BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002N22

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001275144.1|  cystathionine gamma-synthase isoform 2             164   4e-44   Solanum tuberosum [potatoes]
ref|XP_009775846.1|  PREDICTED: cystathionine gamma-synthase, chl...    161   3e-43   Nicotiana sylvestris
ref|XP_009775845.1|  PREDICTED: cystathionine gamma-synthase, chl...    161   3e-43   Nicotiana sylvestris
gb|AHM22940.1|  cystathionine gamma synthase                            161   3e-43   Nicotiana tabacum [American tobacco]
gb|AJF83863.1|  cystathionine gamma synthase 1                          160   6e-43   Nicotiana tabacum [American tobacco]
ref|XP_009602123.1|  PREDICTED: cystathionine gamma-synthase, chl...    160   9e-43   Nicotiana tomentosiformis
ref|XP_009602125.1|  PREDICTED: cystathionine gamma-synthase, chl...    160   9e-43   Nicotiana tomentosiformis
ref|NP_001234489.1|  cystathionine gamma synthase                       154   9e-41   Solanum lycopersicum
gb|AAF74981.1|AF082891_1  cystathionine gamma-synthase isoform 1        150   5e-39   Solanum tuberosum [potatoes]
ref|NP_001274915.1|  cystathionine-gamma-synthase                       148   3e-38   
ref|XP_009797245.1|  PREDICTED: cystathionine gamma-synthase, chl...    147   3e-38   Nicotiana sylvestris
gb|AGT40329.1|  cystathionine gamma synthase                            147   4e-38   Nicotiana attenuata
ref|XP_009592901.1|  PREDICTED: cystathionine gamma-synthase, chl...    145   3e-37   Nicotiana tomentosiformis
gb|AHL84163.1|  cystathionine gamma synthase                            144   5e-37   Nicotiana tabacum [American tobacco]
dbj|BAP47509.1|  cystathionine gamma-synthase                           144   5e-37   Gentiana triflora
ref|XP_009628949.1|  PREDICTED: cystathionine gamma-synthase, chl...    142   1e-36   Nicotiana tomentosiformis
emb|CDP02254.1|  unnamed protein product                                139   2e-35   Coffea canephora [robusta coffee]
ref|XP_011085742.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...    137   1e-34   Sesamum indicum [beniseed]
ref|XP_011098654.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...    136   3e-34   Sesamum indicum [beniseed]
gb|EYU44131.1|  hypothetical protein MIMGU_mgv1a002982mg                135   1e-33   Erythranthe guttata [common monkey flower]
gb|EYU34642.1|  hypothetical protein MIMGU_mgv1a004543mg                129   6e-32   Erythranthe guttata [common monkey flower]
ref|XP_010258325.1|  PREDICTED: cystathionine gamma-synthase, chl...    124   5e-30   Nelumbo nucifera [Indian lotus]
gb|EPS60325.1|  cystathionine gamma-synthase isoform 2                  114   5e-28   Genlisea aurea
gb|KHG00425.1|  Cystathionine gamma-synthase, chloroplastic -like...    119   5e-28   Gossypium arboreum [tree cotton]
ref|XP_006858075.1|  hypothetical protein AMTR_s00062p00067400          118   1e-27   Amborella trichopoda
gb|KJB75685.1|  hypothetical protein B456_012G052100                    115   4e-27   Gossypium raimondii
gb|KJB75688.1|  hypothetical protein B456_012G052100                    115   5e-27   Gossypium raimondii
gb|KJB75686.1|  hypothetical protein B456_012G052100                    115   8e-27   Gossypium raimondii
gb|KJB75684.1|  hypothetical protein B456_012G052100                    115   1e-26   Gossypium raimondii
gb|KJB75687.1|  hypothetical protein B456_012G052100                    115   1e-26   Gossypium raimondii
ref|XP_010670238.1|  PREDICTED: cystathionine gamma-synthase, chl...    114   2e-26   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX74285.1|  BnaA03g27620D                                          110   9e-25   
ref|XP_006373333.1|  hypothetical protein POPTR_0017s12240g             108   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_011035793.1|  PREDICTED: cystathionine gamma-synthase, chl...    108   4e-24   Populus euphratica
ref|XP_009134628.1|  PREDICTED: cystathionine gamma-synthase, chl...    108   4e-24   Brassica rapa
emb|CDP21668.1|  unnamed protein product                                100   1e-23   Coffea canephora [robusta coffee]
gb|KJB11074.1|  hypothetical protein B456_001G240000                    105   2e-23   Gossypium raimondii
gb|KHG14739.1|  Cystathionine gamma-synthase, chloroplastic -like...    106   2e-23   Gossypium arboreum [tree cotton]
ref|XP_006373334.1|  hypothetical protein POPTR_0017s12240g             104   4e-23   
gb|KJB11075.1|  hypothetical protein B456_001G240000                    105   5e-23   Gossypium raimondii
gb|AGA60137.1|  cystathionine gamma-synthase                            103   2e-22   Lens culinaris
ref|XP_002323872.1|  cystathionine gamma synthase family protein        103   2e-22   
ref|NP_001266947.1|  cystathionine gamma-synthase, chloroplastic-...    102   5e-22   Fragaria vesca [alpine strawberry]
ref|XP_006297283.1|  hypothetical protein CARUB_v10013298mg             101   1e-21   
ref|XP_010029311.1|  PREDICTED: cystathionine gamma-synthase, chl...    101   2e-21   Eucalyptus grandis [rose gum]
gb|KCW56210.1|  hypothetical protein EUGRSUZ_I01959                     101   2e-21   Eucalyptus grandis [rose gum]
ref|XP_010550033.1|  PREDICTED: cystathionine gamma-synthase, chl...    100   4e-21   Tarenaya hassleriana [spider flower]
dbj|BAH57133.1|  AT3G01120                                            98.2    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408463.1|  hypothetical protein EUTSA_v10020394mg           99.8    6e-21   Eutrema salsugineum [saltwater cress]
ref|XP_007139535.1|  hypothetical protein PHAVU_008G038100g           99.4    7e-21   Phaseolus vulgaris [French bean]
ref|XP_008353494.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...  95.9    1e-20   
ref|XP_006431204.1|  hypothetical protein CICLE_v10011434mg           95.9    1e-19   Citrus clementina [clementine]
ref|XP_002882199.1|  hypothetical protein ARALYDRAFT_477417           95.5    2e-19   
ref|XP_010463584.1|  PREDICTED: cystathionine gamma-synthase, chl...  95.5    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010429549.1|  PREDICTED: cystathionine gamma-synthase, chl...  95.1    2e-19   Camelina sativa [gold-of-pleasure]
gb|KJB11080.1|  hypothetical protein B456_001G240300                  94.0    3e-19   Gossypium raimondii
gb|KDO72621.1|  hypothetical protein CISIN_1g0091672mg                93.2    3e-19   Citrus sinensis [apfelsine]
ref|XP_008802567.1|  PREDICTED: cystathionine gamma-synthase, chl...  93.2    3e-19   Phoenix dactylifera
gb|KDO72627.1|  hypothetical protein CISIN_1g0091672mg                92.8    4e-19   Citrus sinensis [apfelsine]
ref|XP_008341762.1|  PREDICTED: cystathionine gamma-synthase, chl...  92.8    5e-19   
gb|KDO72628.1|  hypothetical protein CISIN_1g0091672mg                92.4    6e-19   Citrus sinensis [apfelsine]
emb|CAA64383.1|  cystathionine gamma-synthase                         94.0    6e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13883.1|  putative cystathionine gamma-synthase                 94.0    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006431203.1|  hypothetical protein CICLE_v10011434mg           93.6    7e-19   
ref|NP_186761.1|  cystathionine gamma-synthase                        94.0    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802566.1|  PREDICTED: cystathionine gamma-synthase, chl...  92.4    7e-19   Phoenix dactylifera
gb|KJB11079.1|  hypothetical protein B456_001G240300                  93.6    8e-19   Gossypium raimondii
emb|CBI22246.3|  unnamed protein product                              93.2    9e-19   Vitis vinifera
ref|XP_006482629.1|  PREDICTED: cystathionine gamma-synthase, chl...  93.2    1e-18   Citrus sinensis [apfelsine]
gb|AAC19395.1|  cystathionine gamma-synthase                          92.8    2e-18   Mesembryanthemum crystallinum
ref|XP_008368433.1|  PREDICTED: cystathionine gamma-synthase, chl...  92.4    2e-18   
ref|XP_007032603.1|  Pyridoxal phosphate-dependent transferases s...  92.4    2e-18   
ref|XP_007032602.1|  Pyridoxal phosphate-dependent transferases s...  92.4    2e-18   
ref|XP_010485423.1|  PREDICTED: cystathionine gamma-synthase, chl...  92.0    2e-18   Camelina sativa [gold-of-pleasure]
ref|NP_001265950.1|  cystathionine gamma-synthase, chloroplastic-...  92.0    2e-18   Cicer arietinum [garbanzo]
ref|XP_009360603.1|  PREDICTED: cystathionine gamma-synthase, chl...  91.7    3e-18   Pyrus x bretschneideri [bai li]
gb|AGF95115.1|  cystathionine gamma synthase                          88.6    4e-18   Prunus persica
gb|AAC49574.1|  similar to the metB gene product of Escherichia c...  90.9    7e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KDP27172.1|  hypothetical protein JCGZ_19871                       90.5    8e-18   Jatropha curcas
gb|AAC25687.1|  cystathionine gamma-synthase precursor                90.5    9e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003621273.1|  Cystathionine gamma-synthase                     87.0    3e-17   
ref|XP_010939832.1|  PREDICTED: cystathionine gamma-synthase, chl...  89.0    3e-17   Elaeis guineensis
ref|XP_002283866.1|  PREDICTED: cystathionine gamma-synthase, chl...  87.4    1e-16   Vitis vinifera
ref|XP_008230796.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...  86.7    2e-16   
ref|XP_003621272.1|  Cystathionine gamma-synthase                     86.3    3e-16   Medicago truncatula
gb|ABI34092.1|  cystathionine gamma-synthase                          86.3    3e-16   Medicago sativa [alfalfa]
ref|XP_007216002.1|  hypothetical protein PRUPE_ppa004232mg           85.5    4e-16   Prunus persica
emb|CDY37543.1|  BnaA05g34080D                                        84.0    1e-15   Brassica napus [oilseed rape]
ref|NP_001237572.1|  cystathionine-gamma-synthase precursor           83.6    2e-15   
ref|XP_003552541.1|  PREDICTED: cystathionine gamma-synthase, chl...  83.6    2e-15   
ref|XP_010937207.1|  PREDICTED: cystathionine gamma-synthase, chl...  82.4    5e-15   Elaeis guineensis
ref|XP_009404092.1|  PREDICTED: cystathionine gamma-synthase, chl...  82.4    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16369.1|  unknown                                               82.4    5e-15   Picea sitchensis
ref|XP_010937206.1|  PREDICTED: cystathionine gamma-synthase, chl...  82.4    6e-15   Elaeis guineensis
emb|CDY43269.1|  BnaC05g48620D                                        81.6    9e-15   Brassica napus [oilseed rape]
dbj|BAE78434.1|  cystathionine gamma-synthase precursor               76.6    2e-14   Aegilops tauschii
ref|XP_009409044.1|  PREDICTED: cystathionine gamma-synthase, chl...  79.0    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009772869.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...  78.2    1e-13   Nicotiana sylvestris
ref|XP_009147397.1|  PREDICTED: cystathionine gamma-synthase, chl...  78.2    2e-13   Brassica rapa
gb|EMT23437.1|  Cystathionine gamma-synthase, chloroplastic           77.4    3e-13   
ref|XP_004136690.1|  PREDICTED: cystathionine gamma-synthase, chl...  75.9    9e-13   Cucumis sativus [cucumbers]
ref|XP_004984247.1|  PREDICTED: cystathionine gamma-synthase, chl...  75.5    1e-12   Setaria italica
ref|XP_004159653.1|  PREDICTED: cystathionine gamma-synthase, chl...  74.7    1e-12   
gb|AAS50161.1|  chloroplast cystathionine-gamma-synthase              70.1    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AFW87953.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...  74.3    2e-12   
gb|AAB61348.1|  cystathionine gamma-synthase                          74.7    2e-12   Zea mays [maize]
ref|NP_001104875.1|  cystathionine gamma-synthase1                    74.7    2e-12   
dbj|BAE78433.1|  cystathionine gamma-synthase precursor               70.9    3e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001130426.1|  uncharacterized protein LOC100191523             73.9    4e-12   Zea mays [maize]
dbj|BAJ84799.1|  predicted protein                                    73.9    4e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003557832.1|  PREDICTED: cystathionine gamma-synthase, chl...  73.9    4e-12   
ref|XP_001772529.1|  predicted protein                                68.2    4e-10   
ref|XP_008443381.1|  PREDICTED: cystathionine gamma-synthase, chl...  67.8    5e-10   Cucumis melo [Oriental melon]
ref|XP_002983120.1|  hypothetical protein SELMODRAFT_155550           65.1    3e-09   
ref|XP_002965872.1|  hypothetical protein SELMODRAFT_143363           64.7    4e-09   
ref|XP_001761633.1|  predicted protein                                63.9    9e-09   
gb|ABF96221.1|  Cys/Met metabolism PLP-dependent enzyme family pr...  61.2    7e-08   Oryza sativa Japonica Group [Japonica rice]
gb|AAL82522.1|AC084766_8  putative cystathionine gamma synthase       60.1    1e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDX90997.1|  BnaC02g06000D                                        60.1    2e-07   
gb|AAF64422.1|AF206626_1  cystathionine-gamma synthase                55.5    2e-07   Cucumis melo [Oriental melon]
ref|XP_007024261.1|  Uncharacterized protein TCM_028849               55.1    1e-06   
ref|XP_010453667.1|  PREDICTED: cystathionine gamma-synthase, chl...  48.9    7e-04   



