLKL +IL+ A    + VDMQ+L MRMTLDSICKVGFGV
Sbjct  147  FEFASKNLRDFSTIVFREYSLKLSSILSPACKAGKVVDMQELYMRMTLDSICKVGFGV  204



>ref|XP_008778343.1| PREDICTED: cytochrome P450 704B1 [Phoenix dactylifera]
Length=513

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = +2

Query  44   LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  223
            +++  W+ IHR SQR   GP++WP+IGA++EQ+ NY RMHDWL  YL+ S ++ V MPF 
Sbjct  1    MVVLSWILIHRWSQRNHKGPKTWPIIGAAIEQLRNYDRMHDWLAEYLSVSKTITVSMPFR  60

Query  224  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  403
            ++TYIA P NVEHVLKTNF NYPKGE+Y SYM+VLLGDGIFNADG++WRKQRKTASLEFA
Sbjct  61   SFTYIADPANVEHVLKTNFDNYPKGELYRSYMDVLLGDGIFNADGDMWRKQRKTASLEFA  120

Query  404  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            SKNLRDFST VFR+Y+LKL  IL Q S+ NQ +DMQDL MRMTLDSICKVGFGV
Sbjct  121  SKNLRDFSTKVFREYALKLSNILCQLSINNQDMDMQDLFMRMTLDSICKVGFGV  174



>ref|XP_003558727.1| PREDICTED: cytochrome P450 704B1 [Brachypodium distachyon]
Length=557

 Score =   275 bits (703),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            +A+ +I+  W+ +HR S R   GP+SWPVIGA++EQ+ NY RMHDWLV YL+   +V V 
Sbjct  26   VAIFVIVLSWILVHRWSLRNQKGPKSWPVIGATLEQLRNYYRMHDWLVEYLSKYRTVTVD  85

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  86   MPFTSYTYIADPVNVEHVLKTNFNNYPKGEVYRSYMDVLLGDGIFNADGELWRKQRKTAS  145

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFST+VFR+YSLKL +IL+QA    + VDMQ+L MRMTLDSICKVGFGV
Sbjct  146  FEFASKNLRDFSTIVFREYSLKLSSILSQACKTGKVVDMQELFMRMTLDSICKVGFGV  203



>gb|EMT08626.1| Cytochrome P450 704C1 [Aegilops tauschii]
Length=632

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            +A+ L+   W+ +H  S RK  GPRSWPVIGA++EQ+ NY RMHDWLV YL+   +V V 
Sbjct  24   MAIFLVFLSWILVHWWSLRKQKGPRSWPVIGATLEQLRNYYRMHDWLVEYLSKHRTVTVD  83

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  84   MPFTSYTYIADPVNVEHVLKTNFNNYPKGEVYRSYMDVLLGDGIFNADGELWRKQRKTAS  143

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EFASKNLRDFST+VFR+YSLKL +IL+QA    + VDMQ+L MRMTLDSICKVGFGV
Sbjct  144  FEFASKNLRDFSTIVFREYSLKLSSILSQACKAGKVVDMQELYMRMTLDSICKVGFGV  201



>gb|EMS55452.1| Cytochrome P450 86B1 [Triticum urartu]
Length=465

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 148/185 (80%), Gaps = 7/185 (4%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            +A+ L+   W+ +H  S RK  GPRSWPVIGA++EQ+ NY RMHDWLV YL+   +V V 
Sbjct  25   MAIFLVFLSWILVHWWSLRKQKGPRSWPVIGATLEQLRNYYRMHDWLVEYLSKHRTVTVD  84

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
            MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  85   MPFTSYTYIADPVNVEHVLKTNFNNYPKGEVYRSYMDVLLGDGIFNADGELWRKQRKTAS  144

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQ-------DLLMRMTLDSICK  550
             EFASKNLRDFST+VFR+YSLKL +IL+QA    + VDMQ       +L MRMTLDSICK
Sbjct  145  FEFASKNLRDFSTIVFREYSLKLSSILSQACKAGKVVDMQATELIPLELYMRMTLDSICK  204

Query  551  VGFGV  565
            VGFGV
Sbjct  205  VGFGV  209



>gb|ADG34845.1| cytochrome P450 protein [Vanda hybrid cultivar]
Length=538

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = +2

Query  26   LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  205
            L+    + +  W+F+HR +QR   GP++WP+IGA++E + NY RMHDW+  YL+   +V 
Sbjct  14   LIAFSAIFLISWIFLHRWAQRNRRGPKTWPLIGAAIELLNNYERMHDWITDYLSEWRTVT  73

Query  206  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  385
            VP+PFT+YTY A P NVEH+LKTNF NYPKGE++ SYMEVLLGDGIFNADGELWRKQRKT
Sbjct  74   VPLPFTSYTYTADPANVEHILKTNFNNYPKGELFRSYMEVLLGDGIFNADGELWRKQRKT  133

Query  386  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLN--QQVDMQDLLMRMTLDSICKVGF  559
            AS EFASKNLR+ STVVFR+Y+LKL  IL QAS  +  Q VD+QDL MRMT+DSICK+GF
Sbjct  134  ASFEFASKNLRELSTVVFREYALKLSDILCQASCKDHHQAVDIQDLFMRMTMDSICKLGF  193

Query  560  GV  565
            GV
Sbjct  194  GV  195



>ref|XP_009413465.1| PREDICTED: cytochrome P450 704B1 [Musa acuminata subsp. malaccensis]
Length=519

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +2

Query  38   LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  217
            L L +  WVFIHR  QR    P++WPVIG+++EQ+ NY RMHDWL GYL+ S +V V +P
Sbjct  15   LALFLLSWVFIHRWKQRHQRCPKTWPVIGSTIEQLKNYDRMHDWLAGYLSESKTVTVSLP  74

Query  218  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  397
            F +YTYIA P +VEHVLKTNF NYPKGE Y SYM+VLLGDGIFNADGELWR QRKTASLE
Sbjct  75   FKSYTYIADPASVEHVLKTNFANYPKGEAYRSYMDVLLGDGIFNADGELWRAQRKTASLE  134

Query  398  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            FASKNLRD ST VFR+++LKL  IL Q   +++ VDMQDL MRMTLDSI KVGFGV
Sbjct  135  FASKNLRDLSTRVFREHALKLSRILCQVP-VDRDVDMQDLFMRMTLDSIAKVGFGV  189



>ref|NP_001049092.2| Os03g0168600 [Oryza sativa Japonica Group]
 dbj|BAF11006.2| Os03g0168600 [Oryza sativa Japonica Group]
Length=188

 Score =   245 bits (626),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RMHDWLV YL+   +V V
Sbjct  25   LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTV  84

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
             MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGE+WRKQRKTA
Sbjct  85   DMPFTSYTYIADPVNVEHVLKTNFTNYPKGEVYRSYMDVLLGDGIFNADGEMWRKQRKTA  144

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQ  511
            S EFASKNLRDFSTVVFR+YSLKL +IL+QA    + VDMQ
Sbjct  145  SFEFASKNLRDFSTVVFREYSLKLSSILSQACKAGRVVDMQ  185



>dbj|BAC43393.1| unknown protein [Arabidopsis thaliana]
 gb|ABE65757.1| cytochrome P450 family protein [Arabidopsis thaliana]
Length=478

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  158  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
            MHDWLV YL NS +VVVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGD
Sbjct  1    MHDWLVEYLYNSRTVVVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGD  60

Query  338  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  517
            GIFN+DGELWRKQRKTAS EFASKNLRDFSTVVF++YSLKLFTIL+QAS   QQVDMQ+L
Sbjct  61   GIFNSDGELWRKQRKTASFEFASKNLRDFSTVVFKEYSLKLFTILSQASFKEQQVDMQEL  120

Query  518  LMRMTLDSICKVGFGV  565
            LMRMTLDSICKVGFGV
Sbjct  121  LMRMTLDSICKVGFGV  136



>gb|ABK28457.1| unknown [Arabidopsis thaliana]
Length=479

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  158  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
            MHDWLV YL NS +VVVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGD
Sbjct  1    MHDWLVEYLYNSRTVVVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGD  60

Query  338  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  517
            GIFN+DGELWRKQRKTAS EFASKNLRDFSTVVF++YSLKLFTIL+QAS   QQVDMQ+L
Sbjct  61   GIFNSDGELWRKQRKTASFEFASKNLRDFSTVVFKEYSLKLFTILSQASFKEQQVDMQEL  120

Query  518  LMRMTLDSICKVGFGV  565
            LMRMTLDSICKVGFGV
Sbjct  121  LMRMTLDSICKVGFGV  136



>emb|CBI31936.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  158  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
            MHDWLV YL+ S +V VPMPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGD
Sbjct  1    MHDWLVKYLSKSRTVAVPMPFTTYTYIADPANVEHVLKTNFANYPKGEVYHSYMEVLLGD  60

Query  338  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  517
            GIFN DGELWR+QRKTAS EFASKNLRDFST+VFR+YSLKL  IL++AS  N++VDMQDL
Sbjct  61   GIFNVDGELWRRQRKTASFEFASKNLRDFSTIVFREYSLKLSAILSEASFHNREVDMQDL  120

Query  518  LMRMTLDSICKVGFGV  565
            LMRMTLDSICKVGFGV
Sbjct  121  LMRMTLDSICKVGFGV  136



>gb|KCW86574.1| hypothetical protein EUGRSUZ_B03209 [Eucalyptus grandis]
Length=472

 Score =   244 bits (622),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  158  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
            MHDWLV YL+   +VVVPMPFTTYTYIA P+NVEHVLKTNF NYPKGEVYHSYMEVLLGD
Sbjct  1    MHDWLVEYLSKMRTVVVPMPFTTYTYIADPENVEHVLKTNFANYPKGEVYHSYMEVLLGD  60

Query  338  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  517
            GIFN DGE WRKQRKTAS EFASKNLRDFSTVVFR+YSLKL +IL+QAS  N++VDMQ+L
Sbjct  61   GIFNVDGESWRKQRKTASFEFASKNLRDFSTVVFREYSLKLSSILSQASFGNKEVDMQEL  120

Query  518  LMRMTLDSICKVGFGV  565
            LMRMTLDSICKVGFGV
Sbjct  121  LMRMTLDSICKVGFGV  136



>ref|XP_010917078.1| PREDICTED: cytochrome P450 704B1 [Elaeis guineensis]
Length=479

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +2

Query  158  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
            MHDWL  YL+ S ++ V MPFT++TYIA P NVEHVLKTNF NYPKGE+Y SYM+VLLGD
Sbjct  1    MHDWLAEYLSVSKTITVSMPFTSFTYIADPANVEHVLKTNFNNYPKGELYRSYMDVLLGD  60

Query  338  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  517
            GIFNADG++WRKQRKTAS EFASKNLRDFST VFR+Y+LKL  IL Q+S+ NQ +D+QDL
Sbjct  61   GIFNADGDMWRKQRKTASFEFASKNLRDFSTKVFREYALKLSNILCQSSINNQDMDVQDL  120

Query  518  LMRMTLDSICKVGFGV  565
             MRMTLDSICKVGFGV
Sbjct  121  FMRMTLDSICKVGFGV  136



>ref|XP_001764611.1| predicted protein [Physcomitrella patens]
 gb|EDQ70593.1| predicted protein [Physcomitrella patens]
Length=516

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 129/185 (70%), Gaps = 1/185 (1%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
            S E+ V  + +    W++I R  QR    P+ WPVIGA+VE + N+  +HDW++ Y    
Sbjct  10   STESAVTFVIIATLSWLWIFRWQQRHRLAPKEWPVIGAAVETIRNFDDLHDWVLSYFQKG  69

Query  194  YSVV-VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
                 V  P T YTY   P N+E++LKTNF N+PKG++YH  ME LLGDGIFNADGE+WR
Sbjct  70   IKTFRVKFPGTMYTYTVDPKNIEYILKTNFANFPKGDLYHKNMETLLGDGIFNADGEVWR  129

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            +QRKTAS EFAS+ LRD+STV+FR+ +LK+  I+  AS  +  VDMQDL MR+TL+ ICK
Sbjct  130  QQRKTASFEFASRVLRDYSTVIFRENALKVGDIVVGASQTHNAVDMQDLFMRLTLEGICK  189

Query  551  VGFGV  565
            VGFGV
Sbjct  190  VGFGV  194



>ref|XP_002978645.1| hypothetical protein SELMODRAFT_418431 [Selaginella moellendorffii]
 ref|XP_002984583.1| hypothetical protein SELMODRAFT_423745 [Selaginella moellendorffii]
 gb|EFJ14228.1| hypothetical protein SELMODRAFT_423745 [Selaginella moellendorffii]
 gb|EFJ20092.1| hypothetical protein SELMODRAFT_418431 [Selaginella moellendorffii]
Length=520

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 125/185 (68%), Gaps = 0/185 (0%)
 Frame = +2

Query  11   SSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLAN  190
            S   + ++++ L++  WVF+HRL QR   GP++WP++G  VEQ  N+ ++HDWL+GY   
Sbjct  7    SGSASWMISIALLLAWWVFLHRLRQRHLAGPKTWPLLGCIVEQARNFDKLHDWLLGYFNK  66

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
            + +  VPM     T+ A+P NVE++LKTNF N+PKG+      E L+G GIF  DGE W 
Sbjct  67   TLTFSVPMATINNTFTANPANVEYILKTNFNNFPKGDKLCGRFEDLMGQGIFTVDGERWI  126

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
             QRK A+ EFAS  LRD+S   FRD +L+L  +L  AS   +QVD+QDL MR+TLDSIC 
Sbjct  127  HQRKVATAEFASSKLRDYSIHTFRDKALRLVKVLDSASRSGKQVDLQDLFMRLTLDSICT  186

Query  551  VGFGV  565
            VGFGV
Sbjct  187  VGFGV  191



>ref|XP_002979701.1| hypothetical protein SELMODRAFT_111270 [Selaginella moellendorffii]
 gb|EFJ19103.1| hypothetical protein SELMODRAFT_111270 [Selaginella moellendorffii]
Length=545

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 122/181 (67%), Gaps = 0/181 (0%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            T ++   LI+  W+F+HR  QR   GP+SWP++G   EQ+ N+ R+H WL+ Y   +++ 
Sbjct  33   TWIITWALILAWWIFLHRFRQRGLRGPKSWPLVGCLFEQIANFDRLHHWLLDYHHKTWTF  92

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
              P+     T+ AHP NVE++LKTNF NYPKGE+       ++G GIFN DGE+W  QRK
Sbjct  93   SAPVLGVNNTFTAHPANVEYILKTNFVNYPKGELLRQRFRDMMGYGIFNVDGEMWMHQRK  152

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
             A++EFAS  LRD+ST  FRD +LKL  IL   S   Q +D+QDL +R+TLDSICK+GFG
Sbjct  153  VATVEFASSKLRDYSTFAFRDLTLKLAGILADRSGTGQALDLQDLFLRLTLDSICKIGFG  212

Query  563  V  565
            V
Sbjct  213  V  213



>ref|XP_002988354.1| hypothetical protein SELMODRAFT_127881 [Selaginella moellendorffii]
 gb|EFJ10444.1| hypothetical protein SELMODRAFT_127881 [Selaginella moellendorffii]
Length=546

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 121/181 (67%), Gaps = 0/181 (0%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            T ++   LI+  W+F+HR  Q    GP+SWP++G   EQ+ N+ R+H WL+ Y   +++ 
Sbjct  34   TWIITWALILAWWIFLHRFRQGGLRGPKSWPLVGCLFEQIANFDRLHHWLLDYHHKTWTF  93

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
              P+     T+ AHP NVE++LKTNF NYPKGE+       ++G GIFN DGE+W  QRK
Sbjct  94   SAPVLGVNNTFTAHPANVEYILKTNFVNYPKGELLRQRFRDMMGYGIFNVDGEMWMHQRK  153

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
             A++EFAS  LRD+ST  FRD +LKL  IL   S   Q +D+QDL +R+TLDSICK+GFG
Sbjct  154  VATVEFASSKLRDYSTFAFRDLTLKLAGILADRSGTGQALDLQDLFLRLTLDSICKIGFG  213

Query  563  V  565
            V
Sbjct  214  V  214



>ref|XP_001764503.1| predicted protein [Physcomitrella patens]
 gb|EDQ70770.1| predicted protein [Physcomitrella patens]
Length=513

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 123/178 (69%), Gaps = 4/178 (2%)
 Frame = +2

Query  38   LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV-VPM  214
            +  + + W+F  R  QR    P+ WP+IG ++E + ++  MHDW++ Y         V  
Sbjct  16   IATLSYLWIF--RWRQRHRIEPKEWPIIGGALETIQHFDVMHDWILSYFNKGLKTFHVKY  73

Query  215  PFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASL  394
            P  TYTY   P+N+E++LKTNF N+PKGE+YH +ME LLGDGIFN+DGE WR+QRKTAS 
Sbjct  74   PGITYTYTIDPNNIEYILKTNFANFPKGELYHRHMETLLGDGIFNSDGEAWRQQRKTASF  133

Query  395  EFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDM-QDLLMRMTLDSICKVGFGV  565
            EF S+ LRD+STVVFR+ +LK+  IL+     +Q +DM QDL MR TL+ ICKVGFGV
Sbjct  134  EFTSRVLRDYSTVVFRENALKVGDILSSVCQKHQPIDMQQDLFMRFTLEGICKVGFGV  191



>ref|XP_001768338.1| predicted protein [Physcomitrella patens]
 gb|EDQ66952.1| predicted protein [Physcomitrella patens]
Length=518

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 118/168 (70%), Gaps = 6/168 (4%)
 Frame = +2

Query  59   WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY-LANSYSVVVPMPFTTYTY  235
            WV +HR  +RKG  P  WP++G ++E + NY  ++DW+V Y L +  +    M     T+
Sbjct  27   WV-LHR--ERKG--PVQWPILGVTLEALKNYQTLNDWVVYYFLRDGLTFSCKMMHLDLTF  81

Query  236  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  415
             A P NV+H+LKTNF NY KG+ +H   E+ LGDGIFN DGE+WR QRKTAS EFAS+ L
Sbjct  82   TADPVNVKHILKTNFANYDKGKFFHENFEIFLGDGIFNVDGEIWRTQRKTASFEFASRKL  141

Query  416  RDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGF  559
            RDFSTVVFRDYS+KL +IL +A+   Q +DMQDL MR TLDSI KV F
Sbjct  142  RDFSTVVFRDYSVKLASILARAATAQQSMDMQDLFMRFTLDSIFKVTF  189



>ref|XP_002963764.1| hypothetical protein SELMODRAFT_80659 [Selaginella moellendorffii]
 gb|EFJ35635.1| hypothetical protein SELMODRAFT_80659 [Selaginella moellendorffii]
Length=469

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 104/142 (73%), Gaps = 6/142 (4%)
 Frame = +2

Query  158  MHDWLVGY------LANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYM  319
            MHD+L+        L NS +   PMP   Y Y   PD VEH+LK NF NYPKG+ +H  M
Sbjct  1    MHDFLLEKFLRNETLYNSKTFRAPMPTFDYYYTVDPDVVEHILKNNFANYPKGDKFHDIM  60

Query  320  EVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQ  499
            EVLLGDGIFN+DGE+W++QRKTAS EFASK LRDFSTVVFRDY++KL  I++  +   Q 
Sbjct  61   EVLLGDGIFNSDGEVWKRQRKTASFEFASKILRDFSTVVFRDYAVKLADIVSGCTSRGQS  120

Query  500  VDMQDLLMRMTLDSICKVGFGV  565
             DMQDL MRMTLDSICK+GFGV
Sbjct  121  FDMQDLFMRMTLDSICKLGFGV  142



>ref|XP_002974848.1| hypothetical protein SELMODRAFT_101765 [Selaginella moellendorffii]
 gb|EFJ24368.1| hypothetical protein SELMODRAFT_101765 [Selaginella moellendorffii]
Length=469

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 104/142 (73%), Gaps = 6/142 (4%)
 Frame = +2

Query  158  MHDWLVGY------LANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYM  319
            MHD+L+        L NS +   PMP   Y Y   PD VEH+LK NF NYPKG+ +H  M
Sbjct  1    MHDFLLEKFLRNEKLYNSKTFRAPMPTFDYYYTVDPDVVEHILKNNFANYPKGDKFHDIM  60

Query  320  EVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQ  499
            EVLLGDGIFN+DGE+W++QRKTAS EFASK LRDFSTVVFRDY++KL  I++  +   Q 
Sbjct  61   EVLLGDGIFNSDGEVWKRQRKTASFEFASKILRDFSTVVFRDYAVKLADIVSGCTSRGQS  120

Query  500  VDMQDLLMRMTLDSICKVGFGV  565
             DMQDL MRMTLDSICK+GFGV
Sbjct  121  FDMQDLFMRMTLDSICKLGFGV  142



>ref|XP_002982626.1| hypothetical protein SELMODRAFT_116539 [Selaginella moellendorffii]
 gb|EFJ16379.1| hypothetical protein SELMODRAFT_116539 [Selaginella moellendorffii]
Length=501

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 113/171 (66%), Gaps = 11/171 (6%)
 Frame = +2

Query  59   WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVG--YLANSYSVVVPMPFTTYT  232
            W  IHR+ Q    G ++WP+IG ++E   NY R++DWL     +  + ++   MP  +Y 
Sbjct  17   WCAIHRIRQIGTPGFKTWPLIGVTLEVAANYHRIYDWLSWNFRVKETMTMSATMPGRSYV  76

Query  233  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  412
            +   P NVEH+LKTNF NYPKGE +H   E LLG+GIFN+DGE WR QRKTAS EF+S+ 
Sbjct  77   FTVDPANVEHILKTNFANYPKGEEFHEIFEPLLGNGIFNSDGEPWRIQRKTASFEFSSRV  136

Query  413  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            LRD S  VF+D++LKL  I         ++ +QDL MRMTLD+IC +GFG+
Sbjct  137  LRDVSCRVFKDHALKLARI---------KIYLQDLFMRMTLDTICFLGFGL  178



>ref|XP_002981144.1| hypothetical protein SELMODRAFT_113735 [Selaginella moellendorffii]
 gb|EFJ17845.1| hypothetical protein SELMODRAFT_113735 [Selaginella moellendorffii]
Length=501

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 111/171 (65%), Gaps = 11/171 (6%)
 Frame = +2

Query  59   WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVG--YLANSYSVVVPMPFTTYT  232
            W  IHR+ Q    G ++WP+IG ++E   NY R++DWL     +  + ++   MP   Y 
Sbjct  17   WCAIHRIRQIGTPGFKTWPLIGVTLEVAANYHRIYDWLSWNFRVKETMTMSATMPGRCYV  76

Query  233  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  412
            +   P NVEH+LKTNF NYPKGE +H   E LLG+GIFN+DGE WR QRKTAS EF+S+ 
Sbjct  77   FTVDPANVEHILKTNFANYPKGEEFHEIFEPLLGNGIFNSDGEPWRIQRKTASFEFSSRV  136

Query  413  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            LRD S  VF+D++LKL  I         Q  +QDL MRMTLD+IC +GFG+
Sbjct  137  LRDVSCRVFKDHALKLARI---------QFYLQDLFMRMTLDTICFLGFGL  178



>gb|ACN41008.1| unknown [Picea sitchensis]
Length=543

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 112/179 (63%), Gaps = 3/179 (2%)
 Frame = +2

Query  38   LGLIMFCWVFIHRLSQRK--GGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            LG+ ++ WV+I R         GP+SWP++G+++E   N  R++DWL  Y  N  +    
Sbjct  39   LGISIWTWVWICRRRDNHIITAGPKSWPLLGSTLELTANLHRLYDWLTDYAMNFPTFEAK  98

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
                   +   P NVE++LKTNF NY KG   H     LLGDGIFN DGE+W+ QRK+AS
Sbjct  99   YIGFRLLFTVDPANVEYILKTNFSNYVKGPAAHEIQYDLLGDGIFNTDGEMWKLQRKSAS  158

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILT-QASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            LEF+SK LRD+S   FR Y+LKL  IL  Q +  N   +MQD+ MRMT DSIC+VGFGV
Sbjct  159  LEFSSKMLRDYSADAFRKYALKLAMILQGQLAHNNNVANMQDMFMRMTFDSICEVGFGV  217



>ref|XP_007052008.1| Cytochrome P450 family protein [Theobroma cacao]
 gb|EOX96165.1| Cytochrome P450 family protein [Theobroma cacao]
Length=514

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 118/184 (64%), Gaps = 4/184 (2%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIH---RLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
             LVL+L L +F   F+    R  QRK    +  PV G    Q+ N+ R+H ++       
Sbjct  13   ALVLSLILALFTVKFLTAKLRERQRKNKA-KYHPVGGTVFNQLLNFRRLHHYMTDLAGKY  71

Query  194  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  373
             +  +  PF    Y + PDNVE++LKTNF NY KGE  +S ++ LLGDGIF  DG+ WR+
Sbjct  72   RTYRLLSPFRNEIYTSEPDNVEYILKTNFHNYGKGEYNYSLLKGLLGDGIFTVDGDKWRQ  131

Query  374  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  553
            QRK +S EF++K LRDFS+VVFR+ + KL TI+++A+  N+ +D+QDL M+ TLDSI KV
Sbjct  132  QRKVSSYEFSTKVLRDFSSVVFRENAAKLATIVSEAANSNEIMDIQDLFMKSTLDSIFKV  191

Query  554  GFGV  565
             FGV
Sbjct  192  AFGV  195



>sp|Q50EK3.1|C04C1_PINTA RecName: Full=Cytochrome P450 704C1; AltName: Full=Cytochrome 
P450 CYPD [Pinus taeda]
 gb|AAX07434.1| cytochrome P450 CYPD [Pinus taeda]
Length=518

