BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002O09

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             193   2e-54   Prunus persica
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                192   5e-54   Prunus mume [ume]
emb|CBI27801.3|  unnamed protein product                                187   3e-52   Vitis vinifera
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                186   1e-51   Vitis vinifera
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                185   2e-51   Sesamum indicum [beniseed]
ref|XP_007012625.1|  Subtilase family protein                           182   1e-50   
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease                182   2e-50   Fragaria vesca subsp. vesca
ref|XP_010090170.1|  Subtilisin-like protease                           178   5e-49   Morus notabilis
gb|KJB82990.1|  hypothetical protein B456_013G223900                    178   5e-49   Gossypium raimondii
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                176   3e-48   Erythranthe guttata [common monkey flower]
gb|KHG16003.1|  Subtilisin-like protease                                174   1e-47   Gossypium arboreum [tree cotton]
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                174   1e-47   
gb|KJB27211.1|  hypothetical protein B456_004G284900                    172   2e-47   Gossypium raimondii
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           173   3e-47   Glycine max [soybeans]
gb|KJB27210.1|  hypothetical protein B456_004G284900                    172   6e-47   Gossypium raimondii
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like           172   9e-47   Solanum tuberosum [potatoes]
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                172   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                169   8e-46   Nicotiana sylvestris
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                169   1e-45   
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                168   2e-45   Nicotiana tomentosiformis
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                168   2e-45   
gb|EPS65938.1|  hypothetical protein M569_08836                         167   3e-45   Genlisea aurea
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                167   3e-45   Solanum lycopersicum
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             167   5e-45   Phaseolus vulgaris [French bean]
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                167   6e-45   
ref|XP_006381615.1|  subtilase family protein                           166   9e-45   
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like           166   1e-44   Solanum tuberosum [potatoes]
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                166   1e-44   Populus euphratica
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         166   1e-44   Jatropha curcas
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                166   1e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                164   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                164   5e-44   Malus domestica [apple tree]
emb|CDP03080.1|  unnamed protein product                                161   3e-43   Coffea canephora [robusta coffee]
emb|CDY33400.1|  BnaA07g04390D                                          162   3e-43   Brassica napus [oilseed rape]
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                162   4e-43   Camelina sativa [gold-of-pleasure]
gb|AHA84190.1|  subtilisin-like protease                                161   5e-43   Phaseolus vulgaris [French bean]
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           161   5e-43   
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           161   7e-43   Cicer arietinum [garbanzo]
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                160   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                160   2e-42   Nelumbo nucifera [Indian lotus]
emb|CAN71376.1|  hypothetical protein VITISV_001491                     159   2e-42   Vitis vinifera
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   159   2e-42   Citrus sinensis [apfelsine]
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease                159   3e-42   Sesamum indicum [beniseed]
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             158   7e-42   Eutrema salsugineum [saltwater cress]
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                158   1e-41   Cucumis melo [Oriental melon]
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    158   1e-41   Citrus sinensis [apfelsine]
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             157   2e-41   
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                157   2e-41   Brassica rapa
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     157   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      157   2e-41   Ricinus communis
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             157   3e-41   Capsella rubella
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                157   3e-41   Nicotiana sylvestris
emb|CDY18042.1|  BnaC07g04280D                                          154   1e-40   Brassica napus [oilseed rape]
ref|XP_002519361.1|  conserved hypothetical protein                     145   2e-40   
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                153   4e-40   Tarenaya hassleriana [spider flower]
gb|KCW79385.1|  hypothetical protein EUGRSUZ_C00797                     148   9e-39   Eucalyptus grandis [rose gum]
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                149   1e-38   Eucalyptus grandis [rose gum]
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                149   2e-38   
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     149   2e-38   Eucalyptus grandis [rose gum]
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                149   2e-38   Eucalyptus grandis [rose gum]
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                148   5e-38   Eucalyptus grandis [rose gum]
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease                147   8e-38   Nicotiana tomentosiformis
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           147   1e-37   Glycine max [soybeans]
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease                146   2e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease                145   3e-37   Eucalyptus grandis [rose gum]
ref|XP_003595292.1|  Subtilisin-like protease                           145   4e-37   Medicago truncatula
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             142   6e-36   Phaseolus vulgaris [French bean]
ref|XP_002885806.1|  predicted protein                                  141   9e-36   Arabidopsis lyrata subsp. lyrata
gb|KCW79387.1|  hypothetical protein EUGRSUZ_C00799                     140   2e-35   Eucalyptus grandis [rose gum]
ref|NP_565330.1|  Subtilase-like protein                                138   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KHN06066.1|  Subtilisin-like protease                                137   1e-34   Glycine soja [wild soybean]
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    138   1e-34   Arabis alpina [alpine rockcress]
gb|ACN39811.1|  unknown                                                 134   2e-33   Picea sitchensis
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease                134   3e-33   Fragaria vesca subsp. vesca
gb|KDP32432.1|  hypothetical protein JCGZ_13357                         133   1e-32   Jatropha curcas
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             131   4e-32   Musa acuminata [banana]
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                131   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease                130   6e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004976550.1|  PREDICTED: subtilisin-like protease-like           130   8e-32   Setaria italica
gb|EPS61652.1|  hypothetical protein M569_13143                         129   3e-31   Genlisea aurea
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg                129   3e-31   Erythranthe guttata [common monkey flower]
gb|AGT16155.1|  subtilisin-like protease                                128   5e-31   Saccharum hybrid cultivar R570
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                127   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like           127   1e-30   Citrus sinensis [apfelsine]
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                   127   1e-30   Citrus sinensis [apfelsine]
ref|XP_004510560.1|  PREDICTED: subtilisin-like protease-like           127   1e-30   Cicer arietinum [garbanzo]
ref|XP_002448366.1|  hypothetical protein SORBIDRAFT_06g025980          127   1e-30   Sorghum bicolor [broomcorn]
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                127   1e-30   Malus domestica [apple tree]
ref|XP_010105478.1|  Subtilisin-like protease                           127   1e-30   Morus notabilis
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                127   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease                127   2e-30   Sesamum indicum [beniseed]
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg             126   2e-30   Citrus clementina [clementine]
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                126   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                126   3e-30   Nelumbo nucifera [Indian lotus]
gb|EMT07781.1|  Subtilisin-like protease                                125   3e-30   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease                125   5e-30   Nicotiana sylvestris
emb|CBI33725.3|  unnamed protein product                                124   6e-30   Vitis vinifera
gb|KJB34441.1|  hypothetical protein B456_006G065800                    122   9e-30   Gossypium raimondii
ref|XP_010105482.1|  Subtilisin-like protease                           124   1e-29   Morus notabilis
ref|NP_001152427.1|  LOC100286067 precursor                             124   1e-29   
gb|ACN28204.1|  unknown                                                 124   1e-29   Zea mays [maize]
ref|XP_002510884.1|  Cucumisin precursor, putative                      124   1e-29   Ricinus communis
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                124   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_010109072.1|  Subtilisin-like protease                           124   1e-29   Morus notabilis
gb|ABR16566.1|  unknown                                                 122   2e-29   Picea sitchensis
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like           124   2e-29   Cucumis sativus [cucumbers]
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          124   2e-29   Amborella trichopoda
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                124   2e-29   Cucumis melo [Oriental melon]
gb|KJB34438.1|  hypothetical protein B456_006G065800                    122   2e-29   Gossypium raimondii
ref|XP_008367646.1|  PREDICTED: subtilisin-like protease                124   2e-29   
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             124   2e-29   Phaseolus vulgaris [French bean]
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                124   2e-29   Nicotiana sylvestris
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease                123   3e-29   Vitis vinifera
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           123   3e-29   Glycine max [soybeans]
gb|EYU21279.1|  hypothetical protein MIMGU_mgv1a023973mg                121   3e-29   Erythranthe guttata [common monkey flower]
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                123   3e-29   Elaeis guineensis
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g             123   4e-29   Phaseolus vulgaris [French bean]
ref|XP_010105479.1|  Subtilisin-like protease                           123   4e-29   
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease                123   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB34440.1|  hypothetical protein B456_006G065800                    122   5e-29   Gossypium raimondii
gb|KDP22364.1|  hypothetical protein JCGZ_26195                         122   5e-29   Jatropha curcas
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease                122   5e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                122   6e-29   Nicotiana tomentosiformis
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease                122   6e-29   Tarenaya hassleriana [spider flower]
ref|XP_010923357.1|  PREDICTED: subtilisin-like protease                122   7e-29   
ref|XP_008351977.1|  PREDICTED: subtilisin-like protease                122   7e-29   
ref|XP_008393753.1|  PREDICTED: subtilisin-like protease                122   7e-29   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           122   7e-29   Cicer arietinum [garbanzo]
ref|XP_009360421.1|  PREDICTED: subtilisin-like protease                122   7e-29   Pyrus x bretschneideri [bai li]
ref|XP_003559080.1|  PREDICTED: subtilisin-like protease                122   8e-29   Brachypodium distachyon [annual false brome]
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease                122   8e-29   Nicotiana tomentosiformis
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                122   8e-29   Solanum lycopersicum
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            122   9e-29   Prunus persica
ref|XP_003609994.1|  Subtilisin-like protease                           122   9e-29   
gb|KDP41644.1|  hypothetical protein JCGZ_16051                         122   1e-28   Jatropha curcas
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                122   1e-28   Nicotiana tomentosiformis
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like           122   1e-28   
gb|ACN40199.1|  unknown                                                 121   1e-28   Picea sitchensis
ref|XP_003608462.1|  Subtilisin-like protease                           121   1e-28   Medicago truncatula
ref|NP_001234288.1|  SBT2 protein precursor                             121   1e-28   Solanum lycopersicum
emb|CDP02570.1|  unnamed protein product                                121   1e-28   Coffea canephora [robusta coffee]
gb|EPS61757.1|  hypothetical protein M569_13035                         121   1e-28   Genlisea aurea
gb|AES92191.2|  subtilisin-like serine protease                         121   1e-28   Medicago truncatula
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    121   1e-28   Elaeis guineensis
ref|NP_001051353.1|  Os03g0761500                                       121   1e-28   
ref|NP_001151463.1|  LOC100285096 precursor                             121   1e-28   
tpg|DAA51518.1|  TPA: putative subtilase family protein                 121   2e-28   
gb|EPS59495.1|  hypothetical protein M569_15309                         121   2e-28   Genlisea aurea
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                121   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           121   2e-28   Solanum tuberosum [potatoes]
ref|XP_003592386.1|  Subtilisin-like protease                           121   2e-28   
gb|AES62637.2|  subtilisin-like serine protease                         121   2e-28   Medicago truncatula
emb|CDP05276.1|  unnamed protein product                                121   2e-28   Coffea canephora [robusta coffee]
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                121   2e-28   Phoenix dactylifera
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                120   2e-28   Eucalyptus grandis [rose gum]
dbj|BAJ87780.1|  predicted protein                                      120   3e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                120   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease                120   3e-28   Sesamum indicum [beniseed]
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                120   3e-28   Prunus mume [ume]
emb|CDP20511.1|  unnamed protein product                                120   3e-28   Coffea canephora [robusta coffee]
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                120   3e-28   Erythranthe guttata [common monkey flower]
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like           120   3e-28   Solanum tuberosum [potatoes]
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                120   3e-28   Solanum lycopersicum
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                120   3e-28   Phoenix dactylifera
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease                120   4e-28   Prunus mume [ume]
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like           120   4e-28   Solanum tuberosum [potatoes]
ref|NP_001234282.1|  SBT1 protein precursor                             119   5e-28   
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                119   5e-28   Brassica rapa
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           120   5e-28   Setaria italica
emb|CDY00497.1|  BnaA10g07760D                                          119   5e-28   
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like           119   5e-28   Cicer arietinum [garbanzo]
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                119   6e-28   Solanum lycopersicum
emb|CDY29697.1|  BnaA04g17300D                                          119   6e-28   Brassica napus [oilseed rape]
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                119   6e-28   Populus euphratica
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g             119   6e-28   Populus trichocarpa [western balsam poplar]
emb|CDX75758.1|  BnaC03g38410D                                          115   6e-28   
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg             119   7e-28   Citrus clementina [clementine]
gb|EYU36337.1|  hypothetical protein MIMGU_mgv1a020902mg                119   7e-28   Erythranthe guttata [common monkey flower]
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease                119   8e-28   Phoenix dactylifera
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like           119   8e-28   Glycine max [soybeans]
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative      119   8e-28   Ricinus communis
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like           119   1e-27   Glycine max [soybeans]
gb|KJB29423.1|  hypothetical protein B456_005G099900                    119   1e-27   Gossypium raimondii
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    119   1e-27   Glycine max [soybeans]
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg             119   1e-27   Prunus persica
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like           119   1e-27   Glycine max [soybeans]
emb|CDY18651.1|  BnaA09g07440D                                          119   1e-27   Brassica napus [oilseed rape]
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                119   1e-27   Brachypodium distachyon [annual false brome]
ref|XP_003627424.1|  Subtilisin-like serine protease                    119   1e-27   Medicago truncatula
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like           118   1e-27   Citrus sinensis [apfelsine]
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g             119   1e-27   Phaseolus vulgaris [French bean]
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like           118   1e-27   Glycine max [soybeans]
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease                118   1e-27   Populus euphratica
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             118   1e-27   
ref|XP_004142885.1|  PREDICTED: subtilisin-like protease-like iso...    117   2e-27   
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease                118   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...    118   2e-27   Cucumis sativus [cucumbers]
emb|CDY18654.1|  BnaA09g07410D                                          118   2e-27   Brassica napus [oilseed rape]
emb|CDY43570.1|  BnaC02g16670D                                          112   2e-27   Brassica napus [oilseed rape]
emb|CDY18653.1|  BnaA09g07420D                                          118   2e-27   Brassica napus [oilseed rape]
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                118   2e-27   Brassica rapa
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                118   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                118   2e-27   Eucalyptus grandis [rose gum]
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         118   2e-27   Jatropha curcas
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                118   2e-27   
gb|KJB43875.1|  hypothetical protein B456_007G221100                    117   2e-27   Gossypium raimondii
ref|XP_006651839.1|  PREDICTED: subtilisin-like protease-like           117   2e-27   
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like           117   3e-27   Setaria italica
gb|ABR18065.1|  unknown                                                 117   3e-27   Picea sitchensis
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310          117   3e-27   Sorghum bicolor [broomcorn]
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                117   3e-27   Malus domestica [apple tree]
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                117   3e-27   Brassica rapa
ref|XP_003562295.2|  PREDICTED: subtilisin-like protease                117   3e-27   Brachypodium distachyon [annual false brome]
dbj|BAJ96698.1|  predicted protein                                      117   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86110.1|  predicted protein                                      117   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006841997.1|  hypothetical protein AMTR_s00144p00078130          117   3e-27   Amborella trichopoda
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                117   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_003547873.1|  PREDICTED: subtilisin-like protease-like           117   3e-27   Glycine max [soybeans]
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                117   4e-27   Nelumbo nucifera [Indian lotus]
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like           117   4e-27   Cicer arietinum [garbanzo]
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                117   4e-27   Eucalyptus grandis [rose gum]
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                117   4e-27   Prunus mume [ume]
gb|KEH35793.1|  subtilisin-like serine protease                         117   4e-27   Medicago truncatula
dbj|BAJ88205.1|  predicted protein                                      117   4e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY57437.1|  BnaAnng14520D                                          117   5e-27   Brassica napus [oilseed rape]
ref|XP_007047459.1|  Subtilase family protein                           117   5e-27   
ref|XP_002283279.2|  PREDICTED: subtilisin-like protease                117   5e-27   Vitis vinifera
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             117   5e-27   Eutrema salsugineum [saltwater cress]
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease                117   5e-27   Cucumis melo [Oriental melon]
dbj|BAJ99493.1|  predicted protein                                      117   5e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009803919.1|  PREDICTED: subtilisin-like protease                117   5e-27   Nicotiana sylvestris
ref|XP_003516516.1|  PREDICTED: subtilisin-like protease-like           117   5e-27   Glycine max [soybeans]
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           117   5e-27   Glycine max [soybeans]
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease                117   6e-27   Brassica rapa
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                116   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease                116   7e-27   Elaeis guineensis
gb|EYU44466.1|  hypothetical protein MIMGU_mgv1a0020561mg               112   7e-27   Erythranthe guttata [common monkey flower]
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease                116   8e-27   Sesamum indicum [beniseed]
ref|XP_004501532.1|  PREDICTED: subtilisin-like protease-like           116   9e-27   Cicer arietinum [garbanzo]
emb|CAA59963.1|  subtilisin-like protease                               116   9e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2     116   9e-27   
emb|CDX97560.1|  BnaA05g25190D                                          116   9e-27   
emb|CDY12840.1|  BnaC07g15930D                                          116   1e-26   Brassica napus [oilseed rape]
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             116   1e-26   Prunus persica
emb|CDY63300.1|  BnaCnng41800D                                          115   1e-26   Brassica napus [oilseed rape]
ref|XP_006653695.1|  PREDICTED: subtilisin-like protease-like           115   1e-26   
gb|EYU36342.1|  hypothetical protein MIMGU_mgv1a001789mg                115   1e-26   Erythranthe guttata [common monkey flower]
emb|CDY63302.1|  BnaCnng41810D                                          115   1e-26   Brassica napus [oilseed rape]
emb|CDY63219.1|  BnaAnng18730D                                          115   1e-26   Brassica napus [oilseed rape]
ref|XP_003558354.1|  PREDICTED: subtilisin-like protease                115   1e-26   Brachypodium distachyon [annual false brome]
ref|NP_001049524.2|  Os03g0242900                                       115   2e-26   
gb|AAM10321.1|  AT5g67360/K8K14_8                                       115   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                115   2e-26   Nicotiana tomentosiformis
ref|XP_002321861.2|  subtilase family protein                           115   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                115   2e-26   Populus euphratica
ref|NP_569048.1|  subtilisin-like protease                              115   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ADD09584.1|  proteinase inhibitor                                    115   2e-26   Trifolium repens [creeping white clover]
gb|AIX97848.1|  SBT1.5                                                  115   2e-26   Nicotiana tabacum [American tobacco]
ref|XP_009615143.1|  PREDICTED: subtilisin-like protease                115   2e-26   Nicotiana tomentosiformis
emb|CDY55359.1|  BnaCnng28690D                                          115   2e-26   Brassica napus [oilseed rape]
emb|CDX98438.1|  BnaC05g39370D                                          115   2e-26   
emb|CBI24480.3|  unnamed protein product                                114   2e-26   Vitis vinifera
gb|EPS74243.1|  subtilase family protein                                115   2e-26   Genlisea aurea
emb|CDY40653.1|  BnaA03g53100D                                          115   2e-26   Brassica napus [oilseed rape]
ref|XP_008780995.1|  PREDICTED: subtilisin-like protease                115   2e-26   Phoenix dactylifera
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease                115   2e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like           115   2e-26   Glycine max [soybeans]
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease                115   3e-26   Vitis vinifera
ref|XP_007024651.1|  Subtilase family protein                           115   3e-26   
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease                114   3e-26   Fragaria vesca subsp. vesca
ref|XP_010933329.1|  PREDICTED: subtilisin-like protease                114   3e-26   Elaeis guineensis
ref|XP_006587373.1|  PREDICTED: subtilisin-like protease-like           114   3e-26   Glycine max [soybeans]
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease                114   3e-26   Nicotiana sylvestris
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease                114   4e-26   Eucalyptus grandis [rose gum]
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease                114   4e-26   Eucalyptus grandis [rose gum]
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                     114   4e-26   Eucalyptus grandis [rose gum]
ref|NP_001050634.1|  Os03g0605300                                       114   4e-26   
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease                114   4e-26   Vitis vinifera
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease                114   4e-26   Brassica rapa
ref|XP_006280041.1|  hypothetical protein CARUB_v10025918mg             114   4e-26   
emb|CDX82491.1|  BnaA03g33300D                                          114   4e-26   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1     114   4e-26   
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease                114   4e-26   
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g             114   4e-26   
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           114   4e-26   
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290          114   4e-26   
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g             114   6e-26   
gb|EYU36336.1|  hypothetical protein MIMGU_mgv1a019012mg                114   6e-26   
ref|XP_008377982.1|  PREDICTED: subtilisin-like protease                114   6e-26   
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                114   7e-26   
emb|CDY67452.1|  BnaCnng55020D                                          114   7e-26   
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                114   7e-26   
ref|XP_004961962.1|  PREDICTED: subtilisin-like protease-like           114   7e-26   
ref|XP_006651591.1|  PREDICTED: subtilisin-like protease-like           111   7e-26   
dbj|BAJ91233.1|  predicted protein                                      113   8e-26   
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    113   8e-26   
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                113   8e-26   
dbj|BAJ94518.1|  predicted protein                                      113   8e-26   
gb|KFK30136.1|  hypothetical protein AALP_AA7G221600                    113   8e-26   
ref|XP_004512212.1|  PREDICTED: subtilisin-like protease-like           113   9e-26   
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like           113   9e-26   
ref|XP_009146389.1|  PREDICTED: subtilisin-like protease                113   9e-26   
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg             113   1e-25   
ref|XP_004290953.1|  PREDICTED: subtilisin-like protease                113   1e-25   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             113   1e-25   
ref|XP_007017192.1|  Subtilisin-like serine protease 2, putative        113   1e-25   
ref|XP_010920139.1|  PREDICTED: subtilisin-like protease                113   1e-25   
ref|XP_011041660.1|  PREDICTED: subtilisin-like protease                112   1e-25   
ref|XP_010320326.1|  PREDICTED: subtilisin-like protease                112   1e-25   
gb|EMT29812.1|  hypothetical protein F775_42283                         112   2e-25   
ref|XP_002465573.1|  hypothetical protein SORBIDRAFT_01g041350          112   2e-25   
emb|CDY22001.1|  BnaC09g01070D                                          112   2e-25   
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease                112   2e-25   
ref|XP_002534468.1|  Cucumisin precursor, putative                      109   2e-25   
gb|KJB58612.1|  hypothetical protein B456_009G218000                    112   2e-25   
ref|XP_011069783.1|  PREDICTED: subtilisin-like protease                112   2e-25   
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             112   2e-25   
ref|XP_010489238.1|  PREDICTED: subtilisin-like protease                112   2e-25   
ref|XP_007136744.1|  hypothetical protein PHAVU_009G070500g             112   2e-25   
ref|XP_007018544.1|  Xylem serine proteinase 1, putative isoform 2      112   2e-25   
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease                112   3e-25   
emb|CDX99895.1|  BnaC09g28100D                                          112   3e-25   
ref|XP_010519206.1|  PREDICTED: subtilisin-like protease isoform X1     112   3e-25   
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                112   3e-25   
ref|XP_007018543.1|  Xylem serine proteinase 1, putative isoform 1      112   3e-25   
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           112   3e-25   
ref|XP_007225532.1|  hypothetical protein PRUPE_ppa025871mg             112   3e-25   
gb|EYU36340.1|  hypothetical protein MIMGU_mgv1a001790mg                112   3e-25   
ref|XP_010320531.1|  PREDICTED: subtilisin-like protease                112   3e-25   
ref|XP_010688373.1|  PREDICTED: subtilisin-like protease                112   3e-25   
ref|XP_006649720.1|  PREDICTED: subtilisin-like protease-like           112   3e-25   
ref|XP_008788427.1|  PREDICTED: subtilisin-like protease                112   3e-25   
gb|KDO81558.1|  hypothetical protein CISIN_1g0053342mg                  104   3e-25   
ref|XP_007017191.1|  Subtilisin-like serine protease 2, putative        111   4e-25   
ref|XP_010263512.1|  PREDICTED: subtilisin-like protease                111   4e-25   
ref|XP_007158029.1|  hypothetical protein PHAVU_002G118200g             111   4e-25   
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             111   4e-25   
ref|NP_568765.1|  subtilase 1.3                                         111   4e-25   
ref|XP_004985040.1|  PREDICTED: subtilisin-like protease-like           111   4e-25   
ref|XP_010111996.1|  Subtilisin-like protease                           111   4e-25   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             111   5e-25   
ref|XP_002466832.1|  hypothetical protein SORBIDRAFT_01g014930          110   5e-25   
ref|XP_010443668.1|  PREDICTED: subtilisin-like protease isoform X1     111   5e-25   
emb|CDX72509.1|  BnaC07g45310D                                          111   5e-25   
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative      111   6e-25   
gb|AAO62352.1|  subtilase                                               110   7e-25   
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease                110   7e-25   
tpg|DAA50265.1|  TPA: putative subtilase family protein                 110   8e-25   
emb|CAH66960.1|  OSIGBa0147H17.8                                        110   8e-25   
ref|XP_007207210.1|  hypothetical protein PRUPE_ppa001938mg             110   8e-25   
ref|XP_002886065.1|  predicted protein                                  110   8e-25   
ref|XP_010443674.1|  PREDICTED: subtilisin-like protease isoform X2     110   8e-25   
tpg|DAA44340.1|  TPA: putative subtilase family protein                 110   9e-25   
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like           110   9e-25   
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like           110   9e-25   
ref|NP_001053614.1|  Os04g0573300                                       110   9e-25   
emb|CDP01316.1|  unnamed protein product                                110   9e-25   
ref|XP_003550312.1|  PREDICTED: subtilisin-like protease-like           110   9e-25   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g             110   1e-24   
ref|XP_004496012.1|  PREDICTED: subtilisin-like protease-like           110   1e-24   
ref|NP_567972.1|  subtilisin-like serine protease 2                     110   1e-24   
ref|XP_010263511.1|  PREDICTED: subtilisin-like protease                110   1e-24   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             110   1e-24   
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease                110   1e-24   
ref|XP_006412166.1|  hypothetical protein EUTSA_v10026999mg             110   1e-24   
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     110   1e-24   
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     110   1e-24   
ref|XP_010320327.1|  PREDICTED: subtilisin-like protease                110   1e-24   
ref|XP_006374838.1|  hypothetical protein POPTR_0014s01910g             110   1e-24   
ref|XP_003553808.1|  PREDICTED: subtilisin-like protease-like           110   1e-24   
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g             110   2e-24   
ref|XP_008363295.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    110   2e-24   
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease                110   2e-24   
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like           110   2e-24   
gb|ABR17987.1|  unknown                                                 109   2e-24   
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1     109   2e-24   
ref|XP_006369092.1|  subtilase family protein                           109   2e-24   
gb|KDP40686.1|  hypothetical protein JCGZ_24685                         109   2e-24   
ref|XP_011069662.1|  PREDICTED: subtilisin-like protease                109   2e-24   
ref|XP_003520892.1|  PREDICTED: subtilisin-like protease-like           109   2e-24   
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease                109   2e-24   
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like           109   2e-24   
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159             109   2e-24   
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease                109   3e-24   
ref|NP_566473.2|  Subtilase family protein                              109   3e-24   
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           109   3e-24   
dbj|BAE98521.1|  putative subtilisin-like serine proteinase             109   3e-24   
ref|NP_001151549.1|  subtilisin-like protease precursor                 109   3e-24   
ref|XP_002301156.2|  hypothetical protein POPTR_0002s12130g             109   3e-24   
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease                109   3e-24   
emb|CAA59964.1|  subtilisin-like protease                               109   3e-24   
ref|XP_006407103.1|  hypothetical protein EUTSA_v10020111mg             109   3e-24   
ref|XP_008220304.1|  PREDICTED: subtilisin-like protease                109   3e-24   
ref|XP_002313857.1|  hypothetical protein POPTR_0009s10340g             108   3e-24   
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg             108   3e-24   
ref|XP_010103418.1|  Subtilisin-like protease                           109   3e-24   
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                    108   3e-24   
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease                108   3e-24   
ref|XP_009771925.1|  PREDICTED: subtilisin-like protease                108   3e-24   
emb|CDX97540.1|  BnaA05g25390D                                          105   3e-24   
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease                108   3e-24   
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg             108   3e-24   
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like           108   3e-24   
gb|EYU25440.1|  hypothetical protein MIMGU_mgv1a0017511mg               108   3e-24   
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg             109   3e-24   
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease                108   4e-24   
emb|CAN75239.1|  hypothetical protein VITISV_014205                     108   4e-24   
ref|XP_008377981.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    108   4e-24   
ref|XP_008218400.1|  PREDICTED: subtilisin-like protease                108   4e-24   
gb|KJB08038.1|  hypothetical protein B456_001G060600                    108   4e-24   
ref|XP_008377749.1|  PREDICTED: subtilisin-like protease                108   5e-24   
ref|XP_002885009.1|  subtilase family protein                           108   5e-24   
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease                108   5e-24   
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease                108   5e-24   
gb|KDO68024.1|  hypothetical protein CISIN_1g004010mg                   107   6e-24   
gb|KDO68023.1|  hypothetical protein CISIN_1g004010mg                   108   6e-24   
ref|XP_002284864.1|  PREDICTED: subtilisin-like protease                108   6e-24   
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                108   6e-24   
ref|XP_004229661.1|  PREDICTED: subtilisin-like protease                108   6e-24   
ref|XP_007224759.1|  hypothetical protein PRUPE_ppa024174mg             108   6e-24   
gb|KEH30495.1|  subtilisin-like serine protease                         108   6e-24   
ref|XP_003636375.1|  Subtilisin-like protease                           108   6e-24   
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like           108   6e-24   
gb|KHN12975.1|  Subtilisin-like protease                                108   6e-24   
ref|XP_003605881.1|  Subtilisin-like protease                           108   6e-24   
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg             108   7e-24   
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    108   7e-24   
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease                108   7e-24   
ref|XP_009628999.1|  PREDICTED: subtilisin-like protease                108   7e-24   
ref|XP_009409659.1|  PREDICTED: subtilisin-like protease                108   7e-24   
ref|XP_003544482.1|  PREDICTED: subtilisin-like protease-like           108   7e-24   
ref|XP_009350566.1|  PREDICTED: subtilisin-like protease                108   7e-24   
gb|EMT12865.1|  Subtilisin-like protease                                106   8e-24   
ref|XP_006487073.1|  PREDICTED: subtilisin-like protease-like           107   9e-24   
ref|XP_008382901.1|  PREDICTED: subtilisin-like protease                106   9e-24   
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                107   9e-24   
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease                107   9e-24   
emb|CAN64995.1|  hypothetical protein VITISV_001779                     107   1e-23   
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050          107   1e-23   
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                    107   1e-23   
ref|XP_011000657.1|  PREDICTED: subtilisin-like protease                107   1e-23   
emb|CDY44380.1|  BnaA02g29970D                                          107   1e-23   
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           107   1e-23   
ref|XP_010696462.1|  PREDICTED: subtilisin-like protease                107   1e-23   
ref|XP_008352138.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    107   1e-23   
gb|EMT01035.1|  Subtilisin-like protease                                107   1e-23   
ref|XP_010552189.1|  PREDICTED: subtilisin-like protease                107   1e-23   
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841             107   1e-23   
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease                107   1e-23   
ref|XP_002320086.2|  subtilase family protein                           107   1e-23   
ref|XP_004958128.1|  PREDICTED: subtilisin-like protease-like           107   1e-23   
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                107   1e-23   
ref|XP_010089708.1|  Subtilisin-like protease                           107   1e-23   
gb|KDO59723.1|  hypothetical protein CISIN_1g046220mg                   107   1e-23   
ref|XP_006422999.1|  hypothetical protein CICLE_v10027863mg             107   1e-23   
ref|XP_007017194.1|  Subtilisin-like serine endopeptidase family ...    107   1e-23   
ref|XP_011069659.1|  PREDICTED: subtilisin-like protease                107   1e-23   
ref|XP_006847087.1|  hypothetical protein AMTR_s00017p00215540          104   2e-23   
gb|EYU25500.1|  hypothetical protein MIMGU_mgv1a001697mg                107   2e-23   
ref|XP_004249504.1|  PREDICTED: subtilisin-like protease                107   2e-23   
ref|XP_009400347.1|  PREDICTED: subtilisin-like protease                107   2e-23   
ref|XP_008357007.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    106   2e-23   
ref|XP_006401917.1|  hypothetical protein EUTSA_v10012740mg             107   2e-23   
emb|CDY33251.1|  BnaC01g37240D                                          107   2e-23   
ref|XP_007139067.1|  hypothetical protein PHAVU_009G262100g             107   2e-23   
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    106   2e-23   
ref|XP_010028239.1|  PREDICTED: subtilisin-like protease                106   2e-23   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             106   2e-23   
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease                106   2e-23   
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease                106   2e-23   
gb|EYU36350.1|  hypothetical protein MIMGU_mgv1a001799mg                106   2e-23   
gb|KCW54937.1|  hypothetical protein EUGRSUZ_I00910                     106   2e-23   
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           106   2e-23   
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease                106   2e-23   
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease                106   2e-23   
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    106   2e-23   
ref|XP_008785865.1|  PREDICTED: subtilisin-like protease                106   3e-23   
ref|XP_007038510.1|  Subtilase 1.3                                      106   3e-23   
ref|XP_010465317.1|  PREDICTED: subtilisin-like protease isoform X1     106   3e-23   
gb|KJB58523.1|  hypothetical protein B456_009G213500                    106   3e-23   
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    106   3e-23   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                106   3e-23   
gb|EYU36339.1|  hypothetical protein MIMGU_mgv1a001782mg                106   3e-23   
ref|XP_008220348.1|  PREDICTED: subtilisin-like protease                106   3e-23   
ref|XP_003624105.1|  Xylem serine proteinase                            106   3e-23   
ref|XP_004235537.1|  PREDICTED: subtilisin-like protease                106   3e-23   
emb|CAE03027.1|  OSJNBa0084A10.2                                        106   3e-23   
ref|NP_001052820.1|  Os04g0430700                                       106   3e-23   
emb|CAH67004.1|  OSIGBa0160I14.2                                        106   3e-23   
ref|XP_007156742.1|  hypothetical protein PHAVU_002G013500g             105   4e-23   
emb|CAN60787.1|  hypothetical protein VITISV_034533                     106   4e-23   
gb|KDO59722.1|  hypothetical protein CISIN_1g037455mg                   105   4e-23   
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180          106   4e-23   
ref|XP_002284869.3|  PREDICTED: subtilisin-like protease                105   4e-23   
gb|AAM60964.1|  subtilisin-like serine protease                         105   4e-23   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    105   4e-23   
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease                105   5e-23   
ref|XP_004958126.1|  PREDICTED: subtilisin-like protease-like           105   5e-23   
ref|XP_002510194.1|  Xylem serine proteinase 1 precursor, putative      105   5e-23   
ref|XP_006487124.1|  PREDICTED: subtilisin-like protease-like           105   5e-23   