>ref|NP_001275144.1| cystathionine gamma-synthase isoform 2 [Solanum tuberosum]
 gb|AAF74982.1|AF082892_1 cystathionine gamma-synthase isoform 2 [Solanum tuberosum]
Length=540

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 114/165 (69%), Gaps = 8/165 (5%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLR----PNSLSQGSRGYGLSSLILRF  222
            MA+ S +  FPSF+CRSDPDFSG VPRH+ P AG+R      SLS+GS  +G+SSLILRF
Sbjct  1    MAVPSSARAFPSFQCRSDPDFSGGVPRHDLPNAGVRFSVKVKSLSRGSSVHGMSSLILRF  60

Query  223  PPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevssp  402
            PPNFVRQLS+KARRNCSNIG+AQ+VAASWSNN A+            A  A S       
Sbjct  61   PPNFVRQLSVKARRNCSNIGLAQVVAASWSNNHASPDF----TPAAKAVDAASIAPFDIT  116

Query  403  vaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
              +EE  +V++   +D NVQI+DL    Y+SFLSS GS+A+HAGE
Sbjct  117  TGDEEGAVVEDSPRADRNVQIEDLTDVKYSSFLSSDGSIAIHAGE  161



>ref|XP_009775846.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Nicotiana sylvestris]
Length=502

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SSC+  FPSFECRSD +FSG +PRH+ P +G + + LS GS  +GLSSLI RFPPNF
Sbjct  1    MAVSSCARAFPSFECRSDAEFSGGIPRHDIPNSG-KASILSHGSSVHGLSSLIYRFPPNF  59

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspvaee  414
            VRQLSIKARRNCSNIGVAQ+VAASWSNN ++    P AKA+DAAAAA   P  ++ V E+
Sbjct  60   VRQLSIKARRNCSNIGVAQVVAASWSNNNSSPDFTPVAKAVDAAAAAAIAPVDTTVVNED  119

Query  415  evvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
              ++ +N +C+D NVQ   L    YASFL+S GSVA+HAGE
Sbjct  120  VALV-ENETCNDQNVQFDSLPSMKYASFLNSDGSVAIHAGE  159



>ref|XP_009775845.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Nicotiana sylvestris]
Length=538

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SSC+  FPSFECRSD +FSG +PRH+ P +G + + LS GS  +GLSSLI RFPPNF
Sbjct  1    MAVSSCARAFPSFECRSDAEFSGGIPRHDIPNSG-KASILSHGSSVHGLSSLIYRFPPNF  59

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspvaee  414
            VRQLSIKARRNCSNIGVAQ+VAASWSNN ++    P AKA+DAAAAA   P  ++ V E+
Sbjct  60   VRQLSIKARRNCSNIGVAQVVAASWSNNNSSPDFTPVAKAVDAAAAAAIAPVDTTVVNED  119

Query  415  evvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
              ++ +N +C+D NVQ   L    YASFL+S GSVA+HAGE
Sbjct  120  VALV-ENETCNDQNVQFDSLPSMKYASFLNSDGSVAIHAGE  159



>gb|AHM22940.1| cystathionine gamma synthase [Nicotiana tabacum]
Length=540

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 123/162 (76%), Gaps = 2/162 (1%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SSC+  FPSFECRSD +FSG +PRH+ P +G + + LS GS  +GLSSLI RFPPNF
Sbjct  1    MAVSSCARAFPSFECRSDAEFSGGIPRHDIPNSG-KASILSHGSSVHGLSSLIYRFPPNF  59

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe-vsspvae  411
            VRQLSIKARRNCSNIGVAQ+VAASWSNN ++    P AKA+DAAAAA +    V + V  
Sbjct  60   VRQLSIKARRNCSNIGVAQVVAASWSNNNSSPDFTPVAKAVDAAAAAAAAIAPVDTTVVN  119

Query  412  eevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            E+V LV+N +C+D NVQ   L    YASFL+S GSVA+HAGE
Sbjct  120  EDVALVENETCNDQNVQFDSLPSMKYASFLNSDGSVAIHAGE  161



>gb|AJF83863.1| cystathionine gamma synthase 1 [Nicotiana tabacum]
Length=537

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 116/161 (72%), Gaps = 3/161 (2%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SSC+  FPSFECRSD +FSG +PRH+ P +G + + LS GS  +GLSSLI RFPPNF
Sbjct  1    MAVSSCARAFPSFECRSDAEFSGGIPRHDIPNSG-KASILSHGSSIHGLSSLIYRFPPNF  59

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspvaee  414
            VRQLSIKARRNCSNIGVAQ+VAASWSNN ++        A    AAA S   V + V  +
Sbjct  60   VRQLSIKARRNCSNIGVAQVVAASWSNNNSSPDF--TPVAKAVDAAAASIAPVDTTVVND  117

Query  415  evvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            +V LV+N +C+D NVQ   L    YASFL+S GSVA+HAGE
Sbjct  118  DVALVENETCNDQNVQFDSLPSVRYASFLNSDGSVAIHAGE  158



>ref|XP_009602123.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Nicotiana tomentosiformis]
Length=601

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 116/161 (72%), Gaps = 3/161 (2%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SSC+  FPSFECRSD +FSG +PRH+ P +G + + LS GS  +GLSSLI RFPPNF
Sbjct  65   MAVSSCARAFPSFECRSDAEFSGGIPRHDIPNSG-KASILSHGSSIHGLSSLIYRFPPNF  123

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspvaee  414
            VRQLSIKARRNCSNIGVAQ+VAASWSNN ++        A    AAA S   V + V  +
Sbjct  124  VRQLSIKARRNCSNIGVAQVVAASWSNNNSSPDF--TPVAKAVDAAAASIAPVDTTVVND  181

Query  415  evvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            +V LV+N +C+D NVQ   L    YASFL+S GSVA+HAGE
Sbjct  182  DVALVENETCNDQNVQFDSLPSVRYASFLNSDGSVAIHAGE  222



>ref|XP_009602125.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Nicotiana tomentosiformis]
Length=565

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 116/161 (72%), Gaps = 3/161 (2%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SSC+  FPSFECRSD +FSG +PRH+ P +G + + LS GS  +GLSSLI RFPPNF
Sbjct  65   MAVSSCARAFPSFECRSDAEFSGGIPRHDIPNSG-KASILSHGSSIHGLSSLIYRFPPNF  123

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspvaee  414
            VRQLSIKARRNCSNIGVAQ+VAASWSNN ++        A    AAA S   V + V  +
Sbjct  124  VRQLSIKARRNCSNIGVAQVVAASWSNNNSSPDF--TPVAKAVDAAAASIAPVDTTVVND  181

Query  415  evvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            +V LV+N +C+D NVQ   L    YASFL+S GSVA+HAGE
Sbjct  182  DVALVENETCNDQNVQFDSLPSVRYASFLNSDGSVAIHAGE  222



>ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycopersicum]
 gb|AAR92031.1| cystathionine gamma synthase [Solanum lycopersicum]
Length=540

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 117/165 (71%), Gaps = 8/165 (5%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLR----PNSLSQGSRGYGLSSLILRF  222
            MA+SS +  FPSFECRS+PDFSG +P    P AG+R     NS S  S+ YGLSSLI RF
Sbjct  1    MAVSSYARAFPSFECRSEPDFSGSLPH---PKAGVRFSGKYNSGSNRSQVYGLSSLIYRF  57

Query  223  PPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevssp  402
            PPNFVRQLSIKARRNCSNIGVAQ+VAASWSNN+A     PAA A+D++A+A       + 
Sbjct  58   PPNFVRQLSIKARRNCSNIGVAQVVAASWSNNQAGPEFTPAANAVDSSASAAVTSIGITT  117

Query  403  vaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
              EE  V+ +N  CSD NVQI+      YASFL+S GSVA+HAGE
Sbjct  118  GDEEVAVV-ENADCSDQNVQIKGSTGVKYASFLNSDGSVAIHAGE  161



>gb|AAF74981.1|AF082891_1 cystathionine gamma-synthase isoform 1 [Solanum tuberosum]
Length=539

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 116/165 (70%), Gaps = 9/165 (5%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLR----PNSLSQGSRGYGLSSLILRF  222
            MA+SS +  FPSFECRS+PDFSG +P    P AG+R     NS S  S+ YGLSSLI RF
Sbjct  1    MAVSSYARAFPSFECRSEPDFSGSLPH---PKAGVRFSGKYNSGSNRSQVYGLSSLIFRF  57

Query  223  PPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevssp  402
            PPNFVRQLSIKARRNCSNIGVAQ+VAASWSNN+A     PAA A+D++A+A       + 
Sbjct  58   PPNFVRQLSIKARRNCSNIGVAQVVAASWSNNQAGPEFTPAANAVDSSASAAVTSIGITA  117

Query  403  vaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
              EE  V+ +N  C+D NVQI       YASFL+S GSVA+HAGE
Sbjct  118  GDEEVAVV-ENADCNDQNVQITGTG-VKYASFLNSDGSVAIHAGE  160



>ref|NP_001274915.1| cystathionine-gamma-synthase [Solanum tuberosum]
 gb|AAD31520.2|AF144102_1 cystathionine-gamma-synthase [Solanum tuberosum]
Length=583

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 115/165 (70%), Gaps = 9/165 (5%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRP----NSLSQGSRGYGLSSLILRF  222
            MA+SS +  FPSFECRS+PDFSG +P    P AG+R     NS S  S+ YGLSSLI RF
Sbjct  1    MAVSSYARAFPSFECRSEPDFSGSLPH---PKAGVRLSGKYNSRSNRSQVYGLSSLIFRF  57

Query  223  PPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevssp  402
            PPNFVRQLSIKARRNCSNIGVAQ+VAASWSNN+A     PAA A+D++A+A       + 
Sbjct  58   PPNFVRQLSIKARRNCSNIGVAQVVAASWSNNQAGPEFTPAANAVDSSASAAVTSIGITA  117

Query  403  vaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
              EE  V+ +N  C+D N QI       YASFL+S GSVA+HAGE
Sbjct  118  GDEEVAVV-ENADCNDQNEQITGTG-VKYASFLNSDGSVAIHAGE  160



>ref|XP_009797245.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana 
sylvestris]
Length=552

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 117/173 (68%), Gaps = 12/173 (7%)
 Frame = +1

Query  55   MAISSCSTV---FPSFECRSDPDF-SGRVPRH-ECP--GAGLR----PNSLSQGSRGYG-  198
            MA+SSC+     FPSFECRSD DF +G VPRH + P   +G+R     NSL+ GS  +G 
Sbjct  1    MAVSSCAAAARAFPSFECRSDADFFAGGVPRHNDVPKNSSGVRFSGKANSLNHGSSIHGG  60

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaai  378
            +SSLILRFPPNFVRQLS+KARRNCSNIGVAQ+VAASWSNN  +    PAA     A+AA 
Sbjct  61   MSSLILRFPPNFVRQLSVKARRNCSNIGVAQVVAASWSNNLGSPDFTPAAAKAVDASAAA  120

Query  379  sppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            +            +V  +N +C D NVQI+++    Y+SFLSS GS+A+HAGE
Sbjct  121  AAAVAPVDEEVTVMVENENPACDDRNVQIEEVTRGKYSSFLSSDGSIAIHAGE  173



>gb|AGT40329.1| cystathionine gamma synthase [Nicotiana attenuata]
Length=553

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 121/174 (70%), Gaps = 13/174 (7%)
 Frame = +1

Query  55   MAISSCSTV---FPSFECRSDPDFS-GRVPRH-ECP--GAGLR----PNSLSQGSRGYG-  198
            MA+SSC+     FPSFECRSD DFS G VPRH + P   +G+R     NSL+ GS  +G 
Sbjct  1    MAVSSCAAAARAFPSFECRSDADFSAGGVPRHNDVPKNSSGVRFSGKANSLNHGSSIHGG  60

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIp-paakaldaaaaa  375
            +SSLILRFPPNFVRQLS+KARRNCSNIGVAQ+VAASWSNN+ +      AAKA+DA+AAA
Sbjct  61   MSSLILRFPPNFVRQLSVKARRNCSNIGVAQVVAASWSNNRGSPDFTPAAAKAVDASAAA  120

Query  376  isppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             +            V   +N +C D NVQI++L    Y+SFLSS GS+A+HAGE
Sbjct  121  AAAAVAPVDEEVTVVAENENPACDDRNVQIEELTRGKYSSFLSSDGSIAIHAGE  174



>ref|XP_009592901.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=553

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 122/174 (70%), Gaps = 13/174 (7%)
 Frame = +1