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 115/189 (61%), Gaps = 4/189 (2%)
 Frame = +2

Query  2    LKVSSMETLVLALGLIMFCWVFIH-RLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVG  178
            + + +M   V AL L    W+  + R  ++KG  P   PV+G  +    N+ R+HD+   
Sbjct  3    VNILTMFVTVSALALACSLWIASYLRNWRKKGVYP---PVVGTMLNHAINFERLHDYHTD  59

Query  179  YLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADG  358
                  +  V  P  +Y +   P NVEH+LKTNF NY KG   +  M+ LLGDGIFN DG
Sbjct  60   QAQRYKTFRVVYPTCSYVFTTDPVNVEHILKTNFANYDKGTFNYDIMKDLLGDGIFNVDG  119

Query  359  ELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLD  538
            + WR+QRK AS EFASK L+DFS+ VF + + KL  IL QA+ LN  V+MQDL MR +LD
Sbjct  120  DKWRQQRKLASSEFASKVLKDFSSGVFCNNAAKLANILAQAAKLNLSVEMQDLFMRSSLD  179

Query  539  SICKVGFGV  565
            SICKV FG+
Sbjct  180  SICKVVFGI  188



>ref|XP_010054889.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
 gb|KCW78246.1| hypothetical protein EUGRSUZ_D02435 [Eucalyptus grandis]
Length=459

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 102/151 (68%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G  + ++ N+GRMHD++        +  +  PF +  Y   P NVE+VLKTNF NY 
Sbjct  49   PVAGTVLNKLLNFGRMHDYMTDLAGKHRTYRLLRPFRSEVYTCDPANVEYVLKTNFENYG  108

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG   +S ++ LLGDGIF  DG+ WR+QRK +S EF++K LRDFS+VVFR  + KL  IL
Sbjct  109  KGRYNYSLLKDLLGDGIFAVDGDKWRQQRKVSSYEFSTKVLRDFSSVVFRRNAAKLANIL  168

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            ++A+  NQ VD+QDL M+ TLDSI KV FGV
Sbjct  169  SEAASTNQIVDIQDLFMKSTLDSIFKVAFGV  199



>ref|XP_010042417.1| PREDICTED: cytochrome P450 704C1-like, partial [Eucalyptus grandis]
Length=410

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 102/151 (68%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G  + ++ N+GRMHD++        +  +  PF +  Y   P NVE++LKTNF NY 
Sbjct  49   PVAGTVLNKLLNFGRMHDYMTDLAGKHRTYRLLRPFRSEVYTCDPANVEYMLKTNFENYG  108

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG   +S ++ LLGDGIF  DG+ WR+QRK +S EF++K LRDFS+VVFR  + KL  IL
Sbjct  109  KGRYNYSLLKDLLGDGIFAVDGDKWRQQRKVSSYEFSTKVLRDFSSVVFRRNAAKLANIL  168

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            ++A+  NQ VD+QDL M+ TLDSI KV FGV
Sbjct  169  SEAASTNQIVDIQDLFMKSTLDSIFKVAFGV  199



>gb|KJB41138.1| hypothetical protein B456_007G092700 [Gossypium raimondii]
Length=273

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +2

Query  74   RLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDN  253
            R  QRK    +  PV G  V Q+ N+ R+H ++    A   +  +  PF    Y + P N
Sbjct  29   RQKQRKN---KYHPVAGTFVNQLLNFKRLHHYMTDLAAKYRTYRLLSPFRNEIYTSDPAN  85

Query  254  VEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTV  433
            VE++LKTNF NY KGE  HS +  LLG+GIF  DG+ WR+QRK +S EF++K LRDFS+V
Sbjct  86   VEYILKTNFNNYGKGEYNHSLLRDLLGEGIFTVDGDKWREQRKVSSYEFSTKVLRDFSSV  145

Query  434  VFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            VFR    +L  I+++A+  N+ +DMQDL ++ TLDSI KV FGV
Sbjct  146  VFRKNVARLANIVSEAANSNETMDMQDLFLKSTLDSIFKVAFGV  189



>ref|XP_002980994.1| hypothetical protein SELMODRAFT_113847 [Selaginella moellendorffii]
 gb|EFJ17695.1| hypothetical protein SELMODRAFT_113847 [Selaginella moellendorffii]
Length=512

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 111/173 (64%), Gaps = 4/173 (2%)
 Frame = +2

Query  59   WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVG--YLANSYSVVVPMPFTTYT  232
            W  I  + Q    G ++WP+ G ++E   NY R++DWL     +  + ++   MP  ++ 
Sbjct  17   WCGIQCIRQIGTPGFKTWPLFGVTLEVAANYHRLYDWLSWNFQVKETMTMSATMPGRSFL  76

Query  233  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  412
            +   P NVEH+LKTNF NYPKGE +    + LLG+GIFN++GE WR QRKTAS EFAS+ 
Sbjct  77   FTVDPANVEHILKTNFANYPKGEDFQEIFQPLLGNGIFNSNGEAWRFQRKTASFEFASRV  136

Query  413  LRDFSTVVFRDYSLKLFTILTQASLL--NQQVDMQDLLMRMTLDSICKVGFGV  565
            LRD S  VF+D++LKL  I+     L  + +  +QDL MRMTLD+IC +GFG+
Sbjct  137  LRDVSCRVFKDHALKLARIVHALLFLLRSSRKFIQDLFMRMTLDTICYLGFGL  189



>gb|KJB41139.1| hypothetical protein B456_007G092700 [Gossypium raimondii]
Length=278

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +2

Query  74   RLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDN  253
            R  QRK    +  PV G  V Q+ N+ R+H ++    A   +  +  PF    Y + P N
Sbjct  29   RQKQRKN---KYHPVAGTFVNQLLNFKRLHHYMTDLAAKYRTYRLLSPFRNEIYTSDPAN  85

Query  254  VEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTV  433
            VE++LKTNF NY KGE  HS +  LLG+GIF  DG+ WR+QRK +S EF++K LRDFS+V
Sbjct  86   VEYILKTNFNNYGKGEYNHSLLRDLLGEGIFTVDGDKWREQRKVSSYEFSTKVLRDFSSV  145

Query  434  VFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            VFR    +L  I+++A+  N+ +DMQDL ++ TLDSI KV FGV
Sbjct  146  VFRKNVARLANIVSEAANSNETMDMQDLFLKSTLDSIFKVAFGV  189



>ref|XP_011093193.1| PREDICTED: cytochrome P450 704C1-like [Sesamum indicum]
Length=504

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 116/183 (63%), Gaps = 7/183 (4%)
 Frame = +2

Query  38   LGLIMFCWVF-------IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  196
            + +I+ C +F       + R  Q+K G     P+ G    Q+ N+ R+HD++        
Sbjct  1    MAIIILCVIFSIISIQLLARKLQQKQGKKTYHPIGGTVFHQLVNFNRLHDYMTDLAGKHK  60

Query  197  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  376
            +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR+Q
Sbjct  61   TYRLIGPFRSEVYTSDPANVEYMLKTNFENYGKGWYNYSILKDLLGDGIFTVDGEKWREQ  120

Query  377  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  556
            RK +S EF+++ LRDFS+V+FRD  +KL  I+++A++ N+ +D+QDL M+ TLDSI +V 
Sbjct  121  RKVSSYEFSTRVLRDFSSVIFRDNVVKLTRIVSEAAISNEPMDIQDLFMKATLDSIFRVA  180

Query  557  FGV  565
            FGV
Sbjct  181  FGV  183



>ref|XP_007052011.1| Cytochrome P450 family protein isoform 3 [Theobroma cacao]
 gb|EOX96168.1| Cytochrome P450 family protein isoform 3 [Theobroma cacao]
Length=370

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 114/181 (63%), Gaps = 4/181 (2%)
 Frame = +2

Query  26   LVLALGLIMFCWVFIHRLSQR-KGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            L+L L  + F   F  +L ++ K    +  PV G    Q+ N+ R+H ++        + 
Sbjct  16   LILTLFTVKF---FAAKLREKQKKNKTKYHPVGGTVFNQLLNFKRLHHYMTDLAGKYRTY  72

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
             +  PF +  Y + PDNVE++ KTNF NY KGE  +S ++ LLGDGIF  DG+ WR+QRK
Sbjct  73   RLLSPFRSEVYTSEPDNVEYIPKTNFQNYGKGEYNYSLLKGLLGDGIFAVDGDKWRQQRK  132

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
             +S EF++K LRDFSTVVFR  + KL  I++ A+  N+ +D+QDL M+ TLDSI KVGFG
Sbjct  133  VSSYEFSTKVLRDFSTVVFRKNAAKLANIVSDAAKSNKIMDIQDLFMKSTLDSIFKVGFG  192

Query  563  V  565
            V
Sbjct  193  V  193



>ref|XP_010053880.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
Length=513

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 116/190 (61%), Gaps = 9/190 (5%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSW------PVIGASVEQMTNYGRMHDWLV  175
            +   LVLAL    F ++F     Q +     +       PV G  + Q+ N+GR+H ++ 
Sbjct  13   TASALVLALA---FAYLFAKTWKQHRSKPAAAATAKKYHPVAGTVLNQLLNFGRLHHYMT  69

Query  176  GYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNAD  355
               A   +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  D
Sbjct  70   DLAAKHRTYRLLRPFRSEVYTSDPANVEYMLKTNFENYGKGWYSYSLLKDLLGDGIFTVD  129

Query  356  GELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTL  535
            G+ WR+QRK +S EF++K LRDFS+VVFR  + KL  IL++A+  NQ VDMQDL M+ TL
Sbjct  130  GDKWRQQRKVSSYEFSTKVLRDFSSVVFRRTAAKLANILSEAASTNQIVDMQDLFMKSTL  189

Query  536  DSICKVGFGV  565
            DSI KV FGV
Sbjct  190  DSIFKVAFGV  199



>gb|KJB41141.1| hypothetical protein B456_007G092700 [Gossypium raimondii]
Length=383

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +2

Query  74   RLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDN  253
            R  QRK    +  PV G  V Q+ N+ R+H ++    A   +  +  PF    Y + P N
Sbjct  29   RQKQRKN---KYHPVAGTFVNQLLNFKRLHHYMTDLAAKYRTYRLLSPFRNEIYTSDPAN  85

Query  254  VEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTV  433
            VE++LKTNF NY KGE  HS +  LLG+GIF  DG+ WR+QRK +S EF++K LRDFS+V
Sbjct  86   VEYILKTNFNNYGKGEYNHSLLRDLLGEGIFTVDGDKWREQRKVSSYEFSTKVLRDFSSV  145

Query  434  VFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            VFR    +L  I+++A+  N+ +DMQDL ++ TLDSI KV FGV
Sbjct  146  VFRKNVARLANIVSEAANSNETMDMQDLFLKSTLDSIFKVAFGV  189



>gb|KCW44361.1| hypothetical protein EUGRSUZ_L02168 [Eucalyptus grandis]
Length=512

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 106/165 (64%), Gaps = 0/165 (0%)
 Frame = +2

Query  71   HRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPD  250
            HR         +  PV G ++ Q+ N+GR+H ++        +  +  PF +  Y + P 
Sbjct  34   HRSRMAAAAAKKYHPVAGTALNQLLNFGRLHHYMTDLAGKHGTYRLLGPFWSEVYTSDPA  93

Query  251  NVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFST  430
            NVE++LKTNF NY KG   +S ++ LLGDGIF  DG+ WR+QRK +S EF++K LRDFS+
Sbjct  94   NVEYMLKTNFKNYGKGRYNYSLLKDLLGDGIFAVDGDKWRQQRKVSSYEFSTKVLRDFSS  153

Query  431  VVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            VVF+  + KL  IL++A+  NQ VDMQDL M+ TLDSI KV FGV
Sbjct  154  VVFQRNAAKLANILSEAASTNQIVDMQDLFMKSTLDSIFKVAFGV  198



>ref|XP_002982474.1| hypothetical protein SELMODRAFT_116579 [Selaginella moellendorffii]
 gb|EFJ16227.1| hypothetical protein SELMODRAFT_116579 [Selaginella moellendorffii]
Length=538

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 112/189 (59%), Gaps = 20/189 (11%)
 Frame = +2

Query  59   WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVG--YLANSYSVVVPMPFTTYT  232
            W  I  + Q    G ++WP+IG ++E   NY R++DWL     +  + ++   MP  ++ 
Sbjct  17   WCGIQCIRQIGTPGFKTWPLIGVTLEVAANYHRLYDWLSWNFQVKETMTMSATMPGRSFL  76

Query  233  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  412
            +   P NVEH+LKTNF NYPKGE +    + LLG+GIFN++GE WR QRKTAS EFAS+ 
Sbjct  77   FTVDPANVEHILKTNFANYPKGEDFQEIFQPLLGNGIFNSNGEAWRFQRKTASFEFASRV  136

Query  413  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDM------------------QDLLMRMTLD  538
            LRD S  VF+D++LKL  I+  +      ++M                  QDL MRMTLD
Sbjct  137  LRDVSCRVFKDHALKLARIVHGSQESEGSLEMQARIKSSSFLLRSSRKFIQDLFMRMTLD  196

Query  539  SICKVGFGV  565
            +IC +GFG+
Sbjct  197  TICYLGFGL  205



>gb|KDO85884.1| hypothetical protein CISIN_1g010681mg [Citrus sinensis]
 gb|KDO85885.1| hypothetical protein CISIN_1g010681mg [Citrus sinensis]
Length=286

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLAN  190
            S + L +AL  I+   +    L+Q+ G   + +  IG +V  Q+ N+ R+H ++    A 
Sbjct  9    SFKALAIALA-ILVVQIVTKTLTQKSGNKQKKYHPIGGTVFNQLLNFNRLHHYMTDLAAK  67

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
              +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR
Sbjct  68   HGTYRLLGPFRSEVYSSDPANVEYMLKTNFDNYGKGSYNYSILKDLLGDGIFTVDGEKWR  127

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            +QRK +S EF++K LRDFS+  FR  + KL  +L++A+  ++ +D+QDL M+ TLDSI K
Sbjct  128  EQRKISSHEFSTKVLRDFSSAAFRKNAAKLAQLLSEAANSDKILDIQDLFMKSTLDSIFK  187

Query  551  VGFGV  565
            V FGV
Sbjct  188  VAFGV  192



>dbj|BAG88047.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 102/160 (64%), Gaps = 2/160 (1%)
 Frame = +2

Query  92   GGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLK  271
            G   R  PV G    Q+ N+GR+ ++         +  +  P   Y Y   P NVEH+LK
Sbjct  30   GKKRRYPPVAGTMFHQLLNFGRLLEYHTELSRKYRTFRMLTPTCNYVYTVEPANVEHILK  89

Query  272  TNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYS  451
            TNF NY KG + H  +E LLGDGIFN DG +WR+QRK ASLEF+++ LRD+S+ VFRD +
Sbjct  90   TNFANYGKGPMTHDVLEDLLGDGIFNVDGGMWRQQRKVASLEFSTRVLRDYSSAVFRDTA  149

Query  452  LKLFTILTQ--ASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             +L  IL +  A+   ++VDMQDLLMR TLDS  +VGFGV
Sbjct  150  AELAGILERGPAAKGRERVDMQDLLMRATLDSFFRVGFGV  189



>ref|XP_006339516.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=507

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 117/188 (62%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    LKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY  181
            L  SS+ ++   +  ++FC    H L+++     R  P+ G    Q+ N+ R+H ++   
Sbjct  4    LHNSSIMSIAATILSLVFCGFIFHLLTRKVDAKKRYHPIGGTIFNQLINFHRLHHYMTDL  63

Query  182  LANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGE  361
             +   +  +  PF +  Y + P NVE++LKTNF NY +G  ++S ++ LLGDGIF  DG+
Sbjct  64   ASKYKTYRLISPFRSEIYTSDPVNVEYILKTNFDNYGRGRYHYSNLKDLLGDGIFTVDGD  123

Query  362  LWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDS  541
             WR+QRK +S EF+++ LRDFS+VVFR    KL  IL++A+   + VD+QDL M+ TLDS
Sbjct  124  KWREQRKLSSHEFSTRVLRDFSSVVFRKNVAKLAHILSEAASSEKTVDIQDLFMKATLDS  183

Query  542  ICKVGFGV  565
            I KV FGV
Sbjct  184  IFKVAFGV  191



>gb|AAZ39646.1| cytochrome P450 monooxygenase [Petunia x hybrida]
Length=499

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 117/186 (63%), Gaps = 6/186 (3%)
 Frame = +2

Query  17   METLVLALGLIMFCWVFIHRLSQR---KGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLA  187
            M T +L+L   +FC   IH ++++   + G  R  P+ G    Q+ N+ R+HD++     
Sbjct  1    MTTTILSL---LFCGFIIHLVTRKLLGRYGKKRYHPIGGTMFNQLLNFHRLHDYMTDLAG  57

Query  188  NSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELW  367
               +  +  PF    Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DG+ W
Sbjct  58   KHKTYRLISPFRNEIYSSDPANVEYILKTNFDNYGKGWYSYSILKELLGDGIFTVDGDKW  117

Query  368  RKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSIC  547
            R+QRK +S EF+++ LRDFS+VVFR    KL  IL++A+  N+ VD+QDL M+ TLDSI 
Sbjct  118  REQRKLSSHEFSTRVLRDFSSVVFRKNVAKLAHILSEAANSNKIVDIQDLFMKATLDSIF  177

Query  548  KVGFGV  565
            +V FGV
Sbjct  178  RVAFGV  183



>ref|XP_007052009.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
 ref|XP_007052010.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
 gb|EOX96166.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
 gb|EOX96167.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
Length=508

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 114/181 (63%), Gaps = 4/181 (2%)
 Frame = +2

Query  26   LVLALGLIMFCWVFIHRLSQR-KGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            L+L L  + F   F  +L ++ K    +  PV G    Q+ N+ R+H ++        + 
Sbjct  16   LILTLFTVKF---FAAKLREKQKKNKTKYHPVGGTVFNQLLNFKRLHHYMTDLAGKYRTY  72

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
             +  PF +  Y + PDNVE++ KTNF NY KGE  +S ++ LLGDGIF  DG+ WR+QRK
Sbjct  73   RLLSPFRSEVYTSEPDNVEYIPKTNFQNYGKGEYNYSLLKGLLGDGIFAVDGDKWRQQRK  132

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
             +S EF++K LRDFSTVVFR  + KL  I++ A+  N+ +D+QDL M+ TLDSI KVGFG
Sbjct  133  VSSYEFSTKVLRDFSTVVFRKNAAKLANIVSDAAKSNKIMDIQDLFMKSTLDSIFKVGFG  192

Query  563  V  565
            V
Sbjct  193  V  193



>ref|XP_010041418.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
Length=475

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 103/151 (68%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G ++ Q+ N+GR+H ++        +  +  PF +  Y + P NVE++LKTNF NY 
Sbjct  11   PVAGTALNQLLNFGRLHHYMTDLAGKHGTYRLLGPFWSEVYTSDPANVEYMLKTNFKNYG  70

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG   +S ++ LLGDGIF  DG+ WR+QRK +S EF++K LRDFS+VVF+  + KL  IL
Sbjct  71   KGRYNYSLLKDLLGDGIFAVDGDKWRQQRKVSSYEFSTKVLRDFSSVVFQRNAAKLANIL  130

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            ++A+  NQ VDMQDL M+ TLDSI KV FGV
Sbjct  131  SEAASTNQIVDMQDLFMKSTLDSIFKVAFGV  161



>ref|XP_002976944.1| hypothetical protein SELMODRAFT_151517 [Selaginella moellendorffii]
 gb|EFJ22054.1| hypothetical protein SELMODRAFT_151517 [Selaginella moellendorffii]
Length=537

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 102/163 (63%), Gaps = 1/163 (1%)
 Frame = +2

Query  80   SQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIA-HPDNV  256
             +R   GP+ WP++G+  + + N+  +HDW + Y ++    +     T Y  +   P NV
Sbjct  42   EKRDHKGPKRWPLVGSYFQVVKNFPVLHDWFLSYFSSECRTIAVDWGTFYNILTVDPANV  101

Query  257  EHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVV  436
            EH+LKTNF NYPKG V H+     +GDGIFN+DGE+W++ RK AS EF+SK + ++S  V
Sbjct  102  EHILKTNFANYPKGRVSHARNYDFMGDGIFNSDGEMWKRHRKLASYEFSSKKVNEYSGQV  161

Query  437  FRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            FR  ++++  +L   +      D QD+ MRMTLDSIC+V FGV
Sbjct  162  FRKAAVRMMEVLENIASKKTSFDFQDISMRMTLDSICEVAFGV  204



>ref|XP_007052012.1| Cytochrome P450 family protein [Theobroma cacao]
 gb|EOX96169.1| Cytochrome P450 family protein [Theobroma cacao]
Length=508

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 114/181 (63%), Gaps = 4/181 (2%)
 Frame = +2

Query  26   LVLALGLIMFCWVFIHRLSQR-KGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            L+L L  + F   F  +L ++ K    +  PV G    Q+ N+ R+H ++        + 
Sbjct  16   LILTLFTVKF---FAAKLREKQKKNKTKYHPVGGTVFSQLLNFKRLHHYMTDLAGKYRTY  72

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
             +  PF +  Y + PDNVE++LKTN  NY KG+  +S ++ LLGDGIF  DG+ WR+QRK
Sbjct  73   RLLSPFRSEVYTSEPDNVEYILKTNIQNYGKGDYNYSLLKGLLGDGIFAVDGDKWRQQRK  132

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
             +S EF++K LRDFSTVVFR  + KL  I++ A+  N+ +D+QDL M+ TLDSI KVGFG
Sbjct  133  VSSYEFSTKVLRDFSTVVFRKNAAKLANIVSDAAKSNKIMDIQDLFMKSTLDSIFKVGFG  192

Query  563  V  565
            V
Sbjct  193  V  193



>gb|KJB41140.1| hypothetical protein B456_007G092700 [Gossypium raimondii]
Length=505

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +2

Query  74   RLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDN  253
            R  QRK    +  PV G  V Q+ N+ R+H ++    A   +  +  PF    Y + P N
Sbjct  29   RQKQRKN---KYHPVAGTFVNQLLNFKRLHHYMTDLAAKYRTYRLLSPFRNEIYTSDPAN  85

Query  254  VEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTV  433
            VE++LKTNF NY KGE  HS +  LLG+GIF  DG+ WR+QRK +S EF++K LRDFS+V
Sbjct  86   VEYILKTNFNNYGKGEYNHSLLRDLLGEGIFTVDGDKWREQRKVSSYEFSTKVLRDFSSV  145

Query  434  VFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            VFR    +L  I+++A+  N+ +DMQDL ++ TLDSI KV FGV
Sbjct  146  VFRKNVARLANIVSEAANSNETMDMQDLFLKSTLDSIFKVAFGV  189



>gb|KJB41137.1| hypothetical protein B456_007G092700 [Gossypium raimondii]
Length=546

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +2

Query  74   RLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDN  253
            R  QRK    +  PV G  V Q+ N+ R+H ++    A   +  +  PF    Y + P N
Sbjct  69   RQKQRKN---KYHPVAGTFVNQLLNFKRLHHYMTDLAAKYRTYRLLSPFRNEIYTSDPAN  125

Query  254  VEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTV  433
            VE++LKTNF NY KGE  HS +  LLG+GIF  DG+ WR+QRK +S EF++K LRDFS+V
Sbjct  126  VEYILKTNFNNYGKGEYNHSLLRDLLGEGIFTVDGDKWREQRKVSSYEFSTKVLRDFSSV  185

Query  434  VFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            VFR    +L  I+++A+  N+ +DMQDL ++ TLDSI KV FGV
Sbjct  186  VFRKNVARLANIVSEAANSNETMDMQDLFLKSTLDSIFKVAFGV  229



>ref|XP_010054890.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
 gb|KCW78248.1| hypothetical protein EUGRSUZ_D02437 [Eucalyptus grandis]
Length=515

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 113/190 (59%), Gaps = 9/190 (5%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSW------PVIGASVEQMTNYGRMHDWLV  175
            +   LVLAL    F ++F     Q +     +       PV G  + Q+ N+GR+H ++ 
Sbjct  13   TASALVLALA---FAYLFAKTWKQHRSKPAAAATAKKYHPVAGTVLNQLLNFGRLHHYMT  69

Query  176  GYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNAD  355
               A   +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  D
Sbjct  70   DLAAKHRTYRLLRPFRSEVYTSDPANVEYMLKTNFENYGKGWYNNSLLKDLLGDGIFAVD  129

Query  356  GELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTL  535
            G  WR+QRK +S EF+ K LRDFS+VVFR  + KL   L++A+  NQ VDMQDL M+ TL
Sbjct  130  GNKWRQQRKVSSYEFSRKVLRDFSSVVFRRTAAKLANTLSEAASTNQIVDMQDLFMKSTL  189

Query  536  DSICKVGFGV  565
            DSI KV FGV
Sbjct  190  DSIFKVAFGV  199



>ref|XP_006445218.1| hypothetical protein CICLE_v10019805mg [Citrus clementina]
 gb|ESR58458.1| hypothetical protein CICLE_v10019805mg [Citrus clementina]
Length=392

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLAN  190
            S + L +AL  I+   +    L+Q+ G   + +  IG +V  Q+ N+ R+H ++    A 
Sbjct  9    SFKALAIALA-ILVVQIVTKTLTQKSGNKQKKYHPIGGTVFNQLLNFNRLHHYMTDLAAK  67

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
              +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR
Sbjct  68   HGTYRLLGPFRSEVYSSDPANVEYMLKTNFDNYGKGSYNYSILKDLLGDGIFTVDGEKWR  127