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 123/158 (78%), Gaps = 13/158 (8%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSL  195
            WF+A+ +L+  L      +A+AK+TYIV M HH KPSS+ TH DWY+AHLQS   +EDSL
Sbjct  8    WFAALLLLVTCL------SAMAKQTYIVQMNHHSKPSSYATHHDWYSAHLQSLSSTEDSL  61

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
            LYTYTTAYHGFAA+L +++ E LR+ ++V+GVYED++Y+LHTTRTPEFLGL+ E GL AG
Sbjct  62   LYTYTTAYHGFAASLDSEQAELLRQSDSVLGVYEDTLYTLHTTRTPEFLGLEIESGLWAG  121

Query  376  HGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            H + +    + DVIVG+LDTGVWP S SFDD+GM  +P
Sbjct  122  HSTQDLNQASNDVIVGVLDTGVWPESKSFDDAGMPEIP  159



>ref|XP_008242250.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 13/158 (8%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSL  195
            WF+A+ +L+  L      +A AK+TYIV M HH KPSS+ TH DWY+AHLQS   +EDSL
Sbjct  8    WFAALLLLVTCL------SAKAKQTYIVQMNHHSKPSSYATHHDWYSAHLQSLSSTEDSL  61

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
            LYTYTTAYHGFAA+L +++ E LR+ ++V+GVYED++Y+LHTTRTPEFLGL+ E GL AG
Sbjct  62   LYTYTTAYHGFAASLDSEQAELLRQSDSVLGVYEDTLYTLHTTRTPEFLGLEIESGLWAG  121

Query  376  HGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            H + +    + DVIVG+LDTGVWP S SFDD+GM  +P
Sbjct  122  HSTQDLNQASNDVIVGVLDTGVWPESKSFDDAGMPEIP  159



>emb|CBI27801.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 117/164 (71%), Gaps = 13/164 (8%)
 Frame = +1

Query  7    AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  180
            AM S+VW      L      C + + +AK+TYIV M H +KP S+ TH DWY+A LQS  
Sbjct  42   AMASVVW------LFSFWFACFSLSVMAKRTYIVQMNHRQKPLSYATHDDWYSASLQSIS  95

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
             + D LLYTY+TAYHGFAA+L  ++ E LR+ ++V+GVYED VYSLHTTR+PEFLGLD E
Sbjct  96   SNSDDLLYTYSTAYHGFAASLDPEQAEALRKSDSVMGVYEDEVYSLHTTRSPEFLGLDTE  155

Query  358  FGLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             GL AGH + +    + DVI+G+LDTGVWP S SFDDSGMT VP
Sbjct  156  LGLWAGHRTQDLNQASQDVIIGVLDTGVWPDSRSFDDSGMTEVP  199



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 116/163 (71%), Gaps = 13/163 (8%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            M S+VW      L      C + + +AK+TYIV M H +KP S+ TH DWY+A LQS   
Sbjct  1    MASVVW------LFSFWFACFSLSVMAKRTYIVQMNHRQKPLSYATHDDWYSASLQSISS  54

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            + D LLYTY+TAYHGFAA+L  ++ E LR+ ++V+GVYED VYSLHTTR+PEFLGLD E 
Sbjct  55   NSDDLLYTYSTAYHGFAASLDPEQAEALRKSDSVMGVYEDEVYSLHTTRSPEFLGLDTEL  114

Query  361  GLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            GL AGH + +    + DVI+G+LDTGVWP S SFDDSGMT VP
Sbjct  115  GLWAGHRTQDLNQASQDVIIGVLDTGVWPDSRSFDDSGMTEVP  157



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 117/165 (71%), Gaps = 12/165 (7%)
 Frame = +1

Query  7    AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  180
            A  +++WF A++ ++    P       AKKTYIVHMKHH+KP+S+ TH DWY  HLQS  
Sbjct  2    AFRAVIWFLAVSFVI----PSCLHLTCAKKTYIVHMKHHQKPASYATHSDWYTDHLQSLT  57

Query  181  --SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
              + DSLLYTY  AYHG+AAAL  +EVE LR+ E+VVGVYED++YSLHTTRTPEFLGLD+
Sbjct  58   SGAGDSLLYTYDVAYHGYAAALIPEEVESLRQSESVVGVYEDTIYSLHTTRTPEFLGLDS  117

Query  355  EFGLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
              G  AGH   E    + DVI+G+LDTGVWP S SF D+ M  VP
Sbjct  118  GLGPWAGHSLQELNQASQDVIIGVLDTGVWPESKSFIDADMPDVP  162



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 112/137 (82%), Gaps = 7/137 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSLLYTYTTAYHGFAAALGADEVE  258
            AKKTYIVHMKHH+KP SF+TH DWY++ LQ+   + DSLLY+YTTA++GFAA+L  ++VE
Sbjct  21   AKKTYIVHMKHHDKPLSFETHHDWYSSSLQALSAAPDSLLYSYTTAFNGFAASLDPEQVE  80

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTG  426
             LR+ ++V+GVYED++Y+LHTTRTP+FLGLD EFGL AGH + +    + DVI+G+LDTG
Sbjct  81   LLRKSDSVLGVYEDTLYTLHTTRTPQFLGLDTEFGLWAGHNTQQLEQASRDVIIGVLDTG  140

Query  427  VWPXSXSFDDSGMTAVP  477
            VWP S SFDDS M  +P
Sbjct  141  VWPESKSFDDSDMPDLP  157



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=765

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 115/162 (71%), Gaps = 17/162 (10%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------S  183
            W  A+TILL    PC   +  AK+TYIV MKHH KPSSF TH DWY+A+LQ+        
Sbjct  9    WVVALTILL----PC--LSVTAKQTYIVQMKHHSKPSSFATHSDWYSANLQAVSSDSYSD  62

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
             D+LLYTY TAYHGFAA+L  D+ E LR+ E+V+GVYED+VY+LHTTRTPEFLGL+   G
Sbjct  63   SDALLYTYDTAYHGFAASLDPDQAETLRQSESVIGVYEDTVYNLHTTRTPEFLGLETANG  122

Query  364  LGAGHG----SPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
              AGH     +  + DVIVG+LDTGVWP S SF+D+GM  +P
Sbjct  123  FWAGHSLQDLNQASNDVIVGVLDTGVWPESKSFNDAGMPEIP  164



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 121/161 (75%), Gaps = 9/161 (6%)
 Frame = +1

Query  10   MGSLVWFS-AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  180
            M   +WFS ++ +LL L++ C +     K+TYIVHMK+H+KP ++ TH DWY+A+LQS  
Sbjct  1    MAKPIWFSFSVLLLLLLVQQCRSE----KRTYIVHMKNHDKPLAYATHHDWYSANLQSLS  56

Query  181  --SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
              +EDSLLYTYT +Y+GFAA+L  D+ E LR+ ++VVGVYED+VY+LHTTRTPEFLGL  
Sbjct  57   ASAEDSLLYTYTNSYNGFAASLDPDQAELLRKSDSVVGVYEDTVYTLHTTRTPEFLGLAV  116

Query  355  EFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            + GL A   +  + DVIVG+LDTGVWP S SFD++GM  +P
Sbjct  117  DKGLSAQDVNQASDDVIVGVLDTGVWPESKSFDETGMPEIP  157



>gb|KJB82990.1| hypothetical protein B456_013G223900 [Gossypium raimondii]
Length=760

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 107/138 (78%), Gaps = 8/138 (6%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEV  255
            AKKTYIVHMKH +KP SF+TH DWY++ LQS      +SLLY+Y  A+HGFAA+L  ++ 
Sbjct  20   AKKTYIVHMKHQDKPLSFETHNDWYSSSLQSLTATPAESLLYSYNAAFHGFAASLDPEQA  79

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDT  423
            E L + ++V+GVYED+VY+LHTTRTP+FLGLDAE GL AGH + +    + DVI+G+LDT
Sbjct  80   EALSKSDSVLGVYEDTVYNLHTTRTPQFLGLDAESGLWAGHNTQQLEQASRDVIIGVLDT  139

Query  424  GVWPXSXSFDDSGMTAVP  477
            GVWP S SFDDSGM  VP
Sbjct  140  GVWPESKSFDDSGMPEVP  157



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 118/167 (71%), Gaps = 10/167 (6%)
 Frame = +1

Query  7    AMGSLVWFSAIT-ILLHLLRP-CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS  180
            A   ++W  A+  +LLH   P  +ATAA A KTYIVHMKH++KP+S+ TH +WY+ HLQS
Sbjct  2    AFRPVIWLCAVAFVLLHSWLPLVSATAAAAVKTYIVHMKHNQKPASYATHTEWYSDHLQS  61

Query  181  ----SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGL  348
                + DSLLYTY  AY GFAAAL  +E + +R+ ++V+GVYED+VY+LHTTRTPEFLGL
Sbjct  62   LTSAAPDSLLYTYDAAYSGFAAALTPEEADSIRQSDSVLGVYEDTVYTLHTTRTPEFLGL  121

Query  349  DAEFGLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            + E G   GH   E    + DVI+G+LDTGVWP S SF D GM  VP
Sbjct  122  NTEPGPWTGHSLQELNKASQDVIIGVLDTGVWPESKSFADFGMPDVP  168



>gb|KHG16003.1| Subtilisin-like protease [Gossypium arboreum]
Length=760

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 106/138 (77%), Gaps = 8/138 (6%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEV  255
            AKKTYIVHMKH +KP SF+TH DWY + LQS      +SLLY+Y  A++GFAA+L  ++ 
Sbjct  20   AKKTYIVHMKHQDKPLSFETHNDWYRSSLQSLTSTPAESLLYSYNAAFNGFAASLDPEQA  79

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDT  423
            E L + ++V+GVYED+VY+LHTTRTP+FLGLDAE GL AGH + +    + DVI+G+LDT
Sbjct  80   EALGKSDSVLGVYEDTVYNLHTTRTPQFLGLDAESGLWAGHNTQQLEQASRDVIIGVLDT  139

Query  424  GVWPXSXSFDDSGMTAVP  477
            GVWP S SFDDSGM  VP
Sbjct  140  GVWPESKSFDDSGMPEVP  157



>ref|XP_004245414.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=768

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 109/161 (68%), Gaps = 9/161 (6%)
 Frame = +1

Query  19   LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SE  186
            ++   ++ IL  L    +A     KKTYIVHMKHH KP SF TH  WY  HLQS    ++
Sbjct  6    IILLFSMNILFFLHSSTSAIPISTKKTYIVHMKHHLKPPSFSTHHQWYKTHLQSLTSSTQ  65

Query  187  DSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
            +SLLYTYT AYHGFAA+L + EVE LR+ E VV +Y+D+ Y+  TTRTPEFLGLD +   
Sbjct  66   NSLLYTYTNAYHGFAASLDSHEVELLRKSEYVVNIYQDTFYTPQTTRTPEFLGLD-KIDF  124

Query  367  GAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            GAG  SPE    A DVI+G+LD+GVWP S SF D GM+ VP
Sbjct  125  GAGRTSPEFNMAAQDVIIGVLDSGVWPESESFSDLGMSNVP  165



>gb|KJB27211.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=630

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 107/135 (79%), Gaps = 5/135 (4%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS----LLYTYTTAYHGFAAALGADEV  255
            AKKTYIV MKH +KP SF+TH DW+++ LQS  DS    LLY+YT A++GFAA+L  ++ 
Sbjct  25   AKKTYIVQMKHQDKPLSFETHHDWHSSSLQSLTDSPPESLLYSYTEAFNGFAASLNEEQA  84

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA-DVIVGILDTGVW  432
            E L + E+++GVYED+VY+LHTTR+P+FLGLDA+ GL A  GS +A+ DVI+G+LDTGVW
Sbjct  85   ESLSKSESILGVYEDTVYTLHTTRSPQFLGLDADLGLWATGGSTQASEDVIIGVLDTGVW  144

Query  433  PXSXSFDDSGMTAVP  477
            P S SFDDSGM  +P
Sbjct  145  PESKSFDDSGMPEIP  159



>ref|XP_003533787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 105/145 (72%), Gaps = 15/145 (10%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS-----------EDSLLYTYTTAYHGFAA  234
            AKKTYIVHMKHHEKPS + TH DWY+A LQ S            + LLY+YTTAY+GFAA
Sbjct  26   AKKTYIVHMKHHEKPSVYPTHTDWYSASLQQSLTLTTADSDSDSNPLLYSYTTAYNGFAA  85

Query  235  ALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADV  402
            +L  ++ E+L R E V+GVYED+VY LHTTRTPEFLGL+ E GL  GH + +    + DV
Sbjct  86   SLNDEQAEQLLRSEDVLGVYEDTVYQLHTTRTPEFLGLEKETGLWEGHTAQDLNQASNDV  145

Query  403  IVGILDTGVWPXSXSFDDSGMTAVP  477
            I+G+LDTGVWP S SFDD+GM  +P
Sbjct  146  IIGVLDTGVWPESPSFDDAGMPEIP  170



>gb|KJB27210.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=762

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 107/135 (79%), Gaps = 5/135 (4%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS----LLYTYTTAYHGFAAALGADEV  255
            AKKTYIV MKH +KP SF+TH DW+++ LQS  DS    LLY+YT A++GFAA+L  ++ 
Sbjct  25   AKKTYIVQMKHQDKPLSFETHHDWHSSSLQSLTDSPPESLLYSYTEAFNGFAASLNEEQA  84

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA-DVIVGILDTGVW  432
            E L + E+++GVYED+VY+LHTTR+P+FLGLDA+ GL A  GS +A+ DVI+G+LDTGVW
Sbjct  85   ESLSKSESILGVYEDTVYTLHTTRSPQFLGLDADLGLWATGGSTQASEDVIIGVLDTGVW  144

Query  433  PXSXSFDDSGMTAVP  477
            P S SFDDSGM  +P
Sbjct  145  PESKSFDDSGMPEIP  159



>ref|XP_006356658.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=768

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 112/164 (68%), Gaps = 13/164 (8%)
 Frame = +1

Query  19   LVWFSAITILLHLLRPCAATAAV---AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            ++  S I ILL  L    +T+A+    KKTYIVHMKHH KP SF TH  WY  HLQS   
Sbjct  6    IILLSTINILL-FLHSSTSTSAIPISTKKTYIVHMKHHLKPPSFSTHHQWYKTHLQSLTS  64

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
             +++SLLYTYTTAYHGFAA+L + EVE LR+ + VV +YED+ Y+  TTRTPEFLGLD +
Sbjct  65   STQNSLLYTYTTAYHGFAASLDSHEVELLRQSDYVVNIYEDTFYTPQTTRTPEFLGLD-K  123

Query  358  FGLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
               G G   P+    A DVI+G+LDTGVWP S SF D GM+ VP
Sbjct  124  LDFGDGRTLPDFNTAAQDVIIGVLDTGVWPESESFSDLGMSNVP  167



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 112/164 (68%), Gaps = 12/164 (7%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            + S+    AI ++L L   C  + + AKKTYIVHMKH  KP+ + TH +WY+ H QS   
Sbjct  3    LASVFCVCAIAVVLQL---CLFSVS-AKKTYIVHMKHRHKPAIYATHGEWYSDHFQSLTA  58

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
               DSLLYTY  AYHGFAAA+  +E E LR+ ++V+GVYED+VY+LHTTRTPEFLGLD+E
Sbjct  59   ADPDSLLYTYDAAYHGFAAAMSPEEAESLRQSDSVLGVYEDAVYNLHTTRTPEFLGLDSE  118

Query  358  FGLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             G   GH   E    + DVI+G+LDTGVWP S SF DS M  +P
Sbjct  119  LGPWVGHSLQELNQASQDVIIGVLDTGVWPESKSFSDSNMADIP  162



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 113/167 (68%), Gaps = 17/167 (10%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            MGS + FS I +LL +L+PC     +AKK YIVHMK+H+ PSSF TH DWY A LQS   
Sbjct  1    MGSFLCFSVIVVLL-VLQPC-----LAKKVYIVHMKNHQIPSSFATHHDWYNAQLQSLSS  54

Query  190  SLL-------YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGL  348
            S         Y+Y  AY GFAA+L   E E LR+ + VVGVYED+VY+LHTTRTPEFLGL
Sbjct  55   SSTSDESSLLYSYDAAYSGFAASLDPHEAELLRQSDDVVGVYEDTVYTLHTTRTPEFLGL  114

Query  349  DAEFGLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            + E GL AGH   E    A DV++G+LDTGVWP S S++D GM  VP
Sbjct  115  NNELGLWAGHSPQELNNAAQDVVIGVLDTGVWPESKSYNDFGMPDVP  161



>ref|XP_009359724.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 111/158 (70%), Gaps = 13/158 (8%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL--  198
            WF  + +LL    PC   +A+AK+TYIV M HH KP S+ TH DWY+A LQS        
Sbjct  7    WFGVLLLLL----PC--FSAMAKQTYIVQMNHHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  199  -YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
             YTYT AYHGFAA+L  ++ E LR+ ++V+GVYED+VY+LHTTRTPEFLGLD E GL  G
Sbjct  61   LYTYTDAYHGFAASLDPEQAELLRQSDSVIGVYEDTVYNLHTTRTPEFLGLDTELGLWEG  120

Query  376  HGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            H + +    + DVIVG+LDTGVWP S SFDD+GM  +P
Sbjct  121  HSTQDLNQASNDVIVGVLDTGVWPESKSFDDTGMPEIP  158



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 111/167 (66%), Gaps = 17/167 (10%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            MGS + FS I + L + +PC      +KK YIVHMK+H+ PSSF TH DWY A LQS   
Sbjct  1    MGSFLCFSVIVLFL-VFQPC-----FSKKVYIVHMKNHQIPSSFATHHDWYNAQLQSLSS  54

Query  190  SLL-------YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGL  348
            S         Y+Y TAY GFAA+L   E E LR+ + VVGVYED+VY+LHTTRTPEFLGL
Sbjct  55   SSTSDESSLLYSYDTAYSGFAASLDPHEAELLRQSDDVVGVYEDTVYTLHTTRTPEFLGL  114

Query  349  DAEFGLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            + E GL AGH   E    A DV++G+LDTGVWP S SF+D GM  VP
Sbjct  115  NNELGLWAGHSPQELNNAAQDVVIGVLDTGVWPESKSFNDFGMPNVP  161



>ref|XP_009337216.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 113/158 (72%), Gaps = 13/158 (8%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL--  198
            WF A+ +LL    PC   +A+AK+TYIVHM  H KP S+ TH DWY+A LQS        
Sbjct  7    WFGALLLLL----PC--LSAMAKQTYIVHMNQHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  199  -YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
             YTYT AYHGFAA+L  D+ E LR+ ++V+GVYED+VY+LHTTRTPEFLGLD E GL AG
Sbjct  61   LYTYTDAYHGFAASLDPDQAELLRQSDSVIGVYEDTVYNLHTTRTPEFLGLDTELGLWAG  120

Query  376  HGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            H + +    + DVI+G+LDTGVWP S SFDD+GM  +P
Sbjct  121  HSTQDLNQASNDVIIGVLDTGVWPESKSFDDTGMPEIP  158



>gb|EPS65938.1| hypothetical protein M569_08836, partial [Genlisea aurea]
Length=738

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 101/138 (73%), Gaps = 8/138 (6%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEV  255
            AKKTYIVHMK H KP S++TH DWY+ HL S     ED+LLY Y  AY GFAAA+  +EV
Sbjct  2    AKKTYIVHMKRHMKPPSYRTHADWYSQHLASVASAEEDALLYAYDAAYPGFAAAMSPEEV  61

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG---HGSPEAA-DVIVGILDT  423
            + LRR ++V GVYED+VYSLHTTRTP+FLGLD E G  AG    G   A+ DVI+G+LDT
Sbjct  62   DSLRRSDSVFGVYEDTVYSLHTTRTPQFLGLDLELGPLAGVNIEGLNRASQDVIIGVLDT  121

Query  424  GVWPXSXSFDDSGMTAVP  477
            GVWP S SF+D+ M  VP
Sbjct  122  GVWPESKSFNDANMAEVP  139



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 108/165 (65%), Gaps = 15/165 (9%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            MGSL  FS I  LL +L PC      AKKTYIVH+KH +KP S+ TH DWY A L+S   
Sbjct  1    MGSLFCFSLIAFLL-VLHPC-----FAKKTYIVHVKHQQKPPSYSTHHDWYDAQLKSLSS  54

Query  190  SLLYT-----YTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
            S         Y TAY GFAA+L   E E LR+ E VVGVYED+VY+LHTTRTPEFLGLD 
Sbjct  55   SSNSESLLYSYDTAYPGFAASLDPHEAELLRQSEDVVGVYEDTVYTLHTTRTPEFLGLDN  114

Query  355  EFGLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            E G+ AGH   E    A DVI+G+LDTGVWP S SF D GM  VP
Sbjct  115  ELGVWAGHTQQELNSAAQDVIIGVLDTGVWPESKSFSDVGMPDVP  159



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 110/163 (67%), Gaps = 9/163 (6%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            MGS  +F+  T  + L+  C       KKTYIVHMKH  KP+ + TH DWY+A+LQS   
Sbjct  1    MGS--FFTLFTFSVLLVAQCCWCLTSPKKTYIVHMKHRNKPAIYPTHTDWYSANLQSFTT  58

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
              D LLYTYT AY+GFAA+L  D+ + L R E V+GVYE++VY LHTTRTP+FLGLD E 
Sbjct  59   DSDPLLYTYTDAYNGFAASLAEDQAQELLRSEDVLGVYEETVYQLHTTRTPQFLGLDRET  118

Query  361  GLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            GL  GH + +    + DVIVG+LDTGVWP S SF D+ M  +P
Sbjct  119  GLWEGHTTQDLNLASHDVIVGVLDTGVWPESPSFADAEMPEIP  161



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 113/158 (72%), Gaps = 13/158 (8%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL--  198
            WF A+ +LL    PC   +A+AK+TYIVHM  H KP S+ TH DWY+A LQS        
Sbjct  7    WFGALLLLL----PC--LSAMAKQTYIVHMNQHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  199  -YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
             YTYT AYHGFAA+L  D+ E LR+ ++V+GVYED+VY+LHTTRTPEFLGLD E GL AG
Sbjct  61   LYTYTDAYHGFAASLDPDQAELLRQSDSVIGVYEDTVYNLHTTRTPEFLGLDTESGLWAG  120

Query  376  HGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            H + +    + DVI+G+LDTGVWP S SFDD+GM  +P
Sbjct  121  HSTQDLNQASNDVIIGVLDTGVWPESKSFDDTGMPEIP  158



>ref|XP_006381615.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59412.1| subtilase family protein [Populus trichocarpa]
Length=768

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 102/137 (74%), Gaps = 7/137 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSLLYTYTTAYHGFAAALGADEVE  258
            AK+TYIVHMKH+ KP SF TH DWY A LQS   + DSLLYTYT A+ GFAA+L  +EVE
Sbjct  29   AKQTYIVHMKHNTKPDSFPTHHDWYTASLQSVTSTPDSLLYTYTNAFDGFAASLSDEEVE  88

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHG----SPEAADVIVGILDTG  426
             L++ ++VV VYED++YSLHTTRTP FLGL+ + GL  GH     +  + DVIVG+LDTG
Sbjct  89   LLKQSQSVVDVYEDTLYSLHTTRTPAFLGLNTDLGLLDGHHAMGINQSSNDVIVGVLDTG  148

Query  427  VWPXSXSFDDSGMTAVP  477
            +WP S SF DSGM  +P
Sbjct  149  IWPESKSFYDSGMPEIP  165



>ref|XP_006342387.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 111/170 (65%), Gaps = 20/170 (12%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            MGSL+ F  I  LL +L PC      AKKTYIVH+KHH+KPSS+ TH DWY A L+S   
Sbjct  1    MGSLLCFCLIAFLL-VLHPC-----FAKKTYIVHVKHHQKPSSYSTHHDWYDAQLKSLSS  54

Query  190  SLLYT----------YTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEF  339
            S   +          Y TAY GFAA+L   E E LR+ + VVGVYED+VY+LHTTRTPEF
Sbjct  55   SSSSSSSNSESLLYSYDTAYPGFAASLDPHEAELLRQSDDVVGVYEDTVYTLHTTRTPEF  114

Query  340  LGLDAEFGLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            LGLD + G+ AGH   E    A DVI+G+LDTGVWP S SF D GM  VP
Sbjct  115  LGLDNQLGVWAGHTQQELNSAAQDVIIGVLDTGVWPESKSFSDVGMPDVP  164



>ref|XP_011039978.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=767

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 102/137 (74%), Gaps = 7/137 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSLLYTYTTAYHGFAAALGADEVE  258
            AK+TYIVHMKH+ KP SF TH DWY A LQS   + DSLLYTYT A+ GFAA+L  +EVE
Sbjct  29   AKQTYIVHMKHNTKPDSFPTHHDWYTASLQSVTSTPDSLLYTYTNAFDGFAASLSDEEVE  88

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHG----SPEAADVIVGILDTG  426
             L++ ++VV VYED++YSLHTTRTP FLGL+ + GL  GH     +  + DVIVG+LDTG
Sbjct  89   FLKQSQSVVDVYEDTLYSLHTTRTPAFLGLNTDLGLLDGHHAMGINQSSNDVIVGVLDTG  148

Query  427  VWPXSXSFDDSGMTAVP  477
            +WP S SF DSGM  +P
Sbjct  149  IWPESKSFYDSGMPEIP  165



>gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 104/140 (74%), Gaps = 7/140 (5%)
 Frame = +1

Query  79   AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSLLYTYTTAYHGFAAALGAD  249
            +  AK+TYIVHMKH+ KP SF TH DWY+A LQS   + DSLLYTYTTA+ GFAA+L  +
Sbjct  21   SVTAKQTYIVHMKHNAKPESFATHHDWYSASLQSITSASDSLLYTYTTAFPGFAASLDPE  80

Query  250  EVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGIL  417
            EV+ LR  +AV+ VYED++YSLHTTRTP+FLGL  + G   GH + +    + DV++G+L
Sbjct  81   EVDSLRNSDAVLDVYEDTIYSLHTTRTPQFLGLSTDLGFFNGHTTLDIDQASHDVVIGVL  140

Query  418  DTGVWPXSXSFDDSGMTAVP  477
            DTGV P S SFDDSGM  +P
Sbjct  141  DTGVTPGSKSFDDSGMPEIP  160



>ref|XP_010261834.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=773

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 115/167 (69%), Gaps = 10/167 (6%)
 Frame = +1

Query  7    AMGSLVWFSAITILLHLLRPCA--ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS  180
            AM SL W S  T LL LL        + +AK+TYIVHMKHH KP S+ TH DWY+A LQS
Sbjct  2    AMASLAWSSCFTFLLLLLLLLLLHCLSVLAKQTYIVHMKHHLKPLSYATHHDWYSAQLQS  61

Query  181  SEDSLL----YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGL  348
               S      YTY+TAYHGFAA+L  D+VE LR   +V+GVY+DS+Y+LHTTRTPEFLGL
Sbjct  62   LSSSGSSTLLYTYSTAYHGFAASLDPDQVEALRLSASVLGVYQDSIYTLHTTRTPEFLGL  121

Query  349  DAEFGLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            D +  L AGH + +      DVI+GILDTGVWP S SFDDSGM  VP
Sbjct  122  DTDLSLWAGHRTQDLDQATKDVIIGILDTGVWPESKSFDDSGMPQVP  168



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 110/151 (73%), Gaps = 3/151 (2%)
 Frame = +1

Query  31   SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYT  210
            S+ITI+   L       A AKKTYIV +KH +KP SFQTH DWY + LQ SE SLLYTYT
Sbjct  4    SSITIITTFLFLFLLHHASAKKTYIVRVKHSDKPDSFQTHHDWYTSQLQ-SESSLLYTYT  62

Query  211  TAYHGFAAALGADEVER-LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSP  387
            T++HG++A L +DE +  LR  ++V+ V+ED VY+LHTTRTPEFLGL++EFG+  G    
Sbjct  63   TSFHGYSAYLDSDEADSLLRDSDSVLDVFEDPVYTLHTTRTPEFLGLNSEFGVYTGQDLG  122

Query  388  EAAD-VIVGILDTGVWPXSXSFDDSGMTAVP  477
             A++ VI+G+LDTGVWP S SFDD+ M  +P
Sbjct  123  SASNGVIIGVLDTGVWPESKSFDDTDMPEIP  153



>ref|XP_008337844.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 110/158 (70%), Gaps = 13/158 (8%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL--  198
            WF  + +LL    PC   +A+AK+TYIV M HH KP S+ TH DWY+A LQS        
Sbjct  7    WFGVLLLLL----PC--FSAMAKQTYIVQMNHHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  199  -YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
             YTYT AYHGFAA+L  ++ E L + ++V+GVYED+VY+LHTTRTPEFLGLD E GL  G
Sbjct  61   LYTYTDAYHGFAASLDPEQAELLHQSDSVIGVYEDTVYNLHTTRTPEFLGLDTESGLWEG  120

Query  376  HGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            H + +    + DVIVG+LDTGVWP S SFDD+GM  +P
Sbjct  121  HSTQDLNQASNDVIVGVLDTGVWPESKSFDDTGMPEIP  158



>emb|CDP03080.1| unnamed protein product [Coffea canephora]
Length=646

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 98/132 (74%), Gaps = 11/132 (8%)
 Frame = +1

Query  112  MKHHEKPSSFQTHRDWYAAHLQS-----SEDSLLYTYTTAYHGFAAALGADEVERLRRLE  276
            MKHH+KP S+ TH DWY+  LQS       DS++Y+YTTAYHGFAA+L   E E LR+ +
Sbjct  1    MKHHQKPPSYSTHTDWYSDRLQSLTSSSRPDSIVYSYTTAYHGFAASLDPKEAESLRQSD  60

Query  277  AVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE-----AADVIVGILDTGVWPXS  441
             V+GVYED+VY LHTTR+PEFLGLD+E GL AGH +P+     + DVI+G+LDTGVWP S
Sbjct  61   EVLGVYEDAVYQLHTTRSPEFLGLDSELGLWAGH-TPQYLNQASQDVIIGVLDTGVWPES  119

Query  442  XSFDDSGMTAVP  477
             SF D+G+  VP
Sbjct  120  KSFSDAGLPGVP  131



>emb|CDY33400.1| BnaA07g04390D [Brassica napus]
Length=751

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 105/155 (68%), Gaps = 15/155 (10%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------SEDS  192
            I L LL      +A AK+TYIV +KH +KP SF TH DWY + LQS          SE  
Sbjct  11   IFLFLLY-----SAEAKRTYIVRVKHSDKPESFSTHHDWYTSQLQSISTDPQSQSESESP  65

Query  193  LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGA  372
            LLYTYTT+++GF+A L  DE E L R E+++ V+ED VY+L TTRTPEFLGL++EFG+ +
Sbjct  66   LLYTYTTSFNGFSAFLDTDEAESLLRSESILDVFEDPVYTLDTTRTPEFLGLNSEFGVAS  125

Query  373  GHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            G+    +  VI+G+LDTGVWP S S+DD GM  +P
Sbjct  126  GYSGHASNGVIIGVLDTGVWPESKSYDDYGMPEIP  160