Query  55   MAISSCSTV---FPSFECRSDPDFS-GRVPRH-ECP--GAGLR----PNSLSQGSRGYG-  198
            MA+SSC+     FPSFECRSD DFS G VPRH + P   +G+R     NSL+ GS  +G 
Sbjct  1    MAVSSCAAAARAFPSFECRSDADFSAGGVPRHNDVPKNSSGVRFSGKANSLNHGSSIHGG  60

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIp-paakaldaaaaa  375
            +SSLILRFPPNFVRQLS+KARRNCSNIGVAQ+VAASWSNN+ +      AAKA+DA+AAA
Sbjct  61   MSSLILRFPPNFVRQLSVKARRNCSNIGVAQVVAASWSNNRGSPDFTPAAAKAVDASAAA  120

Query  376  isppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             +            VV  +N +C D NVQI++L    Y+SFLSS GS+A+HAGE
Sbjct  121  AAAVAPVDEEEVTVVVENENPACDDRNVQIEELTRGKYSSFLSSDGSIAIHAGE  174



>gb|AHL84163.1| cystathionine gamma synthase [Nicotiana tabacum]
Length=527

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 107/166 (64%), Gaps = 23/166 (14%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLR----PNSLSQGSRGYGLSSLILRF  222
            MA+SS + V PSFECRSDPDFSG +P    P AG+R     +S+S  S+ +GLSSLI RF
Sbjct  1    MAVSSFARVIPSFECRSDPDFSGSLPP---PKAGVRFPGKASSVSHPSQVHGLSSLIFRF  57

Query  223  PPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevssp  402
            PPNFVRQLSIKARRNCSNIGVAQ+VAASWSNN A                    P  ++ 
Sbjct  58   PPNFVRQLSIKARRNCSNIGVAQVVAASWSNNHAGPDF---------------TPAANAV  102

Query  403  vaeeevvlvDNGSCSDPNVQIQDLAHAN-YASFLSSXGSVAVHAGE  537
             +     LV+N + +D  VQI+     N YASFL+S GSVA+HAGE
Sbjct  103  DSSAVAPLVENAAFNDETVQIEGFTGVNKYASFLNSDGSVAIHAGE  148



>dbj|BAP47509.1| cystathionine gamma-synthase [Gentiana triflora]
Length=553

 Score =   144 bits (363),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 97/175 (55%), Positives = 114/175 (65%), Gaps = 15/175 (9%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGS---RGYGLS----SLI  213
            MA+SSC+ V PSF+CRSDPDF+G +P+ E P +G    S S+GS   RG  LS    SLI
Sbjct  1    MAVSSCARVLPSFQCRSDPDFAGSLPKSEIPISGSDRFS-SKGSFVGRGLTLSCLQSSLI  59

Query  214  LRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKA---ASGIppaakaldaaaaaisp  384
            LRFPPNFVRQLS KARRNCSNIGVAQIVAASWSN+K     S     A    AA + I+P
Sbjct  60   LRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNDKLPDYTSASAAKAVDAAAAGSVIAP  119

Query  385  pevsspvaeeevvlvD----NGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             EV + V     V  D    +G   D NVQ+ DLA   Y+SFL S GS+A+HAGE
Sbjct  120  VEVPTGVEVPTGVEADPVVKSGGVVDGNVQLDDLAATKYSSFLKSDGSIAIHAGE  174



>ref|XP_009628949.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=527

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 107/166 (64%), Gaps = 23/166 (14%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLR----PNSLSQGSRGYGLSSLILRF  222
            MA+SS + V PSF+CRSDPDFSG +P    P AG+R     +S+S  S+ +GLSSLI RF
Sbjct  1    MAVSSFARVIPSFDCRSDPDFSGSLPP---PKAGVRFPGKASSVSHPSQVHGLSSLIFRF  57

Query  223  PPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevssp  402
            PPNFVRQLSIKARRNCSNIGVAQ+VAASWSNN A                    P  ++ 
Sbjct  58   PPNFVRQLSIKARRNCSNIGVAQVVAASWSNNHAGPDF---------------TPAANAV  102

Query  403  vaeeevvlvDNGSCSDPNVQIQDLAHAN-YASFLSSXGSVAVHAGE  537
             +     LV+N + +D  VQI+     N YASFL+S GSVA+HAGE
Sbjct  103  DSSAVAPLVENAAFNDETVQIEGFTGVNKYASFLNSDGSVAIHAGE  148



>emb|CDP02254.1| unnamed protein product [Coffea canephora]
Length=552

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 108/172 (63%), Gaps = 11/172 (6%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGL-----RPNSLSQG-SRGYGLSSLIL  216
            MA+S C++ F  FECRSDPDFSGR PR E P +G      + NS++QG   G   SSLI 
Sbjct  1    MAVSGCASAFRPFECRSDPDFSGRFPRPEFPTSGAARFSAKANSVTQGFPVGSLSSSLIF  60

Query  217  RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNK-----AASGIppaakaldaaaaais  381
            RFPPNFVRQLS KARRNCSNIGVAQIVAASWSNN+     + +    A  A  +A+    
Sbjct  61   RFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNNQQGGSTSPTPAAKAVDAAASASVVAP  120

Query  382  ppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                +  V E+    V++G     NVQ  DL  A Y+SFL+  GSVA+HAGE
Sbjct  121  VEFETGVVEEKVAAAVESGFSDGVNVQPDDLVDAKYSSFLTCDGSVAIHAGE  172



>ref|XP_011085742.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase 
1, chloroplastic-like [Sesamum indicum]
Length=543

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 106/169 (63%), Gaps = 13/169 (8%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECP--GAGLRPNSLSQGSRGYGLSSLILRFPP  228
            MA SSC+  FPSFE RSDPDFS    R E P  G G + NS    +  +GLSSLI +FPP
Sbjct  1    MAASSCARAFPSFEARSDPDFS----RPEIPSTGCGRKANSPVLRT-AHGLSSLIFKFPP  55

Query  229  NFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIp------paakaldaaaaaisppe  390
            NFVRQLS KARRNCSNIGVAQ+VAASWSNN+AASG         AA A     AA     
Sbjct  56   NFVRQLSTKARRNCSNIGVAQVVAASWSNNQAASGFTPAASAVDAAGAAFPVRAAAPAAV  115

Query  391  vsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                V    V + ++ SC+  NV+++      YASFLSS GSVA+HAGE
Sbjct  116  APVEVETGLVEVAEDASCNAENVKLEGSPSLEYASFLSSDGSVAIHAGE  164



>ref|XP_011098654.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase 
1, chloroplastic [Sesamum indicum]
Length=532

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 105/165 (64%), Gaps = 16/165 (10%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGY----GLSSLILRF  222
            MA+SS +  FPSFECRSD DFS    R E P  G    S S   RGY     LSSLI RF
Sbjct  1    MAVSSFAKAFPSFECRSDADFS----RPEIPFVGYSGKSKSATFRGYTGVHALSSLIFRF  56

Query  223  PPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevssp  402
            PPNFVRQLS+KARRNCSNIGVAQ+VAASWSNN+ A+ +        + A A++P EV + 
Sbjct  57   PPNFVRQLSVKARRNCSNIGVAQVVAASWSNNQXANPL--------SVAPAVAPVEVDTG  108

Query  403  vaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
              E      ++ S    NVQ++ L    YASFL+S GSVA+HAGE
Sbjct  109  FQEVVPPAAEDPSLDGENVQLEGLPPFKYASFLNSDGSVAIHAGE  153



>gb|EYU44131.1| hypothetical protein MIMGU_mgv1a002982mg [Erythranthe guttata]
Length=619

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 116/169 (69%), Gaps = 13/169 (8%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECP----GAGLRPNS----LSQGSRGYGLSSL  210
            MA+SS +  FPSFECRSDPDFS    R E P    G G    S    L  G+  +GLSSL
Sbjct  77   MAVSSFARAFPSFECRSDPDFS----RPEIPPAGCGGGFSGKSQSAILRGGAAAHGLSSL  132

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe  390
            ILRFPPNFVRQLS KARRNCSNIGVAQ+VAASWSNN+ ASG  PAAKA+DAA AA++P E
Sbjct  133  ILRFPPNFVRQLSNKARRNCSNIGVAQVVAASWSNNQGASGSTPAAKAVDAALAAVAPVE  192

Query  391  vsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            + + V +      D    ++ NVQ + L    YASFL+S GSVA+HAGE
Sbjct  193  IETGVDDVVPAAEDPSPNAE-NVQPEGLPPFKYASFLNSDGSVAIHAGE  240



>gb|EYU34642.1| hypothetical protein MIMGU_mgv1a004543mg [Erythranthe guttata]
Length=521

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 99/167 (59%), Gaps = 31/167 (19%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECP--GAGLRPNSLSQGSR----GYGLSSLIL  216
            MA+SSC+  F SFECRSDPDFS    R E P  G G    + S G R      GLSSLI 
Sbjct  1    MAVSSCARAFSSFECRSDPDFS----RPEIPSAGCGFSVKAKSPGPRCSVAARGLSSLIF  56

Query  217  RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevs  396
            +FPPNFVRQLS KARRNCSNIGVAQ+VAASWS N+A         A++AA   I      
Sbjct  57   KFPPNFVRQLSNKARRNCSNIGVAQVVAASWSENQATPAAKAVDAAVEAAEEII------  110

Query  397  spvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                           C+  NVQ+    ++NYASFLSS GS+A+HAGE
Sbjct  111  ---------------CNADNVQLNGSPYSNYASFLSSDGSIAIHAGE  142



>ref|XP_010258325.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Nelumbo 
nucifera]
Length=535

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 103/174 (59%), Gaps = 32/174 (18%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGY-------------  195
            MA+SSC+ V PSFECRSDPDFSG  PR + P  G    S S  ++ +             
Sbjct  1    MAVSSCARVIPSFECRSDPDFSGN-PRSDKPSFG----SFSGKAKSFPIRGLAGASCGSA  55

Query  196  GLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaa  375
            GLSSLI +FPPNFVRQLSIKARRNCSNIGVAQ+VAASWSN  A+               A
Sbjct  56   GLSSLIFKFPPNFVRQLSIKARRNCSNIGVAQVVAASWSNQPAS-------------VPA  102

Query  376  isppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             S    ++P  +    +VD   C++ +VQ   L  +  ASFL S G+VAVHAGE
Sbjct  103  TSTAVNATPAVDVAAAVVDGDCCNNTDVQFSGLVDSK-ASFLCSDGTVAVHAGE  155



>gb|EPS60325.1| cystathionine gamma-synthase isoform 2, partial [Genlisea aurea]
Length=190

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 98/156 (63%), Gaps = 1/156 (1%)
 Frame = +1

Query  73   STVFPSFECRSDPDFSGRVPRHECPG-AGLRPNSLSQGSRGYGLSSLILRFPPNFVRQLS  249
            ++V  SFECRSDP+F       +C G +G   +++  G    GLSS IL+FPPNFVRQLS
Sbjct  2    ASVIASFECRSDPEFCRSEIPPKCGGFSGRSGSAVLGGGMSRGLSSRILKFPPNFVRQLS  61

Query  250  IKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspvaeeevvlv  429
            IKARRNCSNIGVAQ+VAASWSNN  A G    A A+DAA+AA S P       E   V  
Sbjct  62   IKARRNCSNIGVAQVVAASWSNNLGAPGSASMANAVDAASAASSAPVEIEAGVEVGAVEA  121

Query  430  DNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             +   +  NVQ QD    NY S L + GS+A+HAGE
Sbjct  122  QDPRLNGENVQRQDPNPLNYISSLKTDGSIAIHAGE  157



>gb|KHG00425.1| Cystathionine gamma-synthase, chloroplastic -like protein [Gossypium 
arboreum]
Length=539

 Score =   119 bits (297),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 84/169 (50%), Positives = 104/169 (62%), Gaps = 18/169 (11%)
 Frame = +1

Query  55   MAISSCSTV------FPSFECRSDPDFSGRVPRHECP--GAGLRPNSLSQGSRGYGLSSL  210
            MA+SSCS +      + SFECRSDPDFSG  P  E P  G+  R  +    + G GLSSL
Sbjct  1    MAVSSCSFLPRVFNSYSSFECRSDPDFSG-TPTGEKPRIGSNRRVTASLFCTGGGGLSSL  59

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe  390
            I RFPPNFVRQLS+KARRNCSNIGVAQ+VAASWSN   +           ++AAA +   
Sbjct  60   IFRFPPNFVRQLSVKARRNCSNIGVAQVVAASWSNGPTS--------LYPSSAAAAASQA  111

Query  391  vsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             +  V   + V V  G   + +VQI D ++ +  SFLSS GS+ VHAGE
Sbjct  112  AAPSVPVSDDVAVVEGCIDNDSVQIGD-SYDSKTSFLSSDGSITVHAGE  159



>ref|XP_006858075.1| hypothetical protein AMTR_s00062p00067400 [Amborella trichopoda]
 gb|ERN19542.1| hypothetical protein AMTR_s00062p00067400 [Amborella trichopoda]
Length=520

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 94/169 (56%), Gaps = 36/169 (21%)
 Frame = +1

Query  55   MAISSCST------VFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLIL  216
            MA+SSCS       +FPSFECRSDPDF+G     +    G      S    G+   SLIL
Sbjct  1    MAVSSCSILGGCPRIFPSFECRSDPDFTGHFQSEKQKTRGF-----SGQIHGFSGQSLIL  55