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            +QRK +S EF++K LRDFS+  FR  + KL  +L++A+  ++ +D+QDL M+ TLDSI K
Sbjct  128  EQRKISSHEFSTKVLRDFSSAAFRKNAAKLAQLLSEAANSDKILDIQDLFMKSTLDSIFK  187

Query  551  VGFGV  565
            V FGV
Sbjct  188  VAFGV  192



>gb|KDO85883.1| hypothetical protein CISIN_1g010681mg [Citrus sinensis]
Length=392

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLAN  190
            S + L +AL  I+   +    L+Q+ G   + +  IG +V  Q+ N+ R+H ++    A 
Sbjct  9    SFKALAIALA-ILVVQIVTKTLTQKSGNKQKKYHPIGGTVFNQLLNFNRLHHYMTDLAAK  67

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
              +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR
Sbjct  68   HGTYRLLGPFRSEVYSSDPANVEYMLKTNFDNYGKGSYNYSILKDLLGDGIFTVDGEKWR  127

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            +QRK +S EF++K LRDFS+  FR  + KL  +L++A+  ++ +D+QDL M+ TLDSI K
Sbjct  128  EQRKISSHEFSTKVLRDFSSAAFRKNAAKLAQLLSEAANSDKILDIQDLFMKSTLDSIFK  187

Query  551  VGFGV  565
            V FGV
Sbjct  188  VAFGV  192



>ref|XP_008669003.1| PREDICTED: cytochrome P450 704C1-like [Zea mays]
 tpg|DAA36390.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=507

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 106/163 (65%), Gaps = 2/163 (1%)
 Frame = +2

Query  83   QRKGGGP-RSWP-VIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNV  256
            +R+GGG  RS+P V G  + Q+ N+GR+ ++         +  +  P  +Y Y   P NV
Sbjct  26   RRRGGGKNRSYPPVAGTVLHQLFNFGRLMEYQTALSRRYRTFRMLTPTCSYIYTVEPANV  85

Query  257  EHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVV  436
            E++LKTNF NY KG   H   E LLGDGIFN DG  WR QRK AS EF+++ LRD+ST V
Sbjct  86   EYILKTNFGNYGKGSTLHELSEDLLGDGIFNVDGAKWRHQRKVASHEFSTRVLRDYSTGV  145

Query  437  FRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            FRD + +L  I+  A+   +++DMQ+LLMR TLDSI KVGFGV
Sbjct  146  FRDTAAELAGIVAAAAAAGEKLDMQELLMRSTLDSIFKVGFGV  188



>gb|EAY95236.1| hypothetical protein OsI_17053 [Oryza sativa Indica Group]
Length=506

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 102/160 (64%), Gaps = 2/160 (1%)
 Frame = +2

Query  92   GGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLK  271
            G   R  PV G    Q+ N+GR+ ++         +  +  P   Y Y   P NVEH+LK
Sbjct  30   GKKRRYPPVAGTMFHQLLNFGRLLEYHTELSRKYRTFRMLTPTCNYVYTVEPANVEHILK  89

Query  272  TNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYS  451
            TNF NY KG + H  +E LLGDGIFN DG +WR+QRK ASLEF+++ LRD+S+ VFRD +
Sbjct  90   TNFANYGKGPMTHDVLEDLLGDGIFNVDGGMWRQQRKVASLEFSTRVLRDYSSAVFRDTA  149

Query  452  LKLFTILTQ--ASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             +L  IL +  A+   ++VDMQDLLMR TLDS  +VGFGV
Sbjct  150  AELAGILERGPAAKGRERVDMQDLLMRATLDSFFRVGFGV  189



>ref|NP_001053615.1| Os04g0573900 [Oryza sativa Japonica Group]
 emb|CAD41666.3| OSJNBa0019K04.13 [Oryza sativa Japonica Group]
 dbj|BAF15529.1| Os04g0573900 [Oryza sativa Japonica Group]
Length=506

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 102/160 (64%), Gaps = 2/160 (1%)
 Frame = +2

Query  92   GGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLK  271
            G   R  PV G    Q+ N+GR+ ++         +  +  P   Y Y   P NVEH+LK
Sbjct  30   GKKRRYPPVAGTMFHQLLNFGRLLEYHTELSRKYRTFRMLTPTCNYVYTVEPANVEHILK  89

Query  272  TNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYS  451
            TNF NY KG + H  +E LLGDGIFN DG +WR+QRK ASLEF+++ LRD+S+ VFRD +
Sbjct  90   TNFANYGKGPMTHDVLEDLLGDGIFNVDGGMWRQQRKVASLEFSTRVLRDYSSAVFRDTA  149

Query  452  LKLFTILTQ--ASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             +L  IL +  A+   ++VDMQDLLMR TLDS  +VGFGV
Sbjct  150  AELAGILERGPAAKGRERVDMQDLLMRATLDSFFRVGFGV  189



>gb|ABZ80831.1| CYP86A32 fatty acid omega-hydroxylase [Quercus suber]
Length=520

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 115/196 (59%), Gaps = 14/196 (7%)
 Frame = +2

Query  17   METLVLALGLI--MFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL--  184
            METL +  G+   +  ++F   L  +K  GP+ WPV+G+    ++N  R+HDW+   L  
Sbjct  1    METLSILFGIAGAIALYLFWFNLLAQKLTGPKVWPVVGSLPALISNRSRIHDWMANNLRA  60

Query  185  ----ANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
                A   +  +P PF       +T   HP N+EH+L+T F NYPKG  + +    LLG 
Sbjct  61   TGGSATYQTCTIPFPFLARKQGFFTVTCHPKNIEHILRTKFDNYPKGPDWQAAFHDLLGQ  120

Query  338  GIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQD  514
            GIFN+DGE W  QRKTA+LEF ++ LR   S  V R   L+L+ IL +A+  N  VD+QD
Sbjct  121  GIFNSDGETWLIQRKTAALEFTTRTLRQAMSRWVNRTIKLRLWCILDKAAKDNIHVDLQD  180

Query  515  LLMRMTLDSICKVGFG  562
            LL+R+T D+IC + FG
Sbjct  181  LLLRLTFDNICGLTFG  196



>ref|XP_006652670.1| PREDICTED: cytochrome P450 704C1-like [Oryza brachyantha]
Length=507

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 101/158 (64%), Gaps = 1/158 (1%)
 Frame = +2

Query  95   GGPRSWPVIGASV-EQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLK  271
            G  R +P +  +V  Q+ N+GR  ++         +  +  P   Y Y   P NVEH+LK
Sbjct  33   GKKRKYPPVAGTVFHQLLNFGRFVEYQTDLSRRYRTFRMLTPTCNYVYTVEPANVEHILK  92

Query  272  TNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYS  451
            TNF NY KG + H  ME LLGDGIFN DG +WR+QRK ASLEF+++ LRD+S+ VF D +
Sbjct  93   TNFANYGKGPMTHEVMEDLLGDGIFNVDGGMWRQQRKVASLEFSTRVLRDYSSAVFGDTA  152

Query  452  LKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             +L  IL + +   +++DMQDLLMR TLDS  +VGFGV
Sbjct  153  AELAGILERGAAGGERLDMQDLLMRATLDSFFRVGFGV  190



>gb|KDP27731.1| hypothetical protein JCGZ_19708 [Jatropha curcas]
Length=579

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 102/151 (68%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            P+ G    Q+ N+ R+H ++    +   +  +  PF    Y + P NVE++LKTNFPNY 
Sbjct  111  PIGGTVFNQLFNFNRLHHYMTDLASKYKTYRLLAPFRDEVYTSDPLNVEYILKTNFPNYG  170

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KGE  ++ +  LLGDGIF  DGE WR+QRK +S EF++K LR+FS+VVFR+ + KL  I+
Sbjct  171  KGEYNYNNLRDLLGDGIFTVDGEKWRQQRKVSSYEFSTKVLREFSSVVFRNNAAKLAGIV  230

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            T+A+  NQ +D+QDL M+ TLDSI KV FGV
Sbjct  231  TEAAKSNQSMDIQDLFMKSTLDSIFKVAFGV  261



>gb|EAZ31703.1| hypothetical protein OsJ_15852 [Oryza sativa Japonica Group]
Length=452

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 101/160 (63%), Gaps = 2/160 (1%)
 Frame = +2

Query  92   GGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLK  271
            G   R  PV G    Q+ N+GR+ ++         +  +  P   Y Y   P NVEH+LK
Sbjct  30   GKKRRYPPVAGTMFHQLLNFGRLLEYHTELSRKYRTFRMLTPTCNYVYTVEPANVEHILK  89

Query  272  TNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYS  451
            TNF NY KG + H  +E LLGDGIFN DG +WR+QRK ASLEF+++ LRD+S+ VFRD +
Sbjct  90   TNFANYGKGPMTHDVLEDLLGDGIFNVDGGMWRQQRKVASLEFSTRVLRDYSSAVFRDTA  149

Query  452  LKLFTILTQ--ASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             +L  IL +  A+    +VDMQDLLMR TLDS  +VGFGV
Sbjct  150  AELAGILERGPAAKGRDRVDMQDLLMRATLDSFFRVGFGV  189



>ref|XP_011034689.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Populus euphratica]
 ref|XP_011034695.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Populus euphratica]
Length=509

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 113/190 (59%), Gaps = 4/190 (2%)
 Frame = +2

Query  8    VSSMETLVLALGLIMFCWVFIHRLSQRKGGGP----RSWPVIGASVEQMTNYGRMHDWLV  175
            + S+   +    L++   +FI +LS RK        R  P+ G    Q+ N+ R+H ++ 
Sbjct  4    IDSLSNSLTLSALVLILSIFIVQLSIRKLNKKQEKRRYHPLGGTVFNQLLNFNRLHHYMT  63

Query  176  GYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNAD  355
                   +  +  PF +  Y A P NVE++LKTNF NY KG   +  +  LLGDGIF  D
Sbjct  64   DLAGKHKTYRLIAPFRSEVYTADPVNVEYILKTNFENYGKGGHNYDNLSGLLGDGIFTVD  123

Query  356  GELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTL  535
            G+ WR+QRK +S EF++K LRDFS+VVFR    KL  I+++A+  NQ +D+QDL M+ TL
Sbjct  124  GDKWRQQRKVSSYEFSTKVLRDFSSVVFRKNVAKLANIVSEAAKANQSMDIQDLFMKSTL  183

Query  536  DSICKVGFGV  565
            DSI KV FGV
Sbjct  184  DSIFKVAFGV  193



>gb|KJB19906.1| hypothetical protein B456_003G123900 [Gossypium raimondii]
Length=511

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 112/196 (57%), Gaps = 14/196 (7%)
 Frame = +2

Query  17   METL--VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLV-----  175
            MET   V +L   +F +     +  R+  GPR WP++G+      N  R+HDW+      
Sbjct  1    METFPFVFSLAAAIFAYALWFHILARRLTGPRVWPLVGSLPSLFENRRRIHDWMASNLRA  60

Query  176  -GYLANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
             G LA   +  + +PF       YT   HP N+EH+LKT F NYPKG  + +    LLG 
Sbjct  61   TGGLATYQTCTIALPFLAWKQGLYTVTCHPKNIEHILKTRFDNYPKGPNWQAAFHDLLGQ  120

Query  338  GIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQD  514
            GIFN+DGE W  QRKTA+LEF ++ LR   +  V R    +L+ IL +AS+  + VD+QD
Sbjct  121  GIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIKDRLWHILDRASIEKKSVDLQD  180

Query  515  LLMRMTLDSICKVGFG  562
            LL+R+T D+IC + FG
Sbjct  181  LLLRLTFDNICGLTFG  196



>gb|KDO85881.1| hypothetical protein CISIN_1g010681mg [Citrus sinensis]
Length=452

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLAN  190
            S + L +AL  I+   +    L+Q+ G   + +  IG +V  Q+ N+ R+H ++    A 
Sbjct  9    SFKALAIALA-ILVVQIVTKTLTQKSGNKQKKYHPIGGTVFNQLLNFNRLHHYMTDLAAK  67

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
              +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR
Sbjct  68   HGTYRLLGPFRSEVYSSDPANVEYMLKTNFDNYGKGSYNYSILKDLLGDGIFTVDGEKWR  127

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            +QRK +S EF++K LRDFS+  FR  + KL  +L++A+  ++ +D+QDL M+ TLDSI K
Sbjct  128  EQRKISSHEFSTKVLRDFSSAAFRKNAAKLAQLLSEAANSDKILDIQDLFMKSTLDSIFK  187

Query  551  VGFGV  565
            V FGV
Sbjct  188  VAFGV  192



>ref|XP_002320072.1| hypothetical protein POPTR_0014s06790g [Populus trichocarpa]
 gb|EEE98387.1| hypothetical protein POPTR_0014s06790g [Populus trichocarpa]
Length=509

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 110/179 (61%), Gaps = 4/179 (2%)
 Frame = +2

Query  41   GLIMFCWVFIHRLSQRKGGGPRS----WPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
             L++   +F  +LS RK    +      PV G    Q+ N+ R+H ++        +  +
Sbjct  15   ALVLILSIFTVQLSIRKLNKKQEKHKYHPVGGTVFNQLLNFNRLHHYMTDLAGKYKTYRL  74

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF +  Y A P NVE++LKTNF NY KG+  ++ +  LLGDGIF  DG+ WR+QRK +
Sbjct  75   IAPFRSEVYTADPVNVEYILKTNFENYGKGDHNYNNLSGLLGDGIFTVDGDKWRQQRKVS  134

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRDFS+VVFR    KL  I+++A+  NQ +D+QDL M+ TLDSI KV FGV
Sbjct  135  SHEFSTKVLRDFSSVVFRKNVAKLANIVSEAAKANQSMDIQDLFMKSTLDSIFKVAFGV  193



>gb|KDO85879.1| hypothetical protein CISIN_1g010681mg [Citrus sinensis]
Length=504

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLAN  190
            S + L +AL  I+   +    L+Q+ G   + +  IG +V  Q+ N+ R+H ++    A 
Sbjct  9    SFKALAIALA-ILVVQIVTKTLTQKSGNKQKKYHPIGGTVFNQLLNFNRLHHYMTDLAAK  67

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
              +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR
Sbjct  68   HGTYRLLGPFRSEVYSSDPANVEYMLKTNFDNYGKGSYNYSILKDLLGDGIFTVDGEKWR  127

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            +QRK +S EF++K LRDFS+  FR  + KL  +L++A+  ++ +D+QDL M+ TLDSI K
Sbjct  128  EQRKISSHEFSTKVLRDFSSAAFRKNAAKLAQLLSEAANSDKILDIQDLFMKSTLDSIFK  187

Query  551  VGFGV  565
            V FGV
Sbjct  188  VAFGV  192



>gb|KDO85882.1| hypothetical protein CISIN_1g010681mg [Citrus sinensis]
Length=466

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLAN  190
            S + L +AL  I+   +    L+Q+ G   + +  IG +V  Q+ N+ R+H ++    A 
Sbjct  9    SFKALAIALA-ILVVQIVTKTLTQKSGNKQKKYHPIGGTVFNQLLNFNRLHHYMTDLAAK  67

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
              +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR
Sbjct  68   HGTYRLLGPFRSEVYSSDPANVEYMLKTNFDNYGKGSYNYSILKDLLGDGIFTVDGEKWR  127

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            +QRK +S EF++K LRDFS+  FR  + KL  +L++A+  ++ +D+QDL M+ TLDSI K
Sbjct  128  EQRKISSHEFSTKVLRDFSSAAFRKNAAKLAQLLSEAANSDKILDIQDLFMKSTLDSIFK  187

Query  551  VGFGV  565
            V FGV
Sbjct  188  VAFGV  192



>gb|KDO85880.1| hypothetical protein CISIN_1g010681mg [Citrus sinensis]
Length=503

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLAN  190
            S + L +AL  I+   +    L+Q+ G   + +  IG +V  Q+ N+ R+H ++    A 
Sbjct  9    SFKALAIALA-ILVVQIVTKTLTQKSGNKQKKYHPIGGTVFNQLLNFNRLHHYMTDLAAK  67

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
              +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR
Sbjct  68   HGTYRLLGPFRSEVYSSDPANVEYMLKTNFDNYGKGSYNYSILKDLLGDGIFTVDGEKWR  127

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            +QRK +S EF++K LRDFS+  FR  + KL  +L++A+  ++ +D+QDL M+ TLDSI K
Sbjct  128  EQRKISSHEFSTKVLRDFSSAAFRKNAAKLAQLLSEAANSDKILDIQDLFMKSTLDSIFK  187

Query  551  VGFGV  565
            V FGV
Sbjct  188  VAFGV  192



>ref|XP_006445219.1| hypothetical protein CICLE_v10019805mg [Citrus clementina]
 ref|XP_006490952.1| PREDICTED: cytochrome P450 704C1-like [Citrus sinensis]
 gb|ESR58459.1| hypothetical protein CICLE_v10019805mg [Citrus clementina]
Length=504

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 116/185 (63%), Gaps = 2/185 (1%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLAN  190
            S + L +AL  I+   +    L+Q+ G   + +  IG +V  Q+ N+ R+H ++    A 
Sbjct  9    SFKALAIALA-ILVVQIVTKTLTQKSGNKQKKYHPIGGTVFNQLLNFNRLHHYMTDLAAK  67

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
              +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR
Sbjct  68   HGTYRLLGPFRSEVYSSDPANVEYMLKTNFDNYGKGSYNYSILKDLLGDGIFTVDGEKWR  127

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            +QRK +S EF++K LRDFS+  FR  + KL  +L++A+  ++ +D+QDL M+ TLDSI K
Sbjct  128  EQRKISSHEFSTKVLRDFSSAAFRKNAAKLAQLLSEAANSDKILDIQDLFMKSTLDSIFK  187

Query  551  VGFGV  565
            V FGV
Sbjct  188  VAFGV  192



>ref|XP_002270673.2| PREDICTED: cytochrome P450 704C1 [Vitis vinifera]
Length=528

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 109/179 (61%), Gaps = 3/179 (2%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            + AL L+    + + + +++K    R  P+ G    Q+ N+ R+H ++        +  +
Sbjct  30   ISALTLVFLMKILVGKSTEKK---RRYHPIGGTVFNQLFNFNRLHHYMTDLAGKHRTYRL  86

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    Y A P NVE++LKTNF NY KG   ++ +  LLGDGIF  D E WR+QRK +
Sbjct  87   LSPFRNEIYTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTVDDEKWRQQRKVS  146

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRDFS+VVFR    KL  ++++A+  NQ +D+QDL M+ TLDSI KV FGV
Sbjct  147  SYEFSTKVLRDFSSVVFRKNGAKLAIVVSEAASSNQTMDIQDLFMKATLDSIFKVAFGV  205



>emb|CAN60189.1| hypothetical protein VITISV_002118 [Vitis vinifera]
Length=515

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 109/179 (61%), Gaps = 3/179 (2%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            + AL L+    + + + +++K    R  P+ G    Q+ N+ R+H ++        +  +
Sbjct  17   ISALTLVFLMKILVGKSTEKK---RRYHPIGGTVFNQLFNFNRLHHYMTDLAGKHRTYRL  73

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    Y A P NVE++LKTNF NY KG   ++ +  LLGDGIF  D E WR+QRK +
Sbjct  74   LSPFRNEIYTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTVDDEKWRQQRKVS  133

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRDFS+VVFR    KL  ++++A+  NQ +D+QDL M+ TLDSI KV FGV
Sbjct  134  SYEFSTKVLRDFSSVVFRKNGAKLAIVVSEAASSNQTMDIQDLFMKATLDSIFKVAFGV  192



>ref|XP_002980688.1| hypothetical protein SELMODRAFT_112911 [Selaginella moellendorffii]
 gb|EFJ18339.1| hypothetical protein SELMODRAFT_112911 [Selaginella moellendorffii]
Length=537

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 101/162 (62%), Gaps = 1/162 (1%)
 Frame = +2

Query  83   QRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIA-HPDNVE  259
            +R   GP+ WP++G+  + + N+  +HDW + Y ++    +     T Y  +   P NVE
Sbjct  43   KRNHKGPKRWPLVGSYFQVVKNFPVLHDWFLSYFSSECRTIAVDWGTFYNILTIDPANVE  102

Query  260  HVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVF  439
            H+LKTNF NYPKG V  +     +GDGIFN+DGE+W++ RK AS EF+SK + ++S  VF
Sbjct  103  HILKTNFANYPKGRVSRARNYDFMGDGIFNSDGEMWKRHRKLASYEFSSKKVNEYSGQVF  162

Query  440  RDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +  ++++  +L   +      D QD+ MRMTLDSIC+V FGV
Sbjct  163  KKAAVRMMEVLENIASTKTSFDFQDISMRMTLDSICEVAFGV  204



>emb|CBI38797.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 109/179 (61%), Gaps = 3/179 (2%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            + AL L+    + + + +++K    R  P+ G    Q+ N+ R+H ++        +  +
Sbjct  17   ISALTLVFLMKILVGKSTEKK---RRYHPIGGTVFNQLFNFNRLHHYMTDLAGKHRTYRL  73

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    Y A P NVE++LKTNF NY KG   ++ +  LLGDGIF  D E WR+QRK +
Sbjct  74   LSPFRNEIYTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTVDDEKWRQQRKVS  133

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRDFS+VVFR    KL  ++++A+  NQ +D+QDL M+ TLDSI KV FGV
Sbjct  134  SYEFSTKVLRDFSSVVFRKNGAKLAIVVSEAASSNQTMDIQDLFMKATLDSIFKVAFGV  192



>ref|XP_002529550.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF32833.1| cytochrome P450, putative, partial [Ricinus communis]
Length=394

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 113/185 (61%), Gaps = 5/185 (3%)
 Frame = +2

Query  26   LVLALGLIMFCWVFIHRLSQRKGGGPRS-----WPVIGASVEQMTNYGRMHDWLVGYLAN  190
            L  AL LI    +F   +++ K G  R       P+ G    Q+ N+ ++H ++    A 
Sbjct  9    LFSALALIPCLLIFPLLITKLKRGEQRENKLKYHPIGGTVFNQLLNFNKLHHYMTDLAAK  68

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
              +  +  PF    Y + P NVE++LKTNF NY KGE  ++ +  LLGDGIF  DGE WR
Sbjct  69   YRTYRLISPFRNEIYTSDPVNVEYILKTNFQNYGKGEYNYNNLRDLLGDGIFTVDGEKWR  128

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            +QRK +S EF+++ LRDFS+++FR+  +KL   +++A+  NQ +D+QDL M+ TLDSI K
Sbjct  129  QQRKVSSYEFSTRVLRDFSSIIFRENVVKLAGAVSEAAKSNQSMDIQDLFMKSTLDSIFK  188

Query  551  VGFGV  565
            V FGV
Sbjct  189  VVFGV  193



>ref|XP_009776441.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Nicotiana sylvestris]
Length=517

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 118/189 (62%), Gaps = 4/189 (2%)
 Frame = +2

Query  11   SSMETLVLALGLIMFCWVFIHRLSQR---KGGGPRSWPVIGASV-EQMTNYGRMHDWLVG  178
            SSM  +   +  ++FC   +H L+++   K G  R +  IG ++  Q+ N+ R+H ++  
Sbjct  15   SSMIYIPATILSLIFCGFIVHILTRKILGKHGKKRLYHPIGGTIFNQLLNFHRLHHYMTD  74

Query  179  YLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADG  358
                  +  +  PF    Y A P NVE++LKTNF NY +G  +HS +  LLGDGIF  DG
Sbjct  75   LAGKYRTYRLISPFRNEIYTADPVNVEYILKTNFDNYGRGRYHHSILTDLLGDGIFTVDG  134

Query  359  ELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLD  538
            + WR+QRK +S EF+++ LRDFS+V+FR    KL  +L++A+  ++ VD+QDL M+ TLD
Sbjct  135  DKWREQRKLSSHEFSTRVLRDFSSVIFRKNVAKLAHMLSEAANSSKIVDIQDLFMKATLD  194

Query  539  SICKVGFGV  565
            SI +V FGV
Sbjct  195  SIFRVAFGV  203



>ref|XP_009776440.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Nicotiana sylvestris]
Length=519

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 118/189 (62%), Gaps = 4/189 (2%)
 Frame = +2

Query  11   SSMETLVLALGLIMFCWVFIHRLSQR---KGGGPRSWPVIGASV-EQMTNYGRMHDWLVG  178
            SSM  +   +  ++FC   +H L+++   K G  R +  IG ++  Q+ N+ R+H ++  
Sbjct  15   SSMIYIPATILSLIFCGFIVHILTRKILGKHGKKRLYHPIGGTIFNQLLNFHRLHHYMTD  74

Query  179  YLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADG  358
                  +  +  PF    Y A P NVE++LKTNF NY +G  +HS +  LLGDGIF  DG
Sbjct  75   LAGKYRTYRLISPFRNEIYTADPVNVEYILKTNFDNYGRGRYHHSILTDLLGDGIFTVDG  134

Query  359  ELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLD  538
            + WR+QRK +S EF+++ LRDFS+V+FR    KL  +L++A+  ++ VD+QDL M+ TLD
Sbjct  135  DKWREQRKLSSHEFSTRVLRDFSSVIFRKNVAKLAHMLSEAANSSKIVDIQDLFMKATLD  194

Query  539  SICKVGFGV  565
            SI +V FGV
Sbjct  195  SIFRVAFGV  203



>gb|KCW78247.1| hypothetical protein EUGRSUZ_D02436, partial [Eucalyptus grandis]
Length=370