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = +1

Query  82   AVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVER  261
            A AKKTYIV +KH +KP SFQTH DWY + LQ SE SLLYTYTT++HG++A L +DE + 
Sbjct  21   ASAKKTYIVRVKHSDKPDSFQTHHDWYTSQLQ-SESSLLYTYTTSFHGYSAYLDSDEADS  79

Query  262  -LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD-VIVGILDTGVWP  435
             LR  ++V+ V+ED VY+LHTTRTPEFLGL++EFG+  G     A++ V++G+LDTGVWP
Sbjct  80   LLRDSDSVLDVFEDPVYTLHTTRTPEFLGLNSEFGVYTGQDLGSASNGVVIGVLDTGVWP  139

Query  436  XSXSFDDSGMTAVP  477
             S SFDD+ M  +P
Sbjct  140  ESKSFDDTDMPEIP  153



>gb|AHA84190.1| subtilisin-like protease [Phaseolus vulgaris]
Length=760

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 107/162 (66%), Gaps = 14/162 (9%)
 Frame = +1

Query  19   LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----S  183
            LV FS +     L+  C       KKTYIVHMKH  KP+ + TH DWY+A+LQ       
Sbjct  9    LVHFSVL-----LVAQCCWCLTSPKKTYIVHMKHRNKPAIYPTHTDWYSANLQLLLSPLH  63

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
             D LLYTYTTAY+GFAA+L  D+ + L R E V+GVYE++VY LHTTRTP+FLGLD E G
Sbjct  64   SDPLLYTYTTAYNGFAASLAEDQAQELLRSEDVLGVYEETVYQLHTTRTPQFLGLDRETG  123

Query  364  LGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            L  GH + +    + DVIVG+LDTGVWP S SF D+ M  +P
Sbjct  124  LWEGHTTQDLNQASHDVIVGVLDTGVWPESPSFADAEMPEIP  165



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 105/139 (76%), Gaps = 9/139 (6%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL-----YTYTTAYHGFAAALGADE  252
            AKKTYIVHMKHH  PS + TH DWY+A+LQS   S       YTYT+++HGFAA L + E
Sbjct  23   AKKTYIVHMKHHALPSQYLTHHDWYSANLQSLSSSSSSDSLLYTYTSSFHGFAAFLDSQE  82

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILD  420
            VE LR+ ++V+GVYED+VY+LHTTRTP FLGLD++FGL  GH + +    + DVI+G+LD
Sbjct  83   VELLRQSDSVLGVYEDTVYNLHTTRTPGFLGLDSDFGLWEGHTTQDLNQASHDVIIGVLD  142

Query  421  TGVWPXSXSFDDSGMTAVP  477
            TG+WP S SFDD+GM  +P
Sbjct  143  TGIWPESKSFDDTGMPEIP  161



>ref|XP_004488082.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 102/150 (68%), Gaps = 20/150 (13%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------------SEDSLLYTYTTAY  219
            +KKTYIVHMK H KPS +QTH DWY A LQS                  D LLY+YTTAY
Sbjct  23   SKKTYIVHMKDHNKPSVYQTHHDWYTASLQSLSINTDSESSDSDSDSDFDPLLYSYTTAY  82

Query  220  HGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE---  390
            +GFA  L  ++V+ L R ++V+GVYED+VY LHTTRTP+FLGL+ E GL  GH + E   
Sbjct  83   NGFAVTLNDEQVQSLTRSDSVLGVYEDTVYQLHTTRTPQFLGLETETGLWEGHRTQELDQ  142

Query  391  -AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             + DVIVG+LDTGVWP S SF+D+G+  +P
Sbjct  143  ASHDVIVGVLDTGVWPESLSFNDAGLPVIP  172



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 102/132 (77%), Gaps = 3/132 (2%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERL-  264
            AKKTYIV +KH ++P SFQTH DWY + LQS E SLLYTYTT++HG++A L +DE + L 
Sbjct  24   AKKTYIVRVKHSDEPDSFQTHHDWYTSQLQS-ESSLLYTYTTSFHGYSAYLDSDEADSLL  82

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD-VIVGILDTGVWPXS  441
            R  ++V+ V+ED VY+LHTTRTPEFLGL++EFG+  G     A++ VI+G+LDTGVWP S
Sbjct  83   RDSDSVLDVFEDPVYTLHTTRTPEFLGLNSEFGVYTGQDLGSASNGVIIGVLDTGVWPES  142

Query  442  XSFDDSGMTAVP  477
             SFDD+ M  +P
Sbjct  143  KSFDDTDMPEIP  154



>ref|XP_010273846.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=761

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 100/138 (72%), Gaps = 5/138 (4%)
 Frame = +1

Query  76   TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEV  255
            T   AK+TYIVHM H +KP+SF TH DWY + L +   SL+Y+Y  A+HGFA +L  +++
Sbjct  21   TVFAAKQTYIVHMNHQQKPTSFPTHHDWYQS-LSTDPSSLIYSYNNAFHGFAISLDPNQL  79

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDT  423
              LRR ++V+ +Y DS+YSLHTTR+PEFLGLD++ GL  GH + +    + DVI+G+LDT
Sbjct  80   ASLRRSDSVLAIYPDSLYSLHTTRSPEFLGLDSDLGLWPGHSTEDLDQASQDVIIGVLDT  139

Query  424  GVWPXSXSFDDSGMTAVP  477
            GVWP S SFDD G+  VP
Sbjct  140  GVWPESKSFDDMGIPPVP  157



>emb|CAN71376.1| hypothetical protein VITISV_001491 [Vitis vinifera]
Length=734

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 106/163 (65%), Gaps = 23/163 (14%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            M S+VW      L      C + + +AK+TYIV M H +KP S+ TH DWY+A LQS   
Sbjct  1    MASVVW------LFSFWFACFSLSVMAKRTYIVQMNHRQKPLSYXTHDDWYSASLQSISS  54

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            + D LLYTY+TAYHGFAA+L  ++ E LR+ ++V GVYED VYSLHTTR           
Sbjct  55   NSDDLLYTYSTAYHGFAASLDPEQAEALRKSDSVXGVYEDEVYSLHTTR----------L  104

Query  361  GLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            GL AGH + +    + DVI+G+LDTGVWP S SFDDSGMT VP
Sbjct  105  GLWAGHRTQDLNQASQDVIIGVLDTGVWPDSRSFDDSGMTEVP  147



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL---YTYTTAYHGFAAALGADEVE  258
            AK+TYIVHMKH  KPS+F TH DWYA+ +QS   S     YTY TAY+GFAA+L  D+ +
Sbjct  24   AKQTYIVHMKHQAKPSTFSTHNDWYASSVQSLSSSTDSLLYTYNTAYNGFAASLDPDQAQ  83

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTG  426
             LR+ +AV+GVYED++Y+LHTTR+P+FLG+ ++FGL AG+   +    + DVI+G+LDTG
Sbjct  84   ALRQSDAVLGVYEDTLYTLHTTRSPQFLGISSDFGLSAGYSKLDFDKASLDVIIGVLDTG  143

Query  427  VWPXSXSFDDSGMTAVP  477
            VWP S SFDDS M  VP
Sbjct  144  VWPESKSFDDSAMPEVP  160



>ref|XP_011093838.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=743

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 106/162 (65%), Gaps = 14/162 (9%)
 Frame = +1

Query  19   LVWFSAITILLHL-LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----S  183
            +V   A   LLH  L P +A     KKTYIV M H +KP S+ TH  WY+ HLQ+    +
Sbjct  6    VVCLCAAVFLLHSSLFPVSA-----KKTYIVQMNHQQKPPSYATHGQWYSDHLQTLTSAA  60

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
             +S+LYTY +AY+GFAAAL  +EVE LR+ ++V+ VYED VY+LHTTRTPEFLGLD E  
Sbjct  61   PESILYTYGSAYNGFAAALSDEEVESLRQSDSVLDVYEDPVYTLHTTRTPEFLGLDTELA  120

Query  364  LGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
               GH   E    + +VI+G+LDTGVWP S SF D  M  VP
Sbjct  121  PSVGHSLQELNQASQEVIIGVLDTGVWPESKSFSDKDMADVP  162



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 112/161 (70%), Gaps = 14/161 (9%)
 Frame = +1

Query  31   SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS--------E  186
            S+ITI   L+    +T A  KKTYIV +KH +KP SF TH DWY + LQS         E
Sbjct  3    SSITISFLLIFLLYSTEA--KKTYIVRVKHSDKPDSFPTHHDWYTSQLQSLSTQQQSESE  60

Query  187  DSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
             SLLYTYTT+++GF+A L ++E E L R ++++ V+ED VY+LHTTRTPEFLGL++EFG+
Sbjct  61   SSLLYTYTTSFNGFSAFLDSNEAESLLRSDSILDVFEDPVYTLHTTRTPEFLGLNSEFGV  120

Query  367  GAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             AG+   +    +  VI+G+LDTGVWP S SFDDSGM  +P
Sbjct  121  AAGYSGQDLGQASNSVIIGVLDTGVWPESKSFDDSGMPEIP  161



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 105/139 (76%), Gaps = 9/139 (6%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL-----YTYTTAYHGFAAALGADE  252
            AKKTYIVHMKHH  PS + TH DWY+A LQS   S       YTYT+++HGFAA L ++E
Sbjct  25   AKKTYIVHMKHHALPSEYLTHHDWYSASLQSLSSSSSSDSLLYTYTSSFHGFAAFLDSEE  84

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILD  420
            VE LR+ ++V+GVYED+VY+LHTTRTP FLGLD++FGL  GH + +    + DVI+G+LD
Sbjct  85   VELLRQSDSVLGVYEDTVYNLHTTRTPGFLGLDSDFGLWEGHTTQDLNQASHDVIIGVLD  144

Query  421  TGVWPXSXSFDDSGMTAVP  477
            TG+WP S SFDD+GM  +P
Sbjct  145  TGIWPESKSFDDTGMPEIP  163



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL---YTYTTAYHGFAAALGADEVE  258
            AK+TYIVHMKH  KPS+F TH DWYA+ +QS   S     YTY TAY+GFAA+L  D+ +
Sbjct  24   AKQTYIVHMKHQAKPSTFSTHNDWYASSVQSLSSSTDSLLYTYNTAYNGFAASLDPDQAQ  83

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTG  426
             LR+ +AV+GVYED++Y+LHTTR+P+FLG+ ++FGL AG+   +    + DVI+G+LDTG
Sbjct  84   ALRQSDAVLGVYEDTLYTLHTTRSPQFLGISSDFGLLAGYSKLDFDKASLDVIIGVLDTG  143

Query  427  VWPXSXSFDDSGMTAVP  477
            VWP S SFDDS M  VP
Sbjct  144  VWPESKSFDDSAMPEVP  160



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 102/137 (74%), Gaps = 7/137 (5%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL---YTYTTAYHGFAAALGADEVE  258
            AK+TYIVHMKH  KPS+F TH DWYA+ +QS   S     YTY TAY GFAA+L  D+ +
Sbjct  43   AKQTYIVHMKHQAKPSTFSTHYDWYASSVQSLSSSTDSLLYTYNTAYDGFAASLDPDQAQ  102

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTG  426
             LR+ +AV+GVYED++Y+LHTTR+P+FLG+ ++FGL AG+   +    + DVI+G+LDTG
Sbjct  103  ALRQSDAVLGVYEDTLYTLHTTRSPQFLGISSDFGLSAGYSKLDFDKASLDVIIGVLDTG  162

Query  427  VWPXSXSFDDSGMTAVP  477
            VWP S SFDDS M  VP
Sbjct  163  VWPESKSFDDSAMPEVP  179



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 105/157 (67%), Gaps = 17/157 (11%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-SEDS---------  192
            I L LL      +A AK+TYIV +KH +KP SF TH DWY + LQS S D          
Sbjct  11   IFLFLLY-----SAEAKRTYIVRVKHSDKPESFSTHHDWYTSQLQSISTDPQSQSQSESE  65

Query  193  --LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
              LLYTYTT+++GF+A L  DE E L R E+++ V+ED VY+L TTRTPEFLGL++EFG+
Sbjct  66   SPLLYTYTTSFNGFSAFLDTDEAESLLRSESILDVFEDPVYTLDTTRTPEFLGLNSEFGV  125

Query  367  GAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             +G+    +  VI+G+LDTGVWP S S+DD GM  +P
Sbjct  126  ASGYSGHASNGVIIGVLDTGVWPESKSYDDYGMPEIP  162



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 104/144 (72%), Gaps = 11/144 (8%)
 Frame = +1

Query  79   AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------SEDSLLYTYTTAYHGFAAA  237
            A  +++TYIV M HH KP SF TH DWY++HLQS        E SLLYTYT+A+HGFAA 
Sbjct  28   AGASRRTYIVRMNHHAKPESFSTHHDWYSSHLQSLSSSSDSGEYSLLYTYTSAFHGFAAV  87

Query  238  LGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG---HGSPEAAD-VI  405
            L  DE E LRR + V+ V+E++VYSLHTTRTPEFLGL+ EFG   G   H   +A++ V+
Sbjct  88   LNPDEAEALRRSDPVLDVFEETVYSLHTTRTPEFLGLNPEFGSWVGYSAHDLDQASNGVV  147

Query  406  VGILDTGVWPXSXSFDDSGMTAVP  477
            +G+LDTGVWP S SFDD+GM  +P
Sbjct  148  IGVLDTGVWPESRSFDDTGMPEIP  171



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 111/158 (70%), Gaps = 10/158 (6%)
 Frame = +1

Query  34   AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS------L  195
            A+T+L  L      +  +AK+TYIVHMKHH KP +F TH++WY+A LQS   +      L
Sbjct  5    ALTLLSLLFISITCSTTIAKQTYIVHMKHHTKPEAFATHQEWYSASLQSVTTTTSPSDSL  64

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
            LY+Y++A+ GFAA+L  +E + LR+  AV+ VYED+VYSLHTTRTPEFLGL+ + GL  G
Sbjct  65   LYSYSSAFPGFAASLDPEEADSLRKSNAVLDVYEDTVYSLHTTRTPEFLGLNTDLGLLGG  124

Query  376  HGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            H S +    +  V++G+LDTGVWP S SFDDSGM  +P
Sbjct  125  HNSLDIDRASYSVVIGVLDTGVWPESKSFDDSGMPEIP  162



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = +1

Query  82   AVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVER  261
            A AKKTYIV +KH +KP SFQ+H DWY++ L S E SLLYTYTT++HGF+A L + E E 
Sbjct  23   AAAKKTYIVRVKHSDKPESFQSHHDWYSSQLNS-ESSLLYTYTTSFHGFSAYLTSSEAES  81

Query  262  L-RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD-VIVGILDTGVWP  435
            L R  ++++ V+ED +Y+LHTTRTPEFLGL++EFG+        A++ VI+G+LDTGVWP
Sbjct  82   LLRDSDSILDVFEDPLYTLHTTRTPEFLGLNSEFGVYTNQDLVSASNGVIIGVLDTGVWP  141

Query  436  XSXSFDDSGMTAVP  477
             S SFDD+ M  +P
Sbjct  142  ESKSFDDTDMPEIP  155



>ref|XP_009767539.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=761

 Score =   157 bits (396),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 82/145 (57%), Positives = 102/145 (70%), Gaps = 10/145 (7%)
 Frame = +1

Query  70   AATAAV-AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAA  234
            ++ AA+  KKTYIVHMKHH KP SF TH  WY ++LQS    +++SLLYTY  A HGFAA
Sbjct  17   SSMAAIPTKKTYIVHMKHHLKPPSFSTHHQWYKSYLQSLTSSNKNSLLYTYDIASHGFAA  76

Query  235  ALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADV  402
            +L   EV+ LR+ ++VV VYED+ Y+L TTRTPEFLGLD      AG   PE    A DV
Sbjct  77   SLYPHEVDLLRQSDSVVNVYEDTFYTLQTTRTPEFLGLD-NLNSWAGRTLPELNNAAQDV  135

Query  403  IVGILDTGVWPXSXSFDDSGMTAVP  477
            I+G+LD+G+WP S SF D GM+ VP
Sbjct  136  IIGVLDSGIWPESKSFSDVGMSNVP  160



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 104/159 (65%), Gaps = 12/159 (8%)
 Frame = +1

Query  31   SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------  180
            S ITI L  L      +A AK+TYIV +KH +KP SF TH DWY   LQS          
Sbjct  3    SPITITLIFL--FLLYSAEAKRTYIVRVKHSDKPESFSTHHDWYTWQLQSISTDPQSQTE  60

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            SE  LLYTY T+++GF+A L  +E E L R ++++ V+ED VY+L TTRTPEFLGL +EF
Sbjct  61   SESPLLYTYKTSFNGFSAFLDTEEAESLLRSDSILDVFEDPVYTLDTTRTPEFLGLKSEF  120

Query  361  GLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            G+ +G+    +  VI+G+LDTGVWP S S+DD GM  +P
Sbjct  121  GVASGYSGHASNGVIIGVLDTGVWPESKSYDDYGMPEIP  159



>ref|XP_002519361.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42978.1| conserved hypothetical protein [Ricinus communis]
Length=192

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 104/161 (65%), Gaps = 9/161 (6%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            MGS+    A T     L    +  A+AKKTYIVHM H+ KP+S+ TH  WY + + SS  
Sbjct  1    MGSM----ATTFYFFSLVLSFSLPAIAKKTYIVHMNHNAKPNSYPTHHHWYQSLVTSSSS  56

Query  190  SLL-YTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
              L YTYT A+HGFAA L   E + LR +++V+ V+E+ +Y+L TT TP+FLG+DA FGL
Sbjct  57   DSLLYTYTAAFHGFAAHLDPQEADALREMDSVLNVFEEEIYTLQTTHTPQFLGIDANFGL  116

Query  367  GAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
              G    +    +ADVIVG+LD+GVWP S S DD G+ A+P
Sbjct  117  SDGRNFNDVEQASADVIVGVLDSGVWPESKSLDDKGLPAIP  157



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 102/143 (71%), Gaps = 13/143 (9%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSL---------LYTYTTAYHGFAAAL  240
             ++TYIV M H+EKP SF TH DWY++HL S   S          LYTYT+A+HGF+A L
Sbjct  23   GRRTYIVRMNHNEKPESFSTHHDWYSSHLHSLSSSSSSGDDESSLLYTYTSAFHGFSAVL  82

Query  241  GADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIV  408
              DE E LRR + V+ V+E++VYSLHTTRTPEFLGL++EFG  AG+G+ +    +  V++
Sbjct  83   DPDEAEALRRSDPVLDVFEETVYSLHTTRTPEFLGLNSEFGSWAGYGAQDLNQASYGVVI  142

Query  409  GILDTGVWPXSXSFDDSGMTAVP  477
            G+LDTGVWP S SFDD+GM  +P
Sbjct  143  GVLDTGVWPESRSFDDTGMPEIP  165



>gb|KCW79385.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=564

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 90/135 (67%), Gaps = 9/135 (7%)
 Frame = +1

Query  100  YIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL---------YTYTTAYHGFAAALGADE  252
            YIVHM HHEKPS F TH DWY + L S   S           Y+Y+ AY GFAA+L   +
Sbjct  31   YIVHMSHHEKPSLFPTHHDWYLSRLLSLPSSSSSSTSSPNLLYSYSAAYPGFAASLDPSQ  90

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVW  432
               LRR  AV+GVYED+VYSLHTTRTPEFLGL AE      +  P +ADV++G+LDTGVW
Sbjct  91   AASLRRSPAVLGVYEDAVYSLHTTRTPEFLGLSAELSAHDPNPDPSSADVVIGVLDTGVW  150

Query  433  PXSXSFDDSGMTAVP  477
            P S SFDDSGM  VP
Sbjct  151  PESRSFDDSGMPDVP  165



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 95/145 (66%), Gaps = 16/145 (11%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS----------LLYTYTTAYHGFAAAL  240
            KKTYIVHM  H  PSSF THRDWYA+ LQS   S          LLYTYT A+HGFAA L
Sbjct  33   KKTYIVHMNPHHMPSSFATHRDWYASSLQSLSSSSDASAAAADPLLYTYTAAFHGFAATL  92

Query  241  GADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL-----GAGHGSPEA-ADV  402
              DE + LR   +V+GVYED+VY LHTTRTP FLG+  + GL     G   G   A  DV
Sbjct  93   DPDEADALRSSASVLGVYEDTVYELHTTRTPAFLGISGDLGLWDPQEGPNGGKRRAFGDV  152

Query  403  IVGILDTGVWPXSXSFDDSGMTAVP  477
            IVG+LDTGVWP S SFDD+GM  +P
Sbjct  153  IVGVLDTGVWPESKSFDDAGMPELP  177



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 92/144 (64%), Gaps = 15/144 (10%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE---------DSLLYTYTTAYHGFAAALG  243
            KKTYIVH   H  P SF THRDWYA+ LQS           D LLYTYT A+HGFAA L 
Sbjct  30   KKTYIVHKNPHHMPPSFATHRDWYASSLQSLSSSDASAAAGDPLLYTYTAAFHGFAATLD  89

Query  244  ADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA------ADVI  405
             DE + LR   +V+GVYED+VY LHTTRTP FLG+  + GL   H  P         DVI
Sbjct  90   PDEADALRSSASVLGVYEDTVYELHTTRTPAFLGISDDLGLWDPHEGPNGGKRRAFGDVI  149

Query  406  VGILDTGVWPXSXSFDDSGMTAVP  477
            VG+LDTGVWP S SFDD+GM  +P
Sbjct  150  VGVLDTGVWPESKSFDDAGMPELP  173



>gb|KCW81959.1| hypothetical protein EUGRSUZ_C03325 [Eucalyptus grandis]
Length=840

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 92/144 (64%), Gaps = 15/144 (10%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE---------DSLLYTYTTAYHGFAAALG  243
            KKTYIVH   H  P SF THRDWYA+ LQS           D LLYTYT A+HGFAA L 
Sbjct  30   KKTYIVHKNPHHMPPSFATHRDWYASSLQSLSSSDASAAAGDPLLYTYTAAFHGFAATLD  89

Query  244  ADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA------ADVI  405
             DE + LR   +V+GVYED+VY LHTTRTP FLG+  + GL   H  P         DVI
Sbjct  90   PDEADALRSSASVLGVYEDTVYELHTTRTPAFLGISDDLGLWDPHEGPNGGKRRAFGDVI  149

Query  406  VGILDTGVWPXSXSFDDSGMTAVP  477
            VG+LDTGVWP S SFDD+GM  +P
Sbjct  150  VGVLDTGVWPESKSFDDAGMPELP  173



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 90/135 (67%), Gaps = 9/135 (7%)
 Frame = +1

Query  100  YIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL---------YTYTTAYHGFAAALGADE  252
            YIVHM HHEKPS F TH DWY + L S   S           Y+Y+ AY GFAA+L   +
Sbjct  31   YIVHMSHHEKPSLFPTHHDWYLSRLLSLPSSSSSSTSSPNLLYSYSAAYPGFAASLDPSQ  90

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVW  432
               LRR  AV+GVYED+VYSLHTTRTPEFLGL AE      +  P +ADV++G+LDTGVW
Sbjct  91   AASLRRSPAVLGVYEDAVYSLHTTRTPEFLGLSAELSAHDPNPDPSSADVVIGVLDTGVW  150

Query  433  PXSXSFDDSGMTAVP  477
            P S SFDDSGM  VP
Sbjct  151  PESRSFDDSGMPDVP  165



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 94/145 (65%), Gaps = 16/145 (11%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS----------LLYTYTTAYHGFAAAL  240
            KKTYIVHM  H  PSSF THRDWYA+ LQS   S          LLYTYT A+HGFAA L
Sbjct  30   KKTYIVHMNPHHMPSSFATHRDWYASSLQSLSSSSDASAAAADPLLYTYTAAFHGFAATL  89

Query  241  GADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL-----GAGHGSPEA-ADV  402
              DE + LR   +V+GVYED+VY LHTTR P FLG+  + GL     G   G   A  DV
Sbjct  90   DPDEADALRSSASVLGVYEDTVYELHTTRKPAFLGISGDLGLWDQQEGPNGGKRRAFGDV  149

Query  403  IVGILDTGVWPXSXSFDDSGMTAVP  477
            IVG+LDTGVWP S SFDD+GM  +P
Sbjct  150  IVGVLDTGVWPESKSFDDAGMPELP  174



>ref|XP_009590702.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=778

 Score =   147 bits (371),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 79/153 (52%), Positives = 97/153 (63%), Gaps = 25/153 (16%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------------------SEDSLLYTYT  210
            KKTYIVHMK H KP SF TH  WY ++LQS                    +++SLLYTY 
Sbjct  26   KKTYIVHMKRHLKPPSFSTHNQWYKSYLQSLTSSNKNSLLYTYNISLTSSNKNSLLYTYN  85

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
             A HGFAA+L   EV+ LR+ ++VV VYED+ Y+L TTRTPEFLGLD      AG   PE
Sbjct  86   IASHGFAASLYPHEVDLLRQSDSVVNVYEDTFYTLQTTRTPEFLGLD-NLNSWAGRTLPE  144

Query  391  ----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                A DVI+G+LD+G+WP S SF+D GM+ VP
Sbjct  145  LNNAAQDVIIGVLDSGIWPESKSFNDLGMSNVP  177



>ref|XP_003541310.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=751

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 97/154 (63%), Gaps = 13/154 (8%)
 Frame = +1

Query  31   SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYT  210
            S+I++   LL+    +A   KKTYIVHMK     S   T RDWYAA L SS DSLLY YT
Sbjct  3    SSISLFFLLLQLTMLSAT--KKTYIVHMKQRHDSSVHPTQRDWYAATLDSSPDSLLYAYT  60

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL-----GAG  375
             +Y+GFAA L   E   LR  ++V+GVYED+ Y+LHTTRTPEFLGL A          A 
Sbjct  61   ASYNGFAAILDPQEAHVLRASDSVLGVYEDTRYTLHTTRTPEFLGLQAHSAFWQDLHQAS  120

Query  376  HGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            H      DV++G+LDTGVWP S SFDDS M  +P
Sbjct  121  H------DVVIGVLDTGVWPESQSFDDSQMPQIP  148



>ref|XP_010666857.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=776

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 96/143 (67%), Gaps = 15/143 (10%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLL-------------YTYTTAYHGFA  231
            +KTYIVHM HH+KPS FQTH +WY+++L S                   YTY  +Y GFA
Sbjct  27   RKTYIVHMNHHQKPSIFQTHHEWYSSNLHSLSSFDTLSSSSSSSSPSLLYTYENSYSGFA  86

Query  232  AALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD-AEFGLGAGHGSPEAADVIV  408
            A L   EV+ L++ +AV G+YED++Y+LHTTRTPEFLGLD A  GL +G    + +DVIV
Sbjct  87   ATLTNSEVQSLQQNDAVFGIYEDTLYTLHTTRTPEFLGLDVAGEGLASGE-KLDTSDVIV  145

Query  409  GILDTGVWPXSXSFDDSGMTAVP  477
            G+LDTG+WP S SF DSG+  VP
Sbjct  146  GVLDTGIWPESESFSDSGIPPVP  168



>ref|XP_010050438.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79388.1| hypothetical protein EUGRSUZ_C00800 [Eucalyptus grandis]
Length=759

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 103/163 (63%), Gaps = 14/163 (9%)
 Frame = +1

Query  16   SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SE  186
            S  W   + + L L  PCA    +AKKTYIV M     P +F T +DWY+A+LQS     
Sbjct  4    SAAWLPFLALSL-LAFPCA----MAKKTYIVQMTDQSVPGTFNTSQDWYSANLQSLASGA  58

Query  187  DSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
              +LY Y+ A+HG+AA+L  ++ E LR  +AV+GVYED +Y LHTTRTP FL ++ EFGL
Sbjct  59   TDILYVYSEAFHGYAASLEPNQAEALRSSDAVLGVYEDVMYHLHTTRTPSFLKVEDEFGL  118

Query  367  GAGHGSP-EAAD-----VIVGILDTGVWPXSXSFDDSGMTAVP  477
              G G+P E  D     VIVGILDTGV+P S SFDD G   VP
Sbjct  119  WPGTGNPTEKTDEPFPEVIVGILDTGVFPESKSFDDLGFPEVP  161



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 109/171 (64%), Gaps = 25/171 (15%)
 Frame = +1

Query  34   AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY------------AAHLQ  177
            +I +LL L+  C +  +  KKTYIVHMK+H  P+ + TH +WY            +++L 
Sbjct  7    SIFLLLTLISQCYSLPS--KKTYIVHMKNHYNPTIYPTHYNWYSSTLQSLSLSIDSSNLD  64

Query  178  SSE-------DSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPE  336
            S +       D LLY+YTTAY GFAA L   + E L + + V+GVYED++Y LHTTRTP+
Sbjct  65   SDDVVDETDSDPLLYSYTTAYTGFAAKLNTQQAETLLQNDDVLGVYEDTLYHLHTTRTPQ  124

Query  337  FLGLDAEFGLGAGHGSPE----AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            FLGL+ + GL  GH + E    + DVI+G+LDTGVWP S SF+D+G+  +P
Sbjct  125  FLGLETQTGLWEGHRTQELDQASHDVIIGVLDTGVWPESLSFNDAGLPEIP  175



>ref|XP_007154575.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
 gb|ESW26569.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
Length=761

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 5/132 (4%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERLR  267
            AKK+YIVHMK    P    TH DWY A L SS DSL+Y YT+ Y+GFAA L   ++  LR
Sbjct  30   AKKSYIVHMKERHDPGVHPTHLDWYTATLLSSSDSLIYAYTSVYNGFAATLDPQQLHALR  89

Query  268  RLEAVVGVYEDSVYSLHTTRTPEFLGLDA--EFGLGAGHGSPEAADVIVGILDTGVWPXS  441
              ++V+GVYED++Y+LHTTRTPEFLGL A  EF       S    +V++G+LDTGVWP S
Sbjct  90   TSDSVLGVYEDTLYTLHTTRTPEFLGLQAHSEFWEDLHQAS---HNVVIGVLDTGVWPES  146

Query  442  XSFDDSGMTAVP  477
             SFDDS M  +P
Sbjct  147  QSFDDSQMPQIP  158



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 98/131 (75%), Gaps = 2/131 (2%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERLR  267
            AKKTYI+ +KH +KP SF TH DWY + LQS   SLLYTYTT++HGF+A L ++E + L 
Sbjct  22   AKKTYIIRVKHSDKPESFLTHHDWYTSQLQSQS-SLLYTYTTSFHGFSAYLDSNEADSLL  80

Query  268  RLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD-VIVGILDTGVWPXSX  444
               +++ ++ED +Y+LHTTRTPEFLGL++EFG+  G     A++ VI+G+LDTGVWP S 
Sbjct  81   SSNSILDIFEDPLYTLHTTRTPEFLGLNSEFGVYTGQDLASASNGVIIGVLDTGVWPESK  140

Query  445  SFDDSGMTAVP  477
            SFDD+ M  +P
Sbjct  141  SFDDTDMPEIP  151



>gb|KCW79387.1| hypothetical protein EUGRSUZ_C00799 [Eucalyptus grandis]
Length=729

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 102/163 (63%), Gaps = 14/163 (9%)
 Frame = +1

Query  16   SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SE  186
            S  W + + + L L  PCA    +AKKTYIV MK    P +F T  DWY+A+LQS     
Sbjct  4    SAAWLTFLALSL-LAFPCA----MAKKTYIVQMKEQSVPGTFNTSLDWYSANLQSLAPGV  58

Query  187  DSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
             ++LY Y+ A+HG+A +L   + E LR  + V+GVYED +Y LHTTRTP FL ++ EFGL
Sbjct  59   ANILYVYSEAFHGYAVSLEPHQAEALRSSDTVLGVYEDIMYHLHTTRTPSFLKVEDEFGL  118

Query  367  GAGHGSPEA------ADVIVGILDTGVWPXSXSFDDSGMTAVP  477
              G G+P         +VI+G++DTGV+P S SF+DSG   VP
Sbjct  119  WPGTGNPAKETDQTFPEVIIGLIDTGVFPESKSFEDSGFPEVP  161



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 93/134 (69%), Gaps = 10/134 (7%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERLR  267
            AKKTYI+ + H +KP SF TH DWY + L S E SLLYTYTT++HGF+A L + E + L 
Sbjct  26   AKKTYIIRVNHSDKPESFLTHHDWYTSQLNS-ESSLLYTYTTSFHGFSAYLDSTEADSLL  84

Query  268  RLEAVVG-VYEDSVYSLHTTRTPEFLGLDAEFG---LGAGHGSPEAADVIVGILDTGVWP  435
                 +  ++ED +Y+LHTTRTPEFLGL++EFG   LG+      +  VI+G+LDTGVWP
Sbjct  85   SSSNSILDIFEDPLYTLHTTRTPEFLGLNSEFGVHDLGS-----SSNGVIIGVLDTGVWP  139