Query  217  RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevs  396
            RFPPNFVRQLSIKARRNCSNIGVAQ+VAASWSN   AS                      
Sbjct  56   RFPPNFVRQLSIKARRNCSNIGVAQVVAASWSNGPIAS----------------------  93

Query  397  spvaeeevvlvDNGSCSDPNVQI--QDLAHANYASFLSSXGSVAVHAGE  537
               A   V  V + SC++ N ++   +   +N  SFLSS GS+AVHAGE
Sbjct  94   EEKAIGVVAPVIDSSCNNNNTEVVQSEFTDSN-DSFLSSDGSLAVHAGE  141



>gb|KJB75685.1| hypothetical protein B456_012G052100 [Gossypium raimondii]
Length=427

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 102/169 (60%), Gaps = 18/169 (11%)
 Frame = +1

Query  55   MAISSCS------TVFPSFECRSDPDFSGRVPRHECP--GAGLRPNSLSQGSRGYGLSSL  210
            MA+SSCS        + SFECRSDPDFSG  P  E P  G+  R  +    + G GLSSL
Sbjct  1    MAVSSCSFPPRVFNAYSSFECRSDPDFSG-TPAGEKPRIGSNRRVTASLFCTGGGGLSSL  59

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe  390
            I RFPPNFVRQLS+KARRNCSNIGVAQ+VAASWSN    SG P +A A    AAA S P 
Sbjct  60   IFRFPPNFVRQLSVKARRNCSNIGVAQVVAASWSNG-PTSGYPSSAAAAACQAAAASVPV  118

Query  391  vsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                           G   + +VQI D ++ +  SFLSS GS+ VHAGE
Sbjct  119  SDGVAVV-------EGCIDNDSVQIGD-SYDSKTSFLSSDGSITVHAGE  159



>gb|KJB75688.1| hypothetical protein B456_012G052100 [Gossypium raimondii]
Length=399

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 102/169 (60%), Gaps = 18/169 (11%)
 Frame = +1

Query  55   MAISSCS------TVFPSFECRSDPDFSGRVPRHECP--GAGLRPNSLSQGSRGYGLSSL  210
            MA+SSCS        + SFECRSDPDFSG  P  E P  G+  R  +    + G GLSSL
Sbjct  1    MAVSSCSFPPRVFNAYSSFECRSDPDFSG-TPAGEKPRIGSNRRVTASLFCTGGGGLSSL  59

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe  390
            I RFPPNFVRQLS+KARRNCSNIGVAQ+VAASWSN    SG P +A A    AAA S P 
Sbjct  60   IFRFPPNFVRQLSVKARRNCSNIGVAQVVAASWSNGP-TSGYPSSAAAAACQAAAASVPV  118

Query  391  vsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                           G   + +VQI D ++ +  SFLSS GS+ VHAGE
Sbjct  119  SDGVAVV-------EGCIDNDSVQIGD-SYDSKTSFLSSDGSITVHAGE  159



>gb|KJB75686.1| hypothetical protein B456_012G052100 [Gossypium raimondii]
Length=468

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 104/169 (62%), Gaps = 18/169 (11%)
 Frame = +1

Query  55   MAISSCS------TVFPSFECRSDPDFSGRVPRHECP--GAGLRPNSLSQGSRGYGLSSL  210
            MA+SSCS        + SFECRSDPDFSG  P  E P  G+  R  +    + G GLSSL
Sbjct  1    MAVSSCSFPPRVFNAYSSFECRSDPDFSG-TPAGEKPRIGSNRRVTASLFCTGGGGLSSL  59

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe  390
            I RFPPNFVRQLS+KARRNCSNIGVAQ+VAASWSN   +           ++AAA +   
Sbjct  60   IFRFPPNFVRQLSVKARRNCSNIGVAQVVAASWSNGPTSG--------YPSSAAAAACQA  111

Query  391  vsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             ++ V   + V V  G   + +VQI D ++ +  SFLSS GS+ VHAGE
Sbjct  112  AAASVPVSDGVAVVEGCIDNDSVQIGD-SYDSKTSFLSSDGSITVHAGE  159



>gb|KJB75684.1| hypothetical protein B456_012G052100 [Gossypium raimondii]
Length=539

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 102/169 (60%), Gaps = 18/169 (11%)
 Frame = +1

Query  55   MAISSCS------TVFPSFECRSDPDFSGRVPRHECP--GAGLRPNSLSQGSRGYGLSSL  210
            MA+SSCS        + SFECRSDPDFSG  P  E P  G+  R  +    + G GLSSL
Sbjct  1    MAVSSCSFPPRVFNAYSSFECRSDPDFSG-TPAGEKPRIGSNRRVTASLFCTGGGGLSSL  59

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe  390
            I RFPPNFVRQLS+KARRNCSNIGVAQ+VAASWSN    SG P +A A    AAA S P 
Sbjct  60   IFRFPPNFVRQLSVKARRNCSNIGVAQVVAASWSNG-PTSGYPSSAAAAACQAAAASVPV  118

Query  391  vsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                           G   + +VQI D ++ +  SFLSS GS+ VHAGE
Sbjct  119  SDGVAVV-------EGCIDNDSVQIGD-SYDSKTSFLSSDGSITVHAGE  159



>gb|KJB75687.1| hypothetical protein B456_012G052100 [Gossypium raimondii]
Length=519

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 104/169 (62%), Gaps = 18/169 (11%)
 Frame = +1

Query  55   MAISSCS------TVFPSFECRSDPDFSGRVPRHECP--GAGLRPNSLSQGSRGYGLSSL  210
            MA+SSCS        + SFECRSDPDFSG  P  E P  G+  R  +    + G GLSSL
Sbjct  1    MAVSSCSFPPRVFNAYSSFECRSDPDFSG-TPAGEKPRIGSNRRVTASLFCTGGGGLSSL  59

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe  390
            I RFPPNFVRQLS+KARRNCSNIGVAQ+VAASWSN   +           ++AAA +   
Sbjct  60   IFRFPPNFVRQLSVKARRNCSNIGVAQVVAASWSNGPTSG--------YPSSAAAAACQA  111

Query  391  vsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             ++ V   + V V  G   + +VQI D ++ +  SFLSS GS+ VHAGE
Sbjct  112  AAASVPVSDGVAVVEGCIDNDSVQIGD-SYDSKTSFLSSDGSITVHAGE  159



>ref|XP_010670238.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=543

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 9/98 (9%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYG--------LSSL  210
            MA+SSC+ VFP FECR++P+FS  + + E P +G R +S +  S   G        LSSL
Sbjct  1    MAVSSCARVFPPFECRAEPEFSANL-KPEIPSSGARKSSRTSFSSTGGTSLCGARSLSSL  59

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKA  324
            ILRFPPNFVRQLS KARRNCSNIGVAQ+VAASWSNN A
Sbjct  60   ILRFPPNFVRQLSTKARRNCSNIGVAQVVAASWSNNIA  97



>emb|CDX74285.1| BnaA03g27620D [Brassica napus]
Length=544

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 106/173 (61%), Gaps = 20/173 (12%)
 Frame = +1

Query  55   MAISS--CSTVF--PSFECRSDPDF-----SGRVPRHECPGAGLRPNSLSQGSRGYGLSS  207
            MA+SS  C T+F  PSF+CRSDPD       G   R   P AG+ P+  + G R   +SS
Sbjct  1    MAVSSFQCPTIFSIPSFQCRSDPDLVGSPIGGSSRRRFNPTAGM-PSPFTGGGR---MSS  56

Query  208  LILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAAS---GIppaakaldaaaaai  378
            +ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN A+        A+ A  AA+A  
Sbjct  57   MILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNNPASELPPAAAAASSASAAASAPA  116

Query  379  sppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            +     +    +E V+   G     +VQ++D    +  SFLSS GS+AVHAGE
Sbjct  117  AAVPPVALNGADEEVVAAEGIREIGSVQLKD----SKPSFLSSDGSLAVHAGE  165



>ref|XP_006373333.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa]
 gb|ERP51130.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa]
Length=548

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 101/174 (58%), Gaps = 21/174 (12%)
 Frame = +1

Query  55   MAISSCST----VFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSR----GYGLSSL  210
            MA+SSC      V  SFECRSD   S   P         R NS   G+     G G+SSL
Sbjct  1    MAVSSCPCPKLFVASSFECRSDSSSSADQPSQG------RSNSARHGTTPFLSGAGMSSL  54

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe  390
            IL+FPPNFVRQLS KARRNCSNIGVAQIVAASWSNN AA     AA A  AAAA+  P  
Sbjct  55   ILKFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNNSAAGAPSAAAAAAAAAAASAIPAA  114

Query  391  vsspvaeeevv----lvDNGSCSDPNVQIQDL-AHANYASFLSSXGSVAVHAGE  537
              +       V      DN + S   VQ++DL +   Y SFLSS GS+AVHAGE
Sbjct  115  EPAKTLAGNEVVGIDSSDNKNVS--VVQLEDLSSDLEYKSFLSSDGSIAVHAGE  166



>ref|XP_011035793.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Populus 
euphratica]
Length=543

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 102/170 (60%), Gaps = 18/170 (11%)
 Frame = +1

Query  55   MAISSCST----VFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSR----GYGLSSL  210
            MA+SSC      V  SFECRSD   S   P         R NS   G+     G G+SSL
Sbjct  1    MAVSSCPCPKLFVASSFECRSDSSSSADQPSQG------RSNSARHGTTPFLSGAGMSSL  54

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe  390
            IL+FPPNFVRQLS KARRNCSNIGVAQIVAASWSNN AA     AA A  A+A   + P 
Sbjct  55   ILKFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNNSAAGAPSAAAAAAAASAIPAAEPA  114

Query  391  vsspvaeee-vvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             +    E   +   DN + S   VQ++DL+ ++  SFLSS GS+AVHAGE
Sbjct  115  ETLAGNEVAGIDSSDNKNVS--VVQLEDLS-SDLKSFLSSDGSIAVHAGE  161



>ref|XP_009134628.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Brassica 
rapa]
Length=545

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 107/174 (61%), Gaps = 21/174 (12%)
 Frame = +1

Query  55   MAISS--CSTVF--PSFECRSDPDF-----SGRVPRHECPGAGLRPNSLSQGSRGYGLSS  207
            MA+SS  C T+F  PSF+CRSDPD       G   R   P AG+ P+  + G R   +SS
Sbjct  1    MAVSSFQCPTIFSIPSFQCRSDPDLVGSPIGGSSRRRFNPTAGM-PSPFTGGGR---MSS  56

Query  208  LILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaispp  387
            +ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN  +   P AA A  +A+AA S P
Sbjct  57   MILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNNPDSGSPPAAAAAASSASAAASAP  116

Query  388  evsspvaeeevvlvD----NGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
              + P      V  +     G     +VQ++D    +  SFLSS GS+AVHAGE
Sbjct  117  AAAIPPVALNGVDEEVVAAEGIREIGSVQLKD----SKPSFLSSDGSLAVHAGE  166



>emb|CDP21668.1| unnamed protein product [Coffea canephora]
Length=103

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 66/95 (69%), Gaps = 6/95 (6%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGL-----RPNSLSQG-SRGYGLSSLIL  216
            MA+ SC+     FECRS PDFSGR+PR E P  G      + NS++QG S G    SLI 
Sbjct  1    MAVPSCAIACRPFECRSGPDFSGRLPRPEFPTFGAARFSAKANSVTQGFSAGSLFYSLIS  60

Query  217  RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNK  321
            RFP NF RQ S KARRNCSNIG+AQIVAASWS+N+
Sbjct  61   RFPLNFGRQRSTKARRNCSNIGIAQIVAASWSDNQ  95



>gb|KJB11074.1| hypothetical protein B456_001G240000 [Gossypium raimondii]
Length=433

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 96/173 (55%), Gaps = 20/173 (12%)
 Frame = +1

Query  55   MAISSCSTV--------FPSFECRSDPDFS----GRVPRHECPGAGLRPNSLSQGSRGYG  198
            MA+SSCS          + SFECR DPDFS    G  PR          +  + G    G
Sbjct  1    MAVSSCSFTLSPRAFNPYSSFECRPDPDFSSAPIGDKPRLASSRRVTASSLYAGGISSRG  60

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaai  378
            LSSLI RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSN  A     P A A  A AAA 
Sbjct  61   LSSLIFRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNGPAPD--SPLAAAASAQAAAA  118

Query  379  sppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            +     +         +DNGS     VQI   +  +  +FLSS GS+ VHAGE
Sbjct  119  AVTATVTNDGAAVEGCIDNGS-----VQIGG-SDNSTTTFLSSDGSITVHAGE  165



>gb|KHG14739.1| Cystathionine gamma-synthase, chloroplastic -like protein [Gossypium 
arboreum]
Length=547

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 98/174 (56%), Gaps = 19/174 (11%)
 Frame = +1

Query  55   MAISSCSTV--------FPSFECRSDPDFS----GRVPRHECPGAGLRPNSLSQGSRGYG  198
            MA+SSCS          + SFECR DPDFS    G  PR          +  + G    G
Sbjct  1    MAVSSCSFTLSPRVFNPYSSFECRPDPDFSSAPIGDKPRLASSRRVTASSLYAGGISSRG  60

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAA-SGIppaakaldaaaaa  375
            LSSLI RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSN  A  S    AA +  AAAAA
Sbjct  61   LSSLIFRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNGPAPDSPSLAAAASAQAAAAA  120