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 99/151 (66%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            P+ G  + Q+ N+GR+H ++        +  +  PF +  Y + P NVE++LK NF NY 
Sbjct  19   PIAGTVLNQLLNFGRLHHYMTDLAGKHGTYRLLGPFWSEVYTSDPANVEYMLKINFENYG  78

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
             G+  +S ++ L GDGIF  DG+ WR+QRK +S EF++K LRDFS+VVFR  + KL   L
Sbjct  79   TGQYNNSLLKDLFGDGIFAVDGDKWRQQRKVSSYEFSTKVLRDFSSVVFRRNAAKLANTL  138

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            ++A+  NQ VDMQDL M+ TLDSI KV FGV
Sbjct  139  SEAASTNQIVDMQDLFMKSTLDSIFKVAFGV  169



>ref|XP_002963351.1| hypothetical protein SELMODRAFT_80855 [Selaginella moellendorffii]
 gb|EFJ35222.1| hypothetical protein SELMODRAFT_80855 [Selaginella moellendorffii]
Length=504

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 106/169 (63%), Gaps = 4/169 (2%)
 Frame = +2

Query  68   IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM--PFTTYTYIA  241
            IHR S R GG     P+IG +VE + NY R+ D L+    +  +  VP+  P  +Y +  
Sbjct  18   IHRFS-RGGGRDGGLPLIGHTVEILANYHRIFDLLLEKFQSQGTSTVPLWIPGQSYVFTV  76

Query  242  HPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD  421
             P NVE++LKT F N+PKGE +    + LLG GIFNADG  W+ QRK AS EFAS+ LR+
Sbjct  77   DPANVEYILKTRFQNFPKGERFREKFQPLLGGGIFNADGAAWKSQRKAASFEFASRVLRE  136

Query  422  FSTVVFRDYSLKLFTILT-QASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +S  VFRD++L+L  IL   A   +  +  +DL  RMTLD+IC +GFGV
Sbjct  137  WSGSVFRDHALELARILPGNAGKKDLSLLPRDLFQRMTLDTICSLGFGV  185



>ref|XP_002974639.1| hypothetical protein SELMODRAFT_101746 [Selaginella moellendorffii]
 gb|EFJ24159.1| hypothetical protein SELMODRAFT_101746 [Selaginella moellendorffii]
Length=504

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 106/169 (63%), Gaps = 4/169 (2%)
 Frame = +2

Query  68   IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM--PFTTYTYIA  241
            IHR S R GG     P+IG +VE + NY R+ D L+    +  +  VP+  P  +Y +  
Sbjct  18   IHRFS-RGGGRDGGLPLIGHTVEILANYHRIFDLLLEKFQSQGTSTVPLWIPGQSYVFTV  76

Query  242  HPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD  421
             P NVE++LKT F N+PKGE +    + LLG GIFNADG  W+ QRK AS EFAS+ LR+
Sbjct  77   DPANVEYILKTRFQNFPKGERFREKFQPLLGGGIFNADGAAWKSQRKAASFEFASRVLRE  136

Query  422  FSTVVFRDYSLKLFTILT-QASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +S  VFRD++L+L  IL   A   +  +  +DL  RMTLD+IC +GFGV
Sbjct  137  WSGSVFRDHALELARILPGNAGKKDLSLLPRDLFQRMTLDTICSLGFGV  185



>ref|XP_004133898.1| PREDICTED: cytochrome P450 704C1-like [Cucumis sativus]
 gb|KGN56576.1| Cytochrome P450 [Cucumis sativus]
Length=503

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 111/179 (62%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            +L   +++   + + ++  RK    +  P+ G    Q+ N+ R+HD++        +  +
Sbjct  8    ILVAAVLLLISIVVMQILTRKLRKKKYHPIAGTVFHQLLNFHRLHDYMTDLARKHKTYKL  67

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    Y + P NVE++L+TNF N+ KG   +  +  LLGDGIF  DGE WR+QRK +
Sbjct  68   LGPFRDEVYTSDPPNVEYMLRTNFENFGKGSHNYRILRDLLGDGIFTVDGEKWREQRKIS  127

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRD+STV+FR  ++KL  I+++A++ N+ +D+QDL M+ TLDSI  V FG+
Sbjct  128  SYEFSTKVLRDYSTVIFRKTAVKLANIVSEAAISNRVIDIQDLFMKSTLDSIFHVSFGI  186



>ref|XP_004155805.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 704C1-like [Cucumis 
sativus]
Length=503

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 111/179 (62%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            +L   +++   + + ++  RK    +  P+ G    Q+ N+ R+HD++        +  +
Sbjct  8    ILVAAVLLLISIVVMQILTRKLRKKKYHPIAGTVFHQLLNFHRLHDYMTDLARKHKTYKL  67

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    Y + P NVE++L+TNF N+ KG   +  +  LLGDGIF  DGE WR+QRK +
Sbjct  68   LGPFRDEVYTSDPPNVEYMLRTNFENFGKGSHNYRILRDLLGDGIFTVDGEKWREQRKIS  127

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRD+STV+FR  ++KL  I+++A++ N+ +D+QDL M+ TLDSI  V FG+
Sbjct  128  SYEFSTKVLRDYSTVIFRKTAVKLANIVSEAAISNRVIDIQDLFMKSTLDSIFHVSFGI  186



>ref|XP_010277455.1| PREDICTED: cytochrome P450 704C1-like [Nelumbo nucifera]
Length=520

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 112/187 (60%), Gaps = 3/187 (2%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIH---RLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL  184
            S+   V AL +++   VF     + S ++G   R  P+ G    Q+ N+ R+H ++    
Sbjct  10   SVSLTVTALAVVLAILVFKAISTKTSSQRGTKKRYHPIAGTIFNQLLNFHRLHHYMTDLA  69

Query  185  ANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGEL  364
                +  +  PF    Y A P NVE++LKTNF N+ KG   +  +  LLGDGIF  DGE 
Sbjct  70   IKYGTYRLLSPFRNEVYTADPVNVEYMLKTNFANFGKGLHNYEILSDLLGDGIFTVDGEK  129

Query  365  WRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSI  544
            WR QRK +S EF++K LRD+S+VVFR  +++L  +L+ ++  NQ  D+QDL M+ TLDSI
Sbjct  130  WRHQRKVSSYEFSAKVLRDYSSVVFRRNAVRLAKMLSDSAASNQIFDIQDLFMKSTLDSI  189

Query  545  CKVGFGV  565
             KVGFGV
Sbjct  190  FKVGFGV  196



>ref|XP_008438128.1| PREDICTED: cytochrome P450 704C1-like [Cucumis melo]
Length=503

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 111/179 (62%), Gaps = 5/179 (3%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            VL L  I+   +  H+L ++K       P+ G    Q+ N+ R+HD++        +  +
Sbjct  13   VLLLISIVVRLILTHKLRKKK-----YHPIAGTVFHQLLNFHRLHDYMTDLARKHKTYKL  67

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    Y + P NVE++L+TNF N+ KG   H  +  LLGDGIF  DGE WR+QRK +
Sbjct  68   LGPFRDEVYTSDPPNVEYMLRTNFENFGKGSHNHRILRDLLGDGIFTVDGEKWREQRKIS  127

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRD+S+V+FR  ++KL  I+++A++ N+ +D+QDL M+ TLDSI  V FG+
Sbjct  128  SYEFSTKVLRDYSSVIFRKTAVKLANIVSEAAISNRVIDIQDLFMKSTLDSIFYVSFGI  186



>ref|XP_009389623.1| PREDICTED: cytochrome P450 704C1-like [Musa acuminata subsp. 
malaccensis]
Length=521

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 99/170 (58%), Gaps = 6/170 (4%)
 Frame = +2

Query  56   CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTY  235
            C   +HR   RK   P   PV G    Q+ N  ++ D+         +  +  PF  Y Y
Sbjct  34   CSSSVHR---RKPNYP---PVAGTVFHQLLNLRQLADFQTDLSRKYRTFRILTPFCNYVY  87

Query  236  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  415
               P NVEH+LKTNF NY KG   +  M    GDGIF  D E WR QRK AS EF++K L
Sbjct  88   TVDPANVEHILKTNFANYGKGSFTYDLMCDFFGDGIFAVDDEKWRHQRKLASFEFSTKVL  147

Query  416  RDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            RD S+VVFR  + +L  I++ A+  N+ +++QDLLM+ TLDSICKVGFGV
Sbjct  148  RDSSSVVFRSTAARLAKIISNAARSNEMIEIQDLLMKSTLDSICKVGFGV  197



>dbj|BAJ91929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=294

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 97/151 (64%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV GA ++Q+ N+GR+ +++        +  +  P   + Y   P NVEH+L+ NF NY 
Sbjct  48   PVAGAMLQQLLNWGRLPEYMTELSRRHRTFRMLTPTCNWVYTVDPANVEHILRANFANYG  107

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG + H  +E LLGDGIFN DG  WR QRK AS EF ++ LRD+S+ VFRD + +L  ++
Sbjct  108  KGAMAHGVLEDLLGDGIFNVDGAKWRHQRKVASFEFTTRVLRDYSSGVFRDVAAELAGMV  167

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
              A+   ++VDM++L MR TLDSI  +GFGV
Sbjct  168  AAAADAGERVDMENLFMRSTLDSIFTIGFGV  198



>ref|XP_003581548.1| PREDICTED: cytochrome P450 704C1-like [Brachypodium distachyon]
Length=511

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            P+ G  + Q+ N+GR+ ++         +  +  P  +Y Y   P NVEH+L+TNF NY 
Sbjct  32   PIAGTVLHQLLNFGRLVEYQTELSRKHRTYRMLTPTCSYVYTVEPANVEHILRTNFANYG  91

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG + H  +E LLGDGIFN DG  WR QRK AS EF+++ LR++ST VFRD + +L  I+
Sbjct  92   KGAMTHDVLEDLLGDGIFNVDGAKWRHQRKAASFEFSTRVLREYSTGVFRDTAAELAGIV  151

Query  473  TQASLLNQQ-VDMQDLLMRMTLDSICKVGFGV  565
              A+   ++ VDMQDLLMR TLDSI ++GFGV
Sbjct  152  AVAAARGERAVDMQDLLMRSTLDSIFQIGFGV  183



>ref|XP_010692303.1| PREDICTED: cytochrome P450 704C1-like [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 98/157 (62%), Gaps = 0/157 (0%)
 Frame = +2

Query  95   GGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKT  274
            G  +  P+ G    Q+ N+ R+H ++    A   +  +  PF +  Y + P NVE++LKT
Sbjct  39   GNKKYHPIAGTMFHQLINFKRLHHYMTNLAAKYKTYRLLTPFRSEIYTSDPANVEYILKT  98

Query  275  NFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSL  454
            NF NY KGE  +  +  LLGDGIF  DGE WR QRK +S EF+++ LRDFS+ +FR   +
Sbjct  99   NFDNYGKGEYNYGNLSDLLGDGIFAVDGEKWRHQRKVSSYEFSTRVLRDFSSKIFRKNVV  158

Query  455  KLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            KL  I+  A+  NQ +D+QDL M+ TLDSI KV FGV
Sbjct  159  KLAKIIADAANSNQIMDIQDLFMKSTLDSIFKVAFGV  195



>ref|XP_006848139.1| hypothetical protein AMTR_s00029p00225720 [Amborella trichopoda]
 gb|ERN09720.1| hypothetical protein AMTR_s00029p00225720 [Amborella trichopoda]
Length=392

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 102/167 (61%), Gaps = 11/167 (7%)
 Frame = +2

Query  95   GGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS-----YSVVVPMPFTTY-----TYIAH  244
             GPR WP +G+      N  R+HDW+   L NS      + + P+PF +      T  A+
Sbjct  31   SGPRVWPFLGSLPSLFLNRRRLHDWIASNLKNSPTLTYQTCICPLPFLSLKQGLVTVTAN  90

Query  245  PDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD-  421
            P N+EH+LKT F NYPKG  + +    LLG GIFN+DGE W  QRKTA+LEF ++ L++ 
Sbjct  91   PKNLEHILKTRFENYPKGPHWQAAFHDLLGSGIFNSDGESWVVQRKTAALEFTTRTLKNS  150

Query  422  FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
             +  V R   L+L+ IL +A  L + V++QDLL+R+T D+IC + FG
Sbjct  151  MARWVNRAIKLRLWCILDRAQTLEKAVNLQDLLLRLTFDNICGLAFG  197



>ref|XP_002974847.1| hypothetical protein SELMODRAFT_414990 [Selaginella moellendorffii]
 gb|EFJ24367.1| hypothetical protein SELMODRAFT_414990 [Selaginella moellendorffii]
Length=496

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 103/168 (61%), Gaps = 17/168 (10%)
 Frame = +2

Query  68   IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM--PFTTYTYIA  241
            IHR S R GG     P+IG +VE + NY R+ D L+    +  +  VP+  P  +Y +  
Sbjct  22   IHRFS-RGGGRDGGLPLIGHTVEVLANYHRIFDLLLEKFQSQGTSTVPLWIPGQSYVFTV  80

Query  242  HPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD  421
             P NVE++LKT F N+PKGE +    + LLG GIFNADG  W+ QRKTAS EFAS+ LR+
Sbjct  81   DPANVEYILKTRFQNFPKGERFREKFQPLLGAGIFNADGAAWKSQRKTASFEFASRVLRE  140

Query  422  FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +S  VFRD++L+L  I              DL +RMTLD+IC +GFGV
Sbjct  141  WSGSVFRDHALELARI--------------DLFLRMTLDTICNLGFGV  174



>ref|XP_002963763.1| hypothetical protein SELMODRAFT_405166 [Selaginella moellendorffii]
 gb|EFJ35634.1| hypothetical protein SELMODRAFT_405166 [Selaginella moellendorffii]
Length=496

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 103/168 (61%), Gaps = 17/168 (10%)
 Frame = +2

Query  68   IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM--PFTTYTYIA  241
            IHR S R GG     P+IG +VE + NY R+ D L+    +  +  VP+  P  +Y +  
Sbjct  22   IHRFS-RGGGRDGGLPLIGHTVEVLANYHRIFDLLLQKFQSQGTSTVPLWIPGQSYVFTV  80

Query  242  HPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD  421
             P NVE++LKT F N+PKGE +    + LLG GIFNADG  W+ QRKTAS EFAS+ LR+
Sbjct  81   DPANVEYILKTRFQNFPKGERFREKFQPLLGGGIFNADGAAWKSQRKTASFEFASRVLRE  140

Query  422  FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +S  VFRD++L+L  I              DL +RMTLD+IC +GFGV
Sbjct  141  WSGSVFRDHALELARI--------------DLFLRMTLDTICNLGFGV  174



>ref|XP_011091066.1| PREDICTED: cytochrome P450 704C1-like [Sesamum indicum]
Length=515

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 107/173 (62%), Gaps = 0/173 (0%)
 Frame = +2

Query  47   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT  226
            ++F  + +  LS++  G  R  P+ G    Q+ N+ R+HD++        +  +  PF T
Sbjct  22   VLFSVLIVRFLSRKLLGKKRYHPIGGTVFNQLLNFYRLHDYMADLAGKYKTYRLIAPFRT  81

Query  227  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  406
              Y + P NVEH+LKTNF +Y KG    S +  L G+GIF  DG  WR+QRK +SLEF++
Sbjct  82   EVYTSDPANVEHMLKTNFESYGKGPYNCSILGDLFGEGIFAIDGHKWREQRKVSSLEFST  141

Query  407  KNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            + LRD+S++VFR  +++L  IL+ A+  NQ VD+QDL M+ T DSI +V  GV
Sbjct  142  RVLRDYSSIVFRKNAVRLAKILSGAATSNQPVDIQDLFMKSTFDSISEVALGV  194



>ref|XP_004294257.2| PREDICTED: cytochrome P450 86A1 [Fragaria vesca subsp. vesca]
Length=553

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 117/198 (59%), Gaps = 18/198 (9%)
 Frame = +2

Query  17   METLVL----ALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL  184
            METL L    A    ++C+ F   L  RK  GP+ WPV+G+     TN  R+HDW+   L
Sbjct  34   METLTLFFTLAAATSVYCFWFY--LLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNL  91

Query  185  -----ANSY-SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLL  331
                 +++Y +  + +PF       +T   HP N+EH+L+T F NYPKG  + +    LL
Sbjct  92   RATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLL  151

Query  332  GDGIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDM  508
            G+GIFN+DGE W  QRKTA+LEF ++ LR   +  V R    +L+ IL +AS  +  VD+
Sbjct  152  GEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDL  211

Query  509  QDLLMRMTLDSICKVGFG  562
            QDLL+R+T D+IC + FG
Sbjct  212  QDLLLRLTFDNICGLTFG  229



>ref|XP_010043449.1| PREDICTED: cytochrome P450 86A1 [Eucalyptus grandis]
 gb|KCW85461.1| hypothetical protein EUGRSUZ_B02269 [Eucalyptus grandis]
Length=515

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 109/199 (55%), Gaps = 20/199 (10%)
 Frame = +2

Query  17   METLVL-----ALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY  181
            MET VL     AL      W +   L  RK  GP+ WPV+G+      N  R+HDW+ G+
Sbjct  1    METSVLLFNLSALACAYLIWFY---LLARKLTGPKVWPVVGSLPSLFMNRRRLHDWIAGH  57

Query  182  L------ANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVL  328
            L      A   +  + +PF       YT   HP N+EHVL+T F NYPKG  + +    L
Sbjct  58   LRATGGAATYQTCTIALPFLARKQGFYTVTCHPKNIEHVLRTRFDNYPKGPTWQTAFHDL  117

Query  329  LGDGIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVD  505
            LG GIFN+DGE W  QRKTA+LEF ++ LR      V R    + + IL +A+     +D
Sbjct  118  LGQGIFNSDGETWLLQRKTAALEFTTRTLRQAMDRWVNRTIKNRFWKILDKAASERISID  177

Query  506  MQDLLMRMTLDSICKVGFG  562
            +QDLL+R+T D+IC + FG
Sbjct  178  LQDLLLRLTFDNICGLTFG  196



>gb|ACU18763.1| unknown [Glycine max]
Length=249

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 104/179 (58%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
             L+  L +     + R   ++    +  PV G    QM N+ R++ ++    A   +  +
Sbjct  16   ALSASLTLLVVQLLFRKLNKRHSRKKYHPVAGTIFNQMLNFNRLYHYMTDLAAKHRTYRL  75

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    Y   P NVE++LKTNF NY KG   +  ++ LLGDGIF  DGE WR+QRK +
Sbjct  76   LNPFRYEVYTTEPTNVEYILKTNFENYGKGLYNYHNLKDLLGDGIFTVDGEKWREQRKIS  135

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRDFS  +FR   +KL  I+++A+  N  +++QDLLM+ TLDSI +V FG 
Sbjct  136  SHEFSTKMLRDFSISIFRKNVVKLVNIVSEAATSNSTLEIQDLLMKSTLDSIFQVAFGT  194



>gb|KJB41136.1| hypothetical protein B456_007G092600 [Gossypium raimondii]
Length=506

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 105/167 (63%), Gaps = 1/167 (1%)
 Frame = +2

Query  65   FIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAH  244
            F  +L Q++    +  PV G  +  + N+ R+H ++    A   +  +  P+ +  + + 
Sbjct  24   FTAKLKQKQTKN-KYHPVAGTIINLLLNFNRLHHYMADLAAKYRTYRLLSPYRSEIHTSE  82

Query  245  PDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDF  424
            P NVE++LKTNF NY KGE  HS +    G+GIF  DG+ WR+QRK +S EF++K LRDF
Sbjct  83   PANVEYILKTNFDNYGKGEYNHSLLRDFFGEGIFTVDGDKWRQQRKASSYEFSTKVLRDF  142

Query  425  STVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S+VVFR    +L  I+++A++ N  +DMQDL ++ TLDSI KV FGV
Sbjct  143  SSVVFRKNVARLANIVSEAAISNDTMDMQDLFLKSTLDSIFKVAFGV  189



>emb|CBI38796.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 108/179 (60%), Gaps = 3/179 (2%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            + AL L+    + + + +++K    R  P+ G    Q+ N+ R+H ++        +  +
Sbjct  17   ISALTLVFLVKILVGKSTEKK---RRYHPIGGTIFNQLFNFNRLHHYMTDLAGKHRTYRL  73

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    Y A P NVE++LKTNF NY KG   ++ +  LLGDGIF  D E WR+QRK +
Sbjct  74   LSPFRNEIYTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTVDDEKWRQQRKVS  133

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRDFS+VVFR    KL  ++++A+  N+ +D+Q L M+ TLDSI KV FGV
Sbjct  134  SYEFSTKVLRDFSSVVFRKNGAKLAKVVSEAARSNRTMDIQGLFMKATLDSISKVAFGV  192



>ref|XP_010650931.1| PREDICTED: cytochrome P450 86A1 [Vitis vinifera]
 emb|CBI15990.3| unnamed protein product [Vitis vinifera]
Length=519

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 111/199 (56%), Gaps = 15/199 (8%)
 Frame = +2

Query  2    LKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY  181
            ++  S+   V+A       W +   L  RK  GP+ WPV+G+      N  R+HDW+ G 
Sbjct  1    METPSIVFFVVAAASAYVLWFY---LLARKLTGPKMWPVVGSLPALFMNRRRIHDWISGN  57

Query  182  L------ANSYSVVVPMPFTTY-----TYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVL  328
            L      A   +  + +PF  Y     T   HP N+EH+L+T F NYPKG  + +    L
Sbjct  58   LRETGGAATYQTCTLALPFLAYKQGFYTVTCHPKNIEHILRTRFDNYPKGPTWQTAFHDL  117

Query  329  LGDGIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVD  505
            LG GIFN+DG+ W  QRKTA+LEF ++ LR   S  V R   ++L+ IL +A+     VD
Sbjct  118  LGQGIFNSDGDTWLIQRKTAALEFTTRTLRQAMSRWVNRTIKMRLWRILEKAASEKSSVD  177

Query  506  MQDLLMRMTLDSICKVGFG  562
            MQDLL+R+T D+IC + FG
Sbjct  178  MQDLLLRLTFDNICGLTFG  196



>gb|KHG09033.1| Cytochrome P450 protein [Gossypium arboreum]
Length=506

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 105/167 (63%), Gaps = 1/167 (1%)
 Frame = +2

Query  65   FIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAH  244
            F  +L Q++    +  PV G  +  + N+ R+H ++    A   +  +  P+ +  + + 
Sbjct  24   FTAKLKQKQTKN-KYHPVAGTIINLLLNFNRLHHYMAHLAAKYRTYRLLSPYRSEIHTSE  82

Query  245  PDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDF  424
            P NVE++LKTNF NY KGE  HS +    G+GIF  DG+ WR+QRK +S EF++K LRDF
Sbjct  83   PANVEYILKTNFDNYGKGEYNHSLLRDFFGEGIFTVDGDKWRQQRKASSYEFSTKVLRDF  142

Query  425  STVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S+VVFR    +L  I+++A+  N+ +DMQDL M+ TLDSI KV FGV
Sbjct  143  SSVVFRKNVARLANIVSEAANSNETMDMQDLFMKSTLDSIFKVAFGV  189



>ref|XP_008232728.1| PREDICTED: uncharacterized protein LOC103331840 [Prunus mume]
Length=1036

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 114/182 (63%), Gaps = 4/182 (2%)
 Frame = +2

Query  17   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  196
            +  LVLAL  I    +   +L++ K   P   P+ G  + Q+ N+ R+HD++        
Sbjct  544  LTALVLALS-IFTAQILARKLTKAKKKHP---PIAGTVLHQLLNFNRLHDYMTDLAGKHK  599

Query  197  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  376
            +  +  PF    Y ++P+NVE++LKTNF NY KG   ++ ++ LLGDGIF  DGE WR+Q
Sbjct  600  TYRLLGPFRNEIYTSNPENVEYILKTNFDNYGKGWYNYNILKDLLGDGIFAVDGEKWRQQ  659

Query  377  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  556
            RK +S EF++K LRDFS+V+FR  + KL   +++ +  NQ +D+QDL M+ +LDSI +V 
Sbjct  660  RKISSHEFSTKVLRDFSSVIFRKNAAKLADKVSEIATSNQAIDIQDLFMKSSLDSIFQVA  719

Query  557  FG  562
            FG
Sbjct  720  FG  721


 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 90/156 (58%), Gaps = 0/156 (0%)
 Frame = +2

Query  98   GPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTN  277
             P   PV G    Q+  + R++D+         +  +  P  +  Y     N+EHVLKTN
Sbjct  34   NPNYPPVKGTVFHQLLYFNRLYDYQTEVAKEHTTYRLLAPEHSAIYTTDTRNIEHVLKTN  93

Query  278  FPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLK  457
            F +Y KGE   + +  + G GIF  DGE W++QRK AS EF+++ LRD S  VFR  + K
Sbjct  94   FGSYSKGEYNQAILSDVFGQGIFVVDGEKWKQQRKLASFEFSTRVLRDVSCSVFRRKAAK  153

Query  458  LFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            L  ++ + S+  +  DMQDLLMR TLDSI KVGFG+
Sbjct  154  LVKVIFEISVARRVFDMQDLLMRCTLDSIFKVGFGI  189



>ref|XP_009593544.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Nicotiana tomentosiformis]
Length=520

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 115/180 (64%), Gaps = 5/180 (3%)
 Frame = +2

Query  38   LGLIMFCWVFIHRLSQR---KGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLANSYSVV  205
            L LI F ++ +H L+++   K G  R +  IG ++  Q+ N+ R+H ++        +  
Sbjct  25   LSLICFGFI-VHILTRKVLGKHGKKRLYHPIGGTIFNQLINFHRLHHYMTDLAGKYRTYR  83