Query  436  XSXSFDDSGMTAVP  477
             S SFDD+ M  +P
Sbjct  140  ESRSFDDTDMPEIP  153



>gb|KHN06066.1| Subtilisin-like protease [Glycine soja]
Length=598

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 90/137 (66%), Gaps = 15/137 (11%)
 Frame = +1

Query  112  MKHHEKPSSFQTHRDWYAAHL-----------QSSEDSLLYTYTTAYHGFAAALGADEVE  258
            MKHH+K S + TH DWY   L            S  + LLY+YTT+Y GFAA+L  ++VE
Sbjct  1    MKHHKKSSVYPTHSDWYNTTLLQSLTLTTTDSDSKSNPLLYSYTTSYKGFAASLNDEQVE  60

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----AADVIVGILDTG  426
             L + E V+ VYED+VY LHTTRTPEFLGL+ E  L  GH + +    + DVI+G+LDTG
Sbjct  61   ELLKSEDVLKVYEDTVYQLHTTRTPEFLGLEKETKLWEGHTAQDLNQASHDVIIGVLDTG  120

Query  427  VWPXSXSFDDSGMTAVP  477
            VWP S SFDD+GM  +P
Sbjct  121  VWPESSSFDDAGMPEIP  137



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 97/135 (72%), Gaps = 8/135 (6%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS--EDSLLYTYTTAYHGFAAALGADEVER  261
            +K+TYI+ +KH +KP SF TH DWY++ LQS      LLY+Y+T++HG++A L + E + 
Sbjct  22   SKRTYIIRVKHSDKPDSFSTHHDWYSSQLQSLSSNPQLLYSYSTSFHGYSAFLDSHEADT  81

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGA---GHGSPEAADVIVGILDTGVW  432
            L   ++V+ ++ED +Y+LHTTRTPEFLGL ++ G  A   GH S    DV++G+LDTGVW
Sbjct  82   LLNSDSVLDIFEDPIYTLHTTRTPEFLGLSSDLGFAATDLGHAS---NDVVIGVLDTGVW  138

Query  433  PXSXSFDDSGMTAVP  477
            P S S+DD+GM  +P
Sbjct  139  PESKSYDDTGMPEIP  153



>gb|ACN39811.1| unknown [Picea sitchensis]
Length=690

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 101/164 (62%), Gaps = 23/164 (14%)
 Frame = +1

Query  34   AITILLHLLRPCAATAAVA------KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----  180
             +++LL L   C AT   A      KKTY+VHM   + P+ F +H  WYA+ ++S     
Sbjct  10   CVSVLLVL--GCLATVLAAISHDGVKKTYVVHMAKSQMPAGFTSHEHWYASAVKSVLSEE  67

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD-AE  357
             E S+LY Y  A+HGFAA L A + E L +   ++G+Y ++VY LHTTRTP+FLGL+ AE
Sbjct  68   EEPSILYNYDDAFHGFAARLNAAQAEALEKTHGILGIYPETVYELHTTRTPQFLGLETAE  127

Query  358  FGLGAGHGSPEAA----DVIVGILDTGVWPXSXSFDDSGMTAVP  477
             G+      PE A    DV++G+LDTGVWP S SF+D GM  VP
Sbjct  128  SGM-----WPEKANFGHDVVIGVLDTGVWPESLSFNDRGMGPVP  166



>ref|XP_004287970.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=761

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 92/149 (62%), Gaps = 4/149 (3%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYT  210
            + +LL      AA    ++ TYIVHM   E P+SFQ H  WY A L+S+ DS  +LYTY+
Sbjct  8    LVVLLLGFSGYAAAEVSSRSTYIVHMAKSEMPASFQHHTHWYDASLKSASDSAEMLYTYS  67

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
             A HGF+  L  +E E L+    V+ V  +  Y LHTTRTPEFLGLD    L     S  
Sbjct  68   NAIHGFSTQLTPEEAEMLKFQPGVLFVLPELKYELHTTRTPEFLGLDQNNELFP--ESQS  125

Query  391  AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            A+DVI+G+LDTGVWP S SFDDSG+  VP
Sbjct  126  ASDVIIGVLDTGVWPESKSFDDSGLGPVP  154



>gb|KDP32432.1| hypothetical protein JCGZ_13357 [Jatropha curcas]
Length=1003

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 90/128 (70%), Gaps = 7/128 (5%)
 Frame = +1

Query  112  MKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGV  291
            M H+ KP ++ TH  WY + L S+ DS+LYTYTTA+ GFAA L  +E E L++L+ V+ V
Sbjct  1    MNHNSKPDTYTTHHQWYQS-LTSTSDSILYTYTTAFQGFAAYLDPEEAESLKKLDNVLNV  59

Query  292  YEDSVYSLHTTRTPEFLGLDAEFGL-GAGHGSPE-----AADVIVGILDTGVWPXSXSFD  453
            +ED VYSL TT TP+FLGL++ FGL   G  + +     + D+I+G+LD+G+WP S SFD
Sbjct  60   FEDGVYSLQTTHTPQFLGLNSNFGLIDDGRRTFQEIERASQDIIIGVLDSGIWPESKSFD  119

Query  454  DSGMTAVP  477
            D+G+  +P
Sbjct  120  DTGLPEIP  127



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 89/142 (63%), Gaps = 7/142 (5%)
 Frame = +1

Query  67   CAATAAVA---KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFA  231
            C++TAAVA   K+TYIVHM   + P +F  HR WY A L+S  D+  +LY Y T  HGF+
Sbjct  18   CSSTAAVAAAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVSDTAEILYAYDTVAHGFS  77

Query  232  AALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVG  411
            A L   E   + R   V+GV  ++ Y LHTTRTPEFLGLD   G      S   +DV+VG
Sbjct  78   ARLTPAEARAMERRPGVLGVMAEARYELHTTRTPEFLGLDRTEGFIP--QSNTTSDVVVG  135

Query  412  ILDTGVWPXSXSFDDSGMTAVP  477
            +LDTGVWP   S+DD+G+  VP
Sbjct  136  VLDTGVWPERKSYDDAGLGPVP  157



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 89/142 (63%), Gaps = 7/142 (5%)
 Frame = +1

Query  67   CAATAAVA---KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFA  231
            C++TAAVA   K+TYIVHM   + P +F  HR WY A L+S  D+  +LY Y T  HGF+
Sbjct  18   CSSTAAVAAAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVSDTAEILYAYDTVAHGFS  77

Query  232  AALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVG  411
            A L   E   + R   V+GV  ++ Y LHTTRTPEFLGLD   G      S   +DV+VG
Sbjct  78   ARLTPAEARAMERRPGVLGVMAEARYELHTTRTPEFLGLDRTEGFIP--QSNTTSDVVVG  135

Query  412  ILDTGVWPXSXSFDDSGMTAVP  477
            +LDTGVWP   S+DD+G+  VP
Sbjct  136  VLDTGVWPERKSYDDAGLGPVP  157



>ref|XP_009401756.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=782

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 85/145 (59%), Gaps = 17/145 (12%)
 Frame = +1

Query  94   KTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------------SEDSLLYTYTTAYHG  225
            KTYIVH+   EKP SF TH DWY + + S                  D ++Y+Y TA+HG
Sbjct  33   KTYIVHVAKSEKPDSFATHVDWYLSTINSVAATSSELDASTEADDPADRIVYSYETAFHG  92

Query  226  FAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA-DV  402
            FA  LGADE ERL  +  V+ V  ++VY LHTTR+PEFLG+  E        +  A  DV
Sbjct  93   FATKLGADEAERLESVPGVLAVLPETVYRLHTTRSPEFLGIGPEDSSNIFTTAASANHDV  152

Query  403  IVGILDTGVWPXSXSFDDSGMTAVP  477
             VG+LDTG+WP S SF D GM AVP
Sbjct  153  FVGVLDTGIWPESPSFSDKGMPAVP  177



>ref|XP_004976550.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=777

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 94/170 (55%), Gaps = 16/170 (9%)
 Frame = +1

Query  13   GSLVWFSAITILLHL---LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAA-----  168
            GS  W  A+ + L L   L+ C +  A A KTYIV M   E PSSF  H +WYA+     
Sbjct  4    GSTRW-RALPLCLALAVALQACLSACAPAPKTYIVQMAASEMPSSFDFHHEWYASTVKSV  62

Query  169  ---HLQSSEDS----LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTR  327
                L+  ED     ++Y Y TA+HGFAA L  DE ER+   + VV V  D+V  LHTTR
Sbjct  63   SSVQLEGEEDDPFARIVYNYETAFHGFAAKLDEDEAERMADADGVVAVLPDTVLQLHTTR  122

Query  328  TPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            +P+FLG+  E             DV+VG+LDTG+WP S SF D G+  VP
Sbjct  123  SPDFLGISPEISNSIWSAGLADHDVVVGVLDTGIWPESPSFSDKGLGPVP  172



>gb|EPS61652.1| hypothetical protein M569_13143, partial [Genlisea aurea]
Length=738

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 15/148 (10%)
 Frame = +1

Query  79   AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE-----------DSLLYTYTTAYHG  225
            ++ AK TY++ MK H+ P  + T  +WY+ H  S             D LLYTY++A+HG
Sbjct  1    SSAAKSTYLIQMKRHKMPEKYSTAAEWYSDHFLSHTKPSSSSSSEKFDGLLYTYSSAFHG  60

Query  226  FAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE----A  393
            +AA L  +EV+ +R  +AV GV ED VY + TTR+PEFLGLD   G   G+   E     
Sbjct  61   YAAVLAPEEVDAVRGSDAVAGVMEDRVYRVQTTRSPEFLGLDGVDGFLGGYNLTEINVST  120

Query  394  ADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            ++VIVG++DTG+WP   SF D G+  VP
Sbjct  121  SNVIVGVIDTGIWPEDPSFGDGGLPPVP  148



>gb|EYU25025.1| hypothetical protein MIMGU_mgv1a001588mg [Erythranthe guttata]
Length=789

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 87/147 (59%), Gaps = 17/147 (12%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----------------SEDSLLYTYTTA  216
            +K TYI++M    KP  F  H+ WY++ ++S                  +D ++Y+Y TA
Sbjct  34   SKNTYIIYMDKLAKPEEFSDHKQWYSSLIKSVTTKTDEYDEKTGEYENDDDRIIYSYETA  93

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
            +HG AA L  DEVE+L+    V  V+ ++VY LHTTR+P FLGLD E    A        
Sbjct  94   FHGVAARLNGDEVEKLQGQNGVTAVFPETVYQLHTTRSPMFLGLDREDSTSAFSDKLSDY  153

Query  397  DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            DV+VG+LDTG+WP S SF+D+GMT +P
Sbjct  154  DVVVGVLDTGIWPESPSFNDTGMTRIP  180



>gb|AGT16155.1| subtilisin-like protease [Saccharum hybrid cultivar R570]
Length=711

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 92/170 (54%), Gaps = 14/170 (8%)
 Frame = +1

Query  10   MGSLVWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAA-----  168
             G + W  A+ + L L  L+ C    A + KTYIV M   E PSSF  H +WYA+     
Sbjct  3    FGGIRWKKALPLCLALVALQACLPARAASPKTYIVQMAASEMPSSFDFHHEWYASTVKTV  62

Query  169  ---HLQSSEDS----LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTR  327
                L+   D     ++Y Y TA+HGFAA L  DE ER+   + VV V  ++V  LHTTR
Sbjct  63   SSVQLEGDADDPYARIVYNYETAFHGFAAKLDEDEAERMAEADGVVTVLPETVLRLHTTR  122

Query  328  TPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            +P+FLG+  E             DV+VG+LDTG+WP S SF D G+  VP
Sbjct  123  SPDFLGISPEISNSIWSAGLTDHDVVVGVLDTGIWPESPSFSDKGLGPVP  172



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 90/146 (62%), Gaps = 14/146 (10%)
 Frame = +1

Query  67   CAATAAVA----KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGF  228
            C++TA VA    K+TYIVHM   + P +F  HR WY A L+S  D+  ++Y Y TA HGF
Sbjct  20   CSSTAVVAAVAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVSDAAEIIYAYDTAAHGF  79

Query  229  AAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---AD  399
            +A L   E   L     V+GV  +  Y LHTTRTPEFLGLD   GL      P++   +D
Sbjct  80   SARLSPAEARALEHRPGVLGVVLEERYELHTTRTPEFLGLDRSEGL-----IPQSNTESD  134

Query  400  VIVGILDTGVWPXSXSFDDSGMTAVP  477
            V+VG+LDTGVWP   S+DD+G+  VP
Sbjct  135  VVVGVLDTGVWPERKSYDDAGLGPVP  160



>ref|XP_006466502.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=762

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYI+HM   E P+SF+ H  WY + L+S  DS  +LYTY    HGF+  L  +E E L
Sbjct  29   RATYIIHMAKSEMPASFEHHTHWYESSLKSVSDSAEILYTYDNVIHGFSTQLTREEAESL  88

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
             +   ++ V  +  Y LHTTR+PEFLGLD    L    GS  A++VIVG+LDTGVWP S 
Sbjct  89   EQRPGILSVLPELKYELHTTRSPEFLGLDKSANLFPTSGS--ASEVIVGVLDTGVWPESK  146

Query  445  SFDDSGMTAVP  477
            SFDD+G+  VP
Sbjct  147  SFDDTGLGPVP  157



>gb|KDO79000.1| hypothetical protein CISIN_1g004301mg [Citrus sinensis]
Length=762

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYI+HM   E P+SF+ H  WY + L+S  DS  +LYTY    HGF+  L  +E E L
Sbjct  29   RATYIIHMAKSEMPASFEHHTHWYESSLKSVSDSAEILYTYDNVIHGFSTQLTREEAESL  88

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
             +   ++ V  +  Y LHTTR+PEFLGLD    L    GS  A++VIVG+LDTGVWP S 
Sbjct  89   EQRPGILSVLPELKYELHTTRSPEFLGLDKSANLFPTSGS--ASEVIVGVLDTGVWPESK  146

Query  445  SFDDSGMTAVP  477
            SFDD+G+  VP
Sbjct  147  SFDDTGLGPVP  157



>ref|XP_004510560.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=789

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 89/132 (67%), Gaps = 3/132 (2%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSLLYTYTTAYHGFAAALGADEVER  261
            KKT+I+ ++H  KPS F TH++WY + L S   ++D++++TY T +HGF+A L A EVE+
Sbjct  35   KKTFIIQVQHQSKPSIFPTHKNWYQSSLSSITKTQDTIIHTYDTVFHGFSAKLTALEVEK  94

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXS  441
            L+ L  V+ V  + + +LHTTR+P+FLGL      G  H +   +D+++G++DTG+WP  
Sbjct  95   LQSLSHVITVIPEQIRTLHTTRSPQFLGLKTADRAGLLHETDFGSDLVIGVIDTGIWPER  154

Query  442  XSFDDSGMTAVP  477
             SF+D  +  +P
Sbjct  155  QSFNDRDLAPIP  166



>ref|XP_002448366.1| hypothetical protein SORBIDRAFT_06g025980 [Sorghum bicolor]
 gb|EES12694.1| hypothetical protein SORBIDRAFT_06g025980 [Sorghum bicolor]
Length=777

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 90/165 (55%), Gaps = 14/165 (8%)
 Frame = +1

Query  25   WFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAA--------HL  174
            W  A+ + L L  L+ C    A A KTYIV M   E PSSF  H +WYA+         L
Sbjct  8    WRKALPMCLALVALQACLPARAAAPKTYIVQMAASEMPSSFDFHHEWYASTVKTVSSVQL  67

Query  175  QSSEDS----LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFL  342
            +   D     ++Y Y TA+HGFAA L  DE ER+   + VV V  ++V  LHTTR+P+FL
Sbjct  68   EGGADDPYARIVYNYETAFHGFAAKLDEDEAERMAEADGVVTVLPETVLRLHTTRSPDFL  127

Query  343  GLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            G+  E             DV+VG+LDTG+WP S SF D G+  VP
Sbjct  128  GISPEISNSIWSAGLADHDVVVGVLDTGIWPESPSFSDKGLGPVP  172



>ref|XP_008354210.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=783

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 90/163 (55%), Gaps = 16/163 (10%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  180
            +TI +      +A   + KKTYIV M    KP SF  H DWY++ +QS            
Sbjct  15   LTIFMFFNIALSAKTPLTKKTYIVQMDKSAKPESFSNHIDWYSSKVQSVLINPENQEDGG  74

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
              +  ++YTY  A+HG AA L   E ERL   + V+ ++ ++ Y LHTTR+P FLGL+  
Sbjct  75   EDQQRVIYTYQNAFHGVAARLSEQEAERLEEQDGVLAIFPETKYELHTTRSPLFLGLEPH  134

Query  358  FGLGAGHGSPEAA---DVIVGILDTGVWPXSXSFDDSGMTAVP  477
                  +   +     DVIVG+LDTGVWP S SF+D+GMT VP
Sbjct  135  VRASTTNVWSQRVTDHDVIVGVLDTGVWPESQSFNDTGMTPVP  177



>ref|XP_010105478.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04834.1| Subtilisin-like protease [Morus notabilis]
Length=768

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 87/134 (65%), Gaps = 10/134 (7%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K+TYI+HM    KP++F  H +WY + L+S  DS  +LYTY    HGF+ +L   E + L
Sbjct  33   KRTYIIHMDKSNKPATFDNHFNWYDSSLKSVSDSADMLYTYNNVIHGFSTSLTEKEAQFL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGL---DAEFGLGAGHGSPEAADVIVGILDTGVWP  435
            ++   V+ V +++ Y LHTTRTPEFLGL   DA F       S + ++VIVG+LDTGVWP
Sbjct  93   KQQPGVLSVLQENRYELHTTRTPEFLGLGRSDALF-----PASDKLSEVIVGVLDTGVWP  147

Query  436  XSXSFDDSGMTAVP  477
             S S+DD+G+  VP
Sbjct  148  ESKSYDDAGLRRVP  161



>ref|XP_009348638.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=846

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 90/163 (55%), Gaps = 16/163 (10%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  180
            +TI +      +A   + KKTYIV M    KP SF  H DWY++ +QS            
Sbjct  78   LTIFMFFNIALSAKTPLTKKTYIVQMDKSAKPESFSNHIDWYSSKVQSVLIKPENQEDGG  137

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
              +  ++YTY  A+HG AA L   E ERL   + V+ ++ ++ Y LHTTR+P FLGL+  
Sbjct  138  EDQQRVIYTYQNAFHGVAARLSEQEAERLEEQDGVLAIFPETKYELHTTRSPLFLGLEPH  197

Query  358  FGLGAGHGSPEAA---DVIVGILDTGVWPXSXSFDDSGMTAVP  477
                  +   +     DVIVG+LDTGVWP S SF+D+GMT VP
Sbjct  198  VRASTTNVWSQRVTDHDVIVGVLDTGVWPESQSFNDTGMTPVP  240



>ref|XP_011076276.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=781

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 88/144 (61%), Gaps = 14/144 (10%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------------SEDSLLYTYTTAYHG  225
            A KTYIV+M    KP  F  HR WY++ ++S              ++D ++Y Y TA+HG
Sbjct  32   ATKTYIVYMDKWAKPQEFSDHRQWYSSMIKSVASSRTEKRDDADENDDRIIYNYQTAFHG  91

Query  226  FAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVI  405
             AA L  +EVE+L   + V+ V+ ++VY LHTTR+P FLGL+ E    A        DV+
Sbjct  92   VAAQLSEEEVEKLLEQDGVMAVFPETVYHLHTTRSPLFLGLEREDSTSAFTDKLSDYDVV  151

Query  406  VGILDTGVWPXSXSFDDSGMTAVP  477
            VG+LDTG+WP S SF+D+GM+ +P
Sbjct  152  VGVLDTGIWPESPSFNDTGMSRIP  175



>ref|XP_006426043.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
 gb|ESR39283.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
Length=763

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYI+HM   E P+SF+ H  WY + L+S  DS  +LYTY    HGF+  L  +E E L
Sbjct  30   RATYIIHMAKSEMPASFEHHTHWYESSLKSVSDSAEILYTYDNVIHGFSTQLTREEAESL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
             +   ++ V  +  Y LHTTR+PEFLGLD    L    GS  A++VIVG+LDTGVWP S 
Sbjct  90   EQRPGILSVLPELKYELHTTRSPEFLGLDKSANLFPTSGS--ASEVIVGVLDTGVWPESK  147

Query  445  SFDDSGMTAVP  477
            SFDD+G+  VP
Sbjct  148  SFDDTGLGPVP  158



>ref|XP_009343496.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=783

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 90/163 (55%), Gaps = 16/163 (10%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  180
            +TI +      +A   + KKTYIV M    KP SF  H DWY++ +Q+            
Sbjct  15   LTIFMFFNIALSAKTPLTKKTYIVQMDKSAKPESFSNHIDWYSSKVQAVLIKPDNQEDGG  74

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
              +  +LYTY  A+HG AA L   E ERL   + V+ ++ ++ Y LHTTR+P FLGL+  
Sbjct  75   EDQQRVLYTYQNAFHGVAARLSEQEAERLEEQDGVLAIFPETKYELHTTRSPLFLGLEQH  134

Query  358  FGLGAGHGSPEAA---DVIVGILDTGVWPXSXSFDDSGMTAVP  477
                  +   +     DVIVG+LDTGVWP S SF+D+GMT VP
Sbjct  135  VRASTTNVWSQRVTDHDVIVGVLDTGVWPESQSFNDTGMTPVP  177



>ref|XP_010271938.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=752

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 84/139 (60%), Gaps = 4/139 (3%)
 Frame = +1

Query  67   CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAAL  240
            C  + A  KKTYIVHM   + P SF+ H  WY + L+S  DS  +LYTY    HGF+  L
Sbjct  16   CHLSMAAEKKTYIVHMAKFQMPESFEEHTHWYDSSLKSVSDSAEMLYTYNNVIHGFSTRL  75

Query  241  GADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILD  420
              +E + L     ++ V  +  Y LHTTRTPEFLGLD   GL     S  A++V+VG+LD
Sbjct  76   TDEEAKLLEGRPGILLVLPEVRYELHTTRTPEFLGLDKNDGLFP--QSDSASEVVVGVLD  133

Query  421  TGVWPXSXSFDDSGMTAVP  477
            TGVWP S SFDD G+  +P
Sbjct  134  TGVWPESLSFDDKGLGPIP  152



>gb|EMT07781.1| Subtilisin-like protease [Aegilops tauschii]
Length=602

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 91/161 (57%), Gaps = 13/161 (8%)
 Frame = +1

Query  34   AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-------  192
            ++ ++L LL+   +  A A KTYIVHM   EKPSSF  H +WYA+ ++S   +       
Sbjct  12   SLCLVLVLLQASISACAGAPKTYIVHMAASEKPSSFDFHHEWYASTVKSVSSAQIEAEEE  71

Query  193  ------LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
                  ++Y Y TA HGFAA L  DE ER+     V+ V  ++V  LHTTR+P+FLG+  
Sbjct  72   EDAYARIVYNYETAIHGFAARLDEDEAERMAEAAGVLAVLPETVLQLHTTRSPDFLGIGP  131

Query  355  EFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            E             DV+VG+LDTG+WP S SF D G+  VP
Sbjct  132  EVSNRIWASGLADHDVVVGVLDTGIWPESPSFSDKGLGPVP  172



>ref|XP_009770992.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
 gb|ABQ58080.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 83/136 (61%), Gaps = 14/136 (10%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYIVH+   + P SF+ H+ WY + L+S  DS  +LY Y    HGF+A L   E E L
Sbjct  32   KSTYIVHVAKSQMPESFENHKHWYDSSLKSVSDSAEMLYVYNNVVHGFSARLTVQEAESL  91

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLD--AEFGLGAGHGSPEA---ADVIVGILDTGV  429
             R   ++ V  +  Y LHTTRTP FLGLD  A+F        PE+   +DVIVG+LDTGV
Sbjct  92   ERQSGILSVLPEMKYELHTTRTPSFLGLDRSADF-------FPESNAMSDVIVGVLDTGV  144

Query  430  WPXSXSFDDSGMTAVP  477
            WP S SFDD+G+  VP
Sbjct  145  WPESKSFDDTGLGPVP  160



>emb|CBI33725.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 91/155 (59%), Gaps = 10/155 (6%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVA------KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--  192
            +T+ L LL  C    A        ++TYIVHM   + P SFQ    WY + L+S  +S  
Sbjct  8    LTVALTLLGFCHVFVAAVERNDEERRTYIVHMATSQMPESFQERAHWYDSSLKSVSESAE  67

Query  193  LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGA  372
            +LY Y+   HGF+  L A+E   L+    ++ + E+  Y LHTTRTPEFLGLD    L  
Sbjct  68   MLYKYSNVIHGFSTRLTAEEARSLQGRPGILSILEEVRYELHTTRTPEFLGLDKSADLFP  127

Query  373  GHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
              GS  A++VI+G+LDTG+WP S SFDD+G+  +P
Sbjct  128  ESGS--ASEVIIGVLDTGIWPESKSFDDTGLGPIP  160



>gb|KJB34441.1| hypothetical protein B456_006G065800 [Gossypium raimondii]
Length=505

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 86/143 (60%), Gaps = 12/143 (8%)
 Frame = +1

Query  85   VAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------SEDSLLYTYTTAYHGF  228
            + KKTYIV M     P+SF +  +WY++ L+S             E+ ++Y+Y  A+HG 
Sbjct  29   LIKKTYIVQMHKSAMPASFSSPLEWYSSKLKSVMSDTQSEGEGDGENRIIYSYQNAFHGV  88

Query  229  AAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIV  408
            AA L  +E ERL++ + VV +  ++ Y LHTTR+P FLGL+ E             DVIV
Sbjct  89   AAQLTEEEAERLKQEDGVVAILPETKYELHTTRSPMFLGLEPEESTSIWSQKLADHDVIV  148

Query  409  GILDTGVWPXSXSFDDSGMTAVP  477
            G+LDTG+WP S SF+D+GMT VP
Sbjct  149  GVLDTGIWPESASFNDTGMTPVP  171



>ref|XP_010105482.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04838.1| Subtilisin-like protease [Morus notabilis]
Length=765

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 84/132 (64%), Gaps = 3/132 (2%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYI+HM +  KP+ F+ H +WY + L+S  DS  +LYTY    HGF+ +L   E E L
Sbjct  33   KTTYIIHMDNSNKPAVFEDHVNWYDSSLRSVSDSGEMLYTYNNVIHGFSTSLNYKEAELL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSP-EAADVIVGILDTGVWPXS  441
            +    VV V  +++Y LHTTRTP+FLGL  E    +   SP +  +V+VG+LDTGVWP  
Sbjct  93   KIQPGVVSVIPETIYELHTTRTPDFLGLMEENASNSILPSPGKVGNVVVGMLDTGVWPEI  152

Query  442  XSFDDSGMTAVP  477
             S+DD+G+  VP
Sbjct  153  RSYDDTGLGPVP  164



>ref|NP_001152427.1| LOC100286067 precursor [Zea mays]
 gb|ACG47554.1| subtilisin-like protease precursor [Zea mays]
Length=777

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 94/170 (55%), Gaps = 16/170 (9%)
 Frame = +1

Query  13   GSLVWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  180
            G + W  A+ + L L  L+ C      A KTYIV M   E PSSF  H +WYA+ ++S  
Sbjct  4    GGVRW-KALPLCLALVALQACLPARGAAPKTYIVQMAASEMPSSFDFHHEWYASTVKSVS  62

Query  181  -------SED----SLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTR  327
                   ++D     ++Y Y TA+HGFAA L  DE ER+   + VV V  ++V  LHTTR
Sbjct  63   SVQLEGDADDHYAARIVYNYETAFHGFAAKLDEDEAERMAEADGVVAVLPETVLQLHTTR  122

Query  328  TPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            +P+FLG+  E             DV+VG+LDTG+WP S SF D G+  VP
Sbjct  123  SPDFLGISPEISDSIWSAGLADHDVVVGVLDTGIWPESPSFSDKGLGPVP  172



>gb|ACN28204.1| unknown [Zea mays]
 gb|ACN28823.1| unknown [Zea mays]
 gb|AFW59138.1| putative subtilase family protein [Zea mays]
Length=777

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 94/170 (55%), Gaps = 16/170 (9%)
 Frame = +1

Query  13   GSLVWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  180
            G + W  A+ + L L  L+ C      A KTYIV M   E PSSF  H +WYA+ ++S  
Sbjct  4    GGVRW-KALPLCLALVALQACLPARGAAPKTYIVQMAASEMPSSFDFHHEWYASTVKSVS  62

Query  181  -------SED----SLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTR  327
                   ++D     ++Y Y TA+HGFAA L  DE ER+   + VV V  ++V  LHTTR
Sbjct  63   SVQLEGDADDHYAARIVYNYETAFHGFAAKLDEDEAERMAEADGVVAVLPETVLQLHTTR  122

Query  328  TPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            +P+FLG+  E             DV+VG+LDTG+WP S SF D G+  VP
Sbjct  123  SPDFLGISPEISDSIWSAGLADHDVVVGVLDTGIWPESPSFSDKGLGPVP  172



>ref|XP_002510884.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF51486.1| Cucumisin precursor, putative [Ricinus communis]
Length=775

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 97/168 (58%), Gaps = 15/168 (9%)
 Frame = +1

Query  13   GSLVW-FSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            G L W F  +T  L  +     +  + ++TYI+ M  + KP SF  H +WY++ +QS   
Sbjct  4    GPLRWLFFIVTSYLAFI--VVLSYPLNRQTYIIQMDKYAKPESFSNHLEWYSSKVQSVLS  61

Query  181  ---------SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTP  333
                     +++ ++Y+Y T +HG AA L  +E +RL   + VV ++ ++ Y +HTTR+P
Sbjct  62   KSEHEADTDNDERIIYSYQTVFHGVAAKLSEEEAKRLEEADGVVAIFPETKYQIHTTRSP  121

Query  334  EFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             FLGL+ +        +    DVIVG+LDTG+WP S SF+D+GMT VP
Sbjct  122  MFLGLEPQDSTSVWSQTIADHDVIVGVLDTGIWPESASFNDTGMTTVP  169



>ref|XP_010547540.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=764

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 92/163 (56%), Gaps = 9/163 (6%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLR---PCAATAAVAKK--TYIVHMKHHEKPSSFQTHRDWYAAHL  174
            M SL   +   ++LHL     P AAT    ++  TYIVHM   + P+SF  H  WY + L
Sbjct  1    MTSLTSLAVFLLVLHLGLYHVPSAATGDGRQRRATYIVHMARSQMPASFDHHSHWYDSSL  60

Query  175  QSSEDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGL  348
            +S  DS  LLYTY  A HGF+  L  +E E L     V+ V  +  Y LHTTRTP FLGL
Sbjct  61   RSVSDSAELLYTYDNAIHGFSTRLTPEEAESLTGQPGVISVLPELRYELHTTRTPLFLGL  120

Query  349  DAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            D    L     S  A DV+VG+LDTGVWP S SFDDSG   VP
Sbjct  121  DHNADLFP--QSDSATDVVVGVLDTGVWPESKSFDDSGFGPVP  161



>ref|XP_010109072.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC20872.1| Subtilisin-like protease [Morus notabilis]
Length=770

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 96/165 (58%), Gaps = 22/165 (13%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------S  183
            W   I++   LL    A    AKKTYI+ M     P SF  H +WY++ ++S        
Sbjct  8    WLVLISLTSCLL--FNAVELSAKKTYIIQMDKSAMPESFSDHLEWYSSKVKSVLMKQSDD  65

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE--  357
            E+ ++Y+Y TA+HG AA L  +E E+L + + V+GV+ ++ Y LHTTR+P FLGLD    
Sbjct  66   EERIIYSYQTAFHGVAAQLSEEEAEKLEQDDDVLGVFPETKYELHTTRSPMFLGLDPRQD  125

Query  358  -----FGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                   + + H      DV+VG+LDTG+WP S SF+D+GMT VP
Sbjct  126  RDNVWSQMLSDH------DVVVGVLDTGIWPESESFNDTGMTPVP  164



>gb|ABR16566.1| unknown [Picea sitchensis]
Length=522

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 8/136 (6%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ------SSEDSLLYTYTTAYHGFAAALGAD  249
            A+++YI++M     P  F  H+ WY++ ++      S   +LLYTY T  HGFAA L + 
Sbjct  33   ARQSYIIYMDKSMMPDHFSLHQHWYSSMIKEVSGSNSDPTALLYTYDTVTHGFAACLTST  92

Query  250  EVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGV  429
            E + +  ++  + V++DS Y LHTTRTP+FLGL +  GL     S    D+IVG+LDTG+
Sbjct  93   EAQAMENMDGCLSVFQDSTYGLHTTRTPDFLGLSSSHGLWP--LSRYGDDIIVGVLDTGI  150