Query  376  isppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             +     +         +DNGS     VQI   +  +  +FLSS GS+ VHAGE
Sbjct  121  AAVTVTVTNDGAAVESCIDNGS-----VQIGG-SDNSTTTFLSSDGSITVHAGE  168



>ref|XP_006373334.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa]
 gb|ERP51131.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa]
Length=431

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 95/170 (56%), Gaps = 29/170 (17%)
 Frame = +1

Query  55   MAISSCST----VFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSR----GYGLSSL  210
            MA+SSC      V  SFECRSD   S   P         R NS   G+     G G+SSL
Sbjct  1    MAVSSCPCPKLFVASSFECRSDSSSSADQPSQG------RSNSARHGTTPFLSGAGMSSL  54

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe  390
            IL+FPPNFVRQLS KARRNCSNIGVAQIVAASWSNN AA     AA A  AAAA+  P  
Sbjct  55   ILKFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNNSAAGAPSAAAAAAAAAAASAIPAA  114

Query  391  vsspvaeeevvlvDNGSCSDPNVQIQDL-AHANYASFLSSXGSVAVHAGE  537
              +                    +++DL +   Y SFLSS GS+AVHAGE
Sbjct  115  EPAKTLAGN--------------ELEDLSSDLEYKSFLSSDGSIAVHAGE  150



>gb|KJB11075.1| hypothetical protein B456_001G240000 [Gossypium raimondii]
Length=544

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 96/173 (55%), Gaps = 20/173 (12%)
 Frame = +1

Query  55   MAISSCSTV--------FPSFECRSDPDFS----GRVPRHECPGAGLRPNSLSQGSRGYG  198
            MA+SSCS          + SFECR DPDFS    G  PR          +  + G    G
Sbjct  1    MAVSSCSFTLSPRAFNPYSSFECRPDPDFSSAPIGDKPRLASSRRVTASSLYAGGISSRG  60

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaai  378
            LSSLI RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSN  A     P A A  A AAA 
Sbjct  61   LSSLIFRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNGPAPD--SPLAAAASAQAAAA  118

Query  379  sppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            +     +         +DNGS     VQI   +  +  +FLSS GS+ VHAGE
Sbjct  119  AVTATVTNDGAAVEGCIDNGS-----VQIGG-SDNSTTTFLSSDGSITVHAGE  165



>gb|AGA60137.1| cystathionine gamma-synthase [Lens culinaris]
Length=535

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 66/100 (66%), Gaps = 17/100 (17%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSG--------RVPRHECPGAGLRPNSLSQGSRGYGLSSL  210
            MA+SS   VF +FECRSDPDF+           PRH  P AGL        +  YG+SS 
Sbjct  1    MAVSSLHRVF-TFECRSDPDFASLPSTENLRSTPRH-FPAAGL-------SAAFYGVSSP  51

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAAS  330
            ILRFPPNF RQLS KARRNCSNIGVAQIVAASWSN  A S
Sbjct  52   ILRFPPNFQRQLSTKARRNCSNIGVAQIVAASWSNEGAGS  91



>ref|XP_002323872.1| cystathionine gamma synthase family protein [Populus trichocarpa]
 gb|EEF04005.1| cystathionine gamma synthase family protein [Populus trichocarpa]
Length=532

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 95/170 (56%), Gaps = 29/170 (17%)
 Frame = +1

Query  55   MAISSCST----VFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSR----GYGLSSL  210
            MA+SSC      V  SFECRSD   S   P         R NS   G+     G G+SSL
Sbjct  1    MAVSSCPCPKLFVASSFECRSDSSSSADQPSQG------RSNSARHGTTPFLSGAGMSSL  54

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppe  390
            IL+FPPNFVRQLS KARRNCSNIGVAQIVAASWSNN AA     AA A  AAAA+  P  
Sbjct  55   ILKFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNNSAAGAPSAAAAAAAAAAASAIPAA  114

Query  391  vsspvaeeevvlvDNGSCSDPNVQIQDL-AHANYASFLSSXGSVAVHAGE  537
              +                    +++DL +   Y SFLSS GS+AVHAGE
Sbjct  115  EPAKTLAGN--------------ELEDLSSDLEYKSFLSSDGSIAVHAGE  150



>ref|NP_001266947.1| cystathionine gamma-synthase, chloroplastic-like [Fragaria vesca]
 emb|CAA04772.2| cystathionine gamma synthase [Fragaria vesca]
 emb|CAB57356.1| cystathionine gamma synthase [Fragaria vesca]
Length=545

 Score =   102 bits (255),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 79/168 (47%), Positives = 97/168 (58%), Gaps = 9/168 (5%)
 Frame = +1

Query  55   MAISSCSTVFP------SFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLIL  216
            M + +C  VF       ++ CR  PD + R   +  P  G     +   +  +GLSSLIL
Sbjct  1    MGVYTCPRVFTSSSSSSTYCCRHHPDLATRAAVN--PRPGFAAGRVDSPAPFHGLSSLIL  58

Query  217  RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevs  396
            RFPPNFVRQLS KARRNCSNIGVAQIVAASWSN  +     PAA A+DAAA A      +
Sbjct  59   RFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNKDSDLSAVPAASAVDAAATAADLVVPA  118

Query  397  spvaeeevvlvDNGSCSDPN-VQIQDLAHANYASFLSSXGSVAVHAGE  537
                E+++  VD       N VQ+  L     ASFLSS GS+A+HAGE
Sbjct  119  QIGTEDDLAAVDAEYAVFGNGVQLGGLPDLKDASFLSSDGSIAIHAGE  166



>ref|XP_006297283.1| hypothetical protein CARUB_v10013298mg, partial [Capsella rubella]
 gb|EOA30181.1| hypothetical protein CARUB_v10013298mg, partial [Capsella rubella]
Length=589

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 68/106 (64%), Gaps = 16/106 (15%)
 Frame = +1

Query  37   YLSNSTMAISS--CSTVFPS-----FECRSDPDF-----SGRVPRHECPGAGLRPNSLSQ  180
            + +N TMA+SS  C T+F S     F+CRSDPD       G   R     AG+  +    
Sbjct  21   FTANETMAVSSFQCPTIFSSSSISGFQCRSDPDLVGSPVGGSSRRRVNAAAGISSSFTGD  80

Query  181  GSRGYGLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
            G    GLSS ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN
Sbjct  81   G----GLSSRILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNN  122



>ref|XP_010029311.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW56209.1| hypothetical protein EUGRSUZ_I01959 [Eucalyptus grandis]
Length=558

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 91/171 (53%), Gaps = 30/171 (18%)
 Frame = +1

Query  88   SFECRSDPDFSGRVPRHECPGAG---LRPNS-----LSQGSRGYGLSSLILRFPPNFVRQ  243
            +FECRSDPDF    PR E  G G    RP S     LS G    GLSSLI RFPPNFVRQ
Sbjct  18   AFECRSDPDFFRSSPRPESAGYGRFGCRPGSAGRAVLSSG----GLSSLIFRFPPNFVRQ  73

Query  244  LSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppev----------  393
            LS KARRNCSNIGVAQ+VAASWSN+   +  P A+ A    A + +              
Sbjct  74   LSTKARRNCSNIGVAQVVAASWSNSNGPAPAPSASAASGGGAPSPAAALAGAAAAPAVPA  133

Query  394  ---sspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                +      V  ++NG      V  QDL     +SFLS  GS+ VHAGE
Sbjct  134  LDFVAGEEALAVDGIENG-----GVVSQDLGTLEASSFLSYDGSLTVHAGE  179



>gb|KCW56210.1| hypothetical protein EUGRSUZ_I01959 [Eucalyptus grandis]
Length=556

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 91/171 (53%), Gaps = 30/171 (18%)
 Frame = +1

Query  88   SFECRSDPDFSGRVPRHECPGAG---LRPNS-----LSQGSRGYGLSSLILRFPPNFVRQ  243
            +FECRSDPDF    PR E  G G    RP S     LS G    GLSSLI RFPPNFVRQ
Sbjct  18   AFECRSDPDFFRSSPRPESAGYGRFGCRPGSAGRAVLSSG----GLSSLIFRFPPNFVRQ  73

Query  244  LSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppev----------  393
            LS KARRNCSNIGVAQ+VAASWSN+   +  P A+ A    A + +              
Sbjct  74   LSTKARRNCSNIGVAQVVAASWSNSNGPAPAPSASAASGGGAPSPAAALAGAAAAPAVPA  133

Query  394  ---sspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                +      V  ++NG      V  QDL     +SFLS  GS+ VHAGE
Sbjct  134  LDFVAGEEALAVDGIENG-----GVVSQDLGTLEASSFLSYDGSLTVHAGE  179



>ref|XP_010550033.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010550034.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Tarenaya 
hassleriana]
Length=547

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 100/174 (57%), Gaps = 19/174 (11%)
 Frame = +1

Query  55   MAISS--CSTVFPS-----FECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGY----GL  201
            MA+SS  CST+F S     F+CRSDPD SG        G+  R  +LS  +  +    G+
Sbjct  1    MAVSSFQCSTIFSSVAPSGFQCRSDPDLSGA----PLGGSSRRRVNLSATASSFTGAGGI  56

Query  202  SSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGI--ppaakaldaaaaa  375
             S+ILRFPPNFVRQLS KARRNCSNIGVAQIVAA WSNN  ASG+     A A    AAA
Sbjct  57   FSVILRFPPNFVRQLSTKARRNCSNIGVAQIVAAKWSNN-PASGLPSAAPAPATAPVAAA  115

Query  376  isppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             +     +    E   +V  G     +VQ++ L       FLSS GS+ VHAGE
Sbjct  116  SAAASAPAVTPVETEDVVAEGIRDVGSVQLESLPDLK-PPFLSSDGSLTVHAGE  168



>dbj|BAH57133.1| AT3G01120 [Arabidopsis thaliana]
Length=365

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 92/175 (53%), Gaps = 35/175 (20%)
 Frame = +1

Query  55   MAISS--CSTVFPS-----FECRSDPDFSG-------RVPRHECPGAGLRPNSLSQGSRG  192
            MA+SS  C T+F S     F+CRSDPD  G       R   H   G        S  +  
Sbjct  1    MAVSSFQCPTIFSSSSISGFQCRSDPDLVGSPVGGSSRRRVHASAGIS------SSFTGD  54

Query  193  YGLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaa  372
             GLSS ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN +++    AA  +   + 
Sbjct  55   AGLSSRILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNNPSSAAPVAAAPPVVLKSV  114

Query  373  aisppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                      + E+             +VQ+ D  H    SFLSS GS+ VHAGE
Sbjct  115  DEEVVVAEEGIREKIG-----------SVQLTDSKH----SFLSSDGSLTVHAGE  154



>ref|XP_006408463.1| hypothetical protein EUTSA_v10020394mg [Eutrema salsugineum]
 gb|ESQ49916.1| hypothetical protein EUTSA_v10020394mg [Eutrema salsugineum]
Length=568

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 67/103 (65%), Gaps = 16/103 (16%)
 Frame = +1

Query  55   MAISS--CSTVF-----PSFECRSDPDF-----SGRVPRHECPGAGLRPNSLSQGSRGYG  198
            MA+SS  C T+F     PSF+CRSDPD       G   R     AG+  +    G     
Sbjct  1    MAVSSFQCPTIFSSTSIPSFQCRSDPDLVGSPIGGSSRRRFNATAGMSSSFTGDGR----  56

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAA  327
            +SS+ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN A+
Sbjct  57   ISSMILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNNPAS  99



>ref|XP_007139535.1| hypothetical protein PHAVU_008G038100g [Phaseolus vulgaris]
 gb|ESW11529.1| hypothetical protein PHAVU_008G038100g [Phaseolus vulgaris]
Length=540

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 96/165 (58%), Gaps = 8/165 (5%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SS    F +FECRSDPDFS             R  S+  G+  +G+SSLILRFPPNF
Sbjct  1    MAVSSSHMRF-TFECRSDPDFSPPPSFDNLRRRNFR--SVGSGASFHGVSSLILRFPPNF  57

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspvaee  414
             RQLS KARRNCSNIGVAQIVAASWSNN   +    A      +AA  +   +   ++ +
Sbjct  58   QRQLSTKARRNCSNIGVAQIVAASWSNNSTNNPSAGAPAPPAVSAADAATAPLLVNISAD  117

Query  415  evvlvDN----GSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            E ++V       S +D N  +Q L  ++Y+SFL S  S  +HA E
Sbjct  118  EDIVVSTNDAVASAADNNGVVQ-LNRSSYSSFLKSDASKTIHAAE  161



>ref|XP_008353494.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase, 
chloroplastic-like [Malus domestica]
Length=243

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 93/173 (54%), Gaps = 19/173 (11%)
 Frame = +1

Query  22   PKSDFYLSNSTMAISSCS-TVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYG  198
            PKS     +S MA+ +    VF S +  + P  SGRV     P A +           Y 
Sbjct  48   PKSQKLDPSSLMAVCTYPPRVFASSQPGARPRLSGRV----DPTASV-----------YR  92

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaai  378
            LSS ILRFPPNFVRQLS KARRNCSNIGVAQIVAASWSNN   SG+P A  A    AAA 
Sbjct  93   LSSPILRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNNTPNSGVPAAPSATAVDAAAT  152