Query  206  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  385
            +  PF    Y A P NVE++LKTNF NY +G  +HS +  LLGDGIF  DG+ WR+QRK 
Sbjct  84   LISPFRNEIYTADPVNVEYILKTNFDNYGRGRYHHSILTDLLGDGIFTVDGDEWREQRKL  143

Query  386  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +S EF+++ LRDFS+V+FR    KL  +L++A+  ++ VD+QDL M+ TLDSI +V FGV
Sbjct  144  SSHEFSTRVLRDFSSVIFRKNVAKLAHMLSEAANSSKIVDIQDLFMKATLDSIFRVAFGV  203



>ref|XP_010326134.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Solanum lycopersicum]
Length=475

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 106/172 (62%), Gaps = 0/172 (0%)
 Frame = +2

Query  50   MFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTY  229
            +FC   +H L+++     R  P+ G    Q+ N+ R+H ++        +  +  PF   
Sbjct  45   LFCGFIVHLLTRKLHDKRRYHPIGGTIFNQLINFHRLHHFMTDLAGKYKTYRLISPFRNE  104

Query  230  TYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASK  409
             Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DG+ WR+QRK +S EF+++
Sbjct  105  IYTSDPANVEYILKTNFDNYGKGWHSYSILKDLLGDGIFAVDGDKWREQRKLSSHEFSTR  164

Query  410  NLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             LRDFS+VVFR  + K   IL++    N+ VD+QDL M+ TLDS+ KV FGV
Sbjct  165  VLRDFSSVVFRKNAAKFAHILSELVKSNKIVDIQDLFMKATLDSVFKVAFGV  216



>ref|XP_002270628.3| PREDICTED: cytochrome P450 704C1-like [Vitis vinifera]
Length=528

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 108/179 (60%), Gaps = 3/179 (2%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            + AL L+    + + + +++K    R  P+ G    Q+ N+ R+H ++        +  +
Sbjct  30   ISALTLVFLVKILVGKSTEKK---RRYHPIGGTIFNQLFNFNRLHHYMTDLAGKHRTYRL  86

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    Y A P NVE++LKTNF NY KG   ++ +  LLGDGIF  D E WR+QRK +
Sbjct  87   LSPFRNEIYTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTVDDEKWRQQRKVS  146

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRDFS+VVFR    KL  ++++A+  N+ +D+Q L M+ TLDSI KV FGV
Sbjct  147  SYEFSTKVLRDFSSVVFRKNGAKLAKVVSEAARSNRTMDIQGLFMKATLDSISKVAFGV  205



>ref|XP_009593543.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Nicotiana tomentosiformis]
Length=522

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 115/180 (64%), Gaps = 5/180 (3%)
 Frame = +2

Query  38   LGLIMFCWVFIHRLSQR---KGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLANSYSVV  205
            L LI F ++ +H L+++   K G  R +  IG ++  Q+ N+ R+H ++        +  
Sbjct  25   LSLICFGFI-VHILTRKVLGKHGKKRLYHPIGGTIFNQLINFHRLHHYMTDLAGKYRTYR  83

Query  206  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  385
            +  PF    Y A P NVE++LKTNF NY +G  +HS +  LLGDGIF  DG+ WR+QRK 
Sbjct  84   LISPFRNEIYTADPVNVEYILKTNFDNYGRGRYHHSILTDLLGDGIFTVDGDEWREQRKL  143

Query  386  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +S EF+++ LRDFS+V+FR    KL  +L++A+  ++ VD+QDL M+ TLDSI +V FGV
Sbjct  144  SSHEFSTRVLRDFSSVIFRKNVAKLAHMLSEAANSSKIVDIQDLFMKATLDSIFRVAFGV  203



>ref|XP_006339778.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
 ref|XP_006339782.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=499

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 108/176 (61%), Gaps = 0/176 (0%)
 Frame = +2

Query  38   LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  217
            + L++FC    H L+++  G  R  P+ G     + N+ R+H ++        +  +  P
Sbjct  8    ISLLLFCVFIRHFLTKKLHGKKRYHPIGGTVFNLLINFHRVHHYMTDLAGKYKTYRLISP  67

Query  218  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  397
            F    + + P NVE++LKTNF NY KG   +  ++ LLGDGIF  DG+ WR+QRK +S +
Sbjct  68   FKNRIFTSDPANVEYILKTNFENYGKGGYNYYILKDLLGDGIFTVDGDKWREQRKLSSHD  127

Query  398  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            F+++ LRDFS+VVFR  + K   ILT+A   N+ VD+QDL M+ +LDSI +V FGV
Sbjct  128  FSTRVLRDFSSVVFRKNAAKFAHILTEAVKSNKIVDIQDLFMKASLDSIFRVAFGV  183



>gb|KJB55751.1| hypothetical protein B456_009G092900 [Gossypium raimondii]
Length=511

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 110/196 (56%), Gaps = 14/196 (7%)
 Frame = +2

Query  17   METL--VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL--  184
            METL  V +L   +F +        RK  GPR WP++G+      N  R+HDW+   L  
Sbjct  1    METLQLVFSLAAAIFAYSIWFHFLARKLTGPRVWPLVGSLPLLFMNRRRIHDWIASNLRA  60

Query  185  ----ANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
                A   +  + +PF       YT   HP N+EH+L+T F NYPKG  + +    LLG 
Sbjct  61   TGGSATYQTCTIALPFLARKQGFYTVTCHPKNIEHILRTRFDNYPKGPHWQAAFHDLLGQ  120

Query  338  GIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQD  514
            GIFN+DGE W  QRKTA+LEF ++ LR   +  V R    +L+ IL +A+   + VD+QD
Sbjct  121  GIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRSIKNRLWCILDKAANEKESVDLQD  180

Query  515  LLMRMTLDSICKVGFG  562
            LL+R+T D+IC + FG
Sbjct  181  LLLRLTFDNICGLTFG  196



>emb|CAN80040.1| hypothetical protein VITISV_037194 [Vitis vinifera]
Length=580

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 107/188 (57%), Gaps = 10/188 (5%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS----Y  196
            VL L  I+  ++   R   R   GPR WPV+G+    + N  RMH+W+   L +      
Sbjct  6    VLLLLAIITAYLIWFRSITRSLKGPRVWPVVGSLPLLIQNANRMHEWIAENLRSCGGTYQ  65

Query  197  SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGE  361
            + + P+PF        T    P N+EH+LK  F NYPKG  + +    LLG+GIFN+DGE
Sbjct  66   TCICPIPFLARKQGLVTVTCDPKNLEHILKIRFDNYPKGPTWQAVFHDLLGEGIFNSDGE  125

Query  362  LWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLD  538
             WR QRKTA+LEF ++ LR   +  V R   L+   IL +A L  + VD+QDLL+R+T D
Sbjct  126  TWRFQRKTAALEFTTRTLRQAMARWVTRAIKLRFCPILKKAQLEGKPVDLQDLLLRLTFD  185

Query  539  SICKVGFG  562
            +IC + FG
Sbjct  186  NICGLAFG  193



>ref|XP_010056272.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
 gb|KCW72921.1| hypothetical protein EUGRSUZ_E01363 [Eucalyptus grandis]
Length=513

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 94/151 (62%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G    Q+  + R++D+  G    + +  +  P  +  Y A P NVEH+LKTNF  Y 
Sbjct  44   PVHGTVFGQLFYFNRLYDYQTGVAKRTTTFRILAPDQSEIYTADPRNVEHILKTNFEKYT  103

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KGE     ++ L G+GIF  DGE W+KQRK AS EFA++ LRDFS  VFR  S KL  ++
Sbjct  104  KGEYNKDIVKDLFGEGIFAVDGEKWKKQRKVASFEFATRVLRDFSCCVFRQNSAKLVKVV  163

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             + S  ++  DMQDLLMR TLDSI KVGFGV
Sbjct  164  EELSAASEGFDMQDLLMRCTLDSIFKVGFGV  194



>ref|XP_002275806.1| PREDICTED: cytochrome P450 86A7 [Vitis vinifera]
Length=545

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 107/188 (57%), Gaps = 10/188 (5%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS----Y  196
            VL L  I+  ++   R   R   GPR WPV+G+    + N  RMH+W+   L +      
Sbjct  6    VLLLLAIITAYLIWFRSITRSLKGPRVWPVVGSLPLLIQNANRMHEWIAENLRSCGGTYQ  65

Query  197  SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGE  361
            + + P+PF        T    P N+EH+LK  F NYPKG  + +    LLG+GIFN+DGE
Sbjct  66   TCICPIPFLARKQGLVTVTCDPKNLEHILKIRFDNYPKGPTWQAVFHDLLGEGIFNSDGE  125

Query  362  LWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLD  538
             WR QRKTA+LEF ++ LR   +  V R   L+   IL +A L  + VD+QDLL+R+T D
Sbjct  126  TWRFQRKTAALEFTTRTLRQAMARWVTRAIKLRFCPILKKAQLEGKPVDLQDLLLRLTFD  185

Query  539  SICKVGFG  562
            +IC + FG
Sbjct  186  NICGLAFG  193



>ref|XP_007016155.1| Cytochrome P450, family 86, subfamily A, polypeptide 1 [Theobroma 
cacao]
 gb|EOY33774.1| Cytochrome P450, family 86, subfamily A, polypeptide 1 [Theobroma 
cacao]
Length=511

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 112/196 (57%), Gaps = 14/196 (7%)
 Frame = +2

Query  17   METL--VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL--  184
            METL  V +L   +F +     L  R+  GPR WP++G+    + N GR+HDW+   L  
Sbjct  1    METLTFVFSLAAAIFAYALWFHLLVRRLTGPRVWPIVGSLPYLVMNRGRIHDWIASNLRA  60

Query  185  ----ANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
                A   +  + +P        YT   HP N+EH+L+T F NYPKG  + +    LLG 
Sbjct  61   TGGSATYQTCTIALPCLARKQGFYTVTCHPKNIEHILRTRFDNYPKGPHWQAAFHDLLGQ  120

Query  338  GIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQD  514
            GIFN+DGE W  QRKTA+LEF ++ LR   +  V R    +L+ IL +AS   + VD+Q+
Sbjct  121  GIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIKNRLWCILDKASNEKKWVDLQE  180

Query  515  LLMRMTLDSICKVGFG  562
            LL+R+T D+IC + FG
Sbjct  181  LLLRLTFDNICGLTFG  196



>ref|XP_004231178.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Solanum lycopersicum]
Length=533

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 114/193 (59%), Gaps = 7/193 (4%)
 Frame = +2

Query  8    VSSMETLVLALGLI-------MFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHD  166
            + SME L  ++  I       +FC   +H L+++     R  P+ G    Q+ N+ R+H 
Sbjct  24   IVSMEILDCSIMSITATVVSFLFCGFIVHLLTRKLHDKRRYHPIGGTIFNQLINFHRLHH  83

Query  167  WLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  346
            ++        +  +  PF    Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF
Sbjct  84   FMTDLAGKYKTYRLISPFRNEIYTSDPANVEYILKTNFDNYGKGWHSYSILKDLLGDGIF  143

Query  347  NADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMR  526
              DG+ WR+QRK +S EF+++ LRDFS+VVFR  + K   IL++    N+ VD+QDL M+
Sbjct  144  AVDGDKWREQRKLSSHEFSTRVLRDFSSVVFRKNAAKFAHILSELVKSNKIVDIQDLFMK  203

Query  527  MTLDSICKVGFGV  565
             TLDS+ KV FGV
Sbjct  204  ATLDSVFKVAFGV  216



>ref|XP_003544876.2| PREDICTED: cytochrome P450 86A1-like [Glycine max]
Length=540

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 112/199 (56%), Gaps = 20/199 (10%)
 Frame = +2

Query  17   METLVLALGLIM-----FCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY  181
            METL L L L+      F W   H L+ R   GP+ WP++G+      N  R+HDW+   
Sbjct  21   METLPLLLTLVATLSAYFLW--FHLLA-RTLTGPKPWPLVGSLPGLFRNRDRVHDWIADN  77

Query  182  L------ANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVL  328
            L      A   + ++P PF       YT   HP N+EH+LKT F NYPKG  + +    L
Sbjct  78   LRGRGGSATYQTCIIPFPFLARKKGFYTVTCHPKNLEHILKTRFDNYPKGPKWQTAFHDL  137

Query  329  LGDGIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVD  505
            LG GIFN+DGE W  QRKTA+LEF ++ L+   S  V R    +L+ IL +A+     VD
Sbjct  138  LGQGIFNSDGETWLMQRKTAALEFTTRTLKQAMSRWVNRSIKNRLWCILDKAAKERVSVD  197

Query  506  MQDLLMRMTLDSICKVGFG  562
            +QDLL+R+T D+IC + FG
Sbjct  198  LQDLLLRLTFDNICGLTFG  216



>ref|XP_008457385.1| PREDICTED: cytochrome P450 86A1 [Cucumis melo]
Length=514

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 106/179 (59%), Gaps = 13/179 (7%)
 Frame = +2

Query  62   VFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL------ANSYSVVVPMPFT  223
            ++ H L+ RK  GP  WP+IG+    ++N  R+HDW+ G L      A   +  V +PF 
Sbjct  23   IWFHFLA-RKLTGPPVWPLIGSLPALISNRRRLHDWIAGNLRATGGAATYQTCTVALPFI  81

Query  224  T-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
                  YT   HP N+EHVL+T F NYPKG  + +    LLG GIFN+DGE+W  QRKTA
Sbjct  82   AKRQGFYTVTCHPRNIEHVLRTRFENYPKGPDWQAAFHDLLGQGIFNSDGEIWLIQRKTA  141

Query  389  SLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            +LEF ++ LR      V R    +L+ IL +A+     VD+QDLL+R+T D+IC + FG
Sbjct  142  ALEFTTRTLRQAMDRWVNRTIRTRLWCILEKAAEYKTAVDLQDLLLRLTFDNICGLTFG  200



>ref|XP_006339779.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
 ref|XP_006339784.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=515

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 110/185 (59%), Gaps = 1/185 (1%)
 Frame = +2

Query  11   SSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLAN  190
            SS+      L L+ FC   +H L+++  G  R  P+ G    Q+ N+ R+H ++      
Sbjct  15   SSISITATILSLV-FCVFLVHLLTRKLHGKKRYHPIGGTIFNQLINFHRLHHYMTDLAGK  73

Query  191  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  370
              +  +  PF    Y + P NVE++LKTN  NY KG   +S ++ L GDGIF  DG+ WR
Sbjct  74   YKTYRLISPFRNKIYTSDPANVEYILKTNIDNYGKGWYNYSILKDLFGDGIFAVDGDKWR  133

Query  371  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            +QRK  S EF+++ LRDFS+VVFR    KL  IL++A+  N+ VD+QDL ++ +LDSI +
Sbjct  134  EQRKLLSHEFSTRVLRDFSSVVFRKNVAKLAQILSEAANSNKTVDIQDLFIQTSLDSIFR  193

Query  551  VGFGV  565
            V FG 
Sbjct  194  VAFGA  198



>gb|ABK94777.1| unknown [Populus trichocarpa]
Length=508

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 97/151 (64%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G    Q+ ++ R+H ++        +  +  PF +  Y   P NVE++LKTNF NY 
Sbjct  43   PVAGTVFTQLLHFNRVHHYMTNLAGKYKTYRLRAPFRSEIYTVDPVNVEYILKTNFENYG  102

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG+  +  +  LLGDGIF  DG  WR+QRK +S EF++K LRDFS+V+FR    KL  I+
Sbjct  103  KGDHNYDNLSGLLGDGIFTVDGHKWRQQRKVSSYEFSTKVLRDFSSVIFRKNVAKLANIV  162

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            ++A+  NQ +D+QDL M+ TLDSI KVGFGV
Sbjct  163  SEAAKSNQSMDIQDLFMKSTLDSIFKVGFGV  193



>ref|XP_004510930.1| PREDICTED: cytochrome P450 704C1-like [Cicer arietinum]
Length=513

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 97/151 (64%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G    QM N+ R+H ++        +  +  PF    Y A P NVE++LKTNF NY 
Sbjct  49   PVAGTVFNQMMNFNRLHHYMTDLAGKYKTYRLLNPFRNEIYTAEPTNVEYILKTNFDNYG  108

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG   +  ++ LLGDGIF  DGE WRKQRK +S EF++K LRDFST +FR  + K+  I+
Sbjct  109  KGLYNYHNLKDLLGDGIFTVDGEKWRKQRKISSHEFSTKMLRDFSTFIFRKNAAKVANIV  168

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            ++A+  N ++++QDLLM+ TLDSI +V FG 
Sbjct  169  SEAATSNTKLEIQDLLMKSTLDSIFQVAFGT  199



>ref|XP_002270594.3| PREDICTED: cytochrome P450 704C1 [Vitis vinifera]
Length=528

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 107/179 (60%), Gaps = 3/179 (2%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            + AL L+    + + + +++K    R  P+ G     + N+ R+H ++        +  +
Sbjct  30   ISALTLVFLMKILVGKSTEKK---RRYHPIGGTIFNHLFNFNRLHHYMTDVAGKHRTYRL  86

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    + A P NVE++LKTNF NY KG   ++ +  LLGDGIF  D E WR+QRK +
Sbjct  87   LSPFRNEIFTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTVDDEKWRQQRKVS  146

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRDFS+VVFR    KL  ++++A+  NQ +D+QDL M+ TLDSI K  FGV
Sbjct  147  SYEFSTKVLRDFSSVVFRKNGAKLAIVVSEAASFNQTMDIQDLFMKATLDSIFKFAFGV  205



>emb|CBI38795.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 107/179 (60%), Gaps = 3/179 (2%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
            + AL L+    + + + +++K    R  P+ G     + N+ R+H ++        +  +
Sbjct  17   ISALTLVFLMKILVGKSTEKK---RRYHPIGGTIFNHLFNFNRLHHYMTDVAGKHRTYRL  73

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    + A P NVE++LKTNF NY KG   ++ +  LLGDGIF  D E WR+QRK +
Sbjct  74   LSPFRNEIFTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTVDDEKWRQQRKVS  133

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRDFS+VVFR    KL  ++++A+  NQ +D+QDL M+ TLDSI K  FGV
Sbjct  134  SYEFSTKVLRDFSSVVFRKNGAKLAIVVSEAASFNQTMDIQDLFMKATLDSIFKFAFGV  192



>ref|XP_002320074.1| hypothetical protein POPTR_0014s06820g [Populus trichocarpa]
 gb|EEE98389.1| hypothetical protein POPTR_0014s06820g [Populus trichocarpa]
Length=508

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 97/151 (64%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G    Q+ ++ R+H ++        +  +  PF +  Y   P NVE++LKTNF NY 
Sbjct  43   PVAGTVFTQLLHFNRVHHYMTNLAGKYKTYRLRAPFRSEIYTVDPVNVEYILKTNFENYG  102

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG+  +  +  LLGDGIF  DG  WR+QRK +S EF++K LRDFS+V+FR    KL  I+
Sbjct  103  KGDHNYDNLSGLLGDGIFTVDGHKWRQQRKVSSYEFSTKVLRDFSSVIFRKNVAKLANIV  162

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            ++A+  NQ +D+QDL M+ TLDSI KVGFGV
Sbjct  163  SEAAKSNQSMDIQDLFMKSTLDSIFKVGFGV  193



>ref|XP_011034662.1| PREDICTED: cytochrome P450 704C1-like [Populus euphratica]
Length=508

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 97/151 (64%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G    Q+ ++ R+H ++        +  +  PF +  Y   P NVE++LKTNF NY 
Sbjct  43   PVAGTVFTQLLHFNRVHHYMTNLAGKYKTYRLRAPFRSEIYTVDPVNVEYILKTNFENYG  102

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG+  +  +  LLGDGIF  DG+ WR+QRK +S EF++K LRDFS+VVFR    KL  I+
Sbjct  103  KGDHNYDNLSGLLGDGIFTVDGDKWRQQRKVSSYEFSTKVLRDFSSVVFRKNVAKLANIV  162

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            ++A+  NQ +D+QDL M+ TLDSI KV FGV
Sbjct  163  SEAAKANQSMDIQDLFMKSTLDSIFKVAFGV  193



>dbj|BAJ89249.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 97/151 (64%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV GA ++Q+ N+GR+ +++        +  +  P   + Y   P NVEH+L+ NF NY 
Sbjct  30   PVAGAMLQQLLNWGRLPEYMTELSRRHRTFRMLTPTCNWVYTVDPANVEHILRANFANYG  89

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG + H  +E LLGDGIFN DG  WR QRK AS EF ++ LRD+S+ VFRD + +L  ++
Sbjct  90   KGAMAHGVLEDLLGDGIFNVDGAKWRHQRKVASFEFTTRVLRDYSSGVFRDVAAELAGMV  149

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
              A+   ++VDM++L MR TLDSI  +GFGV
Sbjct  150  AAAADAGERVDMENLFMRSTLDSIFTIGFGV  180



>ref|XP_009379287.1| PREDICTED: cytochrome P450 704C1-like [Pyrus x bretschneideri]
Length=503

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 113/181 (62%), Gaps = 4/181 (2%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            +LVL L  I    +   +L++RK   P   P+ G  + Q+ N+ R+HD++    A   + 
Sbjct  12   SLVLLLS-IFTAQILAWKLTKRKRKYP---PIAGTILHQLLNFKRLHDYMTDLAAKYKTY  67

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
             +  PF    Y ++P NVE++LKTNF NY KG   ++ ++ LLGDGIF  DG+ WR+QRK
Sbjct  68   RLIGPFRNEVYTSNPQNVEYILKTNFDNYGKGWYNYNMLKDLLGDGIFTVDGDKWRQQRK  127

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
             +S EF+++ LR+FS+ VF+  + K+   L++ +  NQ +D+QD+ M+ TLDSI KV FG
Sbjct  128  ISSHEFSTRMLREFSSAVFQKNAAKVADKLSEIAAANQTIDIQDMFMKSTLDSIFKVAFG  187

Query  563  V  565
             
Sbjct  188  T  188



>ref|XP_010092871.1| Cytochrome P450 704C1 [Morus notabilis]
 gb|EXB52689.1| Cytochrome P450 704C1 [Morus notabilis]
Length=506

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 100/160 (63%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   KGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHV  265
            K    R +P IG ++  Q+ N+ R+H ++        +  +  PF    Y + P NVE++
Sbjct  31   KSKPQRKYPPIGGTMFHQLLNFKRLHHYMTELAEKHKTYRIISPFRNEIYTSDPVNVEYI  90

Query  266  LKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRD  445
            LKTNF NY KG      +  LLGDGIF  DGE WR+QRK +S EF++K LRDFSTV+FR 
Sbjct  91   LKTNFENYGKGSYNCDILRDLLGDGIFAVDGEKWRQQRKISSHEFSTKVLRDFSTVIFRK  150

Query  446  YSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             + K+  IL++ +  N+ +D+QDL M+ TLDSI +V FGV
Sbjct  151  NAAKVADILSEIAKTNKTIDIQDLFMKATLDSIFQVAFGV  190



>ref|XP_010056271.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
 gb|KCW72919.1| hypothetical protein EUGRSUZ_E01360 [Eucalyptus grandis]
Length=513

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 101/173 (58%), Gaps = 0/173 (0%)
 Frame = +2

Query  47   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT  226
            I F  + +   + +     +  PV G    Q+  + R++D+L G    S +  +  P  +
Sbjct  22   IAFALLLLKTFTGKSLRSSKYPPVRGTVFVQLVYFNRLYDYLTGVARRSPTFRLLAPHQS  81

Query  227  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  406
              Y   P NVEH+LKTNF  Y KG+     M+ L G+GIF  DGE W+KQRK AS EFA+
Sbjct  82   EMYTTDPRNVEHILKTNFDKYMKGKYDIDIMKDLFGEGIFVVDGEKWKKQRKVASFEFAT  141

Query  407  KNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            K LRDFS  VFR  + KL  ++ + S  ++  DMQD+LMR TLDSI KVGFGV
Sbjct  142  KVLRDFSCCVFRKNAAKLIKVVEELSAASEGFDMQDILMRCTLDSIFKVGFGV  194



>ref|XP_010056273.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
 gb|KCW72920.1| hypothetical protein EUGRSUZ_E01361 [Eucalyptus grandis]
Length=513

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 100/173 (58%), Gaps = 0/173 (0%)
 Frame = +2

Query  47   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT  226
            I F  + +   + +     +  PV G    Q+  + R++D+L G    S +  +  P  +
Sbjct  22   IAFALLLLKTFTGKSLRSSKYPPVRGTVFVQLVYFNRLYDYLTGVARRSPTFRLLAPHQS  81

Query  227  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  406
              Y   P NVEH+LKTNF  Y KG+     M+ L G GIF  DGE W+KQRK AS EFA+
Sbjct  82   EMYTTDPRNVEHILKTNFDKYTKGKYDIDIMKDLFGQGIFVVDGEKWKKQRKVASFEFAT  141

Query  407  KNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            K LRDFS  VFR  + KL  ++ + S  ++  DMQD+LMR TLDSI KVGFGV
Sbjct  142  KVLRDFSCCVFRKNAAKLIKVVEELSAASEGFDMQDILMRCTLDSIFKVGFGV  194



>ref|XP_004164591.1| PREDICTED: cytochrome P450 86A1-like [Cucumis sativus]
Length=513

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 108/184 (59%), Gaps = 13/184 (7%)
 Frame = +2

Query  47   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL------ANSYSVVV  208
            I+  +++ H L+ RK  GP  WP+IG+    ++N   +HDW+ G L      A   +  V
Sbjct  17   ILTYFIWFHFLA-RKLTGPTVWPLIGSLPALISNRRSLHDWIAGNLRATGGAATYQTCTV  75