Query  430  WPXSXSFDDSGMTAVP  477
            WP S SF+D G+T VP
Sbjct  151  WPESKSFNDQGLTPVP  166



>ref|XP_004141887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN48584.1| hypothetical protein Csa_6G493920 [Cucumis sativus]
Length=761

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 90/158 (57%), Gaps = 8/158 (5%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            M + VW      LL       + A   KKTYIVHM  ++ P SF+ H  WY + L+S  D
Sbjct  1    MANPVWM----FLLLCFFSVPSMAVGDKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVSD  56

Query  190  S--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
            S  ++Y Y    HGF+  L A+E +RL     ++ V  + +Y LHTTR+PEFLGLD    
Sbjct  57   SAEMIYAYNNVVHGFSTRLTAEEAQRLEAQPGILAVVPEMIYELHTTRSPEFLGLDKNAN  116

Query  364  LGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            L     S   ++VI+G+LDTG+ P S SFDD+G+  VP
Sbjct  117  LYPESNS--VSEVIIGVLDTGISPESKSFDDTGLGPVP  152



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 87/138 (63%), Gaps = 12/138 (9%)
 Frame = +1

Query  94   KTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-------LLYTYTTAYHGFAAALGADE  252
            + YIV M     P  F TH  WYA+ LQ++ D+       LLYTY +A+HG+AA L   E
Sbjct  39   RVYIVRMSKAHMPPVFTTHDHWYASELQTTIDADANADSRLLYTYDSAFHGYAALLSPYE  98

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGL---DAEFGLGAGHGSPEAADVIVGILDT  423
             E+LR  ++V+ VYE+ VY LHTTR+P FLGL   DA   + +   + E  DV++G+LDT
Sbjct  99   AEKLRSYDSVLAVYEEYVYELHTTRSPAFLGLGGYDAPVDMASLDQASE--DVVIGVLDT  156

Query  424  GVWPXSXSFDDSGMTAVP  477
            GVWP S SF D+GM  VP
Sbjct  157  GVWPESPSFSDAGMAVVP  174



>ref|XP_008440346.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 90/158 (57%), Gaps = 7/158 (4%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            M + VW     +LL L    +      KKTYIVHM  ++ P SF+ H  WY + L+S  D
Sbjct  1    MANPVW---TFLLLCLFSVPSMAVGDKKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVSD  57

Query  190  S--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
            S  ++Y Y    HGF+  L  +E +RL     ++ V  +  Y LHTTR+P+FLGLD    
Sbjct  58   SAEMIYAYNNVVHGFSTRLTTEEAQRLEAQPGILAVVPEMRYELHTTRSPQFLGLDKNAN  117

Query  364  LGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            L     S   ++VI+G+LDTGVWP S SFDD+G+  VP
Sbjct  118  LYPESNS--VSEVIIGVLDTGVWPESKSFDDTGLGPVP  153



>gb|KJB34438.1| hypothetical protein B456_006G065800 [Gossypium raimondii]
Length=598

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 86/143 (60%), Gaps = 12/143 (8%)
 Frame = +1

Query  85   VAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------SEDSLLYTYTTAYHGF  228
            + KKTYIV M     P+SF +  +WY++ L+S             E+ ++Y+Y  A+HG 
Sbjct  29   LIKKTYIVQMHKSAMPASFSSPLEWYSSKLKSVMSDTQSEGEGDGENRIIYSYQNAFHGV  88

Query  229  AAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIV  408
            AA L  +E ERL++ + VV +  ++ Y LHTTR+P FLGL+ E             DVIV
Sbjct  89   AAQLTEEEAERLKQEDGVVAILPETKYELHTTRSPMFLGLEPEESTSIWSQKLADHDVIV  148

Query  409  GILDTGVWPXSXSFDDSGMTAVP  477
            G+LDTG+WP S SF+D+GMT VP
Sbjct  149  GVLDTGIWPESASFNDTGMTPVP  171



>ref|XP_008367646.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 85/133 (64%), Gaps = 5/133 (4%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVE  258
            AKKTYI+HM   E P+SF+  R  WY + L+S  DS  +LY Y T +HGFA  L A+E  
Sbjct  33   AKKTYIIHMDKSEMPASFEDDRFQWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAG  92

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPX  438
             L +   ++ V  +  Y LHTTRTPEFLGL     L     + +A+D+IVG++DTGVWP 
Sbjct  93   LLEKQSGILSVLPERXYELHTTRTPEFLGLGKSEALLP--ATDKASDLIVGVVDTGVWPE  150

Query  439  SXSFDDSGMTAVP  477
              S+DD+G+ AVP
Sbjct  151  IKSYDDTGLAAVP  163



>ref|XP_007143339.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
 gb|ESW15333.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
Length=778

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 94/158 (59%), Gaps = 11/158 (7%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----------S  183
            +TI L L    +A A  AKKTYI+ M  + KP +F +H +WY + ++S            
Sbjct  14   VTIFLLLCILSSANAEFAKKTYIIQMDKYAKPDTFSSHIEWYTSKVKSILSISVEAEMEK  73

Query  184  EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
            E+ ++YTY TA+HG AA L  +E ERL   E VV ++ D+ Y LHTTR+P FLGL+    
Sbjct  74   EERIIYTYQTAFHGMAAKLSREEAERLEAEEGVVAIFPDTKYQLHTTRSPTFLGLEPAQS  133

Query  364  LGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                  +    DV VG+LDTG+WP S SF+D+GM +VP
Sbjct  134  TKVWSETLANYDVTVGVLDTGIWPESESFNDTGMRSVP  171



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 93/159 (58%), Gaps = 16/159 (10%)
 Frame = +1

Query  28   FSAITILLHLLRPC-AATAAVAKKTYIVHMKHHEKPSSFQT-HRDWYAAHLQSSEDS--L  195
            +  I +++ LL  C  + A V KKTYI+HM   + P++F   H  WY + L+S  DS  +
Sbjct  13   YPVILVVVALLFRCHMSVAMVKKKTYIIHMAKSQMPATFNDDHTHWYDSSLRSVSDSAEM  72

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD--AEFGLG  369
            LY Y    HGF+A L   E E L     ++ V  +  Y LHTTRTP FLGLD  A+F   
Sbjct  73   LYVYNNVIHGFSARLTPQEAESLETQPGILSVLPELKYQLHTTRTPTFLGLDKSADF---  129

Query  370  AGHGSPEA---ADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                 PE+   +DVI+G+LDTGVWP S SFDDSG+  +P
Sbjct  130  ----FPESDAMSDVIIGVLDTGVWPESKSFDDSGLGPIP  164



>ref|XP_002284101.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 91/155 (59%), Gaps = 10/155 (6%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVA------KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--  192
            +T+ L LL  C    A        ++TYIVHM   + P SFQ    WY + L+S  +S  
Sbjct  8    LTVALTLLGFCHVFVAAVERNDEERRTYIVHMATSQMPESFQERAHWYDSSLKSVSESAE  67

Query  193  LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGA  372
            +LY Y+   HGF+  L A+E   L+    ++ + E+  Y LHTTRTPEFLGLD    L  
Sbjct  68   MLYKYSNVIHGFSTRLTAEEARSLQGRPGILSILEEVRYELHTTRTPEFLGLDKSADLFP  127

Query  373  GHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
              GS  A++VI+G+LDTG+WP S SFDD+G+  +P
Sbjct  128  ESGS--ASEVIIGVLDTGIWPESKSFDDTGLGPIP  160



>ref|XP_003550022.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=760

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 88/152 (58%), Gaps = 4/152 (3%)
 Frame = +1

Query  28   FSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLY  201
            F ++ + L L    A      K TYIVH+   E P SF+ H  WY + L++  DS  ++Y
Sbjct  11   FLSVVLFLGLYEAAAEQTQTHKSTYIVHVAKSEMPESFEHHAVWYESSLKTVSDSAEMIY  70

Query  202  TYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHG  381
            TY  A HG+A  L A+E   L+R   ++ V  ++ Y L TTRTP FLGLD    L     
Sbjct  71   TYDNAIHGYATRLTAEEARLLQRQTGILAVLPETRYELFTTRTPLFLGLDKSADLFPESS  130

Query  382  SPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            S   +DVIVG+LDTGVWP S SFDD+G+  VP
Sbjct  131  S--GSDVIVGVLDTGVWPESKSFDDTGLGPVP  160



>gb|EYU21279.1| hypothetical protein MIMGU_mgv1a023973mg, partial [Erythranthe 
guttata]
Length=520

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 91/160 (57%), Gaps = 3/160 (2%)
 Frame = +1

Query  7    AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  180
            A+  +   S I      L P +  AA  +KT+IV +KH  KPS F  H +WY + L+S  
Sbjct  2    AISPITTISTIFFCTLFLTPSSIEAAEQRKTFIVRVKHEAKPSVFPNHSNWYESSLRSIS  61

Query  181  -SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
             +   ++++Y T +HGF+A+L A E  +L  L  ++ V  + V  LHTTR+PEFLGL   
Sbjct  62   AASVGVIHSYDTVFHGFSASLSASEAVKLESLPGIIAVIPEQVRQLHTTRSPEFLGLKTG  121

Query  358  FGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
               G    S   +D+++G++DTG+WP S SF+D  +   P
Sbjct  122  DSAGLLKESDFGSDLVIGVIDTGIWPESESFNDRDLGPAP  161



>ref|XP_010939822.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=769

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 84/140 (60%), Gaps = 10/140 (7%)
 Frame = +1

Query  73   ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  246
            A A   + TYIVHM     P++F  H +WY A L+S  DS  +LY Y T  HGF+A L  
Sbjct  27   AAAKEKRVTYIVHMAKSRMPATFTEHGNWYDASLRSVSDSAKILYLYDTVAHGFSARLTP  86

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE---AADVIVGIL  417
             E + L  L+ V+ V  +  Y LHTTRTPEFLGLD   GL      P+   A+DV+VG+L
Sbjct  87   AEAQALESLDGVLCVLAEVRYELHTTRTPEFLGLDKSDGL-----VPQANTASDVVVGVL  141

Query  418  DTGVWPXSXSFDDSGMTAVP  477
            DTGVWP   SFDD+G   VP
Sbjct  142  DTGVWPERKSFDDTGFGPVP  161



>ref|XP_007152373.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
 gb|ESW24367.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
Length=781

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 97/174 (56%), Gaps = 26/174 (15%)
 Frame = +1

Query  10   MGSLVWF-SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  180
            MG++  F S+  ++L +L   +A A  AKKTY++ M     P +F  H +WY++ ++S  
Sbjct  6    MGNMGCFLSSYLLVLTML--FSANAQFAKKTYLIQMDKSAMPKAFPNHLEWYSSKVKSAL  63

Query  181  ---------SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTP  333
                     SE  ++YTY  A+HG AA L   E ++L   E VV ++ D+ Y LHTTR+P
Sbjct  64   STLPEADADSEKRIIYTYQNAFHGVAAKLTEGEAKKLETEEGVVAIFPDTKYELHTTRSP  123

Query  334  EFLGLDAEFGLG------AGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             FLGL+ E          AGH      DVIVG+LDTG+WP S SF D  M  VP
Sbjct  124  TFLGLEPEKAPNMWSEKLAGH------DVIVGVLDTGIWPESESFKDVSMGPVP  171



>ref|XP_010105479.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04835.1| Subtilisin-like protease [Morus notabilis]
Length=776

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 81/131 (62%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K+TYI+HM    KP+ F  H +WY + L+S  DS  +LYTY    HGF+  +  +E   L
Sbjct  35   KRTYIIHMDKSNKPAVFDDHVNWYDSSLKSVSDSAEMLYTYDNVIHGFSTRITEEEAHLL  94

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
                 VV V  ++ Y LHTTRTP+FLGL   + L A   S +A+DVI+G+LDTGVWP   
Sbjct  95   NNQPGVVSVIPETRYELHTTRTPDFLGLKESYSLIA--ASDKASDVIIGVLDTGVWPEIE  152

Query  445  SFDDSGMTAVP  477
            S+DD G+  VP
Sbjct  153  SYDDKGLGPVP  163



>ref|XP_009404128.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 80/139 (58%), Gaps = 4/139 (3%)
 Frame = +1

Query  67   CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAAL  240
            C++  A  K TYIVHM     P SF  HR WY A L+S   S  +LY Y T  HGF+A L
Sbjct  18   CSSAVAAKKPTYIVHMAKSRMPPSFAEHRHWYDASLRSVSGSAEVLYFYDTVAHGFSARL  77

Query  241  GADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILD  420
               E   L R   V+ V  ++ Y LHTTRTPEFLGLD   G G    S    DV+VG+LD
Sbjct  78   TPAEARALARRYGVLSVEPETRYELHTTRTPEFLGLDR--GGGFVTSSDSDGDVVVGVLD  135

Query  421  TGVWPXSXSFDDSGMTAVP  477
            TGVWP   SFDD+G   VP
Sbjct  136  TGVWPERKSFDDAGFGPVP  154



>gb|KJB34440.1| hypothetical protein B456_006G065800 [Gossypium raimondii]
Length=778

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 85/141 (60%), Gaps = 12/141 (9%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------SEDSLLYTYTTAYHGFAA  234
            KKTYIV M     P+SF +  +WY++ L+S             E+ ++Y+Y  A+HG AA
Sbjct  31   KKTYIVQMHKSAMPASFSSPLEWYSSKLKSVMSDTQSEGEGDGENRIIYSYQNAFHGVAA  90

Query  235  ALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGI  414
             L  +E ERL++ + VV +  ++ Y LHTTR+P FLGL+ E             DVIVG+
Sbjct  91   QLTEEEAERLKQEDGVVAILPETKYELHTTRSPMFLGLEPEESTSIWSQKLADHDVIVGV  150

Query  415  LDTGVWPXSXSFDDSGMTAVP  477
            LDTG+WP S SF+D+GMT VP
Sbjct  151  LDTGIWPESASFNDTGMTPVP  171



>gb|KDP22364.1| hypothetical protein JCGZ_26195 [Jatropha curcas]
Length=778

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 89/144 (62%), Gaps = 13/144 (9%)
 Frame = +1

Query  85   VAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------------SEDSLLYTYTTAYHG  225
            + +KTYI+ M  H KP  F  H DWY++ +QS             +E+ ++Y+Y TA+HG
Sbjct  29   LTRKTYIIQMDKHAKPEYFSNHFDWYSSKVQSVLSTPENETNESDNEERIIYSYQTAFHG  88

Query  226  FAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVI  405
             AA L  +E ERL   + V+ ++ +++Y LHTTR+P FLGL+ E        +    DVI
Sbjct  89   VAAKLSEEEAERLEEEDGVLAIFPETIYQLHTTRSPMFLGLEPEDSTSVWSETIADHDVI  148

Query  406  VGILDTGVWPXSXSFDDSGMTAVP  477
            VG+LDTG+WP S SF+D+GMT VP
Sbjct  149  VGVLDTGIWPESASFNDTGMTPVP  172



>ref|XP_010679580.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 93/159 (58%), Gaps = 5/159 (3%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPC-AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE  186
            M  L+ +  + I +  L  C  ++++  K TYIVHM   + P++F  H  WY + L+   
Sbjct  1    MRLLISYPLMIIWVVFLYLCHVSSSSPEKNTYIVHMAKSQMPATFDHHTKWYESSLRHVS  60

Query  187  DS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            D+  ++YTY+ A HG+A  L   E E L  L  ++ V  ++ Y LHTTRTP FLGLD   
Sbjct  61   DTAEMIYTYSNAAHGYATRLTESEAESLSSLPGILAVLPETRYELHTTRTPSFLGLDRT-  119

Query  361  GLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
               +   S  A+DVI+G+LDTGVWP S SFDD GM  VP
Sbjct  120  -RDSFTESESASDVIIGVLDTGVWPESKSFDDKGMGPVP  157



>ref|XP_009613609.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 gb|ABQ58079.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 83/136 (61%), Gaps = 14/136 (10%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYIVH+   + P SF+ H+ WY + L+S  DS  +LY Y    HGF+A L   E E L
Sbjct  32   KSTYIVHVAKSQMPESFEDHKHWYDSSLKSVSDSAEMLYVYNNVVHGFSARLTIQEAESL  91

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLD--AEFGLGAGHGSPEA---ADVIVGILDTGV  429
             R   ++ V  +  Y LHTTRTP FLGLD  A+F        PE+   +DV+VG+LDTGV
Sbjct  92   ERQSGILSVLPELRYELHTTRTPSFLGLDRSADF-------FPESNAMSDVVVGVLDTGV  144

Query  430  WPXSXSFDDSGMTAVP  477
            WP S SFDD+G+  +P
Sbjct  145  WPESKSFDDTGLGPIP  160



>ref|XP_010527146.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=727

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 92/158 (58%), Gaps = 6/158 (4%)
 Frame = +1

Query  16   SLVWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            SL   +  +++LHL      +A A   + TYIVHM   + P+SF  H  WY + L+S  D
Sbjct  6    SLTVLTVFSLVLHLGFCHVSSAPAGHGRATYIVHMARSQMPASFDRHSHWYDSSLRSVSD  65

Query  190  S--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
            S  LLYTY  A HGF+  L  +E + L     V+ V  +  Y LHTTRTP FLGLD +  
Sbjct  66   SAELLYTYDNAIHGFSTRLTPEEADSLAGQPGVISVLPELRYELHTTRTPLFLGLDHDAD  125

Query  364  LGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            +     S  A+DV+VG+LDTG+WP S SFDD+G   VP
Sbjct  126  MFPQADS--ASDVVVGVLDTGIWPESKSFDDTGFGPVP  161



>ref|XP_010923357.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=780

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 90/155 (58%), Gaps = 18/155 (12%)
 Frame = +1

Query  61   RPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED----------------S  192
            +P   T+  A  TYI+H  +  +P    T   WY++ LQS                   +
Sbjct  34   QPDITTSGTAATTYIIHTDNFSRPPHLATQIQWYSSILQSLSSTNTTTTTTTSVKTHSHN  93

Query  193  LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGA  372
            ++YTY T  HGFAA L ++E E++  +  VVGVY+D++  LHTTR+P+FLGL+ +FGL  
Sbjct  94   IIYTYDTILHGFAAILSSEEAEKVSEIPGVVGVYKDTIKQLHTTRSPDFLGLNHDFGLWP  153

Query  373  GHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                 E  DVI+G++D+G+WP S SFDD G+  VP
Sbjct  154  ESNFGE--DVIIGLVDSGIWPESESFDDDGLPEVP  186



>ref|XP_008351977.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            KKTYI+HM   E P+SF+  R  WY + L+S  DS  +LY Y T +HGFA  L A+E   
Sbjct  34   KKTYIIHMDKSEMPASFEDDRFQWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAGL  93

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXS  441
            L +   ++ V  +  Y LHTTRTPEFLGL     L     + +A+D+IVG++DTGVWP  
Sbjct  94   LEKQSGILSVLPERXYELHTTRTPEFLGLGKSEALLP--ATDKASDLIVGVVDTGVWPEI  151

Query  442  XSFDDSGMTAVP  477
             S+DD+G+ AVP
Sbjct  152  KSYDDTGLAAVP  163



>ref|XP_008393753.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            KKTYI+HM   E P+SF+  R  WY + L+S  DS  +LY Y T +HGFA  L A+E   
Sbjct  34   KKTYIIHMDKSEMPASFEDDRFQWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAGL  93

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXS  441
            L +   ++ V  +  Y LHTTRTPEFLGL     L     + +A+D+IVG++DTGVWP  
Sbjct  94   LEKQSGILSVLPERXYELHTTRTPEFLGLGKSEALLP--ATDKASDLIVGVVDTGVWPEI  151

Query  442  XSFDDSGMTAVP  477
             S+DD+G+ AVP
Sbjct  152  KSYDDTGLAAVP  163



>ref|XP_004496644.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=786

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 84/152 (55%), Gaps = 16/152 (11%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS--------------EDSLLYTY  207
            ++ A  AKKTYI+ M +  KP  F  H++WY + ++S               ED ++Y Y
Sbjct  29   SSNAEFAKKTYIIQMDNSAKPDIFSNHQEWYTSKVKSVVYKSLEADEIDNNIEDRIIYNY  88

Query  208  TTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSP  387
             TA+ G AA L  +E ++L   + VV ++ D+ Y LHTTR+P FLGL+            
Sbjct  89   NTAFQGMAAKLSQEEAKKLENEDGVVAIFPDTKYQLHTTRSPSFLGLEPIIQTKNNFSKK  148

Query  388  --EAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
              +  DVIVG+LDTGVWP S SF D GM  VP
Sbjct  149  LVDDHDVIVGVLDTGVWPESESFSDIGMKPVP  180



>ref|XP_009360421.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 86/132 (65%), Gaps = 5/132 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            KKTYI+HM   E P+SF+  R +WY + L+S  DS  +LY Y T +HGFA  L A+E   
Sbjct  34   KKTYIIHMDKSEMPASFEDDRFEWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAGL  93

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXS  441
            L +   ++ V  +  Y LHTTRTPEFLGL+    L     + +A+D+IVG++DTGVWP  
Sbjct  94   LEKQLGILSVLPERRYELHTTRTPEFLGLEKSEALLP--ATDKASDLIVGLVDTGVWPEI  151

Query  442  XSFDDSGMTAVP  477
             S+DD+G+ AVP
Sbjct  152  KSYDDTGLAAVP  163



>ref|XP_003559080.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=766

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 81/131 (62%), Gaps = 5/131 (4%)
 Frame = +1

Query  94   KTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLR  267
            +TYIVHM H   P  F  H DWYA+ LQS  DS  +LYTY T  HG++A L   E E L 
Sbjct  32   RTYIVHMSHSAMPDGFAEHGDWYASSLQSVSDSAAVLYTYDTLLHGYSARLTRAEAEALE  91

Query  268  RLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF-GLGAGHGSPEAADVIVGILDTGVWPXSX  444
                V+ V  ++ Y LHTTRTPEFLGLD     L    G+  A+DV+VG+LDTGVWP   
Sbjct  92   AQPGVLLVNPETRYELHTTRTPEFLGLDGRTDALFPQSGT--ASDVVVGVLDTGVWPERA  149

Query  445  SFDDSGMTAVP  477
            S+DD+G   VP
Sbjct  150  SYDDAGFGPVP  160



>ref|XP_009613725.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 93/161 (58%), Gaps = 14/161 (9%)
 Frame = +1

Query  37   ITILLHLLRPC-AATAAVA--------KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS--  183
            +  L  LL  C AA  A+         KKTYI+ +    KP  F  H  WY++ ++S+  
Sbjct  6    MKCLFFLLSVCLAANFAICTTSNIPNTKKTYIIQIDKWAKPDVFIDHVKWYSSLVKSATA  65

Query  184  ---EDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
               E+ +LY+Y TA+HG AA L  +E+ +LR    V+ V+ ++ Y LHTTR+P FLGLD 
Sbjct  66   GEEEERILYSYQTAFHGVAAQLSEEEINKLRAQHGVLAVFPETKYQLHTTRSPLFLGLDR  125

Query  355  EFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            E             +VIVG+LDTG+WP S SF+D+GMT +P
Sbjct  126  EDSSKLWSDKLADHNVIVGVLDTGIWPESPSFNDTGMTPIP  166



>ref|XP_004231903.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=754

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 82/140 (59%), Gaps = 10/140 (7%)
 Frame = +1

Query  73   ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  246
            + A V KKTYI+HM   + P+ F  H  WY A L+S  +S  ++Y Y    HGFAA L A
Sbjct  18   SVAMVEKKTYIIHMAKSQMPAIFDDHTHWYDASLKSVSESAEMIYVYKNVVHGFAARLTA  77

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGIL  417
             + E L     ++ V  + +Y LHTTRTP FLGLD    +      PE+   +DVIVG+L
Sbjct  78   RQAESLETQPGILSVLPELIYQLHTTRTPLFLGLDRSVNI-----FPESDAMSDVIVGVL  132

Query  418  DTGVWPXSXSFDDSGMTAVP  477
            DTGVWP   SFDD+G   VP
Sbjct  133  DTGVWPERKSFDDTGFGPVP  152



>ref|XP_007219861.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
 gb|EMJ21060.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
Length=780

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 87/157 (55%), Gaps = 28/157 (18%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------------SEDSLLYTYT  210
            +A    A KTYIV M    KP SF  H DWY++ + S              ++ ++YTY 
Sbjct  25   SAKTQFAHKTYIVQMDKSAKPESFTNHLDWYSSKVNSIVFKPENEEDGGHDQERVIYTYQ  84

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
             A+HG AA L  +E ERL+  + V+ ++ D+ Y LHTTR+P FLGL+        H S  
Sbjct  85   NAFHGVAARLSEEEAERLQEQDGVLAIFPDTKYQLHTTRSPLFLGLEP-------HDSTT  137

Query  391  AA--------DVIVGILDTGVWPXSXSFDDSGMTAVP  477
                      DVIVG+LDTGVWP S SF+D+GM+ VP
Sbjct  138  TVWSQRVTDHDVIVGVLDTGVWPESQSFNDTGMSPVP  174



>ref|XP_003609994.1| Subtilisin-like protease [Medicago truncatula]
Length=756

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 93/146 (64%), Gaps = 10/146 (7%)
 Frame = +1

Query  46   LLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAY  219
            L+ LL      A   KKTYIVHMKH++  S        Y+  LQSS  S  LLYTYT AY
Sbjct  14   LVMLLLSVTVMALTNKKTYIVHMKHNKNAS-------MYSPILQSSSSSDSLLYTYTHAY  66

Query  220  HGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD  399
            +GFA +L   +V+ LR  ++V+GVYED++YSLHTTRTPEFLGL  +    +      + D
Sbjct  67   NGFAVSLDTKQVQELRSSDSVLGVYEDTLYSLHTTRTPEFLGL-LQIQTHSQFLHQPSYD  125

Query  400  VIVGILDTGVWPXSXSFDDSGMTAVP  477
            V++G+LDTGVWP S SF DS +  +P
Sbjct  126  VVIGVLDTGVWPESQSFHDSQIPQIP  151



>gb|KDP41644.1| hypothetical protein JCGZ_16051 [Jatropha curcas]
Length=747

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 81/135 (60%), Gaps = 10/135 (7%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            +KKTYI+HM     P SF  H  WY + L+S  +S  +LYTY T  HGF+  L  +E E 
Sbjct  10   SKKTYIIHMDKANVPESFDDHLQWYDSALKSVSESADILYTYNTVIHGFSTRLTPEEAEL  69

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGL---DAEFGLGAGHGSPEAADVIVGILDTGVW  432
            L +   ++ V  + VY LHTTRTPEFLGL   DA F       S    +V+VG+LDTGVW
Sbjct  70   LEKQGGILSVVPEMVYELHTTRTPEFLGLGKNDAVF-----PASDSVGEVVVGVLDTGVW  124

Query  433  PXSXSFDDSGMTAVP  477
            P   SFDD+G+  +P
Sbjct  125  PELKSFDDTGLGPIP  139



>ref|XP_009599383.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=773

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 93/159 (58%), Gaps = 16/159 (10%)
 Frame = +1

Query  28   FSAITILLHLLRPCAATAAVA-KKTYIVHMKHHEKPSSFQT-HRDWYAAHLQSSEDS--L  195
            +  I +++ LL  C  + A+  KKTYI+HM   + P++F   H  WY + L+S  DS  +
Sbjct  13   YPVILVVVALLSLCRMSVAMEEKKTYIIHMAKSQMPATFNDDHAHWYDSSLKSVSDSAEM  72

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD--AEFGLG  369
            LY Y    HGF+A L   E E L     ++ V  +  Y LHTTRTP FLGLD  A+F   
Sbjct  73   LYVYNNVVHGFSARLTPQEAESLETQPGILSVLPELKYQLHTTRTPTFLGLDKGADF---  129

Query  370  AGHGSPEA---ADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                 PE+   +DVI+G+LDTGVWP S SFDD+G+  VP
Sbjct  130  ----FPESDAMSDVIIGVLDTGVWPESKSFDDTGLGPVP  164



>ref|XP_004167070.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=761

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 89/158 (56%), Gaps = 8/158 (5%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  189
            M + VW      LL       + A   KKTYIVHM  ++ P SF+ H  WY + L+S  D
Sbjct  1    MANPVWI----FLLLCFFSVPSMAVGDKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVSD  56

Query  190  S--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFG  363
            S  ++Y Y    HGF+  L A+E +RL     ++ V  +  Y LHTTR+PEFLGLD    
Sbjct  57   SAEMIYAYNNVVHGFSTRLTAEEAQRLEAQPGILAVVPEMRYELHTTRSPEFLGLDKNAN  116

Query  364  LGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            L     S   ++VI+G+LDTG+ P S SFDD+G+  VP
Sbjct  117  LYPESNS--VSEVIIGVLDTGISPESKSFDDTGLGPVP  152



>gb|ACN40199.1| unknown [Picea sitchensis]
Length=766

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 83/137 (61%), Gaps = 8/137 (6%)
 Frame = +1

Query  85   VAKKTYIVHMKHHEKPSSFQTHRDWYAAHL------QSSEDSLLYTYTTAYHGFAAALGA  246
            + K++YIV+M    KP  F  H+ WY + +       S   ++LYTY T  HGFAA L +
Sbjct  40   ITKQSYIVYMDKSMKPEHFSLHQHWYTSLIDEVSGSNSDPAAMLYTYDTVTHGFAAKLTS  99

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTG  426
             E + +   +  + V+ DSVY LHTTRTP+FLGL +  GL     S  A D+IVG+LDTG
Sbjct  100  TEAQAMENTDGCLAVFPDSVYRLHTTRTPDFLGLSSSHGLWP--LSHYADDIIVGVLDTG  157

Query  427  VWPXSXSFDDSGMTAVP  477
            +WP S SF D G+T VP
Sbjct  158  IWPESKSFSDQGLTQVP  174



>ref|XP_003608462.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES90659.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 90/150 (60%), Gaps = 11/150 (7%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            IL+  +  C A++++ K TYIVHM   E P SF+ H  WY + LQS  DS  ++YTY  A
Sbjct  13   ILVLFMGLCDASSSL-KSTYIVHMAKSEMPESFEHHTLWYESSLQSVSDSAEMMYTYENA  71

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGF+  L  +E   L     ++ V  +  Y LHTTRTP+FLGLD    +      PE++
Sbjct  72   IHGFSTRLTPEEARLLESQTGILAVLPEVKYELHTTRTPQFLGLDKSADM-----FPESS  126

Query  397  ---DVIVGILDTGVWPXSXSFDDSGMTAVP  477
               +V+VG+LDTGVWP S SF+D+G   +P
Sbjct  127  SGNEVVVGVLDTGVWPESKSFNDAGFGPIP  156



>ref|NP_001234288.1| SBT2 protein precursor [Solanum lycopersicum]
 emb|CAA67430.1| SBT2 [Solanum lycopersicum]
 emb|CAA07000.1| subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 97/169 (57%), Gaps = 17/169 (10%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            +  + +F ++ + ++L + C+      KKTYI+ M    KP  F  H  WY++ ++S   
Sbjct  6    LKCMFFFVSVCLAINLAK-CSPNT---KKTYIIQMDKWAKPDVFVDHVQWYSSLVKSVLP  61

Query  181  ----------SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRT  330
                       E+ +LY+Y TA+HG AA L  +EV++L+    V+ V+ +  Y LHTTR+
Sbjct  62   STTEVEKTGDGEERILYSYQTAFHGVAAQLSEEEVKKLQERNGVLAVFPEIKYQLHTTRS  121

Query  331  PEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            P FLGLD E             +VIVG+LDTG+WP S SF+DSGMT+VP
Sbjct  122  PLFLGLDREDSSKLWADRLSDHNVIVGVLDTGIWPESPSFNDSGMTSVP  170



>emb|CDP02570.1| unnamed protein product [Coffea canephora]
Length=780

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 88/152 (58%), Gaps = 12/152 (8%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKK--TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYT  210
            + L + R   A +AV +K  TYIVH+   + P+SF  H  WY + L+S  +S  +LYTY 
Sbjct  17   VFLGVCRVSVAASAVQQKKNTYIVHVAKSQMPASFDDHTRWYDSSLKSVSESAEMLYTYN  76

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
             A HGFA  L A E + L+    ++ V  +  Y LHTTRTP FLGL     L      PE
Sbjct  77   NAIHGFATRLTAQEAKSLQDQPGILYVLPEVKYELHTTRTPSFLGLQQSANL-----FPE  131

Query  391  A---ADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            +    DVIV +LDTGVWP S SFDD+GM  VP
Sbjct  132  SDSEGDVIVAVLDTGVWPESKSFDDTGMGPVP  163



>gb|EPS61757.1| hypothetical protein M569_13035, partial [Genlisea aurea]
Length=752

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 88/149 (59%), Gaps = 15/149 (10%)
 Frame = +1

Query  67   CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS------------EDSLLYTYT  210
            C +TA   + TYIV M    KP  F  H  WY++ ++SS            E+ +LYT+ 
Sbjct  4    CGSTA---RNTYIVFMDKSAKPDEFADHSQWYSSMVRSSIASVTPAASEGGEERILYTFG  60