Query  379  sppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            S   V          +   G+       + DL     ASFLSS GS+A+HAGE
Sbjct  153  SAIPVDPAQISGGDEVAVFGNGVQLGEALPDLKE---ASFLSSDGSLAIHAGE  202



>ref|XP_006431204.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
 gb|ESR44444.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
Length=541

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 102/174 (59%), Gaps = 25/174 (14%)
 Frame = +1

Query  55   MAISSCST--------VFPSFECRSDPDFSG--RVPRHECPGAGLRPNSLSQGSRGYGLS  204
            MA+SSCS+           SFECRSDPDFSG  R  +     A +   S +  S   GLS
Sbjct  1    MAVSSCSSQKILSFSSSCSSFECRSDPDFSGSARFDKPRISAARVIGASTASFS---GLS  57

Query  205  SLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisp  384
            SLI RFPPNFVRQLS KARRNCSNIGVAQIVAASWSN    SG          +AAA + 
Sbjct  58   SLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNG-VGSG--------SNSAAAAAA  108

Query  385  pevsspvaeeevvlvDNGSCSD--PNVQIQDLAH-ANYASFLSSXGSVAVHAGE  537
                +P    E+   D+ +  D   NV ++ LA   N ASFLSS GS+A+HAGE
Sbjct  109  SAAPAPPVPVEITSGDDIALVDGLKNVHLEALADLKNEASFLSSDGSLAIHAGE  162



>ref|XP_002882199.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58458.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. 
lyrata]
Length=564

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 64/100 (64%), Gaps = 16/100 (16%)
 Frame = +1

Query  55   MAISS--CSTVFPS-----FECRSDPDF-----SGRVPRHECPGAGLRPNSLSQGSRGYG  198
            MA+SS  C T+F S     F+CRSDPD       G   R     AG+  +    G    G
Sbjct  1    MAVSSFQCPTIFSSSSISGFQCRSDPDLVGSPVGGSSRRRVNATAGISSSFTGDG----G  56

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
            LSS ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN
Sbjct  57   LSSRILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNN  96



>ref|XP_010463584.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=560

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 64/100 (64%), Gaps = 16/100 (16%)
 Frame = +1

Query  55   MAISS--CSTVFPS-----FECRSDPDF-----SGRVPRHECPGAGLRPNSLSQGSRGYG  198
            MA+SS  C ++F +     F+CRSDPD       G   R     AG+  +    G    G
Sbjct  1    MAVSSFQCPSIFSTSSISGFQCRSDPDLVGSPVGGSSRRRVNAAAGISASFTGDG----G  56

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
            LSS ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN
Sbjct  57   LSSRILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNN  96



>ref|XP_010429549.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Camelina 
sativa]
Length=563

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 64/100 (64%), Gaps = 16/100 (16%)
 Frame = +1

Query  55   MAISS--CSTVFPS-----FECRSDPDF-----SGRVPRHECPGAGLRPNSLSQGSRGYG  198
            MA+SS  C ++F +     F+CRSDPD       G   R     AG+  +    G    G
Sbjct  1    MAVSSFQCPSIFSTSSISGFQCRSDPDLVGSPVGGSSRRRVNAAAGISASFTGDG----G  56

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
            LSS ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN
Sbjct  57   LSSRILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNN  96



>gb|KJB11080.1| hypothetical protein B456_001G240300 [Gossypium raimondii]
Length=435

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 94/173 (54%), Gaps = 19/173 (11%)
 Frame = +1

Query  55   MAISSCSTV--------FPSFECRSDPDFS----GRVPRHECPGAGLRPNSLSQGSRGYG  198
            MA+ SCS          + SFECR DPDFS    G  PR          +  + G    G
Sbjct  1    MAVLSCSFTLSPRIFNPYSSFECRPDPDFSTAPIGDKPRLASSRRVTASSLYAGGISSRG  60

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaai  378
            LSSLI  FPPNFVRQLSIKARRNCSNIGVAQIVAAS SN  A    P  A A  A AAA 
Sbjct  61   LSSLIFCFPPNFVRQLSIKARRNCSNIGVAQIVAASRSNGPAPDS-PFLAAAASAQAAAA  119

Query  379  sppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            +    ++         +DNGS     VQI   +  +  +FLSS GS+ VHAGE
Sbjct  120  AVNATATNDGAALEGCIDNGS-----VQIGG-SDNSTTTFLSSDGSITVHAGE  166



>gb|KDO72621.1| hypothetical protein CISIN_1g0091672mg, partial [Citrus sinensis]
 gb|KDO72622.1| hypothetical protein CISIN_1g0091672mg, partial [Citrus sinensis]
 gb|KDO72623.1| hypothetical protein CISIN_1g0091672mg, partial [Citrus sinensis]
 gb|KDO72624.1| hypothetical protein CISIN_1g0091672mg, partial [Citrus sinensis]
 gb|KDO72625.1| hypothetical protein CISIN_1g0091672mg, partial [Citrus sinensis]
 gb|KDO72626.1| hypothetical protein CISIN_1g0091672mg, partial [Citrus sinensis]
Length=393

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 104/174 (60%), Gaps = 25/174 (14%)
 Frame = +1

Query  55   MAISSCST--------VFPSFECRSDPDFSG--RVPRHECPGAGLRPNSLSQGSRGYGLS  204
            MA+SSCS+           SFECRSDPDFSG  R  +     A +   S +  S   G+S
Sbjct  1    MAVSSCSSQKILSFSSSCSSFECRSDPDFSGSARFDKPRISAARVIGASTASFS---GVS  57

Query  205  SLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisp  384
            SLI RFPPNFVRQLS KARRNCSNIGVAQIVAASWSN+  +            +AAA + 
Sbjct  58   SLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNSVGSG---------SNSAAATAA  108

Query  385  pevsspvaeeevvlvDNGSCSD--PNVQIQDLAH-ANYASFLSSXGSVAVHAGE  537
                +P A  E+   D+ +  D   NVQ++ LA   N ASFLSS GS+A+HAGE
Sbjct  109  SAAPAPPAPVEITSGDDIALVDGLKNVQLEALADLKNEASFLSSDGSLAIHAGE  162



>ref|XP_008802567.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=398

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 93/165 (56%), Gaps = 15/165 (9%)
 Frame = +1

Query  55   MAISS---CSTVFPSF-ECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRF  222
            MA+SS      +FP+  +CR D   SG +PR E P A      LS G R  GL   ILRF
Sbjct  1    MAVSSGCCLPKLFPAASDCRGD---SGALPRPEIPAAA-SSRLLSPGCRASGL---ILRF  53

Query  223  PPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevssp  402
            PPNFVRQLS KARRNCSNIGVAQIVAASWSNN A            +AAA  +       
Sbjct  54   PPNFVRQLSTKARRNCSNIGVAQIVAASWSNNSALP----ETPLSASAAADAAATVAIPA  109

Query  403  vaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             A+   ++  +G+     ++  D   A  A+ LSS GS+AVHAGE
Sbjct  110  EADVPTLVGGDGTSDPSQIRAADSKAAAIAALLSSDGSLAVHAGE  154



>gb|KDO72627.1| hypothetical protein CISIN_1g0091672mg, partial [Citrus sinensis]
Length=383

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 104/174 (60%), Gaps = 25/174 (14%)
 Frame = +1

Query  55   MAISSCST--------VFPSFECRSDPDFSG--RVPRHECPGAGLRPNSLSQGSRGYGLS  204
            MA+SSCS+           SFECRSDPDFSG  R  +     A +   S +  S   G+S
Sbjct  1    MAVSSCSSQKILSFSSSCSSFECRSDPDFSGSARFDKPRISAARVIGASTASFS---GVS  57

Query  205  SLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisp  384
            SLI RFPPNFVRQLS KARRNCSNIGVAQIVAASWSN+  +            +AAA + 
Sbjct  58   SLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNSVGSG---------SNSAAATAA  108

Query  385  pevsspvaeeevvlvDNGSCSD--PNVQIQDLAH-ANYASFLSSXGSVAVHAGE  537
                +P A  E+   D+ +  D   NVQ++ LA   N ASFLSS GS+A+HAGE
Sbjct  109  SAAPAPPAPVEITSGDDIALVDGLKNVQLEALADLKNEASFLSSDGSLAIHAGE  162



>ref|XP_008341762.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Malus 
domestica]
Length=415

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 83/153 (54%), Gaps = 18/153 (12%)
 Frame = +1

Query  79   VFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNFVRQLSIKA  258
            VF S +  + P  SGRV     P A +           Y LSS ILRFPPNFVRQLS KA
Sbjct  10   VFASSQPGARPRLSGRVD----PTASV-----------YRLSSPILRFPPNFVRQLSTKA  54

Query  259  RRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspvaeeevvlvDNG  438
            RRNCSNIGVAQIVAASWSNN   SG+  A  A    AAA S   V          +   G
Sbjct  55   RRNCSNIGVAQIVAASWSNNTPNSGVXAAPSATAVDAAATSAIPVDPAQISGGDEVAVFG  114

Query  439  SCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            +       + DL     ASFLSS GS+A+HAGE
Sbjct  115  NGVQLGEALPDLKE---ASFLSSDGSLAIHAGE  144



>gb|KDO72628.1| hypothetical protein CISIN_1g0091672mg, partial [Citrus sinensis]
Length=384

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 98/174 (56%), Gaps = 34/174 (20%)
 Frame = +1

Query  55   MAISSCST--------VFPSFECRSDPDFSG--RVPRHECPGAGLRPNSLSQGSRGYGLS  204
            MA+SSCS+           SFECRSDPDFSG  R  +     A +   S +  S   G+S
Sbjct  1    MAVSSCSSQKILSFSSSCSSFECRSDPDFSGSARFDKPRISAARVIGASTASFS---GVS  57

Query  205  SLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisp  384
            SLI RFPPNFVRQLS KARRNCSNIGVAQIVAASWSN+  +                   
Sbjct  58   SLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNSVGSG------------------  99

Query  385  pevsspvaeeevvlvDNGSCSD--PNVQIQDLAH-ANYASFLSSXGSVAVHAGE  537
               ++  A   +   D+ +  D   NVQ++ LA   N ASFLSS GS+A+HAGE
Sbjct  100  SNSAAATAASAITSGDDIALVDGLKNVQLEALADLKNEASFLSSDGSLAIHAGE  153



>emb|CAA64383.1| cystathionine gamma-synthase [Arabidopsis thaliana]
Length=563

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 63/102 (62%), Gaps = 20/102 (20%)
 Frame = +1

Query  55   MAISS--CSTVFPS-----FECRSDPDFSG-------RVPRHECPGAGLRPNSLSQGSRG  192
            MA+SS  C T+F S     F+CRSDPD  G       R   H   G        S  +  
Sbjct  1    MAVSSFQCPTIFSSSSISGFQCRSDPDLVGSPVGGSSRRRVHASAGIS------SSFTGD  54

Query  193  YGLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
             GLSS ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN
Sbjct  55   AGLSSRILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNN  96



>gb|AAM13883.1| putative cystathionine gamma-synthase [Arabidopsis thaliana]
Length=563

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 63/102 (62%), Gaps = 20/102 (20%)
 Frame = +1

Query  55   MAISS--CSTVFPS-----FECRSDPDFSG-------RVPRHECPGAGLRPNSLSQGSRG  192
            MA+SS  C T+F S     F+CRSDPD  G       R   H   G        S  +  
Sbjct  1    MAVSSFQCPTIFSSSSISGFQCRSDPDLVGSPVGGSSRRRVHASAGIS------SSFTGD  54

Query  193  YGLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
             GLSS ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN
Sbjct  55   AGLSSRILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNN  96



>ref|XP_006431203.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
 gb|ESR44443.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
Length=537

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 101/173 (58%), Gaps = 25/173 (14%)
 Frame = +1

Query  55   MAISSCST--------VFPSFECRSDPDFSG--RVPRHECPGAGLRPNSLSQGSRGYGLS  204
            MA+SSCS+           SFECRSDPDFSG  R  +     A +   S +  S   GLS
Sbjct  1    MAVSSCSSQKILSFSSSCSSFECRSDPDFSGSARFDKPRISAARVIGASTASFS---GLS  57

Query  205  SLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisp  384
            SLI RFPPNFVRQLS KARRNCSNIGVAQIVAASWSN    SG          +AAA + 
Sbjct  58   SLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNG-VGSG--------SNSAAAAAA  108

Query  385  pevsspvaeeevvlvDNGSCSD--PNVQIQDLAH-ANYASFLSSXGSVAVHAG  534
                +P    E+   D+ +  D   NV ++ LA   N ASFLSS GS+A+HAG
Sbjct  109  SAAPAPPVPVEITSGDDIALVDGLKNVHLEALADLKNEASFLSSDGSLAIHAG  161



>ref|NP_186761.1| cystathionine gamma-synthase [Arabidopsis thaliana]
 sp|P55217.3|CGS1_ARATH RecName: Full=Cystathionine gamma-synthase 1, chloroplastic; 
Short=AtCGS1; AltName: Full=METHIONINE OVERACCUMULATION 1; AltName: 
Full=O-succinylhomoserine (thiol)-lyase; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF26162.1|AC008261_19 putative cystathionine gamma-synthase [Arabidopsis thaliana]
 gb|AAB41235.1| cystathionine gamma-synthase [Arabidopsis thaliana]
 dbj|BAA24699.1| cystathionine gamma-synthase [Arabidopsis thaliana]
 gb|AAM19810.1| AT3g01120/T4P13_19 [Arabidopsis thaliana]
 gb|AAO22582.1| putative cystathionine gamma-synthase [Arabidopsis thaliana]
 gb|AEE73612.1| cystathionine gamma-synthase [Arabidopsis thaliana]
Length=563