Query  209  PMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  373
             +PF       YT   HP N+EHVL+T F NYPKG  + +    LLG GIFN+DGE+W  
Sbjct  76   ALPFIAKKQGFYTVTCHPRNIEHVLRTRFENYPKGPDWQAAFHDLLGQGIFNSDGEIWLI  135

Query  374  QRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            QRKTA+LEF ++ LR      V R    +L+ IL +A+     VD+QDLL+R+T D+IC 
Sbjct  136  QRKTAALEFTTRTLRQAMDRWVNRTIRTRLWCILEKAAEYKTAVDLQDLLLRLTFDNICG  195

Query  551  VGFG  562
            + FG
Sbjct  196  LTFG  199



>ref|XP_004150627.1| PREDICTED: cytochrome P450 86A1-like [Cucumis sativus]
 gb|KGN65795.1| hypothetical protein Csa_1G528600 [Cucumis sativus]
Length=513

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 108/184 (59%), Gaps = 13/184 (7%)
 Frame = +2

Query  47   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL------ANSYSVVV  208
            I+  +++ H L+ RK  GP  WP+IG+    ++N   +HDW+ G L      A   +  V
Sbjct  17   ILTYFIWFHFLA-RKLTGPTVWPLIGSLPALISNRRSLHDWIAGNLRATGGAATYQTCTV  75

Query  209  PMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  373
             +PF       YT   HP N+EHVL+T F NYPKG  + +    LLG GIFN+DGE+W  
Sbjct  76   ALPFIAKKQGFYTVTCHPRNIEHVLRTRFENYPKGPDWQAAFHDLLGQGIFNSDGEIWLI  135

Query  374  QRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  550
            QRKTA+LEF ++ LR      V R    +L+ IL +A+     VD+QDLL+R+T D+IC 
Sbjct  136  QRKTAALEFTTRTLRQAMDRWVNRTIRTRLWCILEKAAEYKTAVDLQDLLLRLTFDNICG  195

Query  551  VGFG  562
            + FG
Sbjct  196  LTFG  199



>ref|XP_009389611.1| PREDICTED: cytochrome P450 704C1-like [Musa acuminata subsp. 
malaccensis]
Length=521

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 99/170 (58%), Gaps = 6/170 (4%)
 Frame = +2

Query  56   CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTY  235
            C   +HR   RK   P   P+ G    Q+ N  R+ D+         +  +  PF  Y +
Sbjct  34   CSSSVHR---RKPNYP---PIAGTVFHQLLNLSRLADFQTDLSRKYRTFRILTPFCNYVF  87

Query  236  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  415
               P NVEH+LK NF NY KG   +  M    GDGIF  DGE WR QRK AS EF++K L
Sbjct  88   TVDPANVEHILKINFANYGKGSFTYDIMCDFFGDGIFAVDGEKWRHQRKLASFEFSTKVL  147

Query  416  RDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            ++ S+VVFR  + +L  I++ A+  N+ +++QDLLM+ TLDSIC+VGFGV
Sbjct  148  KNNSSVVFRSTAARLAKIISNAARSNEMIEIQDLLMKSTLDSICEVGFGV  197



>emb|CDP17799.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 111/190 (58%), Gaps = 8/190 (4%)
 Frame = +2

Query  11   SSMETLVLALGLIMFCWVFI-----HRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLV  175
            +S+    L L  I F    I      +L ++K    R  P+ G  + Q+ N+ R+H ++ 
Sbjct  9    ASVAVAFLFLATIAFAVRIITSKIPEKLEKKK---RRHHPIGGTMLNQLINFNRLHHYMT  65

Query  176  GYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNAD  355
                   +  +  PF    Y + P NVE++LKTNF NY KG   ++ ++ LLGDGIF  D
Sbjct  66   ELATKYKTYRLISPFRNEVYTSDPANVEYILKTNFENYGKGLYNYTILKDLLGDGIFTVD  125

Query  356  GELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTL  535
            G+ WR+QRK +S EF+++ LRDFS+V+FR    KL  I+ +A+  NQ  D+QDL M+ TL
Sbjct  126  GDKWREQRKISSFEFSTRVLRDFSSVIFRRNVAKLANIIREATNSNQTFDIQDLFMKATL  185

Query  536  DSICKVGFGV  565
            DSI +V FGV
Sbjct  186  DSIFRVAFGV  195



>ref|XP_003521549.1| PREDICTED: cytochrome P450 704C1-like isoform 1 [Glycine max]
Length=511

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 101/174 (58%), Gaps = 0/174 (0%)
 Frame = +2

Query  44   LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  223
             ++FC++ +  +  +  G P   PV G    Q+  +  +HD+       + +  +  P  
Sbjct  19   FLVFCFIMLTIIIGKSIGDPDYAPVKGTVFNQLLYFNTLHDYQAQLAKTNPTFRLLAPDQ  78

Query  224  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  403
            +  Y A P NVEH+LKTNF  Y KG+     M  L G+GIF  DG+ WR+QRK AS EF+
Sbjct  79   SELYTADPRNVEHILKTNFDKYSKGKYNQDIMTDLFGEGIFAVDGDKWRQQRKLASFEFS  138

Query  404  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            ++ LRDFS  VFR  + KL  ++++ S   Q  DMQD+LMR TLDSI KVGFG 
Sbjct  139  TRVLRDFSCSVFRRNAAKLVRVISEFSHQGQVFDMQDILMRCTLDSIFKVGFGT  192



>gb|EYU25719.1| hypothetical protein MIMGU_mgv1a024571mg [Erythranthe guttata]
Length=497

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 99/151 (66%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            P+ G    Q+ N+ R+H ++        +  +  PF +  Y A P N+E++LKTNF NY 
Sbjct  40   PIGGTIFNQLMNFNRLHHYMTDLATKHKTYRLIAPFRSEVYTADPANIEYILKTNFENYG  99

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG   +S ++ LLGDGIF  DGE W++QRK +SLEF++K LRD ST VF + ++KL  I+
Sbjct  100  KGWHNYSILKDLLGDGIFVVDGEKWKEQRKVSSLEFSTKALRDISTTVFIENAVKLAGIV  159

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +++S  NQ  D+Q+L M+ TLDSI KV FGV
Sbjct  160  SESSFSNQPFDIQELFMKSTLDSIFKVAFGV  190



>ref|XP_003528922.1| PREDICTED: cytochrome P450 704C1 isoform 1 [Glycine max]
 gb|KHN04573.1| Cytochrome P450 704C1 [Glycine soja]
Length=510

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 104/179 (58%), Gaps = 0/179 (0%)
 Frame = +2

Query  29   VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  208
             L+  L +     + R   ++    +  PV G    QM N+ R+H ++    A   +  +
Sbjct  16   ALSASLTLLVVQLLFRKLNKRHSRKKYHPVAGTIFNQMLNFNRLHHYMTDLAAKHRTYRL  75

Query  209  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  388
              PF    Y   P NVE++LKTNF NY KG   +  ++ LLGDGIF  DGE WR+QRK +
Sbjct  76   LNPFRYEVYTTEPTNVEYILKTNFENYGKGLYNYHNLKDLLGDGIFTVDGEKWREQRKIS  135

Query  389  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            S EF++K LRDFS  +FR   +KL  I+++A+  N  +++QDLLM+ TLDSI +V FG 
Sbjct  136  SHEFSTKMLRDFSISIFRKNVVKLVNIVSEAATSNSTLEIQDLLMKSTLDSIFQVAFGT  194



>ref|XP_010685596.1| PREDICTED: cytochrome P450 86A1 [Beta vulgaris subsp. vulgaris]
Length=529

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 111/197 (56%), Gaps = 15/197 (8%)
 Frame = +2

Query  17   METLVLALGL---IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL-  184
            M+++ + LG+   I    ++   LS+R   GP  WPV+G+      N  R+HDW+ G L 
Sbjct  1    MDSIQIFLGMAAVITAYMLWFSHLSRRLSTGPNLWPVVGSLPYLFNNQHRIHDWIAGNLR  60

Query  185  -----ANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLG  334
                 A   +  + +PF       YT   HP N+EH+L+T F NYPKG  + +    LLG
Sbjct  61   RTGGTATYQTCTIAIPFLAFKQGFYTVTCHPKNIEHILRTRFDNYPKGPQWQAAFHDLLG  120

Query  335  DGIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQ  511
             GIFN+DGE W  QRKTA+LEF ++ LR   +  V R    +L+ IL  A    + VD+Q
Sbjct  121  QGIFNSDGETWLLQRKTAALEFTTRTLRQAMNRWVNRTIRTRLWNILETAENEKKPVDLQ  180

Query  512  DLLMRMTLDSICKVGFG  562
            DLL+R+T D+IC + FG
Sbjct  181  DLLLRLTFDNICGLTFG  197



>ref|XP_010033023.1| PREDICTED: cytochrome P450 86A1-like [Eucalyptus grandis]
 gb|KCW52554.1| hypothetical protein EUGRSUZ_J01934 [Eucalyptus grandis]
Length=521

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 110/196 (56%), Gaps = 14/196 (7%)
 Frame = +2

Query  17   METLVLALGLIMFCWVFIHRLS--QRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL--  184
            METL +   ++     ++   S   R   GP+ WP++G+      N  R+HDW+ G L  
Sbjct  1    METLHILFSVVAAVSAYLLWFSFLARTLTGPKVWPLVGSLPALFANRWRIHDWMAGNLRA  60

Query  185  ----ANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
                A   +  + +PF       YT   HP N+EHVL+T F NYPKG  + +    LLG 
Sbjct  61   TGGAATYQTCTIALPFVARREGFYTVTCHPKNIEHVLRTRFDNYPKGPEWQAAFHDLLGQ  120

Query  338  GIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQD  514
            GIFN+DG+ W  QRKTA+LEF ++ LR   +  V R    +L+TIL +A+     VD+QD
Sbjct  121  GIFNSDGDTWLIQRKTAALEFTTRTLRQAMARWVSRTIKSRLWTILDKAARGKTSVDLQD  180

Query  515  LLMRMTLDSICKVGFG  562
            LL+R+T D+IC + FG
Sbjct  181  LLLRLTFDNICGLTFG  196



>ref|XP_008343023.1| PREDICTED: cytochrome P450 704C1-like [Malus domestica]
Length=503

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 113/181 (62%), Gaps = 4/181 (2%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            +LVL L  I    +   +L++RK   P   PV G  + Q+ N+ R+HD++    A   + 
Sbjct  12   SLVLLLS-IFTAQILAWKLTKRKRKYP---PVAGTILHQLLNFNRLHDYMTDLAAKYKTY  67

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
             +  PF    Y ++P NVE++LKTNF NY KG   ++ ++ LLGDGIF  DG+ WR+QRK
Sbjct  68   RLIGPFRNEVYTSNPKNVEYILKTNFDNYGKGWYNYNLLKDLLGDGIFTVDGDKWRQQRK  127

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
             +S EF+++ LR+FS+ VF+  + K+   L++ +  +Q +D+QD+ M+ TLDSI KV FG
Sbjct  128  ISSHEFSTRMLREFSSAVFQKNAAKVADKLSEIATASQTIDIQDMFMKSTLDSIFKVAFG  187

Query  563  V  565
             
Sbjct  188  T  188



>ref|XP_009797232.1| PREDICTED: cytochrome P450 86A8-like [Nicotiana sylvestris]
Length=538

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 109/191 (57%), Gaps = 14/191 (7%)
 Frame = +2

Query  32   LALGLIMF----CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL---AN  190
            +A+ L++F    C++       R   GPR WP++G+    + N  RMHDW+V  L     
Sbjct  3    IAIALLLFTAITCYLLWFTFISRSLKGPRVWPLLGSLPGLIENSERMHDWIVDNLRACGG  62

Query  191  SY-SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  352
            +Y + +  +PF        T    P N+EH+L+T F NYPKG  + +    LLG GIFN+
Sbjct  63   TYQTCICAVPFLARKQGLVTVTCDPKNLEHILRTRFENYPKGPTWQAVFHELLGQGIFNS  122

Query  353  DGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRM  529
            DG+ W  QRKTA+LEF ++ LR   +  V R   L+   IL  A L N+ VD+QDLL+R+
Sbjct  123  DGDTWLFQRKTAALEFTTRTLRQAMARWVNRAIQLRFCPILKTAQLENKPVDLQDLLLRL  182

Query  530  TLDSICKVGFG  562
            T D+IC + FG
Sbjct  183  TFDNICGLAFG  193



>ref|XP_004252175.2| PREDICTED: cytochrome P450 704C1-like [Solanum lycopersicum]
Length=513

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 112/178 (63%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            ++L  ++    F+ +L +++ G  +  P++ ++ +Q+ N+ R+HD +    A   +  + 
Sbjct  18   ISLSFLVLIVFFMSKLGEKQKGKKKYHPIVDSTTKQLINFHRIHDHMADLAAKYKTYRLE  77

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
             PF    Y + P N+E++LKTNF NY KG+ +H  ++   GDG+F  DGE W++QRK +S
Sbjct  78   SPFRREIYTSDPANIEYILKTNFDNYGKGDYHHEILKDFYGDGMFTVDGEKWKEQRKVSS  137

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EF+ + +R+ + V+F   ++KL  IL +++   + VD+QDLL++ +LDS+ +V FG+
Sbjct  138  PEFSKRVIREVNCVIFSKNAVKLANILDESANSKETVDIQDLLLKSSLDSVFQVAFGI  195



>ref|XP_010262795.1| PREDICTED: cytochrome P450 86A1 [Nelumbo nucifera]
Length=512

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 114/197 (58%), Gaps = 16/197 (8%)
 Frame = +2

Query  17   METLV---LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLV----  175
            METL+   LA  +    +++ + L+ RK  GP+ WP++G+    + N  R+HDW+     
Sbjct  1    METLLAFFLAAAITSAYFLWFNVLA-RKLTGPKVWPIVGSLPYLIANRSRVHDWIAQNLR  59

Query  176  --GYLANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLG  334
              G  A   +  + +PF       +T   HP N+E+VLKT F NYPKG  +      LLG
Sbjct  60   QTGGTATYQTCTLALPFVARKQGFFTVTCHPKNIEYVLKTRFDNYPKGPTWQEAFHDLLG  119

Query  335  DGIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQ  511
             GIFN+DG+ W  QRKTA+LEF ++ LR   +  V R   L+L++IL +A      VD+Q
Sbjct  120  QGIFNSDGDTWLIQRKTAALEFTTRTLRQAMARWVNRTIRLRLWSILAKAEAQRSSVDLQ  179

Query  512  DLLMRMTLDSICKVGFG  562
            DLL+R+T D+IC + FG
Sbjct  180  DLLLRLTFDNICGLTFG  196



>gb|AFN53663.1| cytochrome P450 [Linum usitatissimum]
Length=516

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 101/171 (59%), Gaps = 12/171 (7%)
 Frame = +2

Query  86   RKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL-----ANSY-SVVVPMPFTT-----YT  232
            R+  GP+ WP+ G+      N  R HDW+   L     A++Y +  +P+PF       YT
Sbjct  26   RRLTGPKVWPLFGSLPHVFMNRARFHDWIADNLRATGRASTYQTCTLPLPFLARTQGFYT  85

Query  233  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  412
               HP N+EH+L+T F NYPKG  + +    LLG GIFN+DG+ W  QRKTA+LEF ++ 
Sbjct  86   VTCHPKNIEHILRTRFDNYPKGPQWQAAFHDLLGQGIFNSDGDTWLIQRKTAALEFTTRT  145

Query  413  LRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            LR   +  V R    +LF IL  AS  +  VD+QDLL+R+T D+IC + FG
Sbjct  146  LRQAMARWVNRTIKNRLFIILDNASKSDTAVDLQDLLLRLTFDNICGLTFG  196



>ref|XP_006339781.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=506

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 112/184 (61%), Gaps = 3/184 (2%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
            S+  ++L+L   +FC   +H L+++     R  PV G     + N+ R+H ++       
Sbjct  9    SITAIILSL---VFCVFILHLLTKKVHVKKRYHPVGGTIFNHLINFHRLHHYMTDLAGKY  65

Query  194  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  373
             +  +  PF    + + P NVE++LKTNF NY KG   ++ ++ L GDGIF  DG+ WR+
Sbjct  66   KTYRLISPFRNDIFTSDPANVEYILKTNFENYGKGRYSYNILKDLFGDGIFTVDGDKWRE  125

Query  374  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  553
            QRK  S EF+++ LRDFS+VVFR  + KL  IL++A   ++ +D+QDL M+ TLDSI ++
Sbjct  126  QRKFLSHEFSARILRDFSSVVFRKDAAKLAHILSEAVKSSKIIDIQDLFMKATLDSIFRI  185

Query  554  GFGV  565
             FGV
Sbjct  186  AFGV  189



>ref|XP_004976569.1| PREDICTED: cytochrome P450 704C1-like [Setaria italica]
Length=518

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 101/166 (61%), Gaps = 5/166 (3%)
 Frame = +2

Query  83   QRKGGGPRSW---PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDN  253
            QR+G G ++    PV G  + Q+ NY R+ ++         +  V  P     Y   P N
Sbjct  27   QRRGAGGKNRKYPPVAGTVLHQLLNYDRLMEYQTELSRRHRTFRVLTPTGNDVYTVDPAN  86

Query  254  VEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTV  433
            VEHVLKT+F +Y KG   H  ME LLGDGIFN DG+ WR QRK AS EF+ + LRD+S+ 
Sbjct  87   VEHVLKTSFADYGKGATMHDVMEDLLGDGIFNVDGDKWRHQRKVASHEFSVRVLRDYSSG  146

Query  434  VFRDYSLKLFTILTQASLLNQ--QVDMQDLLMRMTLDSICKVGFGV  565
            VFRD + +L  I+  A+  +   +VD+ DLLMR TLDSI KVGFGV
Sbjct  147  VFRDTATELAGIVAAAARGDGGIRVDIADLLMRSTLDSIFKVGFGV  192



>ref|XP_004490585.1| PREDICTED: cytochrome P450 86A1-like [Cicer arietinum]
Length=510

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 99/167 (59%), Gaps = 12/167 (7%)
 Frame = +2

Query  98   GPRSWPVIGASVEQMTNYGRMHDWLVGYL------ANSYSVVVPMPFTT-----YTYIAH  244
            GP+ WP +G+      N  R+HDW+ G L      A   + ++P+PF       YT   H
Sbjct  30   GPKPWPFVGSLPALFKNRNRVHDWIAGNLRATGGSATYQTCIIPIPFLARKQGFYTVTCH  89

Query  245  PDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD-  421
            P N+EH+L+T F NYPKG  + +    LLG GIFN+DGE W  QRKTA+LEF ++ L+  
Sbjct  90   PKNLEHILRTRFDNYPKGPKWQTAFHDLLGQGIFNSDGETWLMQRKTAALEFTTRTLKQA  149

Query  422  FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
             +  V R    +L+ IL +A   N  VD+QDLL+R+T D+IC + FG
Sbjct  150  MARWVSRSIKNRLWCILDKAVSDNVFVDLQDLLLRLTFDNICGLTFG  196



>ref|XP_003636830.1| Cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula]
 gb|AET02145.2| cytochrome P450 family protein [Medicago truncatula]
Length=512

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM-PFTTYTYIAHPDNVEHVLKTNFPNY  289
            PV G    QM N+ R+H ++   LA  Y     + PF +  Y + P NVE++LKTNF NY
Sbjct  49   PVAGTVFNQMMNFNRLHHYMTD-LARKYRTYRLLNPFRSEVYTSEPSNVEYILKTNFENY  107

Query  290  PKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTI  469
             KG   +  ++ LLGDGIF  DGE WR+QRK +S EF++K LRDFST +FR  + K+  I
Sbjct  108  GKGLYNYQNLKDLLGDGIFAVDGEKWREQRKISSHEFSTKMLRDFSTSIFRKNAAKVANI  167

Query  470  LTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +++A+  N ++++QDLLM+ TLDSI +V FG 
Sbjct  168  VSEAATSNFKLEIQDLLMKSTLDSIFQVAFGT  199



>ref|XP_003627669.1| Cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula]
 ref|XP_003636311.1| Cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula]
Length=506

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM-PFTTYTYIAHPDNVEHVLKTNFPNY  289
            PV G    QM N+ R+H ++   LA  Y     + PF +  Y + P NVE++LKTNF NY
Sbjct  43   PVAGTVFNQMMNFNRLHHYMTD-LARKYRTYRLLNPFRSEVYTSEPSNVEYILKTNFENY  101

Query  290  PKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTI  469
             KG   +  ++ LLGDGIF  DGE WR+QRK +S EF++K LRDFST +FR  + K+  I
Sbjct  102  GKGLYNYQNLKDLLGDGIFAVDGEKWREQRKISSHEFSTKMLRDFSTSIFRKNAAKVANI  161

Query  470  LTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +++A+  N ++++QDLLM+ TLDSI +V FG 
Sbjct  162  VSEAATSNFKLEIQDLLMKSTLDSIFQVAFGT  193



>ref|XP_010272641.1| PREDICTED: cytochrome P450 704C1-like [Nelumbo nucifera]
Length=519

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 106/184 (58%), Gaps = 0/184 (0%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
            ++ +  L L  I FC + +     +    PR  PV G   +Q+  + R++D+        
Sbjct  9    TVASAALFLLFISFCALLLKIFMGKSVMDPRYAPVKGTIFDQLLYFNRLYDYQTQVARTH  68

Query  194  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  373
             +  +  P  +  Y   P N+E+VLKTNF  Y KG+     +  L+G GIF  DG+ WR+
Sbjct  69   QTFRLLAPSHSEIYTTDPRNIEYVLKTNFDKYSKGQYNQDIVTDLVGHGIFAVDGDRWRQ  128

Query  374  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  553
            QRK AS EF+++ LRDFS+ VFR  + KL  I+ + S+ NQ  D+QDLLMR TLDSI KV
Sbjct  129  QRKLASFEFSTRVLRDFSSAVFRRNAAKLSRIILEFSITNQTFDIQDLLMRCTLDSIFKV  188

Query  554  GFGV  565
            GFG+
Sbjct  189  GFGM  192



>ref|XP_009629836.1| PREDICTED: cytochrome P450 86A8 [Nicotiana tomentosiformis]
Length=536

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 109/191 (57%), Gaps = 14/191 (7%)
 Frame = +2

Query  32   LALGLIMF----CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL---AN  190
            +A+ L++F    C++       R   GPR WP++G+    + N  RMHDW+V  L     
Sbjct  3    IAIALLLFTAITCYLLWFTFISRSLKGPRVWPLLGSLPGLIENSERMHDWIVDNLRACGG  62

Query  191  SY-SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  352
            +Y + +  +PF        T    P N+EH+LKT F NYPKG  + +    LLG GIFN+
Sbjct  63   TYQTCICAIPFLARKQGLVTVTCDPKNLEHILKTRFENYPKGPTWQAVFHELLGQGIFNS  122

Query  353  DGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRM  529
            DG+ W  QRKTA+LEF ++ LR   +  V R   L+   IL  A L ++ VD+QDLL+R+
Sbjct  123  DGDTWLFQRKTAALEFTTRTLRQAMARWVNRAIQLRFCPILKTAQLESKPVDLQDLLLRL  182

Query  530  TLDSICKVGFG  562
            T D+IC + FG
Sbjct  183  TFDNICGLAFG  193



>ref|XP_010053250.1| PREDICTED: cytochrome P450 86A7 [Eucalyptus grandis]
 gb|KCW77511.1| hypothetical protein EUGRSUZ_D01839 [Eucalyptus grandis]
Length=553

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 96/165 (58%), Gaps = 10/165 (6%)
 Frame = +2

Query  98   GPRSWPVIGASVEQMTNYGRMHDWLVGYLANS----YSVVVPMPFTT-----YTYIAHPD  250
            GPR WP++G+    + N  RMHDW+   L  +     + ++P+PF        T    P 
Sbjct  29   GPRVWPLVGSLPTLIRNAARMHDWIADNLRAAGGTYQTCIIPLPFLARKQGLVTVTCDPK  88

Query  251  NVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD-FS  427
            N+EHVLK  F NYPKG  + +    LLGDGIFN+DG+ W+ QRKTA+LEF ++ LR    
Sbjct  89   NLEHVLKARFDNYPKGPTWQAVFHDLLGDGIFNSDGDTWKDQRKTAALEFTTRTLRQAMG  148

Query  428  TVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
              V R    +   IL  A L  + VD+QDLL+R+T D+IC + FG
Sbjct  149  RWVSRAIKHRFCPILKAAQLEGRSVDLQDLLLRLTFDNICGLTFG  193



>gb|EYU45975.1| hypothetical protein MIMGU_mgv1a025576mg [Erythranthe guttata]
Length=521

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 103/173 (60%), Gaps = 11/173 (6%)
 Frame = +2

Query  77   LSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV-----VPMPFTT-----  226
            L  RK  GP++WP++G+      N  R+HDW+ G L +S +       + +P+       
Sbjct  23   LLARKLTGPKAWPLVGSLPYLYMNRRRIHDWISGNLQSSAAATYQTTTIAVPYFARKQGF  82

Query  227  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  406
            YT   HP N+EH+L+T F NYPKG  + +    LLG GIFN+DGE W  QRKTA+LEF +
Sbjct  83   YTVTCHPKNIEHILRTRFDNYPKGPTWQTAFHDLLGQGIFNSDGETWLIQRKTAALEFTT  142

Query  407  KNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            + LR   +  V R    +L+ IL +A+     VD+QDLL+R+T D+IC + FG
Sbjct  143  RTLRQAMARWVNRTIRTRLWVILNKAAKERAPVDLQDLLLRLTFDNICGLTFG  195