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
            TA+HG A  L  +E+ RL +   VV V+ ++VY LHTTR+P FLGL++E    +      
Sbjct  61   TAFHGVAVQLNEEEIARLGQRNGVVSVFPETVYHLHTTRSPLFLGLESEDSTSSWPTEVS  120

Query  391  AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
              DV+VG+LDTG+WP S SF+D+G+  +P
Sbjct  121  EYDVVVGVLDTGIWPESPSFNDTGLGPIP  149



>gb|AES92191.2| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 93/146 (64%), Gaps = 10/146 (7%)
 Frame = +1

Query  46   LLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAY  219
            L+ LL      A   KKTYIVHMKH++  S        Y+  LQSS  S  LLYTYT AY
Sbjct  14   LVMLLLSVTVMALTNKKTYIVHMKHNKNAS-------MYSPILQSSSSSDSLLYTYTHAY  66

Query  220  HGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD  399
            +GFA +L   +V+ LR  ++V+GVYED++YSLHTTRTPEFLGL  +    +      + D
Sbjct  67   NGFAVSLDTKQVQELRSSDSVLGVYEDTLYSLHTTRTPEFLGL-LQIQTHSQFLHQPSYD  125

Query  400  VIVGILDTGVWPXSXSFDDSGMTAVP  477
            V++G+LDTGVWP S SF DS +  +P
Sbjct  126  VVIGVLDTGVWPESQSFYDSQIPQIP  151



>ref|XP_010919193.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=784

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 91/169 (54%), Gaps = 19/169 (11%)
 Frame = +1

Query  25   WFSAITILLHL-LRPCAATAAVA-KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------  180
            W S     LHL L  C  T      +TYI+HM   E P SF  H  WYA+ ++S      
Sbjct  11   WLSLCLAALHLTLSLCTTTPPKPLPRTYIIHMAKSEMPQSFTHHLQWYASTIKSVTTSSK  70

Query  181  ----SEDS------LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRT  330
                +ED       ++Y+Y TA+HGFAA L  DE E L+ +  V  V  ++VY LHTTR+
Sbjct  71   PEAVAEDEEDPAERIIYSYETAFHGFAAKLTEDEAEMLQSIPGVAAVLPETVYQLHTTRS  130

Query  331  PEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            P FLG+  +        +    DVIVGILDTG+WP S SF D GMT VP
Sbjct  131  PRFLGITGKRNR-IWSAALSDHDVIVGILDTGIWPESPSFSDRGMTPVP  178



>ref|NP_001051353.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|AAK63927.1|AC084282_8 putative serine protease [Oryza sativa Japonica Group]
 gb|ABF99010.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13267.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|EAZ28668.1| hypothetical protein OsJ_12679 [Oryza sativa Japonica Group]
 dbj|BAG95169.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95978.1| unnamed protein product [Oryza sativa Japonica Group]
Length=764

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 81/131 (62%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM    KP+ F  H +WYAA LQS  D  ++LYTY T  HG++A L   E E L
Sbjct  34   RRTYIVHMSRSAKPNDFVEHGEWYAASLQSVSDAATVLYTYDTIVHGYSARLTRAEAEAL  93

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
                 V+ V  +  Y LHTTRTPEFLGLD    L     S   +DVIVG+LDTGVWP   
Sbjct  94   ESQPGVLLVNPEVRYELHTTRTPEFLGLDRTDALFP--QSNTGSDVIVGVLDTGVWPERP  151

Query  445  SFDDSGMTAVP  477
            S+DD+G+  VP
Sbjct  152  SYDDAGLGPVP  162



>ref|NP_001151463.1| LOC100285096 precursor [Zea mays]
 gb|ACG42951.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 79/131 (60%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM H   P  F  H +WYAA LQ+  D  ++LYTY+T  HG++A L   E   L
Sbjct  33   RQTYIVHMSHSAMPDEFAEHEEWYAASLQAVSDAATVLYTYSTLLHGYSARLTRAEAAAL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
                 V+ V  +  Y LHTTRTPEFLGLD    L    G+    DV+VG+LDTGVWP   
Sbjct  93   ESQPGVIVVNPEVRYELHTTRTPEFLGLDGTDALFPQSGT--GTDVVVGVLDTGVWPERP  150

Query  445  SFDDSGMTAVP  477
            S+DD+G   VP
Sbjct  151  SYDDTGFGPVP  161



>tpg|DAA51518.1| TPA: putative subtilase family protein [Zea mays]
Length=765

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 79/131 (60%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM H   P  F  H +WYAA LQ+  D  ++LYTY+T  HG++A L   E   L
Sbjct  33   RQTYIVHMSHSAMPDEFAEHEEWYAASLQAVSDAATVLYTYSTLLHGYSARLTRAEAAAL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
                 V+ V  +  Y LHTTRTPEFLGLD    L    G+    DV+VG+LDTGVWP   
Sbjct  93   ESQPGVIVVNPEVRYELHTTRTPEFLGLDGTDALFPQSGT--GTDVVVGVLDTGVWPERP  150

Query  445  SFDDSGMTAVP  477
            S+DD+G   VP
Sbjct  151  SYDDTGFGPVP  161



>gb|EPS59495.1| hypothetical protein M569_15309, partial [Genlisea aurea]
Length=736

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 83/129 (64%), Gaps = 4/129 (3%)
 Frame = +1

Query  100  YIVHMKHHEKPSSF-QTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLRR  270
            +IVHM H + P +F   H DWY + L+S  +S  ++Y YT+  HG++A + A E   L +
Sbjct  1    FIVHMDHSDMPEAFIDNHLDWYGSSLRSVSESANMIYAYTSVVHGYSARMTAAEANLLEK  60

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSF  450
               V+ V ED VY +HTTR+PEFLGL    G  A  GSP   DV+VG+LDTGVWP S S+
Sbjct  61   QPGVLLVQEDMVYDVHTTRSPEFLGLLGNEGSTAVSGSP-IGDVVVGVLDTGVWPESKSY  119

Query  451  DDSGMTAVP  477
            DD+G+  +P
Sbjct  120  DDAGLGPIP  128



>ref|XP_010248001.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=782

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 99/166 (60%), Gaps = 17/166 (10%)
 Frame = +1

Query  16   SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----  180
            S +W+  +T++  +     AT +  KKTYIVHM     P SF  H +WY++ ++S     
Sbjct  16   SFLWY--LTVVFAV---STATLSSLKKTYIVHMDKSVLPESFADHLEWYSSTVKSVMATP  70

Query  181  -SEDS-----LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFL  342
             SED      ++Y+Y TA+HGFAA L  +E +RL     V+ VY ++VY LHTTR+P FL
Sbjct  71   QSEDEDASERIIYSYETAFHGFAARLIEEEAQRLEEGYGVLAVYPETVYHLHTTRSPMFL  130

Query  343  GLDAEFGLGAGHGSPEAA-DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            GL+ E           +  DV+VG+LDTG+WP S SF+D+GM  VP
Sbjct  131  GLETEDSTSTVWSDTLSDHDVVVGVLDTGIWPESASFNDTGMKPVP  176



>ref|XP_006339823.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 79/134 (59%), Gaps = 10/134 (7%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            KKTYI+HM   + P +F  H  WY A L+S  +S  ++Y Y    HGFAA L A E E L
Sbjct  37   KKTYIIHMAKSQMPVTFDDHTHWYDASLKSVSESAEMIYVYKNVVHGFAARLTAQEAESL  96

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGILDTGVWP  435
                 ++ V  + +Y LHTTRTP FLGLD    +      PE+   +DVIVG+LDTGVWP
Sbjct  97   ETQPGILSVLPEVIYQLHTTRTPLFLGLDKSVNI-----FPESDSMSDVIVGVLDTGVWP  151

Query  436  XSXSFDDSGMTAVP  477
               SFDD+G   VP
Sbjct  152  ERKSFDDTGFGPVP  165



>ref|XP_003592386.1| Subtilisin-like protease [Medicago truncatula]
Length=830

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 91/165 (55%), Gaps = 15/165 (9%)
 Frame = +1

Query  28   FSAITILLHLLRPCAAT-AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------  180
             S I     LL    +T A   KKTYI+HM    KP  F +H++WY++ ++S        
Sbjct  12   MSCILTTCFLLSIVLSTHAEFVKKTYIIHMDQSAKPDIFSSHQEWYSSKVKSVLSKSVEA  71

Query  181  -----SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLG  345
                  E+ ++Y+Y TA+HG AA L  +E ++L     VV ++ D+ Y LHTTR+P FLG
Sbjct  72   EIDSSEEERIIYSYNTAFHGMAAKLSTEEAKKLESEAGVVAIFPDTKYQLHTTRSPYFLG  131

Query  346  LDAEFGLGAGHGSPEAA-DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            L+             A  DVIVG+LDTG+WP S SF D+G+  VP
Sbjct  132  LEPIQNTNRSWSEKLANHDVIVGVLDTGIWPESESFIDTGLKPVP  176



>gb|AES62637.2| subtilisin-like serine protease [Medicago truncatula]
Length=782

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 91/165 (55%), Gaps = 15/165 (9%)
 Frame = +1

Query  28   FSAITILLHLLRPCAAT-AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------  180
             S I     LL    +T A   KKTYI+HM    KP  F +H++WY++ ++S        
Sbjct  12   MSCILTTCFLLSIVLSTHAEFVKKTYIIHMDQSAKPDIFSSHQEWYSSKVKSVLSKSVEA  71

Query  181  -----SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLG  345
                  E+ ++Y+Y TA+HG AA L  +E ++L     VV ++ D+ Y LHTTR+P FLG
Sbjct  72   EIDSSEEERIIYSYNTAFHGMAAKLSTEEAKKLESEAGVVAIFPDTKYQLHTTRSPYFLG  131

Query  346  LDAEFGLGAGHGSPEAA-DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            L+             A  DVIVG+LDTG+WP S SF D+G+  VP
Sbjct  132  LEPIQNTNRSWSEKLANHDVIVGVLDTGIWPESESFIDTGLKPVP  176



>emb|CDP05276.1| unnamed protein product [Coffea canephora]
Length=778

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 83/138 (60%), Gaps = 12/138 (9%)
 Frame = +1

Query  100  YIVHMKHHEKPSSFQTHRDWYAAHLQS------------SEDSLLYTYTTAYHGFAAALG  243
            YI+ +    KP+ F  H  WY++ ++S             ED ++YTY TA+HG AA L 
Sbjct  35   YILQIDKWAKPALFVDHVQWYSSIVKSVTSKPSKVDDSGDEDRIIYTYHTAFHGIAARLN  94

Query  244  ADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDT  423
             +EVERLR    V+ V+ ++VY LHTTR+P FLGL+  +G          +DVIVG+LDT
Sbjct  95   QEEVERLREKHGVMAVFPETVYQLHTTRSPLFLGLENRYGTSVWSDRLSQSDVIVGVLDT  154

Query  424  GVWPXSXSFDDSGMTAVP  477
            G+WP S SF+D+ M  VP
Sbjct  155  GIWPESPSFNDTEMGPVP  172



>ref|XP_008780900.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 82/134 (61%), Gaps = 10/134 (7%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM    +PS+F  H  WY A L+S   S  +LY+Y T  HGF+A L   E + L
Sbjct  32   RQTYIVHMAKSRRPSTFAEHGHWYDASLRSVSSSAEILYSYDTVAHGFSARLTTAEAQAL  91

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGILDTGVWP  435
              L+ V+ V  +  Y LHTTRTPEFLGLD    L      P+A   +DV+VG+LDTGVWP
Sbjct  92   ESLDGVLSVLPEVRYELHTTRTPEFLGLDKSDDL-----VPQANTGSDVVVGVLDTGVWP  146

Query  436  XSXSFDDSGMTAVP  477
               SFDD+G   VP
Sbjct  147  ERKSFDDAGFGPVP  160



>ref|XP_010070634.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59525.1| hypothetical protein EUGRSUZ_H02279 [Eucalyptus grandis]
Length=767

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 82/131 (63%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM   + P++FQ H  WY + L+S   S  ++Y+Y T  HGF+A L A+E   L
Sbjct  37   RRTYIVHMAKSQMPAAFQHHAHWYDSSLKSVSGSAQMIYSYDTVVHGFSARLTAEEAGSL  96

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
                 ++ V  +  Y LHTTRTPEFLGLD    L     S    +V+VG+LDTGVWP S 
Sbjct  97   EARHGILAVMPELRYELHTTRTPEFLGLDKSSSLLP--ASESVNEVVVGVLDTGVWPESK  154

Query  445  SFDDSGMTAVP  477
            SFDD+G+ AVP
Sbjct  155  SFDDTGLGAVP  165



>dbj|BAJ87780.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=778

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 90/162 (56%), Gaps = 14/162 (9%)
 Frame = +1

Query  34   AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHL-----------QS  180
            ++ + L LL+   +  A A +TYIV M   EKPS+F  H +WYA+ +           Q 
Sbjct  12   SLRLALVLLQASISACAGASQTYIVQMAASEKPSAFDFHHEWYASTVKSVSSAQVEAEQQ  71

Query  181  SEDS---LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD  351
             ED    ++Y Y TA+HGFAA L  DE ER+     V+ V  ++V  LHTTR+P+FLG+ 
Sbjct  72   EEDGYARIVYNYETAFHGFAARLDEDEAERMAEAAGVLAVLPETVLQLHTTRSPDFLGIG  131

Query  352  AEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             E             DV+VG+LDTG+WP S SF D G+  VP
Sbjct  132  PEVSNRIWAAGLADHDVVVGVLDTGIWPESPSFSDKGLGPVP  173



>ref|XP_010444660.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 87/150 (58%), Gaps = 9/150 (6%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            IL   LR  +++++  + TYIVHM   + PSSF  H +WY + L+S  DS  LLYTY  A
Sbjct  15   ILCLGLRHVSSSSSNEQGTYIVHMAQSQMPSSFDLHSNWYDSSLRSISDSAELLYTYENA  74

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD---AEFGLGAGHGSP  387
             HGFA  L  DE + L     V+ V  +  Y LHTTRTP FLGLD   A+     G    
Sbjct  75   IHGFATRLTQDEADSLMTQPGVLSVLPEHRYELHTTRTPLFLGLDDHNADLFPQTG----  130

Query  388  EAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             + DV+VG+LDTGVWP S S+ D G   VP
Sbjct  131  ASTDVVVGVLDTGVWPESKSYSDEGFGPVP  160



>ref|XP_011099335.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=768

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 91/159 (57%), Gaps = 11/159 (7%)
 Frame = +1

Query  16   SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-  192
            +++  S +  ++  L  C  + A  K+TYIVHM   E P+ FQ H  WY + L+S  DS 
Sbjct  5    TIIPTSLVVRVVLFLALCQLSLA-EKRTYIVHMAKSEMPAVFQDHTHWYDSSLKSVSDSA  63

Query  193  -LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG  369
             +LYTY    HGF+  L  +E + +     ++ V  +  Y LHTTRTP FLGLD    + 
Sbjct  64   EMLYTYNNVIHGFSTRLTPEEAQAMETRPGILSVLPELRYELHTTRTPSFLGLDQNAAM-  122

Query  370  AGHGSPEA---ADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                 PE+   ++VIVG+LDTGVWP S SFDD+G   VP
Sbjct  123  ----FPESDSVSEVIVGVLDTGVWPESPSFDDTGFGPVP  157



>ref|XP_008234331.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=841

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 87/157 (55%), Gaps = 28/157 (18%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------------SEDSLLYTYT  210
            +A    A KTYIV M    KP SF  H DWY++ + S             +++ ++Y Y 
Sbjct  86   SAKTQFAHKTYIVQMDKSAKPESFTNHLDWYSSKVNSIVFKPENEEDGGHNQERVIYAYQ  145

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
             A+HG AA L  +E ERL+  + V+ ++ D+ Y LHTTR+P FLGL+        H S  
Sbjct  146  NAFHGVAARLSEEEAERLQEQDGVLAIFPDTKYQLHTTRSPLFLGLEP-------HDSTT  198

Query  391  AA--------DVIVGILDTGVWPXSXSFDDSGMTAVP  477
                      DVIVG+LDTGVWP S SF+D+GM+ VP
Sbjct  199  NVWSQRVTDHDVIVGVLDTGVWPESQSFNDTGMSPVP  235



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 85/143 (59%), Gaps = 10/143 (7%)
 Frame = +1

Query  73   ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------SEDSLLYTYTTAYHGF  228
            A ++  ++TYIVH+   +KPS F TH  WY++ L+S            L+YTY  A HGF
Sbjct  22   AASSDGRETYIVHVAKAQKPSVFPTHHHWYSSILRSLSPLSAHHPPTKLIYTYDHAVHGF  81

Query  229  AAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIV  408
            +A L + +   LRR   V+ V  DSV  LHTTRTP FLGLD  FG+     S  A D+IV
Sbjct  82   SARLTSSQAAELRRRRCVLSVVPDSVRQLHTTRTPHFLGLDDFFGIWP--NSDYAEDIIV  139

Query  409  GILDTGVWPXSXSFDDSGMTAVP  477
             +LDTG+WP   SF D G++ VP
Sbjct  140  AVLDTGIWPERPSFSDEGLSPVP  162



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 85/134 (63%), Gaps = 7/134 (5%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----SEDSLLYTYTTAYHGFAAALGADEV  255
            ++T+IVH+   EKP +F TH  WY++ ++S         +LYTY  A  GF+A L A + 
Sbjct  28   QETFIVHVIKSEKPLTFSTHHHWYSSIIKSLPPHHRPAEILYTYDRAVRGFSARLSAAQA  87

Query  256  ERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWP  435
            + LRR+ AVV V  D+V  LHTT TP+FLGL   FGL     S  A DVIVG+LDTG+WP
Sbjct  88   DALRRVPAVVSVIPDAVRYLHTTHTPKFLGLADSFGLWP--NSDYADDVIVGVLDTGIWP  145

Query  436  XSXSFDDSGMTAVP  477
               SF D G++AVP
Sbjct  146  ERSSFSDEGLSAVP  159



>ref|XP_006362066.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 87/148 (59%), Gaps = 2/148 (1%)
 Frame = +1

Query  40   TILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTT  213
            T++L L       +   KKTYI+HM     P+ F  H  WY + L+S   S  +LYTY +
Sbjct  11   TLVLVLFHVFVDASQNQKKTYIIHMDKFNMPADFDDHTQWYDSSLKSVSKSANVLYTYNS  70

Query  214  AYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA  393
              HG++  L ADE + L +   ++ V+E+ +Y LHTTR+P FLGL+          +   
Sbjct  71   VIHGYSTQLTADEAKALEQQPGILSVHEEVIYELHTTRSPTFLGLEGHESRSFFPQTEAR  130

Query  394  ADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            ++VI+G+LDTGVWP S SFDD+G+  VP
Sbjct  131  SEVIIGVLDTGVWPESKSFDDTGLGPVP  158



>ref|XP_004231902.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=763

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 81/131 (62%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            KKTYI+HM   + P++F  H  WY A L+S  +S  ++Y Y    HGFAA L A E E L
Sbjct  36   KKTYIIHMAKSQMPATFDDHTHWYDASLKSVSESAEMIYVYNNVIHGFAARLTAQEAESL  95

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
            +    ++ V  + +Y LHTTRTP FLGLD    +   + S   ++VI+GILD+G+WP   
Sbjct  96   KTQPGILSVLSEVIYQLHTTRTPLFLGLDNRPDV--FNDSDAMSNVIIGILDSGIWPERR  153

Query  445  SFDDSGMTAVP  477
            SFDD+G+  VP
Sbjct  154  SFDDTGLGPVP  164



>ref|XP_008780099.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=813

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 88/169 (52%), Gaps = 19/169 (11%)
 Frame = +1

Query  25   WFSAITILLHL-LRPCAATAA-VAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--  192
            W S     LHL L  C  T      +TYI+HM   E P  F     WYA+ ++S   S  
Sbjct  41   WLSLCVAALHLTLSLCTTTPPKPPSRTYIIHMAKSEMPQIFTHRLQWYASTIKSVTSSPK  100

Query  193  --------------LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRT  330
                          ++Y+Y  A+HGFAA L  DE E+L  +  V  V  +++Y LHTTR+
Sbjct  101  LEAVAEEEEDPAERIIYSYENAFHGFAAKLTEDEAEKLESIPGVATVLPETIYRLHTTRS  160

Query  331  PEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            PEFLG+  E        +    DVIVGILDTG+WP S SF D GMTAVP
Sbjct  161  PEFLGITGESN-SMWSAALSDHDVIVGILDTGIWPESPSFSDGGMTAVP  208



>ref|XP_008220305.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=769

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 93/157 (59%), Gaps = 12/157 (8%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVA-------KKTYIVHMKHHEKPSSFQT-HRDWYAAHLQSSEDS  192
            + +L  +L P +    VA       KKTYI+HM   + P+SF+  H  WY + L+S  +S
Sbjct  7    MLLLAVMLLPISHICVVAEDREQQVKKTYIIHMDKSQMPASFEDDHFQWYDSSLKSVSNS  66

Query  193  --LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
              +LYTY T  HGF+  L A+E E L +   ++ V  +  Y LHTTRTPEFLGL     L
Sbjct  67   ADMLYTYRTIIHGFSTRLTAEEAELLEKQPGILSVLPERKYELHTTRTPEFLGLGKSEAL  126

Query  367  GAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                 S + ++VIVG++DTGVWP   S+DD+G+ AVP
Sbjct  127  LP--ASDKVSEVIVGVVDTGVWPELKSYDDTGLAAVP  161



>ref|XP_006362686.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 95/166 (57%), Gaps = 17/166 (10%)
 Frame = +1

Query  19   LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------  180
            L +F ++ + ++L +    T    KKTYI+ M    KP  F  H  WY++ ++S      
Sbjct  9    LFFFVSLCLAINLAKCIPNT----KKTYIIQMDKWAKPDVFIDHVKWYSSLVKSVLPSTP  64

Query  181  -------SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEF  339
                    E+ +LY+Y TA+HG AA L  +EV++L+    V+ V+ +  Y LHTTR+P F
Sbjct  65   EGEKTGDEEERILYSYQTAFHGVAAQLSEEEVKKLQERNGVLAVFPEIKYQLHTTRSPLF  124

Query  340  LGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            LGLD E             +VIVG+LDTG+WP S SF+D+GMT+VP
Sbjct  125  LGLDREDSSKLWADRLSDHNVIVGVLDTGIWPESPSFNDTGMTSVP  170



>ref|NP_001234282.1| SBT1 protein precursor [Solanum lycopersicum]
 emb|CAA67429.1| SBT1 [Solanum lycopersicum]
 emb|CAA06999.1| subtilisin-like protease [Solanum lycopersicum]
Length=766

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 2/131 (2%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            KKTYI+HM     P+ F  H  WY + L+S   S  +LYTY +  HG++  L ADE + L
Sbjct  28   KKTYIIHMDKFNMPADFDDHTQWYDSSLKSVSKSANMLYTYNSVIHGYSTQLTADEAKAL  87

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
             +   ++ V+E+ +Y LHTTR+P FLGL+          +   ++VI+G+LDTGVWP S 
Sbjct  88   AQQPGILLVHEEVIYELHTTRSPTFLGLEGRESRSFFPQTEARSEVIIGVLDTGVWPESK  147

Query  445  SFDDSGMTAVP  477
            SFDD+G+  VP
Sbjct  148  SFDDTGLGQVP  158



>ref|XP_009141044.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=757

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 88/163 (54%), Gaps = 11/163 (7%)
 Frame = +1

Query  10   MGSLVWFSAIT--ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS  183
            M S   FS  +  I+L  L  C  +    + TYIVHM   + PSSF  H  WYA+ L+S 
Sbjct  1    MSSSFLFSTASFFIVLLYLGSCHVSNGAQQATYIVHMAKSQMPSSFDLHSLWYASSLKSV  60

Query  184  EDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
             +S  LLYTY  A HGF+  L   E + L     V+ V  +  Y LHTTRTP FLGLD  
Sbjct  61   SESAELLYTYNNAIHGFSTRLTPQEADSLMTQPGVISVLPEQQYELHTTRTPLFLGLDVH  120

Query  358  FGLGAGHGSPE---AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                 G   PE   ++DV+VG++DTGVWP   SF D G   +P
Sbjct  121  ----NGDLFPETEASSDVVVGVIDTGVWPERKSFSDKGYGPIP  159



>ref|XP_004982450.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=775

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 86/135 (64%), Gaps = 7/135 (5%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSF-QTHRDWYAAHLQS--SEDSLLYTYTTAYHGFAAALGADEVER  261
            +KTYIVHM     P+ +   HR+WY A L+S  +  ++LY Y T  HGF+A L A E   
Sbjct  29   RKTYIVHMAKSAMPAEYADDHREWYGASLRSVSAASNMLYAYDTVLHGFSARLTAQEAAD  88

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE---AADVIVGILDTGVW  432
            L  L  V+ V  ++ Y LHTTRTPEFLG+ A+ G   G   P+   AADV+VG+LDTGVW
Sbjct  89   LACLGGVLAVNPEARYELHTTRTPEFLGI-ADGGADQGGLFPQSGTAADVVVGVLDTGVW  147

Query  433  PXSXSFDDSGMTAVP  477
            P S S+DD+G+  VP
Sbjct  148  PESRSYDDAGLGEVP  162



>emb|CDY00497.1| BnaA10g07760D [Brassica napus]
Length=775

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 88/159 (55%), Gaps = 11/159 (7%)
 Frame = +1

Query  28   FSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED------  189
            F  I + L+L+   A T    KKTY+VHM     PS +  H  WY++ + S  D      
Sbjct  11   FLFIILSLNLMSLHAETGQ--KKTYVVHMDKSAMPSPYTNHLQWYSSKIDSVTDPKSHEE  68

Query  190  ---SLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
                +LYTY TA+HG AA L  +E  RL     VV V  ++ Y LHTTR+P FLGL+ + 
Sbjct  69   EGNRILYTYQTAFHGLAARLSKEEAARLEEEPGVVAVIPETRYELHTTRSPRFLGLERQE  128

Query  361  GLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                        DV+VG+LDTG+WP S SF+D+GM+ VP
Sbjct  129  SERVWAERVTDHDVVVGVLDTGIWPESESFNDTGMSPVP  167



>ref|XP_004509085.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 91/154 (59%), Gaps = 6/154 (4%)
 Frame = +1

Query  22   VWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--L  195
            ++   +++LL L   C A++++ K TYIVHM   E P SF  H  WY + LQS  +S  +
Sbjct  8    IFLIVLSVLL-LTNLCDASSSL-KSTYIVHMAKSEMPESFDHHTMWYESSLQSVSESAEM  65

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
            LYTY  A HG++  L A+E   L     ++ V  +  Y LHTTRTP FLGLD    +   
Sbjct  66   LYTYENAIHGYSTRLTAEEARLLESQTGILAVVPEVKYELHTTRTPLFLGLDKSADMFPE  125

Query  376  HGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
              S   ++V++G+LDTGVWP S SFDD+G   VP
Sbjct  126  SNS--GSEVVIGVLDTGVWPESKSFDDTGFGPVP  157



>ref|XP_004234656.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 79/134 (59%), Gaps = 10/134 (7%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K  +IVHM   + P SF+ H  WY + L+S   S  +LY Y  A HGFAA L A+E E L
Sbjct  36   KSNFIVHMAKSQMPESFEDHTHWYDSSLRSVSGSAEMLYVYNNAVHGFAARLTAEEAESL  95

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGILDTGVWP  435
            +    ++ V  +  Y LHTTRTP FLGLD      +    PE+    DVIVG+LDTGVWP
Sbjct  96   QNQPGILSVLPEMKYELHTTRTPSFLGLDV-----SADYFPESNAMGDVIVGVLDTGVWP  150

Query  436  XSXSFDDSGMTAVP  477
             S SFDD+G   +P
Sbjct  151  ESKSFDDTGFGPIP  164



>emb|CDY29697.1| BnaA04g17300D [Brassica napus]
Length=747

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 88/163 (54%), Gaps = 11/163 (7%)
 Frame = +1

Query  10   MGSLVWFSAIT--ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS  183
            M S   FS  +  I+L  L  C  +    + TYIVHM   + PSSF  H  WYA+ L+S 
Sbjct  1    MSSSFLFSTASFFIVLLYLGSCHVSNGAQQATYIVHMAKSQMPSSFDLHSLWYASSLKSV  60

Query  184  EDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
             +S  LLYTY  A HGF+  L   E + L     V+ V  +  Y LHTTRTP FLGLD  
Sbjct  61   SESAELLYTYNNAIHGFSTRLTPQEADSLMTQPGVISVLPEQQYELHTTRTPLFLGLDVH  120

Query  358  FGLGAGHGSPE---AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                 G   PE   ++DV+VG++DTGVWP   SF D G   +P
Sbjct  121  ----NGDLFPETEASSDVVVGVIDTGVWPERKSFSDKGYGPIP  159



>ref|XP_011010186.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=766

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 88/156 (56%), Gaps = 8/156 (5%)
 Frame = +1

Query  28   FSAITILL----HLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-  192
             S  +ILL    H+ R   AT    K TYIVHM   E P+SF+ H  WY + L+S  DS 
Sbjct  11   ISLFSILLLGVCHVSRATLATNKEKKATYIVHMSKPEMPASFEHHTHWYESSLKSVSDSA  70

Query  193  -LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG  369
             +LYTY  A HGF+  L   E + L     ++ V  +  Y LHTTRTPEFLGLD    L 
Sbjct  71   QMLYTYENAIHGFSTRLTLAEAKLLESQPGILSVMLELRYELHTTRTPEFLGLDKSADLL  130

Query  370  AGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                S   ++VI+G+LDTGVWP S SF D+G   VP
Sbjct  131  P--QSDSVSEVIIGVLDTGVWPESKSFLDTGFGPVP  164



>ref|XP_002318860.1| hypothetical protein POPTR_0012s14140g [Populus trichocarpa]
 gb|EEE97080.1| hypothetical protein POPTR_0012s14140g [Populus trichocarpa]
Length=778

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 91/159 (57%), Gaps = 12/159 (8%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  180
            +TI L      +    + +KTYIV M    KP  F +H +WY++ +QS            
Sbjct  13   LTIYLPFNIVVSMNNPLTRKTYIVQMDRSAKPEYFTSHLEWYSSKVQSVLSKPEIEGNAD  72

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
             ED ++Y+Y TA+HG AA L  +E ERL   + VV ++ ++ Y LHTTR+P FLGL+ E 
Sbjct  73   EEDRIIYSYETAFHGVAAKLNEEEAERLEEADGVVAIFPETKYQLHTTRSPMFLGLEPED  132

Query  361  GLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                        DVIVG+LDTG+WP S SF+D+GMT VP
Sbjct  133  TTSVWSEKLAGHDVIVGVLDTGIWPESESFNDTGMTPVP  171



>emb|CDX75758.1| BnaC03g38410D [Brassica napus]
Length=305

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 80/129 (62%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   TYIVHMKHHEKPSSFQTHRDWYAAHLQS--SEDSLLYTYTTAYHGFAAALGADEVERLRR  270
            TYIVH+ H  KPS F THR WY + L S  S  S+++TY T +HGF+A L A +  +L  
Sbjct  25   TYIVHVDHEAKPSIFPTHRHWYTSSLASLTSTPSIIHTYDTVFHGFSARLTAQDATQLLN  84

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSF  450
               V+ V  + V  +HTTR+PEFLGL +    G    S   +D+++G++DTG+WP   SF
Sbjct  85   HPHVISVIPEQVRHVHTTRSPEFLGLRSTDKAGLLEESDFGSDLVIGVIDTGIWPERPSF  144

Query  451  DDSGMTAVP  477
            DD G+  VP
Sbjct  145  DDRGLGPVP  153



>ref|XP_006433609.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
 gb|ESR46849.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
Length=766

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 79/131 (60%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            KKTY+VHM     P++F  H +WY + L+S   S  +LYTY    HGF+  L A E E L
Sbjct  30   KKTYVVHMDKSTMPATFNDHFEWYDSSLKSVSASAAMLYTYKNVIHGFSTRLTAKEAESL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
            ++   +V V  +  Y LHTTRTPEFLGL     L     S   ++VIVG+LDTGVWP   
Sbjct  90   QKQPGIVSVLPEVRYELHTTRTPEFLGLGKSETLFP--ASEAQSEVIVGVLDTGVWPEIK  147

Query  445  SFDDSGMTAVP  477
            SFDD+GM  VP
Sbjct  148  SFDDTGMGPVP  158



>gb|EYU36337.1| hypothetical protein MIMGU_mgv1a020902mg, partial [Erythranthe 
guttata]
Length=734

 Score =   119 bits (298),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 58/135 (43%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQ------SSEDSLLYTYTTAYHGFAAALGADE  252
            + TYIVHM     P +F +H  WY++ L         E  L+YTY  A+HGF+A L  DE
Sbjct  2    RSTYIVHMDKSSMPKAFSSHHHWYSSMLSFGKPLDEPESKLIYTYDNAFHGFSAVLSEDE  61