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 63/102 (62%), Gaps = 20/102 (20%)
 Frame = +1

Query  55   MAISS--CSTVFPS-----FECRSDPDFSG-------RVPRHECPGAGLRPNSLSQGSRG  192
            MA+SS  C T+F S     F+CRSDPD  G       R   H   G        S  +  
Sbjct  1    MAVSSFQCPTIFSSSSISGFQCRSDPDLVGSPVGGSSRRRVHASAGIS------SSFTGD  54

Query  193  YGLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
             GLSS ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN
Sbjct  55   AGLSSRILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNN  96



>ref|XP_008802566.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=411

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 63/94 (67%), Gaps = 11/94 (12%)
 Frame = +1

Query  55   MAISS---CSTVFPSF-ECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRF  222
            MA+SS      +FP+  +CR D   SG +PR E P A      LS G R  GL   ILRF
Sbjct  1    MAVSSGCCLPKLFPAASDCRGD---SGALPRPEIPAAA-SSRLLSPGCRASGL---ILRF  53

Query  223  PPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKA  324
            PPNFVRQLS KARRNCSNIGVAQIVAASWSNN A
Sbjct  54   PPNFVRQLSTKARRNCSNIGVAQIVAASWSNNSA  87



>gb|KJB11079.1| hypothetical protein B456_001G240300 [Gossypium raimondii]
Length=546

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 94/173 (54%), Gaps = 19/173 (11%)
 Frame = +1

Query  55   MAISSCSTV--------FPSFECRSDPDFS----GRVPRHECPGAGLRPNSLSQGSRGYG  198
            MA+ SCS          + SFECR DPDFS    G  PR          +  + G    G
Sbjct  1    MAVLSCSFTLSPRIFNPYSSFECRPDPDFSTAPIGDKPRLASSRRVTASSLYAGGISSRG  60

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaai  378
            LSSLI  FPPNFVRQLSIKARRNCSNIGVAQIVAAS SN  A    P  A A  A AAA 
Sbjct  61   LSSLIFCFPPNFVRQLSIKARRNCSNIGVAQIVAASRSNGPAPDS-PFLAAAASAQAAAA  119

Query  379  sppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            +    ++         +DNGS     VQI   +  +  +FLSS GS+ VHAGE
Sbjct  120  AVNATATNDGAALEGCIDNGS-----VQIGG-SDNSTTTFLSSDGSITVHAGE  166



>emb|CBI22246.3| unnamed protein product [Vitis vinifera]
Length=497

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 79/167 (47%), Gaps = 55/167 (33%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGY------GLSSLIL  216
            MA+SSC  V  +FECRS+PDF G   R E   +G R +  +     +       LSSLI 
Sbjct  1    MAVSSCPRVSAAFECRSEPDFCGGPHRPEAFASGGRFSGKASSVPSHQIFGASALSSLIF  60

Query  217  RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevs  396
            RFPPNFVRQLS KARRNCSNIGVAQ+VAAS                              
Sbjct  61   RFPPNFVRQLSTKARRNCSNIGVAQVVAASC-----------------------------  91

Query  397  spvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                               +VQ +DLA    ASFL   G++ +HAGE
Sbjct  92   -------------------DVQYEDLADEK-ASFLGFDGTLTIHAGE  118



>ref|XP_006482629.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Citrus 
sinensis]
Length=541

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 102/174 (59%), Gaps = 25/174 (14%)
 Frame = +1

Query  55   MAISSCST--------VFPSFECRSDPDFSG--RVPRHECPGAGLRPNSLSQGSRGYGLS  204
            MA+SSCS+           SFECRSDPDFSG  R  +     A +   S +  S   G+S
Sbjct  1    MAVSSCSSQKILSFSSSCSSFECRSDPDFSGSARFDKPRISAARVIGASTASFS---GVS  57

Query  205  SLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisp  384
            SLI RFPPNFVRQLS KARRNCSNIGVAQIVAASWSN+  +            +AA    
Sbjct  58   SLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNSVGSG---------SNSAAXXXX  108

Query  385  pevsspvaeeevvlvDNGSCSD--PNVQIQDLAH-ANYASFLSSXGSVAVHAGE  537
                +P A  E+   D+ +  D   NVQ++ LA   N ASFLSS GS+A+HAGE
Sbjct  109  SAAPAPPAPVEITSGDDIALVDGLKNVQLEALADLKNEASFLSSDGSLAIHAGE  162



>gb|AAC19395.1| cystathionine gamma-synthase [Mesembryanthemum crystallinum]
Length=548

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 60/93 (65%), Gaps = 9/93 (10%)
 Frame = +1

Query  64   SSCSTVFPSFECRSDP-DFSGRVPRHECPGAGLRPNSLSQGSRG----YGLSSLILRFPP  228
            S C+ V P FECR +P DFS    + E       P S   G+ G       SSLILRFPP
Sbjct  7    SCCARVLPPFECRPEPADFSTAAAKQEKN----IPKSFFGGANGRLFSSSSSSLILRFPP  62

Query  229  NFVRQLSIKARRNCSNIGVAQIVAASWSNNKAA  327
            NFVRQLS KARRNCSNIGVAQ+VAASWSNN  A
Sbjct  63   NFVRQLSTKARRNCSNIGVAQVVAASWSNNSDA  95



>ref|XP_008368433.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Malus 
domestica]
Length=523

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 83/153 (54%), Gaps = 18/153 (12%)
 Frame = +1

Query  79   VFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNFVRQLSIKA  258
            VF S +  + P  SGRV     P A +           Y LSS ILRFPPNFVRQLS KA
Sbjct  10   VFASSQPGARPRLSGRVD----PTASV-----------YRLSSPILRFPPNFVRQLSTKA  54

Query  259  RRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspvaeeevvlvDNG  438
            RRNCSNIGVAQIVAASWSNN   SG+  A  A    AAA S   V          +   G
Sbjct  55   RRNCSNIGVAQIVAASWSNNTPNSGVXAAPSATAVDAAATSAIPVDPAQISGGDEVAVFG  114

Query  439  SCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            +       + DL     ASFLSS GS+A+HAGE
Sbjct  115  NGVQLGEALPDLKE---ASFLSSDGSLAIHAGE  144



>ref|XP_007032603.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY03529.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 2 [Theobroma cacao]
Length=541

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 100/172 (58%), Gaps = 21/172 (12%)
 Frame = +1

Query  55   MAISSCS------TVFPSFECRSDPDFSG----RVPRHECPGAGLRPNSL-SQGSRGYGL  201
            MA+SSCS        + SFECRSDPDFSG      PR   P   L   S  + G  G GL
Sbjct  1    MAVSSCSCPPRVFNAYSSFECRSDPDFSGAPIGDKPRVR-PSRRLTAASFCTGGIGGGGL  59

Query  202  SSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaais  381
            SSLI RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSN+ A+      + A  AA  A +
Sbjct  60   SSLIFRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNSPASG---SPSSAAAAAQTATA  116

Query  382  ppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                 S          DNGS     VQI   +  +  SFLSS GS+AVHAGE
Sbjct  117  ATVHVSDDVAFVQGCNDNGS-----VQIGG-SDNSTTSFLSSDGSIAVHAGE  162



>ref|XP_007032602.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY03528.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 1 [Theobroma cacao]
Length=559

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 100/172 (58%), Gaps = 21/172 (12%)
 Frame = +1

Query  55   MAISSCS------TVFPSFECRSDPDFSG----RVPRHECPGAGLRPNSL-SQGSRGYGL  201
            MA+SSCS        + SFECRSDPDFSG      PR   P   L   S  + G  G GL
Sbjct  1    MAVSSCSCPPRVFNAYSSFECRSDPDFSGAPIGDKPRVR-PSRRLTAASFCTGGIGGGGL  59

Query  202  SSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaais  381
            SSLI RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSN+ A+      + A  AA  A +
Sbjct  60   SSLIFRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNSPASG---SPSSAAAAAQTATA  116

Query  382  ppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                 S          DNGS     VQI   +  +  SFLSS GS+AVHAGE
Sbjct  117  ATVHVSDDVAFVQGCNDNGS-----VQIGG-SDNSTTSFLSSDGSIAVHAGE  162



>ref|XP_010485423.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Camelina 
sativa]
Length=562

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 54/81 (67%), Gaps = 9/81 (11%)
 Frame = +1

Query  91   FECRSDPDF-----SGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNFVRQLSIK  255
            F+CRSDPD       G   R     AG+  +    G    GLSS ILRFPPNFVRQLSIK
Sbjct  20   FQCRSDPDLVGSPVGGSSRRRVNAAAGISASFTGDG----GLSSRILRFPPNFVRQLSIK  75

Query  256  ARRNCSNIGVAQIVAASWSNN  318
            ARRNCSNIGVAQIVAA WSNN
Sbjct  76   ARRNCSNIGVAQIVAAKWSNN  96



>ref|NP_001265950.1| cystathionine gamma-synthase, chloroplastic-like [Cicer arietinum]
 gb|AGA60136.1| cystathionine gamma-synthase [Cicer arietinum]
Length=534

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 89/167 (53%), Gaps = 18/167 (11%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFS------GRVPRHECPGAGLRPNSLSQGSRGYGLSSLIL  216
            MA+SS   V  +FECRSDPDF+       R  RH  P A +           Y  SS IL
Sbjct  1    MAVSSFHRVL-TFECRSDPDFASLPSFDNRRTRH-FPTAAV-------SVAFYAASSPIL  51

Query  217  RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevs  396
            RFPPNF RQLS KARRNCSNIGVAQIVAASWSN    SG P A      A A+      +
Sbjct  52   RFPPNFQRQLSTKARRNCSNIGVAQIVAASWSNE--GSGNPAAGAPPVPAVASTVDATTA  109

Query  397  spvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
             P  + + V  +N    D N  +Q    ++Y+ FL S  S  +HA E
Sbjct  110  PPPLDLDAVADENVVAVDENGAVQT-NRSSYSKFLKSDASKTIHAAE  155



>ref|XP_009360603.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Pyrus 
x bretschneideri]
Length=521

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 89/154 (58%), Gaps = 22/154 (14%)
 Frame = +1

Query  79   VFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNFVRQLSIKA  258
            VF S +  + P  SGRV     P A +           Y LSS ILRFPPNFVRQLS KA
Sbjct  10   VFASSQPGARPRLSGRVD----PTASV-----------YRLSSPILRFPPNFVRQLSTKA  54

Query  259  RRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspvaeeevvlvDNG  438
            RRNCSNIGVAQIVAASWSNN   SG+     A DA A +  P + +     +EV +  NG
Sbjct  55   RRNCSNIGVAQIVAASWSNNTPNSGVXXXXAAADAPATSAIPVDPAQISGGDEVAVFGNG  114

Query  439  SCSDPNVQI-QDLAHANYASFLSSXGSVAVHAGE  537
                  VQ+ + +     ASFLSS GS+A+HAGE
Sbjct  115  ------VQLGEAVPDLKEASFLSSDGSLAIHAGE  142



>gb|AGF95115.1| cystathionine gamma synthase, partial [Prunus persica]
Length=217

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 92/164 (56%), Gaps = 20/164 (12%)
 Frame = +1

Query  49   STMAISSCST-VFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFP  225
            S MA+ +C   VF S +    P  +GRV                  +  +GLSSLILRFP
Sbjct  34   SLMAVCTCPPRVFTSSQPGPRPRLAGRV---------------DATAPFHGLSSLILRFP  78

Query  226  PNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspv  405
            PNFVRQLS KARRNCSNIGVAQIVAASWSNN + SGIP A  A    AAA +   V    
Sbjct  79   PNFVRQLSTKARRNCSNIGVAQIVAASWSNNNSNSGIPAAPSATAVDAAATAAIPVDPAK  138

Query  406  aeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                     +    + +VQ++ L     ASFLSS GS+A+HAGE
Sbjct  139  LSAGG----DEVVFENDVQLEALPDLKEASFLSSDGSLAIHAGE  178



>gb|AAC49574.1| similar to the metB gene product of Escherichia coli; cloned 
by functional complementation of a metB mutant strain of Escherichia 
coli LE392 [Arabidopsis thaliana]
Length=563

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 62/100 (62%), Gaps = 16/100 (16%)
 Frame = +1

Query  55   MAISSCS--TVFPS-----FECRSDPDF-----SGRVPRHECPGAGLRPNSLSQGSRGYG  198
            MA+SS    T+F S     F+CRSDPD       G   R     AG+  +    G    G
Sbjct  1    MAVSSFQSPTIFSSSSISGFQCRSDPDLVGSPVGGSSRRRVHASAGISSSFTGDG----G  56

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
            LSS ILRFPPNFVRQLSIKARRNCSNIGVAQIVA  WSNN
Sbjct  57   LSSRILRFPPNFVRQLSIKARRNCSNIGVAQIVAGKWSNN  96