>ref|XP_006339777.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=505

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 111/184 (60%), Gaps = 3/184 (2%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
            S+  ++L+L   +FC   +  L+ +  G  R  PV G     + N+ R+H ++       
Sbjct  9    SITAIILSL---VFCVFILLLLTNKLNGKKRYHPVGGTIFNHLINFHRLHHYMTDLAGKY  65

Query  194  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  373
             +  +  PF    + + P NVE++LKTNF NY KG   ++ ++ L GDGIF  DG+ WR+
Sbjct  66   KTYRLVSPFRNDIFTSDPANVEYILKTNFENYGKGRYSYNILKDLFGDGIFTVDGDKWRE  125

Query  374  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  553
            QRK  S EF+++ LRDFS+VVFR  + KL  IL++A   ++ +D+QDL M+ TLDSI ++
Sbjct  126  QRKFLSHEFSARILRDFSSVVFRKDAAKLAHILSEAVKSSKIIDIQDLFMKATLDSIFRI  185

Query  554  GFGV  565
             FGV
Sbjct  186  AFGV  189



>ref|XP_009374269.1| PREDICTED: cytochrome P450 86A1 [Pyrus x bretschneideri]
Length=524

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 113/196 (58%), Gaps = 14/196 (7%)
 Frame = +2

Query  17   METLVL--ALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL--  184
            METL +  AL    F ++F   L  RK  GP  WPV+G+     +N  ++HDW+   L  
Sbjct  1    METLPIFSALFAAAFVYLFWFYLLARKLTGPSVWPVVGSIPFLFSNRKQIHDWITSNLRA  60

Query  185  ----ANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
                A   +  + +PF       +T   +P N+EH+L+T F NYPKG  Y +    LLG+
Sbjct  61   TGGSATYQTCTLALPFVARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTYQAAFHDLLGE  120

Query  338  GIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQD  514
            GIFN+DGE W  QRKTA+LEF ++ LR   +  V R    +L+ IL +A+  +  VD+QD
Sbjct  121  GIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAARDHIAVDLQD  180

Query  515  LLMRMTLDSICKVGFG  562
            LL+R+T D+IC + FG
Sbjct  181  LLLRLTFDNICGLTFG  196



>ref|XP_004229915.2| PREDICTED: cytochrome P450 704C1-like [Solanum lycopersicum]
Length=515

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 105/172 (61%), Gaps = 0/172 (0%)
 Frame = +2

Query  50   MFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTY  229
            +FC   +H L+++  G  R  P+ G    Q+ N+ R+H ++    A   +  +  PF   
Sbjct  27   VFCVFLVHLLTRKLHGKKRYHPIGGTIFNQLINFQRLHHYMTDLAAKYKTYRLISPFRNK  86

Query  230  TYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASK  409
             Y + P NVE++LKTN  NY KG   +S ++ LLG+GIF  DG+ WR+QRK  S EF+++
Sbjct  87   IYTSDPANVEYILKTNIDNYGKGWYNYSILKDLLGNGIFAVDGDKWREQRKLLSHEFSTR  146

Query  410  NLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
              RDFS+VVFR    KL  IL++++  N+ VD+QDL M+ +LDSI  V FG 
Sbjct  147  VSRDFSSVVFRKNVAKLAQILSESANSNKAVDIQDLFMQSSLDSIIGVAFGA  198



>ref|XP_002446967.1| hypothetical protein SORBIDRAFT_06g026000 [Sorghum bicolor]
 gb|EES11295.1| hypothetical protein SORBIDRAFT_06g026000 [Sorghum bicolor]
Length=507

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 96/151 (64%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G    Q+ N+GR+ ++         +  +  P   Y Y   P NVE++LKTNF NY 
Sbjct  38   PVAGTVFHQLLNFGRLMEYQTELAQRYRTFRMLTPTCNYVYTVEPANVEYMLKTNFANYG  97

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG + H  +E LLGDGIFN DG  WR QRK AS EF+++ LRD+S+ VFRD + +L  I+
Sbjct  98   KGVMTHDVLEDLLGDGIFNVDGAKWRHQRKVASHEFSTRVLRDYSSGVFRDTAAELAGIV  157

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
              A+   +++D+ DLL+R TLDS+ KVGFGV
Sbjct  158  AMAAGAGERLDVADLLLRSTLDSMFKVGFGV  188



>ref|XP_002525608.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF36726.1| cytochrome P450, putative [Ricinus communis]
Length=511

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 113/196 (58%), Gaps = 14/196 (7%)
 Frame = +2

Query  17   METL--VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL--  184
            METL     L   +  ++F   L  RK  GPR WP++G+      N  ++HDW+ G L  
Sbjct  1    METLPFFFTLAASVSAYLFWFYLLARKLTGPRVWPLVGSLPVLFKNRRQIHDWIAGNLRA  60

Query  185  ---ANSY-SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  337
               A++Y +  + +PF       YT   HP N+EH+L+T F NYPKG  +      LLG 
Sbjct  61   TGGASTYQTCTIALPFLARRQGFYTVTCHPKNLEHILRTRFENYPKGPHWQKAFHDLLGQ  120

Query  338  GIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQD  514
            GIFN+DGE W  QRKTA+LEF ++ LR   +  V R    +L++IL +++     VD+QD
Sbjct  121  GIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIKNRLWSILDKSAKEKISVDLQD  180

Query  515  LLMRMTLDSICKVGFG  562
            LL+R+T D+IC + FG
Sbjct  181  LLLRLTFDNICGLTFG  196



>gb|EPS61958.1| hypothetical protein M569_12832, partial [Genlisea aurea]
Length=519

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 107/194 (55%), Gaps = 13/194 (7%)
 Frame = +2

Query  11   SSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL--  184
            +S  T+VLA     F W    RL  R   GPR WPV+G+    + N  R+HDW+   L  
Sbjct  3    ASTATIVLAFVAAYFMWF---RLMTRSLKGPRVWPVVGSLPGLIQNNARLHDWIADNLRT  59

Query  185  -ANSY-SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGI  343
             A +Y + +  +P+        T    P N+EH+LK  F NYPKG  + +    LLG GI
Sbjct  60   CAGTYQTCIFALPYLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGKGI  119

Query  344  FNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLL  520
            FN+DG+ W  QRKTA+LEF ++ LR   +  V R    +   IL  A L  + VD+QDLL
Sbjct  120  FNSDGDTWLFQRKTAALEFTTRTLRQAMARWVSRAIETRFCPILGAAQLSGEAVDLQDLL  179

Query  521  MRMTLDSICKVGFG  562
            +R+T D+IC + FG
Sbjct  180  LRLTFDNICGLAFG  193



>ref|XP_002446966.1| hypothetical protein SORBIDRAFT_06g025990 [Sorghum bicolor]
 gb|EES11294.1| hypothetical protein SORBIDRAFT_06g025990 [Sorghum bicolor]
Length=508

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 101/159 (64%), Gaps = 3/159 (2%)
 Frame = +2

Query  92   GGGPRSWP-VIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVL  268
            G   RS+P V G  + Q+ N+GR+ ++         +  +  P ++Y Y   P NVE++L
Sbjct  33   GAKNRSYPPVAGTVLHQLFNFGRLMEYHTELSRRYRTFRMLTPSSSYIYTVEPANVEYIL  92

Query  269  KTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDY  448
            KTNF NY KG   H   E LLGDGIF+ DG  WR QRK AS EF+++ LRD+ST VFRD 
Sbjct  93   KTNFSNYGKGSKVHEVGEDLLGDGIFSVDGAKWRHQRKVASHEFSTRVLRDYSTGVFRDT  152

Query  449  SLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            + +L  I+  A+   ++VDMQDLL+R TLDSI  VGFGV
Sbjct  153  AAELAGIV--AADAGEKVDMQDLLLRSTLDSIFTVGFGV  189



>ref|XP_010473620.1| PREDICTED: cytochrome P450 86A7-like [Camelina sativa]
Length=533

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 108/193 (56%), Gaps = 13/193 (7%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
            SM  ++L + +    W    R   R   GPR WP++G+    +TN  RMHD++   L   
Sbjct  4    SMAVIILTVIVTYLIWFVSIR---RSCKGPRVWPLLGSLPALITNAHRMHDFIADNLRKC  60

Query  194  ----YSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  346
                 + + P+PF        T    P N+EH+LKT F NYPKG  +HS    LLGDGIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWHSVFHDLLGDGIF  120

Query  347  NADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLM  523
            N+DG+ WR QRKTA+LEF ++ LR   +  V R    +L  IL  +    + +D+QD+L+
Sbjct  121  NSDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESSMSRAEPIDLQDVLL  180

Query  524  RMTLDSICKVGFG  562
            R+T D+IC + FG
Sbjct  181  RLTFDNICGLTFG  193



>gb|EMT31268.1| Cytochrome P450 704C1 [Aegilops tauschii]
Length=569

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 106/164 (65%), Gaps = 5/164 (3%)
 Frame = +2

Query  77   LSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYT-YIAHPDN  253
            L +R+   P   PV G  + Q+ N+GR+ +++   L+  Y     +  T  + +   P N
Sbjct  29   LGKRRRSYP---PVAGTMLHQLLNWGRLPEYMT-ELSRRYRTFRMLTLTCSSIHTVDPAN  84

Query  254  VEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTV  433
            VE++L+TNF NY KG + H  ME LLGDGIFN DG  WR QRK AS EF+++ LRD+S+ 
Sbjct  85   VEYILRTNFANYGKGTMTHEVMEDLLGDGIFNVDGTKWRHQRKVASFEFSTRMLRDYSSG  144

Query  434  VFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            VFRD +++L  I+  A+   ++VDM++L MR TLDSI K+GFGV
Sbjct  145  VFRDMAVQLAGIVAAAASAGERVDMENLFMRSTLDSIFKIGFGV  188



>ref|XP_002299820.2| Cytochrome P450 86A1 family protein [Populus trichocarpa]
 gb|EEE84625.2| Cytochrome P450 86A1 family protein [Populus trichocarpa]
Length=511

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 111/199 (56%), Gaps = 20/199 (10%)
 Frame = +2

Query  17   METLVL-----ALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY  181
            METL L     A  L    W +   L  RK  GPR WP++G+      N  R+HDW+ G 
Sbjct  1    METLPLFFTLTAATLAYLLWFY---LLSRKLTGPRVWPLVGSLPYLFMNRRRIHDWIAGN  57

Query  182  L-----ANSY-SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVL  328
            L     A +Y +  + +PF       YT   HP N+EH+L+T F NYPKG  + +    L
Sbjct  58   LRATGGAGTYQTCTIALPFFARKQGFYTVTCHPKNLEHILRTRFDNYPKGPDWQTAFHDL  117

Query  329  LGDGIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVD  505
            LG GIFN DGE W  QRKTA+LEF ++ LR   +  V +    +L+ IL +A+     VD
Sbjct  118  LGQGIFNTDGETWLIQRKTAALEFTTRTLRQAMARWVNQTIKNRLWNILDKAATEKLSVD  177

Query  506  MQDLLMRMTLDSICKVGFG  562
            +QDLL+R+T D+IC + FG
Sbjct  178  LQDLLLRLTFDNICGLTFG  196



>ref|XP_008803291.1| PREDICTED: cytochrome P450 704C1-like [Phoenix dactylifera]
Length=506

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 110/183 (60%), Gaps = 5/183 (3%)
 Frame = +2

Query  23   TLVLALGLI-MFCWVFIHRLSQRKGG-GPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  196
            +  +ALGL+ ++C   + R+ +R    G R  PV G    Q  N+ R+HD+         
Sbjct  11   SATVALGLLALYC---VSRIFRRGSSHGKRYPPVAGTVFHQFFNFRRLHDYHTELSRKHM  67

Query  197  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  376
            +  +  PF    Y   P  +E++LKTNFPNY KG   +   + L GDGIF  DG+ WR Q
Sbjct  68   TFKLLAPFRQQIYTTDPTVIEYILKTNFPNYGKGLFNYQNSKDLFGDGIFAVDGDKWRHQ  127

Query  377  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  556
            RK AS EF++K LRDFS  VF+  + KL  I++++++ N+++++QDL M+ T+DSI KVG
Sbjct  128  RKLASYEFSTKVLRDFSGAVFKSNAAKLAHIISESAVSNKKLNIQDLFMKSTMDSIFKVG  187

Query  557  FGV  565
            FG 
Sbjct  188  FGT  190



>ref|XP_006576393.1| PREDICTED: cytochrome P450 704C1-like [Glycine max]
Length=511

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 101/174 (58%), Gaps = 0/174 (0%)
 Frame = +2

Query  44   LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  223
             ++FC++ +  +  +  G P   PV G    Q+  +  +HD+       + +  +  P  
Sbjct  19   FLVFCFIMLTIIIGKSIGDPDYAPVKGTVFNQLLYFNTLHDYHAQVAKTNPTFRLLAPDQ  78

Query  224  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  403
            +  Y A P N+EH+LKTNF  Y KG+     +  L G+GIF  DG+ WR+QRK AS EF+
Sbjct  79   SELYTADPRNIEHILKTNFDKYSKGKYNQDIVTDLFGEGIFAVDGDKWRQQRKLASFEFS  138

Query  404  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            ++ LRDFS  VFR  + KL  ++++ S   Q  DMQD+LMR TLDSI KVGFG 
Sbjct  139  TRVLRDFSCSVFRRNAAKLVRVISEFSHQGQVFDMQDILMRCTLDSIFKVGFGT  192



>ref|XP_011082379.1| PREDICTED: cytochrome P450 86A1 [Sesamum indicum]
Length=520

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 101/174 (58%), Gaps = 12/174 (7%)
 Frame = +2

Query  77   LSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLV------GYLANSYSVVVPMPFTT----  226
            L  R   GP++WP++G+      N  R+HDW+       G  A   +  + +PF      
Sbjct  23   LLARTLNGPKAWPLVGSLPHLFMNRRRIHDWIASNLRATGPAATYQTCTIAIPFFACKQG  82

Query  227  -YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  403
             YT   HP N+EH+L+T F NYPKG  + +    LLG GIFN+DGE W  QRKTA+LEF 
Sbjct  83   FYTVTCHPKNIEHILRTRFDNYPKGPTWQTAFHDLLGQGIFNSDGETWLIQRKTAALEFT  142

Query  404  SKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            ++ LR   +  V R    +L+ IL +A+  +  VD+QDLL+R+T D+IC + FG
Sbjct  143  TRTLRQAMARWVNRTIRTRLWIILEKAAKHHTSVDLQDLLLRLTFDNICGLTFG  196



>ref|XP_010418406.1| PREDICTED: cytochrome P450 86A7-like [Camelina sativa]
Length=533

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 107/193 (55%), Gaps = 13/193 (7%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
            SM  ++L + +    W    R   R   GPR WP+ G+    +TN  RMHD++   L   
Sbjct  4    SMAVIILTVIVTYLIWFVSLR---RSCKGPRVWPLFGSLPALITNAHRMHDFIADNLRKC  60

Query  194  ----YSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  346
                 + + P+PF        T    P N+EH+LKT F NYPKG  +HS    LLGDGIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWHSVFHDLLGDGIF  120

Query  347  NADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLM  523
            N+DG+ W+ QRKTA+LEF ++ LR   +  V R    +L  IL  A    + +D+QD+L+
Sbjct  121  NSDGDTWKFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESAMSRAEPIDLQDILL  180

Query  524  RMTLDSICKVGFG  562
            R+T D+IC + FG
Sbjct  181  RLTFDNICGLTFG  193



>ref|XP_006348042.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=507

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 112/178 (63%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  211
            +++  ++    F+ +L  ++ G  +  P++ ++ +Q+ N+ R+HD +    A   +  + 
Sbjct  13   ISVSFLVLIVFFMSKLGAKQKGKKKYHPIVDSTTKQLINFHRIHDHMADLAAKYKTYRLE  72

Query  212  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  391
             PF    Y + P N+E++LKTNF NY KG+ +H  ++   GDG+F  DGE W++QRK +S
Sbjct  73   SPFRREIYTSDPANIEYILKTNFDNYGKGDYHHEILKDFYGDGMFTVDGEKWKEQRKVSS  132

Query  392  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
             EF+ + +R+ ++V+F   ++KL  IL +++   + VD+QDLL++ +LDS+ +V FG+
Sbjct  133  PEFSKRVIREVNSVIFSKNAVKLANILDESANSKETVDIQDLLLKSSLDSVFQVAFGI  190



>emb|CBI34653.3| unnamed protein product [Vitis vinifera]
Length=1462

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 104/182 (57%), Gaps = 10/182 (5%)
 Frame = +2

Query  47   IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS----YSVVVPM  214
            I+  ++   R   R   GPR WPV+G+    + N  RMH+W+   L +      + + P+
Sbjct  139  IITAYLIWFRSITRSLKGPRVWPVVGSLPLLIQNANRMHEWIAENLRSCGGTYQTCICPI  198

Query  215  PFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQR  379
            PF        T    P N+EH+LK  F NYPKG  + +    LLG+GIFN+DGE WR QR
Sbjct  199  PFLARKQGLVTVTCDPKNLEHILKIRFDNYPKGPTWQAVFHDLLGEGIFNSDGETWRFQR  258

Query  380  KTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  556
            KTA+LEF ++ LR   +  V R   L+   IL +A L  + VD+QDLL+R+T D+IC + 
Sbjct  259  KTAALEFTTRTLRQAMARWVTRAIKLRFCPILKKAQLEGKPVDLQDLLLRLTFDNICGLA  318

Query  557  FG  562
            FG
Sbjct  319  FG  320



>gb|KDP46522.1| hypothetical protein JCGZ_08494 [Jatropha curcas]
Length=511

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 110/189 (58%), Gaps = 12/189 (6%)
 Frame = +2

Query  32   LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL-----ANSY  196
              L  + F ++F   L  RK  GP+ WP++G+      N  ++HDW+   L     A++Y
Sbjct  8    FTLATVTFAYLFWFHLLARKLTGPKVWPIVGSLPFLFKNRRQIHDWIASNLRSTGGASTY  67

Query  197  -SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADG  358
             +  + +PF       YT   HP N+EH+L+T F NYPKG  + +    LLG GIFN+DG
Sbjct  68   QTCTIALPFFAHRQGFYTVTCHPKNLEHILRTRFDNYPKGPHWQTAFHDLLGQGIFNSDG  127

Query  359  ELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTL  535
            + W  QRKTA+LEF ++ LR   +  V R    +L++IL +A+     VD+QDLL+R+T 
Sbjct  128  DTWLIQRKTAALEFTTRTLRQAMARWVNRTIKSRLWSILDKAANEKIVVDLQDLLLRLTF  187

Query  536  DSICKVGFG  562
            D+IC + FG
Sbjct  188  DNICGLTFG  196



>ref|XP_007219038.1| hypothetical protein PRUPE_ppa004579mg [Prunus persica]
 gb|EMJ20237.1| hypothetical protein PRUPE_ppa004579mg [Prunus persica]
Length=502

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 113/183 (62%), Gaps = 4/183 (2%)
 Frame = +2

Query  17   METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  196
            +  LVLAL  I    +   +L++ K   P   P+ G  + Q+ N+ R+HD++        
Sbjct  10   LTALVLALS-IFTAQILAGKLTKAKKKHP---PIAGTVLHQLLNFNRVHDYMTDLAGKHG  65

Query  197  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  376
            +  +   F    Y ++P NVE++LKTNF NY KG   ++ ++ LLG+GIF  DGE WR+Q
Sbjct  66   TYRLLGLFRNEIYTSNPANVEYILKTNFDNYGKGWYNYNILKDLLGEGIFAVDGEKWRQQ  125

Query  377  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  556
            RK +S +F++K LRDFS+V+FR  + KL   +++ +  NQ +D+QDL M+ +LDSI +V 
Sbjct  126  RKISSHDFSTKMLRDFSSVIFRKNAAKLADKVSEIATSNQAIDIQDLFMKSSLDSIFQVA  185

Query  557  FGV  565
            FG+
Sbjct  186  FGI  188



>gb|ABD97099.1| cytochrome P450 monooxygenase CYP94D24 [Glycine max]
Length=341

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 106/172 (62%), Gaps = 6/172 (3%)
 Frame = +2

Query  65   FIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS--YSVVVPMPFTTYTYI  238
            F+ R   R     + +P+IG   E + N  R  +W    L +S   + V   P+  +  +
Sbjct  21   FLARKKPRNNKAFKDYPLIGTLPEFLKNRHRFLEWTTQVLRDSPTNTGVFSRPYKLHGIL  80

Query  239  -AHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  415
             A+PDNVEHVLKT F NYPKGE +   ++  LG+GIFN+DG+LW+ QRKTAS EF++K+L
Sbjct  81   TANPDNVEHVLKTKFDNYPKGERFIHLLQDFLGNGIFNSDGDLWKVQRKTASYEFSTKSL  140

Query  416  RDF--STVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            R+F    V F +   +L  IL++AS  N+ +D+QDLL R   D++CK+ F V
Sbjct  141  RNFVVDAVTF-ELQTRLLPILSKASETNKGLDLQDLLERFAFDNVCKLAFNV  191



>ref|XP_010430476.1| PREDICTED: cytochrome P450 86A7 [Camelina sativa]
Length=533

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 107/193 (55%), Gaps = 13/193 (7%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
            SM  ++L + +    W    R   R   GPR WP++G+    +TN  RMHD++   L   
Sbjct  4    SMAVIILTVIVTYLIWFVSIR---RSCKGPRVWPLLGSLPALITNAHRMHDFIADNLRKC  60

Query  194  ----YSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  346
                 + + P+PF        T    P N+EH+LKT F NYPKG  + S    LLGDGIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCEPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDGIF  120

Query  347  NADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLM  523
            N+DG+ WR QRKTA+LEF ++ LR   +  V R    +L  IL  A    + +D+QD+L+
Sbjct  121  NSDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESAMSQAKPIDLQDILL  180

Query  524  RMTLDSICKVGFG  562
            R+T D+IC + FG
Sbjct  181  RLTFDNICGLTFG  193



>ref|XP_006827573.1| hypothetical protein AMTR_s00009p00227030 [Amborella trichopoda]
 gb|ERM94989.1| hypothetical protein AMTR_s00009p00227030 [Amborella trichopoda]
Length=510

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 97/170 (57%), Gaps = 10/170 (6%)
 Frame = +2

Query  83   QRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL----ANSYSVVVPMPFTT-----YTY  235
            +R   GPR WP++G+      N  RMHDW+   L        + +  +P+        T 
Sbjct  12   RRSLTGPRVWPLLGSLPGLFQNKHRMHDWIAENLTMCKGTYQTCIAAVPYLARMQGLVTV  71

Query  236  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  415
               P N+EH+LKT F NYPKG  + +    LLGDGIFN+DG+ WR QRKTA+LEF ++ L
Sbjct  72   TCDPRNLEHILKTRFENYPKGPTWQAVFHDLLGDGIFNSDGDTWRFQRKTAALEFTTRTL  131

Query  416  RD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            R   +  V R    +L  IL    L N+ VD+QDLL+R+T D+IC + FG
Sbjct  132  RQAMARWVSRSIENRLVPILASCQLKNEAVDLQDLLLRLTFDNICGLAFG  181



>ref|XP_006300436.1| hypothetical protein CARUB_v10020100mg [Capsella rubella]
 gb|EOA33334.1| hypothetical protein CARUB_v10020100mg [Capsella rubella]
Length=546

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 108/193 (56%), Gaps = 13/193 (7%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  193
            SM  ++L + +    W    R S +   GPR WP++G+    +TN  RMHD++   L  S
Sbjct  4    SMAVIILTVIVTYLIWFVSLRRSYK---GPRVWPLLGSLPALITNAHRMHDFIADNLRMS  60

Query  194  ----YSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  346
                 + + P+PF        T    P N+EH+LKT F NYPKG  + S    LLGDGIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDGIF  120

Query  347  NADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLM  523
            N DG+ WR QRKTA+LEF ++ LR   +  V R    +L  IL  A    + VD+QD+L+
Sbjct  121  NTDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESAMSRAEPVDLQDVLL  180

Query  524  RMTLDSICKVGFG  562
            R+T D+IC + FG
Sbjct  181  RLTFDNICGLTFG  193



>ref|XP_004976553.1| PREDICTED: cytochrome P450 704C1-like [Setaria italica]
Length=508

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 96/153 (63%), Gaps = 2/153 (1%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G  + Q+ N+GR+ ++         +  +  P   Y Y   P NVE++LKTNF NY 
Sbjct  38   PVAGTVLHQLLNFGRLVEYQTELARRYRTFRMLTPTCNYVYTVEPANVEYMLKTNFANYG  97

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KG   H  +E LLGDGIFN DG  WR QRK AS EF+++ LRD+S+ VFRD + +L  I+
Sbjct  98   KGATMHDVLEDLLGDGIFNVDGARWRHQRKVASHEFSTRVLRDYSSGVFRDTAAELAGIV  157

Query  473  TQASLLNQ--QVDMQDLLMRMTLDSICKVGFGV  565
              A+  +   +VD+ DLLMR TLDSI K+GFGV
Sbjct  158  AAAARGDGGIRVDIADLLMRSTLDSIFKIGFGV  190



>emb|CDO99497.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 110/197 (56%), Gaps = 17/197 (9%)
 Frame = +2

Query  17   METLVL---ALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL-  184
            MET++L   A+G   +   F   L  RK  GP+ WP  G+      N  R HDW+ G L 
Sbjct  1    METVLLFTIAIGTSTYLLWFY--LLARKLTGPKVWPFFGSLPFLFLNRRRFHDWIAGNLR  58