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVW  432
            +E L++    +  Y D V + HTTR+ +FL L++  GL     S    DVI+G++DTG+W
Sbjct  62   LEALKKSPGFISSYADDVITTHTTRSTQFLSLNSATGLWPASNS--GKDVIIGVIDTGIW  119

Query  433  PXSXSFDDSGMTAVP  477
            P S SF D GMT VP
Sbjct  120  PESRSFSDEGMTEVP  134



>ref|XP_008792659.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 81/134 (60%), Gaps = 10/134 (7%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM     P++F  H  WY A ++S  DS  +LY+Y T  HGF+A L   E   L
Sbjct  32   RRTYIVHMAKSRMPATFAEHGHWYDASVRSVSDSVEILYSYNTVAHGFSAHLTPAEAAAL  91

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE---FGLGAGHGSPEAADVIVGILDTGVWP  435
               + V+ V ++  Y LHTTRTPEFLGLD     F  G       A+DV+VG+LDTGVWP
Sbjct  92   ESRDGVLSVLQEVRYKLHTTRTPEFLGLDKSDDIFPQGN-----TASDVVVGVLDTGVWP  146

Query  436  XSXSFDDSGMTAVP  477
               SFDD+G  AVP
Sbjct  147  ERKSFDDTGFGAVP  160



>ref|XP_003536496.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN02773.1| Subtilisin-like protease [Glycine soja]
Length=782

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 95/168 (57%), Gaps = 14/168 (8%)
 Frame = +1

Query  10   MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  180
            M  +V   A  +LL  L   +A A   KKTYI+ M    KP +F  H DWY++ ++S   
Sbjct  9    MEKMVLILASYLLLSTL--FSANAEFVKKTYIIQMDKSAKPDTFSNHLDWYSSKVKSILS  66

Query  181  --------SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPE  336
                     E+ ++YTY TA+HG AA L  +E E+L   E VV ++ D+ Y LHTTR+P 
Sbjct  67   KSVEAEMDKEERIIYTYQTAFHGVAAKLSQEEAEKLEAEEGVVAIFPDTKYQLHTTRSPT  126

Query  337  FLGLDAEFGLGAGHGSPEAA-DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            FLGL+             A  DVIVG+LDTGVWP S SF+D+GM  VP
Sbjct  127  FLGLEPTQSTNNVWSEKLANHDVIVGVLDTGVWPESESFNDTGMRPVP  174



>ref|XP_002510119.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52306.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=769

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 83/135 (61%), Gaps = 10/135 (7%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            +K TYI+HM     P+SF  H  WY + L+S  +S  +LY Y    HGF+  L ++E E 
Sbjct  32   SKNTYIIHMDKSYMPASFDDHLQWYDSSLKSVSESADMLYDYNNVIHGFSTRLTSEEAEL  91

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGL---DAEFGLGAGHGSPEAADVIVGILDTGVW  432
            L + E ++ V  + +Y LHTTRTPEFLGL   +A F       S   ++V+VG+LDTGVW
Sbjct  92   LEKQEGIISVLPEMIYELHTTRTPEFLGLGKSEAFF-----PTSDSVSEVVVGVLDTGVW  146

Query  433  PXSXSFDDSGMTAVP  477
            P + SFDD+G+  +P
Sbjct  147  PEAKSFDDTGLGPIP  161



>ref|XP_003523991.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN04450.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 88/161 (55%), Gaps = 9/161 (6%)
 Frame = +1

Query  16   SLVWFSAITILLHLLRPCAATAAVAKK-----TYIVHMKHHEKPSSFQTHRDWYAAHLQS  180
            +++ F ++ I L L+     T A  K      TYI+HM     P SF  H  W+ + L+S
Sbjct  6    NMLIFKSLQISLLLVFSIRNTTAEKKTHHTKHTYIIHMDKFNMPESFNDHLLWFDSSLKS  65

Query  181  SEDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
              DS  +LYTY    HGF+  L   E E L +   V+ V  +  Y LHTTRTPEFLGL  
Sbjct  66   VSDSAEMLYTYKKVAHGFSTRLTTQEAELLSKQPGVLSVIPEVRYDLHTTRTPEFLGLAK  125

Query  355  EFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
               L    G  + +DVIVG+LDTGVWP   SFDD+G+  VP
Sbjct  126  YSTLSLASG--KQSDVIVGVLDTGVWPELKSFDDTGLGPVP  164



>gb|KJB29423.1| hypothetical protein B456_005G099900 [Gossypium raimondii]
Length=766

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 85/154 (55%), Gaps = 5/154 (3%)
 Frame = +1

Query  22   VWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--L  195
            +  +AI ++L L   C   A  AK+TYIVHM     P  F  H  WY + L+S   S  +
Sbjct  16   IKVAAIVVVLSLCYACV-MAEQAKRTYIVHMDKSNMPECFTHHSLWYDSSLKSVSKSASM  74

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
            LY Y    HG++A L  +E E L +   V+ V  D  Y LHTTRTPEFLGL     L   
Sbjct  75   LYRYENVIHGYSARLTPEEAESLGKQSGVLSVLPDVRYELHTTRTPEFLGLGNNSALIPT  134

Query  376  HGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
              S   ++VIVGILDTGVWP   SFDDS +  VP
Sbjct  135  TAS--TSEVIVGILDTGVWPELKSFDDSELGPVP  166



>ref|XP_006579930.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006579931.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
 ref|XP_006579932.1| PREDICTED: subtilisin-like protease-like isoform X3 [Glycine 
max]
Length=755

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYIVH+   E P SF+ H  WY + L++  DS  ++YTY  A HG+A  L A+E   L
Sbjct  28   KSTYIVHVAKSEMPESFEHHALWYESSLKTVSDSAEIMYTYDNAIHGYATRLTAEEARLL  87

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
                 ++ V  ++ Y LHTTRTP FLGLD    +     S   +DVI+G+LDTGVWP S 
Sbjct  88   ETQAGILAVLPETRYELHTTRTPMFLGLDKSADMFPESSS--GSDVIIGVLDTGVWPESK  145

Query  445  SFDDSGMTAVP  477
            SFDD+G+  VP
Sbjct  146  SFDDTGLGPVP  156



>ref|XP_007226995.1| hypothetical protein PRUPE_ppa001756mg [Prunus persica]
 gb|EMJ28194.1| hypothetical protein PRUPE_ppa001756mg [Prunus persica]
Length=769

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 86/133 (65%), Gaps = 7/133 (5%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQT-HRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            KKTYI+HM   + P+SF+  H  WY + L+S  +S  +LYTY T  HGF+  L A+E E 
Sbjct  32   KKTYIIHMDKSQMPASFEDDHFQWYDSSLKSVSNSADMLYTYRTIIHGFSTRLTAEEAEL  91

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGL-DAEFGLGAGHGSPEAADVIVGILDTGVWPX  438
            L +   ++ V  +  Y LHTTRTPEFLGL  +E  L A   S + + VIVG++DTGVWP 
Sbjct  92   LEKQPGILSVLPERKYELHTTRTPEFLGLGKSEAFLPA---SDKVSQVIVGVVDTGVWPE  148

Query  439  SXSFDDSGMTAVP  477
              S+DD+G+ AVP
Sbjct  149  LKSYDDTGLAAVP  161



>ref|XP_003525925.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 75/131 (57%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSL--LYTYTTAYHGFAAALGADEVERL  264
            K TYI+HM     P SF  H  WY + L+S  DS   LYTY    HGF+  L   E E L
Sbjct  36   KNTYIIHMDKFNMPESFNDHLHWYDSSLKSVSDSAERLYTYKKVAHGFSTRLTTQEAELL  95

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
             +   V+ V  +  Y LHTTRTPEFLGL     L    G  + +DVIVG+LDTGVWP   
Sbjct  96   SKQPGVLSVIPEVRYELHTTRTPEFLGLAKYTTLSLASG--KQSDVIVGVLDTGVWPELK  153

Query  445  SFDDSGMTAVP  477
            SFDD+G+  VP
Sbjct  154  SFDDTGLEPVP  164



>emb|CDY18651.1| BnaA09g07440D [Brassica napus]
Length=751

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 80/130 (62%), Gaps = 5/130 (4%)
 Frame = +1

Query  97   TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLRR  270
            TYIVHM   + PSSF  H  WY + L+S+ +S  +LYTY +A HGFA  L  +E + L  
Sbjct  32   TYIVHMAKSQMPSSFDQHSLWYESSLKSASESAEMLYTYNSAIHGFATRLTPEEADSLMT  91

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLDA-EFGLGAGHGSPEAADVIVGILDTGVWPXSXS  447
               V+ V  +  Y LHTTRTP FLGLD    GL    G+  A+DV++G+LD+GVWP S S
Sbjct  92   QPGVISVQPEQQYELHTTRTPLFLGLDVHNAGLFPETGA--ASDVVIGVLDSGVWPESKS  149

Query  448  FDDSGMTAVP  477
            F D G   VP
Sbjct  150  FSDEGYGPVP  159



>ref|XP_010240288.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=778

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 88/162 (54%), Gaps = 14/162 (9%)
 Frame = +1

Query  34   AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-------  192
            ++ ++L L+       A A KTYIV M   E PSSF  H +WYA+ ++S   +       
Sbjct  12   SLCLVLVLVHASIYACAGAPKTYIVQMAASEMPSSFDYHHEWYASTVKSVSSAQLEAEAG  71

Query  193  -------LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD  351
                   ++Y Y TA+HGFAA L  DE ER+     V+ V  ++V  LHTTR+P+FLG+ 
Sbjct  72   DDDAYTRIVYNYETAFHGFAARLDEDEAERMAEAAGVLAVLPETVLQLHTTRSPDFLGIG  131

Query  352  AEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             E             DV+VG+LDTG+WP S SF D G+  VP
Sbjct  132  PEISNSIWAAGLADHDVVVGVLDTGIWPESPSFSDKGLGPVP  173



>ref|XP_003627424.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AET01900.1| subtilisin-like serine protease [Medicago truncatula]
Length=782

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 86/133 (65%), Gaps = 4/133 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEVE  258
            K+T+I+ ++H+ KPS F TH++WY + L S    + +++++TY T +HGF+  L   E +
Sbjct  27   KQTFIIQVQHNSKPSIFPTHKNWYESSLSSITKTTSNNIIHTYDTVFHGFSTKLTQLEAQ  86

Query  259  RLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPX  438
             L++L  V+ +  + + +LHTTR+PEFLGL      G  H +   +D+++G++DTG+WP 
Sbjct  87   NLQKLSHVITIIPEQIRTLHTTRSPEFLGLKTAAKTGLLHETDFGSDLVIGVIDTGIWPE  146

Query  439  SXSFDDSGMTAVP  477
              SF+D  +  VP
Sbjct  147  RQSFNDRELGPVP  159



>ref|XP_006472275.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=766

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 79/131 (60%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            KKTY+VHM     P++F  H +WY + L+S   S  +LYTY    HGF+  L A E E L
Sbjct  30   KKTYVVHMDKSTMPATFNDHFEWYDSSLKSVSASAAMLYTYKNVIHGFSTRLTAKEAESL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
            ++   +V V  +  Y LHTTRTPEFLGL     L     S   ++VIVG+LDTGVWP   
Sbjct  90   QKQPGIVSVLPEVRYELHTTRTPEFLGLGKSETLFP--TSEVQSEVIVGVLDTGVWPEIK  147

Query  445  SFDDSGMTAVP  477
            SFDD+GM  VP
Sbjct  148  SFDDTGMGPVP  158



>ref|XP_007155854.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
 gb|ESW27848.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
Length=794

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 82/140 (59%), Gaps = 4/140 (3%)
 Frame = +1

Query  64   PCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAA  237
            P A  +   + TYIVH+   E P SF  H  WY + L+S  +S  ++YTY  A HG+A  
Sbjct  56   PAAQASEPERATYIVHVAKSEMPQSFDHHAMWYESSLKSVSNSAQMIYTYDNAIHGYATR  115

Query  238  LGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGIL  417
            L  +E   L     ++ V  +  Y LHTTRTP+FLGLD    +     S  A+DV+VG+L
Sbjct  116  LTPEEARLLESQTGILAVLPEMRYELHTTRTPQFLGLDKSADMFPESNS--ASDVVVGVL  173

Query  418  DTGVWPXSXSFDDSGMTAVP  477
            DTGVWP S SFDD+G+  VP
Sbjct  174  DTGVWPESKSFDDTGLGPVP  193



>ref|XP_003549134.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 83/147 (56%), Gaps = 11/147 (7%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----------SEDSLLYTYTTA  216
            +A A  +KKTY++ M     P +F  H +WY++ ++S           +E+ ++YTY  A
Sbjct  25   SANAQFSKKTYLIQMDKSTMPKAFPNHLEWYSSKVKSALSTSPEADMDNEERIIYTYQNA  84

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
            +HG AA L   E ++L   E VV ++ D+ Y LHTTR+P FLGL+               
Sbjct  85   FHGVAAKLTEGEAKKLEAEEGVVAIFPDTKYELHTTRSPIFLGLEPAKSTNMWSEKLAGH  144

Query  397  DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            DVIVG++DTG+WP S SF D GM  VP
Sbjct  145  DVIVGVVDTGIWPESESFKDVGMRPVP  171



>ref|XP_011030007.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=778

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 91/159 (57%), Gaps = 12/159 (8%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  180
            +T+ L      +    + +KTYIV M    KP  F +H +WY++ +QS            
Sbjct  13   LTVYLPFNIVVSMNNPLTRKTYIVQMDRSAKPEYFTSHLEWYSSKVQSVLSKPEIEGNAD  72

Query  181  SEDSLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
             ED ++Y+Y TA+HG AA L  +E ERL   + VV ++ ++ Y LHTTR+P FLGL+ E 
Sbjct  73   EEDRIIYSYETAFHGVAAKLNEEEAERLEEADGVVAIFPETKYQLHTTRSPMFLGLEPED  132

Query  361  GLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                        DVIVG+LDTG+WP S SF+D+GMT VP
Sbjct  133  SASVWSEKLADHDVIVGVLDTGIWPESESFNDTGMTPVP  171



>ref|XP_006383545.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
 gb|ERP61342.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
Length=766

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 88/156 (56%), Gaps = 8/156 (5%)
 Frame = +1

Query  28   FSAITILL----HLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-  192
             S  +ILL    H+ R   A+    K TYIVHM   E P+SF+ H  WY + L+S  DS 
Sbjct  11   ISLFSILLLGVCHVSRATLASNKEKKATYIVHMSKPEMPASFEHHTHWYESSLKSVSDSA  70

Query  193  -LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG  369
             +LYTY  A HGF+  L   E + L     ++ V  +  Y LHTTRTPEFLGLD    L 
Sbjct  71   QMLYTYENAIHGFSTRLTLAEAKLLESQPGILSVMLELRYELHTTRTPEFLGLDKSADLL  130

Query  370  AGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                S   ++VI+G+LDTGVWP S SF D+G   VP
Sbjct  131  P--QSDSVSEVIIGVLDTGVWPESKSFLDTGFGPVP  164



>ref|XP_004142885.1| PREDICTED: subtilisin-like protease-like isoform 2 [Cucumis sativus]
 ref|XP_004172334.1| PREDICTED: subtilisin-like protease-like isoform 2 [Cucumis sativus]
Length=641

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 88/161 (55%), Gaps = 17/161 (11%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAAT--------AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS  180
            WF     LL L+  C+ +          + KKTYI+HM     P +F  H  WY + L+S
Sbjct  9    WF-----LLFLISFCSCSFTEAQKSNQQLKKKTYIIHMDKTNMPQAFDDHFQWYDSSLKS  63

Query  181  SEDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
              DS  +LY+Y T  HGF+  L  +E + + + E ++ V  +  Y LHTTRTPEFLGL  
Sbjct  64   VSDSAQMLYSYNTVIHGFSTRLTVEEAKLMEKQEGIIAVIPEMKYELHTTRTPEFLGLGK  123

Query  355  EFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                     S + ++VI+G+LDTGVWP   SF D+G+  +P
Sbjct  124  SVSFFP--ASEKVSEVIIGVLDTGVWPELESFSDAGLGPIP  162



>ref|XP_010277120.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 78/129 (60%), Gaps = 4/129 (3%)
 Frame = +1

Query  97   TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLRR  270
            TYIVHM   + P+SF  H  WY + L+S  DS  +LYTY    HGF+  L  +E + L  
Sbjct  35   TYIVHMAKFQMPASFDEHTHWYDSSLKSVSDSAEMLYTYDNVIHGFSTRLTDEEAKLLEA  94

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSF  450
               ++ V  +  Y LHTTRTPEFLGLD   GL     S  A++V VG+LDTG+WP S SF
Sbjct  95   QPGILSVLPEVRYELHTTRTPEFLGLDKNEGLFP--QSDIASEVFVGVLDTGIWPESLSF  152

Query  451  DDSGMTAVP  477
            DD G+  VP
Sbjct  153  DDKGLGPVP  161



>ref|XP_004142884.1| PREDICTED: subtilisin-like protease-like isoform 1 [Cucumis sativus]
 ref|XP_004172333.1| PREDICTED: subtilisin-like protease-like isoform 1 [Cucumis sativus]
 gb|KGN62460.1| Xylem serine proteinase 1 [Cucumis sativus]
Length=770

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 88/161 (55%), Gaps = 17/161 (11%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAAT--------AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS  180
            WF     LL L+  C+ +          + KKTYI+HM     P +F  H  WY + L+S
Sbjct  9    WF-----LLFLISFCSCSFTEAQKSNQQLKKKTYIIHMDKTNMPQAFDDHFQWYDSSLKS  63

Query  181  SEDS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
              DS  +LY+Y T  HGF+  L  +E + + + E ++ V  +  Y LHTTRTPEFLGL  
Sbjct  64   VSDSAQMLYSYNTVIHGFSTRLTVEEAKLMEKQEGIIAVIPEMKYELHTTRTPEFLGLGK  123

Query  355  EFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                     S + ++VI+G+LDTGVWP   SF D+G+  +P
Sbjct  124  SVSFFP--ASEKVSEVIIGVLDTGVWPELESFSDAGLGPIP  162



>emb|CDY18654.1| BnaA09g07410D [Brassica napus]
Length=745

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 80/132 (61%), Gaps = 5/132 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYIVHM   + PSSF  H  WY + L+S+ +S  +LYTY  A HGFA  L  +E + L
Sbjct  30   QSTYIVHMAKSQMPSSFDQHSLWYESSLKSASESAEMLYTYNNAIHGFATRLTPEEADSL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDA-EFGLGAGHGSPEAADVIVGILDTGVWPXS  441
                 V+ V  +  Y LHTTRTP FLGL+    GL    G+  A+DV++G+LDTGVWP S
Sbjct  90   MVQPGVISVQSEQQYELHTTRTPLFLGLEVHNAGLFPETGA--ASDVVIGVLDTGVWPES  147

Query  442  XSFDDSGMTAVP  477
             SF D G   VP
Sbjct  148  KSFSDEGYGPVP  159



>emb|CDY43570.1| BnaC02g16670D [Brassica napus]
Length=196

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 84/153 (55%), Gaps = 12/153 (8%)
 Frame = +1

Query  40   TILLHLLRP--CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTY  207
            TILL +L P  C  +      TYIVHM   + PS F  H  WY + L++   S  LLYTY
Sbjct  14   TILL-VLHPGFCHVSDGAQHATYIVHMAQSQMPSGFDLHSLWYDSSLRTVSQSAQLLYTY  72

Query  208  TTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSP  387
              A HGF+  L  +E + L  L  V+ V  +  Y LHTTRTP FLGL    G+      P
Sbjct  73   ANAIHGFSTRLTPEEADSLMTLPGVISVLPEHRYELHTTRTPLFLGL----GVHNADLFP  128

Query  388  EAA---DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            E     DV+VG+LDTGVWP S SF D G+  +P
Sbjct  129  ETGSSLDVVVGVLDTGVWPESKSFSDVGLGPIP  161



>emb|CDY18653.1| BnaA09g07420D [Brassica napus]
Length=717

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 84/147 (57%), Gaps = 3/147 (2%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            I+   L  C  +    + TYIVHM   + PSSF  H  WY + L+S  +S  ++YTY  A
Sbjct  14   IVFLYLGSCHVSNGAQQATYIVHMAKSQMPSSFDQHSLWYDSSLRSVSESAEMIYTYNNA  73

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGFA  L  +E + L     V+ V ++  Y LHTTRTP FLGLD   G G    +  ++
Sbjct  74   IHGFATRLTPEEADSLMTQPGVISVRQEQRYELHTTRTPLFLGLDVHNG-GLFPETSTSS  132

Query  397  DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            +++VG+LDTG+WP S SF D G   +P
Sbjct  133  NLVVGVLDTGIWPESKSFSDEGYGPIP  159



>ref|XP_009112373.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=766

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 80/130 (62%), Gaps = 5/130 (4%)
 Frame = +1

Query  97   TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLRR  270
            TYIVHM   + PSSF  H  WY + L+S+ +S  +LYTY +A HGFA  L  +E + L  
Sbjct  32   TYIVHMAKSQMPSSFDQHSLWYESSLKSASESAEMLYTYNSAIHGFATRLTPEEADSLMT  91

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLDA-EFGLGAGHGSPEAADVIVGILDTGVWPXSXS  447
               V+ V  +  Y LHTTRTP FLGLD    GL    G+  A+DV++G+LD+GVWP S S
Sbjct  92   QPGVISVQPEQQYELHTTRTPLFLGLDVHNAGLFPETGA--ASDVVIGVLDSGVWPESKS  149

Query  448  FDDSGMTAVP  477
            F D G   +P
Sbjct  150  FSDEGYGPIP  159



>ref|XP_009380035.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380036.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380037.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 94/161 (58%), Gaps = 11/161 (7%)
 Frame = +1

Query  28   FSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE----DSL  195
             +++T L+ L   CA       +TYIV+M    +P+   TH DWYAAHLQS +      L
Sbjct  1    MASVTALVMLFLACAGGLVCGNQTYIVYMNPAHRPAVHPTHADWYAAHLQSLDIDPGRHL  60

Query  196  LYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAG  375
            LYTY+ A HGFAA+L    ++ LRR  AVV ++ D V +LHTTR+P+FLGL  +    A 
Sbjct  61   LYTYSDALHGFAASLLPHHLDLLRRSPAVVQLHPDPVLTLHTTRSPQFLGLAPDASSSAA  120

Query  376  HGSP----EAA--DVIVGILDTGVWPXSXSFD-DSGMTAVP  477
               P    EAA  DV + +LDTGVWP   SF   +G+  VP
Sbjct  121  VPRPIQAVEAASRDVFIAVLDTGVWPEVPSFSAAAGLPEVP  161



>ref|XP_010061844.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW90792.1| hypothetical protein EUGRSUZ_A02859 [Eucalyptus grandis]
Length=780

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 82/147 (56%), Gaps = 15/147 (10%)
 Frame = +1

Query  82   AVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---------------SEDSLLYTYTTA  216
              AK T+IV M     P +F  H DWY++ ++S                E+ ++Y Y TA
Sbjct  28   CTAKTTFIVQMDRSAMPGTFSDHLDWYSSKIKSVVSGSDLQEIRGDADDEERIIYNYRTA  87

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
            +HG AA L  DE ++L + + V+ V+ +  Y LHTTR+P FLGLD E             
Sbjct  88   FHGVAARLTGDEAKKLEQEDGVLAVFPEEKYELHTTRSPMFLGLDREDTSDVWSQKNLDH  147

Query  397  DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            DV+VG+LDTG+WP S SF+D+GM  VP
Sbjct  148  DVVVGVLDTGIWPESESFNDTGMAPVP  174



>gb|KDP32042.1| hypothetical protein JCGZ_12503 [Jatropha curcas]
Length=742

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 80/138 (58%), Gaps = 4/138 (3%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALG  243
            A T    KKTYIVHM   + P+SF+ H  WY + L+S   S  +LY Y  A HGF+  L 
Sbjct  2    ATTQKQDKKTYIVHMAKSQMPASFEQHVHWYDSSLKSVSGSAQMLYFYDNAIHGFSTRLT  61

Query  244  ADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDT  423
             +E E L     ++ V  +  Y LHTTR+PEFLGLD    +     S    DVI+G+LDT
Sbjct  62   PEEAELLENQPGILSVLPELRYELHTTRSPEFLGLDKSADMFP--QSDSVGDVIIGVLDT  119

Query  424  GVWPXSXSFDDSGMTAVP  477
            GVWP S SF D+G+  VP
Sbjct  120  GVWPESKSFADTGLGPVP  137



>ref|XP_009336065.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 78/129 (60%), Gaps = 4/129 (3%)
 Frame = +1

Query  97   TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLRR  270
            TYIVHM   + P+SF+ H  WY + L+S  DS  +LYTYT+A HGF+  L  ++   L  
Sbjct  40   TYIVHMAKSQMPASFEHHTHWYDSSLKSVSDSAEMLYTYTSAIHGFSTRLTPEQAASLSS  99

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSF  450
               V+ V  +  Y LHTTRTPEFLGL           S  A DVI+G+LDTGVWP S SF
Sbjct  100  QPGVLSVLPELKYELHTTRTPEFLGLGQT--TETMPQSDSAGDVIIGVLDTGVWPESKSF  157

Query  451  DDSGMTAVP  477
            DD+G   VP
Sbjct  158  DDTGFGPVP  166



>gb|KJB43875.1| hypothetical protein B456_007G221100 [Gossypium raimondii]
Length=761

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 78/131 (60%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            +KTYIVHM   E P SFQ H  WY + L+S   S  +LYTY    HGF+  L   E E+L
Sbjct  31   RKTYIVHMAKSEMPPSFQHHTHWYDSSLKSVSGSAAMLYTYDNVIHGFSTQLTDKEAEQL  90

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
                 ++ V  +  Y LHTTRTPEFLGL     L     S  A++V++G+LDTGVWP S 
Sbjct  91   ESQPGILAVLPEVRYELHTTRTPEFLGLSQAAALFP--ESESASEVVIGVLDTGVWPESK  148

Query  445  SFDDSGMTAVP  477
            SF D+G+  +P
Sbjct  149  SFADTGLGPIP  159



>ref|XP_006651839.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=716

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 80/131 (61%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM     P+ F  H +WYAA LQS  D  ++LYTY T  HG++A L   E E L
Sbjct  31   RRTYIVHMSRSAMPNDFAEHGEWYAASLQSVSDAATVLYTYDTLVHGYSARLTRAEAEAL  90

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
                 V+ V  +  Y LHTTRTPEFLGLD    L     S   +DVIVG+LDTGVWP   
Sbjct  91   ESQPGVLFVNPEVRYELHTTRTPEFLGLDRTDALFP--QSNTGSDVIVGVLDTGVWPERP  148

Query  445  SFDDSGMTAVP  477
            S+D++G+  VP
Sbjct  149  SYDETGLGPVP  159



>ref|XP_004981675.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 80/131 (61%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM H   P+ F  H +WYAA LQ+  +  ++LYTY T  HG++A L   E E L
Sbjct  30   RQTYIVHMSHSAMPNDFVEHGEWYAASLQAVSEAATVLYTYDTLVHGYSARLTRAEAEAL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
                 V+ V  +  Y LHTTRTPEFLGLD    L     S   +DVI+G+LDTGVWP   
Sbjct  90   ESQPGVLIVNPEVRYELHTTRTPEFLGLDGTDALFP--QSSTGSDVIIGVLDTGVWPERP  147

Query  445  SFDDSGMTAVP  477
            S+DD+G   VP
Sbjct  148  SYDDTGFGPVP  158



>gb|ABR18065.1| unknown [Picea sitchensis]
Length=783

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 82/137 (60%), Gaps = 8/137 (6%)
 Frame = +1

Query  85   VAKKTYIVHMKHHEKPSSFQTHRDWYAAHL------QSSEDSLLYTYTTAYHGFAAALGA  246
            + K++YIV+M    KP  F  H+ WY + +       S   ++LYTY T  HGFAA L +
Sbjct  40   ITKQSYIVYMDKSMKPEHFSLHQHWYTSLIDEVSGSNSDPAAMLYTYDTVTHGFAAKLTS  99

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTG  426
             E + +   +  + V+ D VY +HTTRTP+FLGL +  GL     S  A D+IVG+LDTG
Sbjct  100  TEAQAMENTDGCLAVFPDYVYRVHTTRTPDFLGLSSSHGLWP--LSHYADDIIVGVLDTG  157

Query  427  VWPXSXSFDDSGMTAVP  477
            +WP S SF D G+T VP
Sbjct  158  IWPESKSFSDQGLTQVP  174



>ref|XP_002463844.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 ref|XP_002464198.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
 gb|EER90842.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 gb|EER91196.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
Length=764

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 79/131 (60%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  264
            ++TYIVHM H   PS F  H +WYAA LQ+  D  ++LYTY T  HG++A L   E   L
Sbjct  33   RQTYIVHMSHSAMPSDFVEHEEWYAASLQAVSDAATVLYTYNTLLHGYSARLTRAEAAAL  92

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
                 V+ V  +  Y LHTTRT EFLGLD    L    G+   +DVIVG+LDTGVWP   
Sbjct  93   ESQPGVLVVNPEVRYELHTTRTWEFLGLDGTDALFPQSGT--GSDVIVGVLDTGVWPERP  150

Query  445  SFDDSGMTAVP  477
            S+DD+G   VP
Sbjct  151  SYDDTGFGPVP  161



>ref|XP_008391410.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 79/132 (60%), Gaps = 6/132 (5%)
 Frame = +1

Query  94   KTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED----SLLYTYTTAYHGFAAALGADEVER  261
            KT+IVH+   +KP+ F +HR WY + +QS        LLYTY  A HGF+AAL + +  +
Sbjct  32   KTFIVHVSKSDKPALFSSHRSWYTSIIQSLPSPHPTKLLYTYDRAVHGFSAALTSSQATQ  91

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXS  441
            L    AV+ V  D    LHTT TP FLGL   FGL     S  A DVIVG+LDTG+WP  
Sbjct  92   LLSHPAVLSVTPDQPRQLHTTHTPSFLGLAESFGLWP--NSDYADDVIVGVLDTGIWPER  149

Query  442  XSFDDSGMTAVP  477
             SF DSG+  VP
Sbjct  150  PSFSDSGLGPVP  161



>ref|XP_009103426.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=760

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 84/147 (57%), Gaps = 2/147 (1%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            ++L+LL     +    + TYIVHM   + PSS+  H  WY + L+S  +S  LLYTY  A
Sbjct  16   LILYLLGSSQVSDGAQQSTYIVHMAKSQMPSSYDLHSLWYDSSLRSVSESAQLLYTYNNA  75

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGF+  L  +E + L     V+ V  +  Y LHTTR+P FLGLD          +  ++
Sbjct  76   IHGFSTRLTPEEADSLMTQPGVISVLPEHRYELHTTRSPLFLGLDEHNNADLFPQTGASS  135

Query  397  DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            DV+VG+LDTGVWP S SF D+G   VP
Sbjct  136  DVVVGVLDTGVWPESKSFSDNGFGPVP  162



>ref|XP_003562295.2| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=773

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 80/130 (62%), Gaps = 3/130 (2%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-SEDSLLYTYTTAYHGFAAALGADEVERLR  267
            + TYIVHM     P+ +  H +WY A L+S S   ++YTY T  HGF+A L   E   + 
Sbjct  38   RATYIVHMAKSAMPAGYTEHGEWYGASLRSVSGAKMIYTYDTLLHGFSARLTEREAGDMA  97

Query  268  RLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXS  447
             ++ V+ V  ++ Y LHTTRTPEFLGL    GL    G+    DV+VG+LDTGVWP S S
Sbjct  98   AMDGVLAVNPETRYQLHTTRTPEFLGLAGNEGLFPQSGT--KGDVVVGVLDTGVWPESKS  155

Query  448  FDDSGMTAVP  477
            +DD+G+  VP
Sbjct  156  YDDAGLGEVP  165



>dbj|BAJ96698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------SEDSLLYTYTTAYHGFAAALGADE  252
            + TYIVHM     P+ +  H +WY A L+S          +LY Y T  HGF+A L   E
Sbjct  29   RATYIVHMAKSAMPAEYADHGEWYGASLRSVSAGGAPAAKMLYAYDTVLHGFSARLTEQE  88

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVW  432
               +  +E V+ V  ++ Y LHTTRTPEFLGL    GL    G+  A DV+VG+LDTGVW
Sbjct  89   ASDMAGMEGVLAVNPETRYELHTTRTPEFLGLAGNEGLFPQSGT--AGDVVVGVLDTGVW  146

Query  433  PXSXSFDDSGMTAVP  477
            P S S+DD+G+  VP
Sbjct  147  PESKSYDDAGLGEVP  161



>dbj|BAJ86110.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------SEDSLLYTYTTAYHGFAAALGADE  252
            + TYIVHM     P+ +  H +WY A L+S          +LY Y T  HGF+A L   E
Sbjct  29   RATYIVHMAKSAMPAEYADHGEWYGASLRSVSAGGAPAAKMLYAYDTVLHGFSARLTEQE  88

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVW  432
               +  +E V+ V  ++ Y LHTTRTPEFLGL    GL    G+  A DV+VG+LDTGVW
Sbjct  89   ASDMAGMEGVLAVNPETRYELHTTRTPEFLGLAGNEGLFPQSGT--AGDVVVGVLDTGVW  146

Query  433  PXSXSFDDSGMTAVP  477
            P S S+DD+G+  VP
Sbjct  147  PESKSYDDAGLGEVP  161



>ref|XP_006841997.1| hypothetical protein AMTR_s00144p00078130 [Amborella trichopoda]
 gb|ERN03672.1| hypothetical protein AMTR_s00144p00078130 [Amborella trichopoda]
Length=753

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 88/143 (62%), Gaps = 13/143 (9%)
 Frame = +1

Query  67   CAATAAVAKKTYIVHMKHHEKPSSFQ-THRDWYAAHLQSSEDS--LLYTYTTAYHGFAAA  237
            C+ T  +  KT++VHM     P S+   H+ WY + ++S+  S  +LYTY T  HGFAA 
Sbjct  15   CSPT--LGHKTFLVHMAKSMMPESYNGDHQAWYMSIMKSAVQSTEILYTYDTVLHGFAAR  72

Query  238  LGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE---AADVIV  408
            L  +E E LR+    + VYE++VY LHTTRTPEFLGLD   GL      PE   A DVIV
Sbjct  73   LTDEEAELLRQRPEALSVYEEAVYQLHTTRTPEFLGLDGNNGLW-----PESDYATDVIV  127

Query  409  GILDTGVWPXSXSFDDSGMTAVP  477
            G+LDTG  P S S+ D+G+  VP
Sbjct  128  GVLDTGASPESKSYVDAGLGPVP  150



>ref|XP_010484513.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 86/150 (57%), Gaps = 9/150 (6%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            IL   LR  +++++    TYIVHM   + PSSF  H +WY + L+S  DS  LLYTY  A
Sbjct  15   ILCLGLRHVSSSSSSEHGTYIVHMAQSQMPSSFDLHSNWYDSSLRSISDSAELLYTYENA  74

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLD---AEFGLGAGHGSP  387
             HGFA  L  DE + L     V+ V  +  Y LHTTRTP FLGLD   A+     G  S 
Sbjct  75   IHGFATRLTQDEADSLMAQPGVLSVLPEHRYELHTTRTPLFLGLDDHNADLFPQTGASS-  133

Query  388  EAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
               DV+VG+LDTGVWP S S+ D G   VP
Sbjct  134  ---DVVVGVLDTGVWPESKSYSDEGFGPVP  160



>ref|XP_003547873.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=776

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 92/155 (59%), Gaps = 5/155 (3%)
 Frame = +1

Query  28   FSAITILLHLL---RPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--SEDS  192
            F ++ IL  LL     C+ +     KT+IV + H  KPS F TH+ WY + L S  +  S
Sbjct  4    FGSLVILPFLLIATVTCSTSEKENSKTFIVQVHHQTKPSIFPTHKHWYDSSLSSISTTAS  63

Query  193  LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGA  372
            +++TY T +HGF+A L   E ++L+ L  V+ +  + + SLHTTR+PEFLGL      G 
Sbjct  64   VIHTYDTVFHGFSAKLSPSEAQKLQSLGHVITLIPEQLRSLHTTRSPEFLGLTTADRTGL  123

Query  373  GHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             H +   +D+++G++DTG+WP   SF+D  +  VP
Sbjct  124  LHETDFGSDLVIGVIDTGIWPERQSFNDRDLGPVP  158



>ref|XP_010272631.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=785

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 91/146 (62%), Gaps = 17/146 (12%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPS-SFQTHRDWYAAHLQS-------SEDS---------LLYTYTTAY  219
            KKTYIVHM   E P+ SF  H DWYA+ L+S       +ED          ++Y+Y TA+
Sbjct  34   KKTYIVHMDKSEMPADSFADHLDWYASTLKSVVANPDSAEDDNTAGEAAQRMMYSYETAF  93

Query  220  HGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAAD  399
            HGFAA L  +E ER+     V+GV+ ++VY LHTTR+P FLGL+ E        +    D
Sbjct  94   HGFAARLSEEEAERMEEGLGVLGVFPETVYHLHTTRSPMFLGLETEDSTSVWSDALTDHD  153

Query  400  VIVGILDTGVWPXSXSFDDSGMTAVP  477
            VIVG+LDTG+WP S SF+D+GM+ VP
Sbjct  154  VIVGVLDTGIWPESPSFNDTGMSPVP  179



>ref|XP_004496643.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=780

 Score =   117 bits (293),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 58/154 (38%), Positives = 87/154 (56%), Gaps = 18/154 (12%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------------SEDSLLYTYT  210
            ++ A   KKTYI+ M    KP+ F  H++WY++ ++S             +E+ ++Y Y 
Sbjct  29   SSNAEFVKKTYIIQMDKSAKPNIFSNHKEWYSSKVKSVMSISLEAERDNNNEERIIYNYN  88

Query  211  TAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE  390
            TA+HG AA L   E  +L   + VV ++ D+ Y LHTTR+P FLGL+        +   +
Sbjct  89   TAFHGMAAKLSQKEANKLEDEDGVVAIFPDTKYQLHTTRSPSFLGLEPIIQSNNNNSLSQ  148

Query  391  AA-----DVIVGILDTGVWPXSXSFDDSGMTAVP  477
                   +VIVG+LDTG+WP S SF+D+GM  VP
Sbjct  149  NLVDNDQNVIVGVLDTGIWPESESFNDTGMKPVP  182



>ref|XP_010059854.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66296.1| hypothetical protein EUGRSUZ_F00121 [Eucalyptus grandis]
Length=765

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 90/155 (58%), Gaps = 12/155 (8%)
 Frame = +1

Query  34   AITILLHLLRPCAA--TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLY  201
            A  +LL L +  AA  T   AK TYI+HM     P++F  H +WY + L+S  D   +LY
Sbjct  9    AALVLLVLSQYGAAESTKKPAKSTYIIHMDKSNMPTTFAGHLEWYDSSLKSVSDGADMLY  68

Query  202  TYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHG  381
            TY +  HGF+  L A E E L +   ++ V  +  Y LHTTRTPEFLGL+    L     
Sbjct  69   TYNSVLHGFSVRLTAKEAELLEKQPGILSVLPEVRYELHTTRTPEFLGLEKNEAL-----  123

Query  382  SPE---AADVIVGILDTGVWPXSXSFDDSGMTAVP  477
             PE   A++VIV +LDTG WP   S+DD+G++ VP
Sbjct  124  YPESNLASEVIVAVLDTGAWPELKSYDDAGLSPVP  158



>ref|XP_008238402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            A  TYIVHM   E P+SF+ H  WY + L++  DS  ++Y Y+ A HGF+  L  ++ E 
Sbjct  37   ASTTYIVHMAKSEMPASFEHHTHWYDSSLKTVSDSAEMVYIYSNAIHGFSTKLTPEQAES  96

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXS  441
            L+    V+ V  +  Y LHTTRTPEFLGL           S   +DVI+G+LDTGVWP S
Sbjct  97   LQSQPGVLSVLPELKYELHTTRTPEFLGLGQTTETIPQSNS--ESDVIIGVLDTGVWPES  154

Query  442  XSFDDSGMTAVP  477
             SFDD+G+  VP
Sbjct  155  KSFDDTGLGPVP  166



>gb|KEH35793.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 78/131 (60%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K+TYI+HM     P+SF  H  WY + L+S  D+   +YTY    HGF+  L   E + L
Sbjct  22   KRTYIIHMDKFNMPASFDDHLQWYDSSLKSVSDTAETMYTYKHVAHGFSTRLTTQEADLL  81

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
             +   ++ V  D  Y LHTTRTPEFLGL+    L    G  + ++VIVG++DTGVWP   
Sbjct  82   TKQPGILSVIPDVRYELHTTRTPEFLGLEKTITLLPSSG--KQSEVIVGVIDTGVWPELK  139

Query  445  SFDDSGMTAVP  477
            SFDD+G+  VP
Sbjct  140  SFDDTGLGPVP  150



>dbj|BAJ88205.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=811

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------SEDSLLYTYTTAYHGFAAALGADE  252
            + TYIVHM     P+ +  H +WY A L+S          +LY Y T  HGF+A L   E
Sbjct  29   RATYIVHMAKSAMPAEYADHGEWYGASLRSVSAGGAPAAKMLYAYDTVLHGFSARLTEQE  88

Query  253  VERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVW  432
               +  +E V+ V  ++ Y LHTTRTPEFLGL    GL    G+  A DV+VG+LDTGVW
Sbjct  89   ASDMAGMEGVLAVNPETRYELHTTRTPEFLGLAGNEGLFPQSGT--AGDVVVGVLDTGVW  146

Query  433  PXSXSFDDSGMTAVP  477
            P S S+DD+G+  VP
Sbjct  147  PESKSYDDAGLGEVP  161



>emb|CDY57437.1| BnaAnng14520D [Brassica napus]
Length=760

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 84/147 (57%), Gaps = 2/147 (1%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            ++L+LL     +    + TYIVHM   + PSS+  H  WY + L+S  +S  LLYTY  A
Sbjct  16   LILYLLGSSQISDGAQQATYIVHMAKSQMPSSYDLHSLWYDSSLRSVSESAQLLYTYNNA  75

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGF+  L  +E + L     V+ V  +  Y LHTTR+P FLGLD          +  ++
Sbjct  76   IHGFSTRLTPEEADSLMTQPGVISVLPEHRYELHTTRSPLFLGLDEHNNADLFPQTGASS  135

Query  397  DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            DV+VG+LDTGVWP S SF D+G   VP
Sbjct  136  DVVVGVLDTGVWPESKSFSDNGFGPVP  162



>ref|XP_007047459.1| Subtilase family protein [Theobroma cacao]
 gb|EOX91616.1| Subtilase family protein [Theobroma cacao]
Length=760

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            +KTYIVHM   E P+SF  H  WY + L+S  DS  +LYTY    HGF+  L  +E ++L
Sbjct  30   RKTYIVHMAKSEMPASFLHHTHWYDSSLKSVSDSAQMLYTYDNVIHGFSTQLTNEEAQQL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
                 ++ V  +  Y LHTTRTP+FLGL     L     S  A++VIVG+LDTGVWP S 
Sbjct  90   ESQAGILAVLPELRYELHTTRTPQFLGLSKAADLFP--ESDSASEVIVGVLDTGVWPESK  147

Query  445  SFDDSGMTAVP  477
            SF D+G+  +P
Sbjct  148  SFADTGLGPIP  158



>ref|XP_002283279.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=765

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 78/131 (60%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K TYIVHM     P++F  H  WY + L+++  S  +LYTY    HGF+  L  +E E L
Sbjct  29   KNTYIVHMDKSNMPTTFDDHFQWYDSSLKTASSSADMLYTYNNVVHGFSTRLTTEEAELL  88

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
            R    ++ V  ++ Y LHTTRTPEFLGL           S  A++VIVG+LDTGVWP   
Sbjct  89   RGQLGILSVLPEARYELHTTRTPEFLGLGKSVAFLPQADS--ASEVIVGVLDTGVWPELK  146

Query  445  SFDDSGMTAVP  477
            SFDD+G+  VP
Sbjct  147  SFDDTGLGPVP  157



>ref|XP_006393933.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
 gb|ESQ31219.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
Length=758

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 81/137 (59%), Gaps = 15/137 (11%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYIVHM+  E PSSF  H  WY + L+S  +S  LLYTYT A HGF+  L  +E + L
Sbjct  30   QGTYIVHMEKSEMPSSFDLHSLWYDSSLRSVSESAELLYTYTNAIHGFSTRLTPEEADSL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGS---PE---AADVIVGILDTG  426
                 V+ V  +  Y LHTTRTP FLGLD        H +   PE   ++DV+VG+LDTG
Sbjct  90   MTQPGVISVLPEHRYELHTTRTPLFLGLDI-------HNADLFPETGASSDVVVGVLDTG  142

Query  427  VWPXSXSFDDSGMTAVP  477
            VWP S SF D G   +P
Sbjct  143  VWPESKSFSDEGFGPIP  159



>ref|XP_008444575.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=770

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 85/159 (53%), Gaps = 13/159 (8%)
 Frame = +1

Query  25   WFSAITILLHLLRPCAATAA------VAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE  186
            WF    + L     C+ T A      + KKTYI+HM     P +F  H  WY   L+S  
Sbjct  9    WF---LLFLISFSSCSFTEAQKSNQQLKKKTYIIHMDKTSMPQAFDDHFQWYDTSLKSVS  65

Query  187  DS--LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
            DS  +LY+Y    HGF+ +L  +E + + + E ++ V  +  Y LHTTRTPEFLGL    
Sbjct  66   DSAQMLYSYNNVIHGFSTSLTVEEAKLMEKQEGIIAVMPEMKYELHTTRTPEFLGLGKSA  125

Query  361  GLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                   S + ++VI+GILDTGVWP   SF D G+  +P
Sbjct  126  SFFP--ASAKVSEVIIGILDTGVWPELESFSDDGLGPIP  162



>dbj|BAJ99493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=764

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 81/135 (60%), Gaps = 11/135 (8%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED---SLLYTYTTAYHGFAAALGADEVER  261
            ++TYIVH  H   PS F  H DWYA+ LQS      +++YTY T  HG++A L   E   
Sbjct  33   RRTYIVHCSHAAMPSEFAAHADWYASSLQSVSGGAAAVIYTYDTLLHGYSARLTRAEARA  92

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPE---AADVIVGILDTGVW  432
            L     V+ V  ++ Y LHTTRTPEFLGLD    L      PE   A+DV+VG+LDTGVW
Sbjct  93   LEAQPGVLLVNPETRYELHTTRTPEFLGLDRAEAL-----FPESNTASDVVVGVLDTGVW  147

Query  433  PXSXSFDDSGMTAVP  477
            P   S+DD+G+  VP
Sbjct  148  PERASYDDAGLGPVP  162



>ref|XP_009803919.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=766

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 88/157 (56%), Gaps = 5/157 (3%)
 Frame = +1

Query  13   GSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED-  189
            G ++  + + +L H+           +KTYI+HM     P+ F  H  WY + L+S  + 
Sbjct  5    GVMILSTLVLVLFHVFVDAGQNQ---RKTYIIHMDKSNMPADFDDHTLWYDSSLKSVSEG  61

Query  190  -SLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGL  366
             +LLYTY    HG++  L ADE + L +   ++ V+E+  Y LHTTR+P FLGL+     
Sbjct  62   ANLLYTYNNVIHGYSTQLTADEAKSLEQQPGILSVHEEVRYELHTTRSPTFLGLEGRESK  121

Query  367  GAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                 +   +DV +G+LDTG+WP S SFDD+G+  VP
Sbjct  122  SFFLQAETRSDVTIGVLDTGIWPESKSFDDTGLGPVP  158



>ref|XP_003516516.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=775

 Score =   117 bits (292),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 61/136 (45%), Positives = 82/136 (60%), Gaps = 4/136 (3%)
 Frame = +1

Query  76   TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGAD  249
            +A   K TYIVH+   E PSSF  H  WY + L+S+ +S  +LYTY    HGF+  L  +
Sbjct  31   SAENPKGTYIVHLAKSEMPSSFNQHSIWYKSVLKSASNSAEMLYTYDNVIHGFSTRLTHE  90

Query  250  EVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGV  429
            E   LR    ++ V  + +Y  HTTRTP FLGLD    +     S E +D+I+G+LDTGV
Sbjct  91   EAWLLRSQAGILKVQPEKIYKPHTTRTPHFLGLDKIADMVP--ESNEGSDIIIGLLDTGV  148

Query  430  WPXSXSFDDSGMTAVP  477
            WP S SFDD+G+  +P
Sbjct  149  WPESKSFDDTGLGPIP  164



>ref|XP_006606084.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 87/148 (59%), Gaps = 12/148 (8%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----------SEDSLLYTYTTA  216
            +A A   KKTYI+ M    KP +F  H +WY++ ++S            E+ ++YTY TA
Sbjct  27   SANAEFVKKTYIIQMDKSAKPDTFTNHLNWYSSKVKSILSNSVEAEMDQEERIIYTYQTA  86

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
            +HG AA L  +E E+L   E VV ++ D+ Y LHTTR+P FLGL+             A 
Sbjct  87   FHGLAAMLSQEEAEKLEAEEGVVAIFPDTKYQLHTTRSPTFLGLEPTQSTNNMWSLKLAN  146

Query  397  -DVIVGILDTGVWPXSXSFDDSGMTAVP  477
             DVIVG+LDTGVWP S SF+D+GM  VP
Sbjct  147  HDVIVGVLDTGVWPESESFNDTGMRPVP  174



>ref|XP_009107228.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 87/159 (55%), Gaps = 11/159 (7%)
 Frame = +1

Query  28   FSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED------  189
            F  I + L+L+   A T    KKTY+VHM     PS +  H  WY++ + S  D      
Sbjct  11   FLFIILSLNLMSLHAETGQ--KKTYVVHMDKSAMPSPYTNHLQWYSSKIDSVTDPKSHEE  68

Query  190  ---SLLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF  360
                +LYTY TA+HG AA L  +E  RL     VV V  ++ Y LHTTR+P FLGL+ + 
Sbjct  69   EGNRILYTYQTAFHGLAARLSKEEAARLEEEPGVVAVIPETRYELHTTRSPRFLGLERQE  128

Query  361  GLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                        DV+VG+LDTG+WP S SF+D+GM+  P
Sbjct  129  SERVWAERVTDHDVVVGVLDTGIWPESESFNDTGMSPGP  167



>ref|XP_010464171.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=758

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 77/132 (58%), Gaps = 9/132 (7%)
 Frame = +1

Query  97   TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLRR  270
            TYIVHM   + PSSF  H +WY + L+S  DS  LLYTY  A HGFA  L  DE + L  
Sbjct  32   TYIVHMAQSQMPSSFDLHSNWYDSSLRSISDSAELLYTYENAIHGFATRLTQDEADSLMA  91

Query  271  LEAVVGVYEDSVYSLHTTRTPEFLGLD---AEFGLGAGHGSPEAADVIVGILDTGVWPXS  441
               V+ V  +  Y LHTTRTP FLGLD   A+     G     + DV+VG+LDTGVWP S
Sbjct  92   QPGVLSVLPEHRYELHTTRTPLFLGLDDHNADLFPQTG----ASTDVVVGVLDTGVWPES  147

Query  442  XSFDDSGMTAVP  477
             S+ D G   VP
Sbjct  148  KSYSDEGFGPVP  159



>ref|XP_010906269.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=764

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 81/140 (58%), Gaps = 10/140 (7%)
 Frame = +1

Query  73   ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  246
            A A   ++TYIVHM     P++F  H  WY A L+S  DS  +LY+Y T  HGF+  L  
Sbjct  21   AAAEEKRRTYIVHMAKSRMPATFTDHGHWYHASLRSVSDSAEILYSYDTVSHGFSTRLTP  80

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---ADVIVGIL  417
             E   L   E V+ V  +  Y LHTTRTP FLGLD   GL      P+A   +DV+VG+L
Sbjct  81   AEAATLESREGVLSVLPEVRYELHTTRTPMFLGLDESHGL-----FPQADTGSDVVVGLL  135

Query  418  DTGVWPXSXSFDDSGMTAVP  477
            DTGVWP   SFDD+G   VP
Sbjct  136  DTGVWPERKSFDDTGFGPVP  155



>gb|EYU44466.1| hypothetical protein MIMGU_mgv1a0020561mg, partial [Erythranthe 
guttata]
Length=293

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 84/147 (57%), Gaps = 15/147 (10%)
 Frame = +1

Query  67   CAATAAVA-----KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHG  225
            C  +AA A     + TYIVHM   E P  +  H  WY + L+S   S  +LYTYT   HG
Sbjct  25   CHVSAAAAVEEERRGTYIVHMAKSEMPERYDDHTHWYESSLRSVSGSAEMLYTYTNVVHG  84

Query  226  FAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA---A  396
            F+  L  +E   +     ++ V  ++ Y LHTTRTP FLGLD    +      PE+   +
Sbjct  85   FSTRLTPEEARVMETRPGILSVLPETKYELHTTRTPTFLGLDQNAAM-----FPESDSMS  139

Query  397  DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            +VIVG+LDTGVWP S SFDD+G+ +VP
Sbjct  140  EVIVGVLDTGVWPESPSFDDAGLGSVP  166



>ref|XP_011072681.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=792

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 88/161 (55%), Gaps = 14/161 (9%)
 Frame = +1

Query  37   ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---------SED  189
            + I L +  P     A  +KT+I+H++H  KPS F TH  WY + L+S         S D
Sbjct  16   LVISLLIFSPSPTQEAEQRKTFIIHVQHDAKPSIFPTHNHWYESSLRSLSTVSVNAASPD  75

Query  190  S-----LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDA  354
            S     ++++Y   +HGF+A L A E ++L  L  ++ V  + V  +HTTR+PEFLGL  
Sbjct  76   SADASRIIHSYNNVFHGFSAKLSASEAQKLESLSGIIAVIPEQVRQVHTTRSPEFLGLKT  135

Query  355  EFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                G    S   +D+++G++DTG+WP   SF+D  +   P
Sbjct  136  GDNAGLLKESDFGSDLVIGVIDTGIWPERESFNDRNLGPAP  176



>ref|XP_004501532.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=777

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 79/131 (60%), Gaps = 4/131 (3%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            K+TYI+HM     P+SF  H  WY + L+S  +S  +LYTY    HGF+  L   E E L
Sbjct  41   KRTYIIHMDKFNMPTSFNDHLQWYDSSLKSVSESAEMLYTYKHVAHGFSTRLTTQEAELL  100

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSX  444
             +   ++ V  +  Y LHTTRTPEFLGL+    L   +G  + ++VIVG++DTGVWP   
Sbjct  101  TKQPGILSVIPEVRYELHTTRTPEFLGLEKTTTLLVSYG--KQSEVIVGVIDTGVWPELK  158

Query  445  SFDDSGMTAVP  477
            SFDD+ +  VP
Sbjct  159  SFDDTKLGPVP  169



>emb|CAA59963.1| subtilisin-like protease [Arabidopsis thaliana]
Length=746

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 86/150 (57%), Gaps = 10/150 (7%)
 Frame = +1

Query  46   LLHLLRPC-AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            LL  L  C  ++++  + TYIVHM   + PSSF  H +WY + L+S  DS  LLYTY  A
Sbjct  4    LLLCLGFCHVSSSSSDQGTYIVHMAKSQTPSSFDLHSNWYDSSLRSISDSAELLYTYENA  63

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEA-  393
             HGF+  L  +E + L     V+ V  +  Y LHTTRTP FLGLD           PEA 
Sbjct  64   IHGFSTRLTQEEADSLMTQPGVISVLPEHRYELHTTRTPLFLGLDEH----TADLFPEAG  119

Query  394  --ADVIVGILDTGVWPXSXSFDDSGMTAVP  477
              +DV+VG+LDTGVWP S S+ D G   +P
Sbjct  120  SYSDVVVGVLDTGVWPESKSYSDEGFGPIP  149



>ref|XP_009112375.1| PREDICTED: subtilisin-like protease isoform X2 [Brassica rapa]
Length=758

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 80/132 (61%), Gaps = 5/132 (4%)
 Frame = +1

Query  91   KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  264
            + TYIVHM   + PSSF  H  WY + L+S+ +S  +LYTY  A HGFA  L  +E + L
Sbjct  30   QSTYIVHMAKSQMPSSFDQHSLWYESSLKSASESAEMLYTYNNAIHGFATRLTPEEADSL  89

Query  265  RRLEAVVGVYEDSVYSLHTTRTPEFLGLDA-EFGLGAGHGSPEAADVIVGILDTGVWPXS  441
                 V+ V  +  Y LHTTRTP FLGL+    GL    G+  A+DV++G+LD+GVWP S
Sbjct  90   MVQPGVISVQSEQQYELHTTRTPLFLGLEVHNAGLFPETGA--ASDVVIGVLDSGVWPES  147

Query  442  XSFDDSGMTAVP  477
             SF D G   +P
Sbjct  148  KSFSDEGYGPIP  159



>emb|CDX97560.1| BnaA05g25190D [Brassica napus]
Length=770

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 0/127 (0%)
 Frame = +1

Query  97   TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERLRRLE  276
            TYIVH+ H  KPS F THR WY + L S+  S+++TY T +HGF+A L A E  +L    
Sbjct  25   TYIVHVDHEAKPSIFPTHRHWYTSSLTSTSSSIIHTYDTVFHGFSARLTAQEATQLLNHP  84

Query  277  AVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXSXSFDD  456
             V+ V  + V  LHTTR+PEFLGL +    G    S   +D+++G++DTG+WP   SFDD
Sbjct  85   HVISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDLVIGVIDTGIWPERPSFDD  144

Query  457  SGMTAVP  477
             G+  VP
Sbjct  145  RGLGPVP  151



>emb|CDY12840.1| BnaC07g15930D [Brassica napus]
Length=760

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 82/147 (56%), Gaps = 2/147 (1%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
             +L+LL     +    + TYIVHM   + PSS+  H  WY + L+S  +S  LLYTY  A
Sbjct  15   FILYLLGSSQVSDGAQQATYIVHMAKSQMPSSYDLHSLWYDSSLRSVSESAQLLYTYNNA  74

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGF+  L  +E + L     V+ V  +  Y LHTTR+P FLGLD          +  ++
Sbjct  75   IHGFSTRLTPEEADSLMTQPGVISVLPEHRYELHTTRSPLFLGLDEHNNADLFPQTGASS  134

Query  397  DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            DV+VG+LDTGVWP S SF D G   VP
Sbjct  135  DVVVGVLDTGVWPESKSFSDKGFGPVP  161



>ref|XP_007208070.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
 gb|EMJ09269.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
Length=777

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 79/132 (60%), Gaps = 4/132 (3%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  261
            A  TYIVHM   E P+SF+ H  WY + L++  DS  ++Y Y+ A HGF+  L   + E 
Sbjct  38   ASTTYIVHMAKSEMPASFEHHTHWYDSSLKTVSDSAEMMYIYSNAIHGFSTKLTPAQAES  97

Query  262  LRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVGILDTGVWPXS  441
            L+    V+ V  +  Y LHTTRTPEFLGL           S   +DVI+G+LDTGVWP S
Sbjct  98   LQSQPGVLSVLPELKYELHTTRTPEFLGLGQTTETIPQSNS--ESDVIIGVLDTGVWPES  155

Query  442  XSFDDSGMTAVP  477
             SFDD+G+  VP
Sbjct  156  KSFDDTGLGPVP  167



>emb|CDY63300.1| BnaCnng41800D [Brassica napus]
Length=716

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 84/147 (57%), Gaps = 3/147 (2%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            I+   L  C  +    + TYIVHM   + PSSF  H  WY + L+S  +S  ++YTY  A
Sbjct  14   IVFLYLGSCHVSHGAQQATYIVHMAKSQMPSSFDHHSLWYDSSLRSVSESAEMIYTYNNA  73

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGFA  L  +E + L     V+ V ++  Y LHTTRTP FLGLD   G G    +  ++
Sbjct  74   IHGFATRLTPEEADSLMTQPGVISVRQEQRYELHTTRTPLFLGLDVHNG-GLFPETSTSS  132

Query  397  DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            ++++G+LDTG+WP S SF D G   +P
Sbjct  133  NLVIGVLDTGIWPESKSFSDEGYGPIP  159



>ref|XP_006653695.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=744

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 90/160 (56%), Gaps = 12/160 (8%)
 Frame = +1

Query  34   AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-------  192
            A++++  LL+   +  A   KTYI+ M   E PSSF  + +WYA+ ++S   S       
Sbjct  12   ALSLVAVLLQASFSACAPTPKTYIIQMAASEMPSSFDFYHEWYASTMKSVSSSQLEDEED  71

Query  193  -----LLYTYTTAYHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAE  357
                 ++Y Y TA++GFAA L  +E E +   + V+ V  ++V  LHTTR+P+FLG+  E
Sbjct  72   DASTRIIYNYETAFNGFAARLDDEEAELMAEADGVLAVTPETVLQLHTTRSPDFLGIGPE  131

Query  358  FGLGAGHGSPEAADVIVGILDTGVWPXSXSFDDSGMTAVP  477
                    S    DVIVG+LDTG+WP S SF D G+  VP
Sbjct  132  VSNRIWSASLADHDVIVGVLDTGIWPESPSFSDKGLGPVP  171



>gb|EYU36342.1| hypothetical protein MIMGU_mgv1a001789mg [Erythranthe guttata]
Length=759

 Score =   115 bits (289),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 8/142 (6%)
 Frame = +1

Query  70   AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------SEDSLLYTYTTAYHGFA  231
            A   +  + TYIVHM     P +F +H  WY++ L S      SE  ++YTY  A+HGF+
Sbjct  19   AGDVSAERSTYIVHMDKSSMPKAFSSHHHWYSSMLTSAKSLDESESKIIYTYDNAFHGFS  78

Query  232  AALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAADVIVG  411
              +   E+E L++L   +  +ED V +  TT + +FL L+   GL     S    DVI+G
Sbjct  79   VVMNKQELEALKKLPGFLSAFEDGVVTADTTHSYKFLSLNTASGLWP--ASNYGKDVIIG  136

Query  412  ILDTGVWPXSXSFDDSGMTAVP  477
            ILDTG+WP S SF D GMTA+P
Sbjct  137  ILDTGIWPESPSFRDEGMTAIP  158



>emb|CDY63302.1| BnaCnng41810D [Brassica napus]
Length=748

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 86/148 (58%), Gaps = 5/148 (3%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            I+L  L    A+    + TYIVHM   + PSSF  H  WY + L+S  +S  ++YTY  A
Sbjct  13   IVLLNLSSFHASDGAQQATYIVHMAKSQMPSSFDHHSLWYDSSLRSVSESAEMIYTYNNA  72

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEF-GLGAGHGSPEA  393
             HGFA  L   E + L     V+ V ++  Y LHTTRTP FLGLD +  GL    G+  +
Sbjct  73   IHGFATRLTPGEADSLMTQPGVISVQQEQKYELHTTRTPLFLGLDGQNAGLFPETGA--S  130

Query  394  ADVIVGILDTGVWPXSXSFDDSGMTAVP  477
            +D+++G+LDTG+WP S SF D G   +P
Sbjct  131  SDIVIGVLDTGIWPESKSFSDEGYGPIP  158



>emb|CDY63219.1| BnaAnng18730D [Brassica napus]
Length=743

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 82/147 (56%), Gaps = 2/147 (1%)
 Frame = +1

Query  43   ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  216
            I+L  L  C  +    + TYIVHM   + PSSF  H  WY + L+S  +S  LLYTY +A
Sbjct  14   IVLLYLGACHISDGAQQSTYIVHMAKSQMPSSFDQHSLWYESSLRSVSESAELLYTYNSA  73

Query  217  YHGFAAALGADEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLGAGHGSPEAA  396
             HGF+  L  +E + L     V+ V  +  Y L TTRTP FLGLD          +  ++
Sbjct  74   IHGFSTRLTPEEADSLMTHPGVISVLPEKRYELDTTRTPHFLGLDVHNAGLFPETTGASS  133

Query  397  DVIVGILDTGVWPXSXSFDDSGMTAVP  477
            D++VG+ D+GVWP S SFDD G   +P
Sbjct  134  DIVVGVFDSGVWPESKSFDDEGYGPIP  160



>ref|XP_003558354.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=792

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 82/139 (59%), Gaps = 13/139 (9%)
 Frame = +1

Query  88   AKKTYIVHMKHHEKPSSFQTHRDWYA-AHLQSSEDS------LLYTYTTAYHGFAAALGA  246
            AKKTYI  + H  KPS F TH  WY+ A   S  D+       L+ Y T +HGF+A++ A
Sbjct  37   AKKTYIFRVDHRAKPSVFPTHAHWYSSAAFASGADADGPLLEPLHVYDTVFHGFSASVSA  96

Query  247  DEVERLRRLEAVVGVYEDSVYSLHTTRTPEFLGLDAEFGLG--AGHGSPEAADVIVGILD  420
               + LRR  AV+  +ED V  LHTTR+P+F+GL A  GL   A +GS    DVIVG+LD
Sbjct  97   PRADALRRHPAVLAAFEDRVRPLHTTRSPQFMGLRARLGLWSLADYGS----DVIVGVLD  152

Query  421  TGVWPXSXSFDDSGMTAVP  477
            TGVWP   S  D  +  VP
Sbjct  153  TGVWPERRSLSDRNLPPVP  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567171140730