Query  185  -----ANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLG  334
                 A   +  + +PF       YT   HP N+EH+L+T F NYPKG  + +    LLG
Sbjct  59   STGAAATYQTSTICIPFLARRQGFYTVTCHPKNIEHILRTRFDNYPKGPTWQTAFHDLLG  118

Query  335  DGIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQ  511
             GIFN+DGE W  QRKTA+LEF ++ LR   +  V R    +L+ IL +AS  +  VD+Q
Sbjct  119  QGIFNSDGETWLIQRKTAALEFTTRTLRQAMNRWVNRTIRTRLWVILEKASKEHIAVDLQ  178

Query  512  DLLMRMTLDSICKVGFG  562
            DLL+R+T D+IC + FG
Sbjct  179  DLLLRLTFDNICGLTFG  195



>gb|KCW78251.1| hypothetical protein EUGRSUZ_D02439 [Eucalyptus grandis]
Length=431

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +2

Query  215  PFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASL  394
            PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DG+ WR+QRK +S 
Sbjct  16   PFRSEVYTSDPANVEYMLKTNFENYGKGWYSYSLLKDLLGDGIFTVDGDKWRQQRKVSSY  75

Query  395  EFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            EF++K LRDFS+VVFR  + KL  IL++A+  NQ VDMQDL M+ TLDSI KV FGV
Sbjct  76   EFSTKVLRDFSSVVFRRTAAKLANILSEAASTNQIVDMQDLFMKSTLDSIFKVAFGV  132



>ref|XP_004229925.2| PREDICTED: cytochrome P450 704C1-like [Solanum lycopersicum]
Length=509

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 101/171 (59%), Gaps = 0/171 (0%)
 Frame = +2

Query  53   FCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYT  232
            FC    H L+++  G  R  P+ G    Q+ N+ R+H ++        +  +  PF    
Sbjct  25   FCGFIFHLLTKKVYGKKRYHPIGGTIFNQLINFHRLHHYMTDLACKYKTYRLISPFRNEI  84

Query  233  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  412
            Y + P NVE++LKTNF NY KG   +S ++ L GDGIF  DG+ W+ QRK +S EF+++ 
Sbjct  85   YTSDPANVEYILKTNFDNYGKGWYNYSILKDLFGDGIFTVDGDKWQGQRKLSSHEFSTRV  144

Query  413  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            LRDFS+VVFR    KL  +L+ A+  N  VD+QDL M+ T DSI +V  GV
Sbjct  145  LRDFSSVVFRKNVAKLAHVLSNAANSNTTVDIQDLFMKSTQDSIFRVACGV  195



>ref|XP_006339587.1| PREDICTED: cytochrome P450 86A2-like [Solanum tuberosum]
Length=535

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 107/191 (56%), Gaps = 14/191 (7%)
 Frame = +2

Query  32   LALGLIMF----CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL---AN  190
            +A+ L +F    C++       R   GPR WP++G+    + N  RMHDW+V  L     
Sbjct  3    IAIALFLFSSITCYLLWFTFISRSLKGPRVWPLLGSLPGLIENSERMHDWIVDNLRACGG  62

Query  191  SY-SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  352
            +Y + +  +PF        T    P N+EH+LKT F NYPKG  + +    LLG GIFN+
Sbjct  63   TYQTCICAIPFLARKQGLVTVTCDPKNLEHILKTRFENYPKGPTWQAVFHELLGQGIFNS  122

Query  353  DGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRM  529
            DG+ W  QRKTA+LEF ++ LR   +  V R   L+   IL  A +  + VD+QDLL+R+
Sbjct  123  DGDTWLFQRKTAALEFTTRTLRQAMARWVNRAIQLRFCPILKTAQVEGKPVDLQDLLLRL  182

Query  530  TLDSICKVGFG  562
            T D+IC + FG
Sbjct  183  TFDNICGLAFG  193



>gb|EMT32710.1| Cytochrome P450 704C1 [Aegilops tauschii]
Length=486

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT-TYTYIAHPDNVEHVLKTNFPNY  289
            PV GA ++Q+ ++GR+ +++   L+  Y     +  T  + Y   P NVEH+L+TNF NY
Sbjct  33   PVAGAMLQQLLHWGRLPEYMT-ELSRRYGTFRMLTLTCNWVYTVDPANVEHILRTNFANY  91

Query  290  PKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTI  469
             KG + H  +E LLGDGIFN DG  WR QRK AS EF ++ LR++S+ VFRD + +L  I
Sbjct  92   GKGPMTHGVLEDLLGDGIFNVDGAKWRHQRKVASFEFTTRALREYSSGVFRDMAAELAGI  151

Query  470  LTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +  A+   +++DM++L MR TLDSI  VGFGV
Sbjct  152  VAAAAAAGERLDMENLFMRSTLDSIFTVGFGV  183



>ref|XP_002270428.2| PREDICTED: cytochrome P450 704C1-like isoform X6 [Vitis vinifera]
 ref|XP_010662359.1| PREDICTED: cytochrome P450 704C1-like isoform X6 [Vitis vinifera]
Length=474

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (63%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G    Q+ ++ ++ D+         +  + +P  +  Y A P NVE++LKTNF NY 
Sbjct  8    PVAGPVFSQLIHFSKLFDYQASLAQKYITYRMILPSHSEIYTADPVNVEYILKTNFINYG  67

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KGE +   M+ L GDGIF  DGE WR QRK AS EF++K LRDFST VF+D + KL   +
Sbjct  68   KGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVFQDNAAKLVLKV  127

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +  +   Q +D+QD+LM+ TLDSI KVGFGV
Sbjct  128  SMVAAAKQMMDLQDMLMKSTLDSIFKVGFGV  158



>ref|XP_010662358.1| PREDICTED: cytochrome P450 704C1-like isoform X5 [Vitis vinifera]
Length=496

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 103/171 (60%), Gaps = 4/171 (2%)
 Frame = +2

Query  53   FCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYT  232
            F +V+I  +  +    P + PV      Q+ ++ ++ D+         +  + +P  +  
Sbjct  14   FLFVYIREVMSKDQRPPVAGPVFS----QLIHFSKLFDYQASLAQKYITYRMILPSHSEI  69

Query  233  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  412
            Y A P NVE++LKTNF NY KGE +   M+ L GDGIF  DGE WR QRK AS EF++K 
Sbjct  70   YTADPVNVEYILKTNFINYGKGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKV  129

Query  413  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            LRDFST VF+D + KL   ++  +   Q +D+QD+LM+ TLDSI KVGFGV
Sbjct  130  LRDFSTSVFQDNAAKLVLKVSMVAAAKQMMDLQDMLMKSTLDSIFKVGFGV  180



>gb|KCW78252.1| hypothetical protein EUGRSUZ_D02439 [Eucalyptus grandis]
Length=446

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = +2

Query  215  PFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASL  394
            PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DG+ WR+QRK +S 
Sbjct  16   PFRSEVYTSDPANVEYMLKTNFENYGKGWYSYSLLKDLLGDGIFTVDGDKWRQQRKVSSY  75

Query  395  EFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            EF++K LRDFS+VVFR  + KL  IL++A+  NQ VDMQDL M+ TLDSI KV FGV
Sbjct  76   EFSTKVLRDFSSVVFRRTAAKLANILSEAASTNQIVDMQDLFMKSTLDSIFKVAFGV  132



>ref|XP_010662357.1| PREDICTED: cytochrome P450 704C1-like isoform X4 [Vitis vinifera]
Length=497

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 103/171 (60%), Gaps = 4/171 (2%)
 Frame = +2

Query  53   FCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYT  232
            F +V+I  +  +    P + PV      Q+ ++ ++ D+         +  + +P  +  
Sbjct  15   FLFVYIREVMSKDQRPPVAGPVFS----QLIHFSKLFDYQASLAQKYITYRMILPSHSEI  70

Query  233  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  412
            Y A P NVE++LKTNF NY KGE +   M+ L GDGIF  DGE WR QRK AS EF++K 
Sbjct  71   YTADPVNVEYILKTNFINYGKGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKV  130

Query  413  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            LRDFST VF+D + KL   ++  +   Q +D+QD+LM+ TLDSI KVGFGV
Sbjct  131  LRDFSTSVFQDNAAKLVLKVSMVAAAKQMMDLQDMLMKSTLDSIFKVGFGV  181



>ref|XP_010662355.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Vitis vinifera]
Length=513

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 103/171 (60%), Gaps = 4/171 (2%)
 Frame = +2

Query  53   FCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYT  232
            F +V+I  +  +    P + PV      Q+ ++ ++ D+         +  + +P  +  
Sbjct  31   FLFVYIREVMSKDQRPPVAGPVFS----QLIHFSKLFDYQASLAQKYITYRMILPSHSEI  86

Query  233  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  412
            Y A P NVE++LKTNF NY KGE +   M+ L GDGIF  DGE WR QRK AS EF++K 
Sbjct  87   YTADPVNVEYILKTNFINYGKGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKV  146

Query  413  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            LRDFST VF+D + KL   ++  +   Q +D+QD+LM+ TLDSI KVGFGV
Sbjct  147  LRDFSTSVFQDNAAKLVLKVSMVAAAKQMMDLQDMLMKSTLDSIFKVGFGV  197



>ref|XP_010255320.1| PREDICTED: cytochrome P450 86A8 [Nelumbo nucifera]
Length=561

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 112/195 (57%), Gaps = 15/195 (8%)
 Frame = +2

Query  17   MET---LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL-  184
            MET   ++L  G++ +  +F  R   R   GPR WP++G+    + N  RMH+W+   L 
Sbjct  1    METSTVMLLVAGVVAY--LFWFRFISRSLNGPRVWPLLGSLPGLIENADRMHEWIAENLR  58

Query  185  --ANSY-SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDG  340
                +Y + +  +PF        T    P N+EH+LKT F NYPKG  + +    LLG+G
Sbjct  59   ACGGTYQTCICAIPFLARKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQAVFHDLLGEG  118

Query  341  IFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  517
            IFN+DG+ W  QRKTA+LEF ++ LR   +  V R   L+   IL  A L ++ VD+QDL
Sbjct  119  IFNSDGDTWLFQRKTAALEFTTRTLRQAMARWVNRAIKLRFCPILKTAQLESKAVDLQDL  178

Query  518  LMRMTLDSICKVGFG  562
            L+R+T D+IC + FG
Sbjct  179  LLRLTFDNICGLAFG  193



>ref|XP_009763725.1| PREDICTED: cytochrome P450 86A1 [Nicotiana sylvestris]
Length=521

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 112/201 (56%), Gaps = 24/201 (12%)
 Frame = +2

Query  17   METLVLALGL-------IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL-  172
            M+ +V+  G+       +++ W+   RL+     GP+ WP++G+      N  R HDW+ 
Sbjct  1    MDPVVIYFGIAAATTVYLLWFWLLAQRLT-----GPKVWPLVGSLPYTFMNRRRFHDWIS  55

Query  173  -----VGYLANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYME  322
                  G  A   +  + +PF       YT   HP N+EH+L+T F NYPKG  + S  +
Sbjct  56   ENLRSTGGAATYQTSTICIPFLAWKQGFYTVTCHPKNIEHILRTRFDNYPKGPTWQSAFD  115

Query  323  VLLGDGIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQ  499
             LLG GIFN+DG+ W  QRKTA+LEF ++ LR   +  V R    +L+ IL +A+     
Sbjct  116  DLLGQGIFNSDGDTWLMQRKTAALEFTTRTLRQAMNRWVNRTIRTRLWVILDKAAKEKNP  175

Query  500  VDMQDLLMRMTLDSICKVGFG  562
            V++QDLL+R+T D+IC + FG
Sbjct  176  VELQDLLLRLTFDNICGLTFG  196



>ref|XP_010104672.1| Cytochrome P450 86A1 [Morus notabilis]
 gb|EXC01478.1| Cytochrome P450 86A1 [Morus notabilis]
Length=520

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 103/181 (57%), Gaps = 12/181 (7%)
 Frame = +2

Query  56   CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL------VGYLANSYSVVVPMP  217
             ++F      RK  GP+ WPVIG+    + N  R+HDW+       G L    +  + +P
Sbjct  16   AYLFWFHFLARKLTGPKVWPVIGSLPALIVNRARIHDWMSNNLRATGGLCTYQTCTIALP  75

Query  218  FTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
            F       +T   HP N+EH+L+T F NYPKG  + +    LLG GIFN+DG+ W  QRK
Sbjct  76   FFAHKQGYFTVTCHPKNIEHILRTRFDNYPKGPNWQAAFHDLLGQGIFNSDGDTWLIQRK  135

Query  383  TASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGF  559
            TA+LEF ++ LR   +  V R    +L+ IL +A+     VD+QDLL+R+T D+IC + F
Sbjct  136  TAALEFTTRTLRQAMARWVNRTIKNRLWRILERAAHDKTSVDLQDLLLRLTFDNICGLTF  195

Query  560  G  562
            G
Sbjct  196  G  196



>ref|XP_004955136.1| PREDICTED: cytochrome P450 86A2-like [Setaria italica]
Length=455

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 101/173 (58%), Gaps = 11/173 (6%)
 Frame = +2

Query  74   RLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS----YSVVVPMPFTTY----  229
            RLS R   GPR WPV+G+    + +   MH+W+VG L  +     + +  +P        
Sbjct  22   RLS-RGLSGPRVWPVLGSLPGLVQHAEDMHEWIVGNLRRTGGTYQTCIFAVPGVARRGGL  80

Query  230  -TYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  406
             T    P N+EHVLK  F NYPKG  +H+    LLGDGIFN+DGE W  QRKTA+LEF +
Sbjct  81   VTVTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDGIFNSDGETWVAQRKTAALEFTT  140

Query  407  KNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            + LR   S  V R   L+L  IL +A+     VD+QDLL+R+T D+IC + FG
Sbjct  141  RTLRTAMSRWVSRSIHLRLLPILDEAANEKTHVDLQDLLLRLTFDNICGLAFG  193



>ref|XP_010662354.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Vitis vinifera]
Length=527

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 103/171 (60%), Gaps = 4/171 (2%)
 Frame = +2

Query  53   FCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYT  232
            F +V+I  +  +    P + PV      Q+ ++ ++ D+         +  + +P  +  
Sbjct  45   FLFVYIREVMSKDQRPPVAGPVFS----QLIHFSKLFDYQASLAQKYITYRMILPSHSEI  100

Query  233  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  412
            Y A P NVE++LKTNF NY KGE +   M+ L GDGIF  DGE WR QRK AS EF++K 
Sbjct  101  YTADPVNVEYILKTNFINYGKGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKV  160

Query  413  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            LRDFST VF+D + KL   ++  +   Q +D+QD+LM+ TLDSI KVGFGV
Sbjct  161  LRDFSTSVFQDNAAKLVLKVSMVAAAKQMMDLQDMLMKSTLDSIFKVGFGV  211



>ref|XP_009630929.1| PREDICTED: cytochrome P450 86A1 [Nicotiana tomentosiformis]
Length=521

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 112/201 (56%), Gaps = 24/201 (12%)
 Frame = +2

Query  17   METLVLALGL-------IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL-  172
            M+ +V+  G+       +++ W+   RL+     GP+ WP++G+      N  R HDW+ 
Sbjct  1    MDPVVIYFGIAAATTVYLLWFWLLAQRLT-----GPKVWPLVGSLPYTFMNRRRFHDWIS  55

Query  173  -----VGYLANSYSVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYME  322
                  G  A   +  + +PF       YT   HP N+EH+L+T F NYPKG  + S  +
Sbjct  56   ENLRSTGGAATYQTSTICIPFLAWKQGFYTVTCHPKNIEHILRTRFDNYPKGPTWQSAFD  115

Query  323  VLLGDGIFNADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQ  499
             LLG GIFN+DG+ W  QRKTA+LEF ++ LR   +  V R    +L+ IL +A+     
Sbjct  116  DLLGQGIFNSDGDTWLMQRKTAALEFTTRTLRQAMNRWVNRTIRTRLWVILDKAAKEKSP  175

Query  500  VDMQDLLMRMTLDSICKVGFG  562
            V++QDLL+R+T D+IC + FG
Sbjct  176  VELQDLLLRLTFDNICGLTFG  196



>ref|XP_010933914.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Elaeis guineensis]
Length=506

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 113/187 (60%), Gaps = 5/187 (3%)
 Frame = +2

Query  8    VSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYL  184
            VS   T+ L L L+++C   + R+ +R     + +P +  +V  Q  N+ R+HD+     
Sbjct  8    VSLSATVALGL-LVLYC---VSRIFRRGSNHKKRYPPVAGTVFHQFHNFRRLHDYHTELS  63

Query  185  ANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGEL  364
                +  +  PF    Y + P  VE++L+TNFPNY KG   +  ++ L GDGIF  DG+ 
Sbjct  64   RKHKTFKLLAPFRQQIYTSDPTVVEYILRTNFPNYGKGLFNYQNLKDLFGDGIFAVDGDK  123

Query  365  WRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSI  544
            WR QRK AS EF +K LRDFS  VF+  + KL  I++++ ++N+ +++QDL M+ T+DSI
Sbjct  124  WRHQRKLASYEFTTKVLRDFSGAVFQSNAAKLAHIISKSVIVNKILNIQDLFMKSTMDSI  183

Query  545  CKVGFGV  565
             KVGFG+
Sbjct  184  FKVGFGM  190



>gb|KHF99845.1| Cytochrome P450 protein [Gossypium arboreum]
Length=524

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 108/181 (60%), Gaps = 5/181 (3%)
 Frame = +2

Query  23   TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  202
            T VL + + +F ++ +  L  +     R  P+ G+ + Q+ ++  + D+         + 
Sbjct  32   TSVLVIFVALFLFLHVPELRSK----ARRPPIAGSMLHQLLHFNTLSDYQTSLAKKHRTY  87

Query  203  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  382
             + MP  +  Y   P NVE++LKTNFPNY +G  +   M  L GDGIF  DGE WR QRK
Sbjct  88   RLIMPLHSEIYTTDPANVEYILKTNFPNYGRG-AHIEIMRDLFGDGIFAVDGEKWRHQRK  146

Query  383  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
             AS EF+++ LR++S+ VFRD + KL   ++ A++ N+ +D+QDL M+  LDSI KVGFG
Sbjct  147  LASYEFSTRVLREYSSAVFRDNATKLVAKVSTAAVANRAMDLQDLFMKSALDSIFKVGFG  206

Query  563  V  565
            V
Sbjct  207  V  207



>gb|KJB08946.1| hypothetical protein B456_001G115100 [Gossypium raimondii]
Length=514

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 100/174 (57%), Gaps = 12/174 (7%)
 Frame = +2

Query  77   LSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL------ANSYSVVVPMPFTT----  226
            L  ++  GPR WP++G+      N  RMHDW+   L      A   +  + +PF      
Sbjct  26   LLAKRLSGPRVWPLVGSLPFLFMNRRRMHDWIASNLRATGGSATYQTCTIAVPFLARKQG  85

Query  227  -YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  403
             YT   HP N+EH+L+T F NYPKG  + +    LLG GIFN+DGE W  QRKTA+LEF 
Sbjct  86   FYTVTCHPKNIEHILRTRFDNYPKGPHWQAAFHDLLGQGIFNSDGESWLIQRKTAALEFT  145

Query  404  SKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            ++ LR      V R    +L+ IL +AS   + VD+QDLL+R+T D+IC + FG
Sbjct  146  TRTLRQAMGRWVNRTIKNRLWCILDKASNEKKAVDLQDLLLRLTFDNICGLTFG  199



>ref|XP_011035187.1| PREDICTED: cytochrome P450 86A1-like [Populus euphratica]
Length=511

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 102/174 (59%), Gaps = 12/174 (7%)
 Frame = +2

Query  77   LSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL-----ANSY-SVVVPMPFTT----  226
            L  RK  GPR WP++G+      N  R+HDW+ G L     A +Y +  + +PF      
Sbjct  23   LLSRKLTGPRVWPLVGSLPYLFMNRRRIHDWIAGNLRATGGAGTYQTCTIALPFFARKQG  82

Query  227  -YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  403
             YT   HP N+EH+L+T F NYPKG  + +    LLG GIFN DGE W  QRKTA+LEF 
Sbjct  83   FYTVTCHPKNMEHILRTRFDNYPKGPDWQTAFHDLLGQGIFNTDGETWLIQRKTAALEFT  142

Query  404  SKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  562
            ++ LR   +  V +    +L+ IL +A+     VD+QDLL+R+T D+IC + FG
Sbjct  143  TRTLRQAMARWVNQTIKNRLWNILDKAATEKLSVDLQDLLLRLTFDNICGLTFG  196



>emb|CBI24485.3| unnamed protein product [Vitis vinifera]
Length=493

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (63%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G    Q+ ++ ++ D+         +  + +P  +  Y A P NVE++LKTNF NY 
Sbjct  8    PVAGPVFSQLIHFSKLFDYQASLAQKYITYRMILPSHSEIYTADPVNVEYILKTNFINYG  67

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KGE +   M+ L GDGIF  DGE WR QRK AS EF++K LRDFST VF+D + KL   +
Sbjct  68   KGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVFQDNAAKLVLKV  127

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +  +   Q +D+QD+LM+ TLDSI KVGFGV
Sbjct  128  SMVAAAKQMMDLQDMLMKSTLDSIFKVGFGV  158



>ref|XP_010662356.1| PREDICTED: cytochrome P450 704C1-like isoform X3 [Vitis vinifera]
Length=502

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (63%), Gaps = 0/151 (0%)
 Frame = +2

Query  113  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  292
            PV G    Q+ ++ ++ D+         +  + +P  +  Y A P NVE++LKTNF NY 
Sbjct  36   PVAGPVFSQLIHFSKLFDYQASLAQKYITYRMILPSHSEIYTADPVNVEYILKTNFINYG  95

Query  293  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  472
            KGE +   M+ L GDGIF  DGE WR QRK AS EF++K LRDFST VF+D + KL   +
Sbjct  96   KGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVFQDNAAKLVLKV  155

Query  473  TQASLLNQQVDMQDLLMRMTLDSICKVGFGV  565
            +  +   Q +D+QD+LM+ TLDSI KVGFGV
Sbjct  156  SMVAAAKQMMDLQDMLMKSTLDSIFKVGFGV  186



>gb|AAM65207.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=523

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 109/193 (56%), Gaps = 13/193 (7%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL---  184
            S   ++L L +    W    R S +   GPR WP++G+    +TN  RMHD++   L   
Sbjct  4    STAAIILTLIVTYIIWFVSLRRSYK---GPRVWPLVGSLPALITNAHRMHDFIADNLRMC  60

Query  185  ANSY-SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  346
              +Y + + P+PF        T    P N+EH+LKT F NYPKG  + S    LLGDGIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDGIF  120

Query  347  NADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLM  523
            N+DG+ WR QRKTA+LEF ++ LR   +  V R    +L  IL  A    + +D+QD+L+
Sbjct  121  NSDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESARSRAEPIDLQDVLL  180

Query  524  RMTLDSICKVGFG  562
            R+T D+IC + FG
Sbjct  181  RLTFDNICGLTFG  193



>ref|NP_176558.1| cytochrome P450, family 86, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
 sp|Q9CAD6.1|C86A7_ARATH RecName: Full=Cytochrome P450 86A7 [Arabidopsis thaliana]
 gb|AAG52424.1|AC011622_12 putative cytochrome P450; 34849-36420 [Arabidopsis thaliana]
 gb|AEE34136.1| cytochrome P450, family 86, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
Length=523

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 109/193 (56%), Gaps = 13/193 (7%)
 Frame = +2

Query  14   SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL---  184
            S   ++L L +    W    R S +   GPR WP++G+    +TN  RMHD++   L   
Sbjct  4    STAAIILTLIVTYIIWFVSLRRSYK---GPRVWPLVGSLPALITNAHRMHDFIADNLRMC  60

Query  185  ANSY-SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  346
              +Y + + P+PF        T    P N+EH+LKT F NYPKG  + S    LLGDGIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDGIF  120

Query  347  NADGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLM  523
            N+DG+ WR QRKTA+LEF ++ LR   +  V R    +L  IL  A    + +D+QD+L+
Sbjct  121  NSDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESARSRAEPIDLQDVLL  180

Query  524  RMTLDSICKVGFG  562
            R+T D+IC + FG
Sbjct  181  RLTFDNICGLTFG  193



>ref|XP_004229934.1| PREDICTED: cytochrome P450 86A8-like [Solanum lycopersicum]
Length=526

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 108/191 (57%), Gaps = 14/191 (7%)
 Frame = +2

Query  32   LALGLIMF----CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL---AN  190
            +A+ L++F    C++       R   GPR WP++G+    + N  RMH+W+V  L     
Sbjct  3    IAIALLLFSFITCYLLWFTFISRSLKGPRVWPLLGSLPGLIENSERMHEWIVDNLRACGG  62

Query  191  SY-SVVVPMPFTT-----YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  352
            +Y + +  +PF        T    P N+EH+LKT F NYPKG  + +    LLG GIFN+
Sbjct  63   TYQTCICAIPFLARKQGLVTVTCDPKNLEHILKTRFENYPKGPTWQAVFHELLGQGIFNS  122

Query  353  DGELWRKQRKTASLEFASKNLRD-FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRM  529
            DG+ W  QRKTA+LEF ++ LR   +  V R   L+   IL  A +  + VD+QDLL+R+
Sbjct  123  DGDTWLFQRKTAALEFTTRTLRQAMARWVNRAIQLRFCPILKTAQVEGKPVDLQDLLLRL  182

Query  530  TLDSICKVGFG  562
            T D+IC + FG
Sbjct  183  TFDNICGLAFG  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920