>gb|KDP27172.1| hypothetical protein JCGZ_19871 [Jatropha curcas]
Length=540

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 107/172 (62%), Gaps = 22/172 (13%)
 Frame = +1

Query  55   MAISSCS-----TVF-PSFECRSDPDFSGRVPRHE--CPGAGLRPNSLSQGSRGY---GL  201
            MA+SSC       VF PSFECRSDP  + + P +    P    R NS+  G+  +   G+
Sbjct  1    MAVSSCPCPKSLAVFSPSFECRSDPSGTDQ-PSYSRFSP----RVNSVRHGTASFFGGGM  55

Query  202  SSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaais  381
            SSLIL+FPPNFVRQLS KARRNCSNIGVAQ+VAASWSNN A+S    AA A  AAA+AI 
Sbjct  56   SSLILKFPPNFVRQLSTKARRNCSNIGVAQVVAASWSNNSASSVPSAAANAAAAAASAIP  115

Query  382  ppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
              E         V  ++     + +VQ++DL   N  SFL S GS+AVHAGE
Sbjct  116  TAEPVIGDKVVVVEELNE----NESVQLKDLTTEN--SFLGSDGSLAVHAGE  161



>gb|AAC25687.1| cystathionine gamma-synthase precursor [Arabidopsis thaliana]
Length=563

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 62/100 (62%), Gaps = 16/100 (16%)
 Frame = +1

Query  55   MAISSCS--TVFPS-----FECRSDPDF-----SGRVPRHECPGAGLRPNSLSQGSRGYG  198
            MA+SS    T+F S     F+CRSDPD       G   R     AG+  +    G    G
Sbjct  1    MAVSSFQSPTIFSSSSISGFQCRSDPDLVGSPVGGSSRRRVHASAGISSSFTGDG----G  56

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
            LSS ILRFPPNFVRQLSIKARRNCSNIGVAQIVA  WSNN
Sbjct  57   LSSRILRFPPNFVRQLSIKARRNCSNIGVAQIVAGKWSNN  96



>ref|XP_003621273.1| Cystathionine gamma-synthase [Medicago truncatula]
Length=305

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SS   VF +FECRSDPDF+             R    +  S    +SS ILRFPPNF
Sbjct  1    MAVSSFHRVF-TFECRSDPDFTSLPSTDNHHHNRRRHFPTTSLSSAAAISSPILRFPPNF  59

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNN  318
             RQLS KARRNCSNIGVAQIVAASWSN 
Sbjct  60   QRQLSTKARRNCSNIGVAQIVAASWSNE  87



>ref|XP_010939832.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Elaeis 
guineensis]
Length=539

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 96/167 (57%), Gaps = 13/167 (8%)
 Frame = +1

Query  55   MAISS---CSTVFPSF-ECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGY-GLSS-LIL  216
            MA+SS       FP+  +CR D   SG +PR E P A    + L        GLSS LIL
Sbjct  1    MAVSSGCCLPKFFPAASDCRGD---SGALPRPEIPSAAAASSRLLSLRSRASGLSSTLIL  57

Query  217  RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevs  396
            RFPPNFVRQLS KARRNCSNIGVAQIVAASWSNN   SG+P    +  AAA A +   + 
Sbjct  58   RFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNN---SGLPETPLSASAAADATATVAIP  114

Query  397  spvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
                    V  D G+ ++  +   D   A  A+ LSS GS+AVHAGE
Sbjct  115  VEADVATPVGGD-GTSTESQIPAADSKAAAIAALLSSDGSLAVHAGE  160



>ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Vitis 
vinifera]
Length=531

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 99/167 (59%), Gaps = 21/167 (13%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGY------GLSSLIL  216
            MA+SSC  V  +FECRS+PDF G   R E   +G R +  +     +       LSSLI 
Sbjct  1    MAVSSCPRVSAAFECRSEPDFCGGPHRPEAFASGGRFSGKASSVPSHQIFGASALSSLIF  60

Query  217  RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevs  396
            RFPPNFVRQLS KARRNCSNIGVAQ+VAASWS + AA+          AAA+A +    S
Sbjct  61   RFPPNFVRQLSTKARRNCSNIGVAQVVAASWSADSAAA----------AAASASAAAAAS  110

Query  397  spvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
               + E  V+  +GS    +VQ +DLA    ASFL   G++ +HAGE
Sbjct  111  VEASVEVSVVESSGS----DVQYEDLADEK-ASFLGFDGTLTIHAGE  152



>ref|XP_008230796.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase, 
chloroplastic-like [Prunus mume]
Length=522

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 77/115 (67%), Gaps = 4/115 (3%)
 Frame = +1

Query  193  YGLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaa  372
            +GLSSLILRFPPNFVRQLS KARRNCSNIGVAQIVAASWSNN + SGIP A  A    AA
Sbjct  33   HGLSSLILRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNNNSNSGIPAAPSATAVDAA  92

Query  373  aisppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            A +   V+            +    + +VQ++ L     ASFLSS GS+A+HAGE
Sbjct  93   ATAAIPVAPAPLSAVX----DEVVFENDVQLEALPDLKEASFLSSDGSLAIHAGE  143



>ref|XP_003621272.1| Cystathionine gamma-synthase [Medicago truncatula]
 gb|AES77490.1| cystathionine gamma-synthase [Medicago truncatula]
Length=535

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SS   VF +FECRSDPDF+             R    +  S    +SS ILRFPPNF
Sbjct  1    MAVSSFHRVF-TFECRSDPDFTSLPSTDNHHHNRRRHFPTTSLSSAAAISSPILRFPPNF  59

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNN  318
             RQLS KARRNCSNIGVAQIVAASWSN 
Sbjct  60   QRQLSTKARRNCSNIGVAQIVAASWSNE  87



>gb|ABI34092.1| cystathionine gamma-synthase [Medicago sativa]
Length=536

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SS   VF +FECRSDPDF+             R    +  S    +SS ILRFPPNF
Sbjct  1    MAVSSFHRVF-TFECRSDPDFTSLPSTDNHHHNRRRHFPTTSLSSAAAISSPILRFPPNF  59

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNN  318
             RQLS KARRNCSNIGVAQIVAASWSN 
Sbjct  60   QRQLSTKARRNCSNIGVAQIVAASWSNE  87



>ref|XP_007216002.1| hypothetical protein PRUPE_ppa004232mg [Prunus persica]
 gb|EMJ17201.1| hypothetical protein PRUPE_ppa004232mg [Prunus persica]
Length=522

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 76/115 (66%), Gaps = 4/115 (3%)
 Frame = +1

Query  193  YGLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaa  372
            +GLSSLILRFPPNFVRQLS KARRNCSNIGVAQIVAASWSNN + SGIP A  A    AA
Sbjct  33   HGLSSLILRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNNNSNSGIPAAPSATAVDAA  92

Query  373  aisppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            A +   V             +    + +VQ++ L     ASFLSS GS+A+HAGE
Sbjct  93   ATAAIPVDPAKLSAGG----DEVVFENDVQLEALPDLKEASFLSSDGSLAIHAGE  143



>emb|CDY37543.1| BnaA05g34080D [Brassica napus]
Length=530

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = +1

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaai  378
            +SS+ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN  +SG+P AA A  + +AA 
Sbjct  41   ISSMILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNN-PSSGLPSAAAAASSVSAAA  99

Query  379  sppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            S P  + P       + +    ++   +I  L   +  SFLSS GS+ VHAGE
Sbjct  100  SAPAAAVPPVVALNGVDEEVVAAEGAREI-GLKKDSKPSFLSSDGSLTVHAGE  151



>ref|NP_001237572.1| cystathionine-gamma-synthase precursor [Glycine max]
 gb|AAD34548.1|AF141602_1 cystathionine-gamma-synthase precursor [Glycine max]
Length=536

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SS    F +FECRSDPDFS   P  +        +S   G+  +G+SSLILRFPPNF
Sbjct  1    MAVSSSHMRF-TFECRSDPDFSPPPPSFDNLRRRNFRSSADSGAAFHGISSLILRFPPNF  59

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNN  318
             RQLS KARRNCSNIGVAQIVAASWSNN
Sbjct  60   QRQLSTKARRNCSNIGVAQIVAASWSNN  87



>ref|XP_003552541.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Glycine 
max]
Length=535

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = +1

Query  55   MAISSCSTVFPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNF  234
            MA+SS    F +FECRSDPDFS   P  +        +S   G+  +G+SSLILRFPPNF
Sbjct  1    MAVSSSHMRF-TFECRSDPDFSPPPPSFDNLRRRNFRSSAGSGAAFHGISSLILRFPPNF  59

Query  235  VRQLSIKARRNCSNIGVAQIVAASWSNN  318
             RQLS KARRNCSNIGVAQIVAASWSNN
Sbjct  60   QRQLSTKARRNCSNIGVAQIVAASWSNN  87



>ref|XP_010937207.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Elaeis guineensis]
Length=512

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Frame = +1

Query  94   ECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSS-LILRFPPNFVRQLSIKARRNC  270
            +CR D   SG   R E P        L   S   GLSS LILRFPPNFVRQLS K+RRNC
Sbjct  21   DCRGD---SGAHLRSEFPSGAASSRLLFPRSCTSGLSSALILRFPPNFVRQLSTKSRRNC  77

Query  271  SNIGVAQIVAASWSNN  318
            SNIGVAQIVAASWSNN
Sbjct  78   SNIGVAQIVAASWSNN  93



>ref|XP_009404092.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=540

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 55/82 (67%), Gaps = 10/82 (12%)
 Frame = +1

Query  82   FPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNFVRQLSIKAR  261
            F + +CRS    SG  PR E P A    +SL    RG   S LILRFPPNFVRQLSIKAR
Sbjct  19   FSAADCRSSD--SGARPRIEMPAA----SSL----RGGRASPLILRFPPNFVRQLSIKAR  68

Query  262  RNCSNIGVAQIVAASWSNNKAA  327
            RNC NIGVAQI AASWSN+  A
Sbjct  69   RNCCNIGVAQIAAASWSNDPPA  90



>gb|ABR16369.1| unknown [Picea sitchensis]
 gb|ABR18082.1| unknown [Picea sitchensis]
Length=521

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 55/79 (70%), Gaps = 5/79 (6%)
 Frame = +1

Query  85   PSFECRSDPDFSGRVPRHECPGAGLRPNS--LSQGSRGYGLSSLILRFPPNFVRQLSIKA  258
            P FECR+D   S +   HE P +G  P +  L +G+     + LILRFPPNFVRQLSIKA
Sbjct  22   PLFECRADTSGSAK---HERPDSGSSPPTGFLKRGACFGASAPLILRFPPNFVRQLSIKA  78

Query  259  RRNCSNIGVAQIVAASWSN  315
            RRNCSNIGVAQ+ AAS +N
Sbjct  79   RRNCSNIGVAQVAAASVTN  97



>ref|XP_010937206.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Elaeis guineensis]
Length=541

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Frame = +1

Query  94   ECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSS-LILRFPPNFVRQLSIKARRNC  270
            +CR D   SG   R E P        L   S   GLSS LILRFPPNFVRQLS K+RRNC
Sbjct  21   DCRGD---SGAHLRSEFPSGAASSRLLFPRSCTSGLSSALILRFPPNFVRQLSTKSRRNC  77

Query  271  SNIGVAQIVAASWSNN  318
            SNIGVAQIVAASWSNN
Sbjct  78   SNIGVAQIVAASWSNN  93



>emb|CDY43269.1| BnaC05g48620D [Brassica napus]
Length=492

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
            +SS+ILRFPPNFVRQLSIKARRNCSNIGVAQIVAA WSNN
Sbjct  41   ISSMILRFPPNFVRQLSIKARRNCSNIGVAQIVAAKWSNN  80



>dbj|BAE78434.1| cystathionine gamma-synthase precursor [Aegilops tauschii]
Length=128

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  163  PNSLSQGSRGYGLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAAS  330
            P S +  + G   S+ ILRFPPNFVRQLS KARRNCSNIGVAQIVAA+WS+ +A +
Sbjct  9    PASFAGDNSGALTSATILRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSDRRAVT  64



>ref|XP_009409044.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=541

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 61/95 (64%), Gaps = 12/95 (13%)
 Frame = +1

Query  55   MAISSCSTVFPSFEC------RSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSS-LI  213
            MA+SS  T++P++        R   D SG  PR E  G+      L    R  GLSS  I
Sbjct  1    MAVSS--TIYPAYFVSAAAGDRRTSD-SGAHPRPEKLGSS--SFLLGGAPRFSGLSSATI  55

Query  214  LRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
            LRFPPNFVRQLS KARRNCSNIGVAQIVAASWSN+
Sbjct  56   LRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNS  90



>ref|XP_009772869.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase, 
chloroplastic-like, partial [Nicotiana sylvestris]
Length=445

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 61/100 (61%), Gaps = 16/100 (16%)
 Frame = +1

Query  241  QLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaaisppevsspvaeeev  420
            QLSIKARRNCSN GVAQ+VAASWSNN A                    P  ++  +    
Sbjct  1    QLSIKARRNCSNNGVAQVVAASWSNNHAVPDF---------------TPAANAVDSSAFA  45

Query  421  vlvDNGSCSDPNVQIQDLAHAN-YASFLSSXGSVAVHAGE  537
             LV+N +C+D NVQI+ L   N YASFL+S GSVA+HAGE
Sbjct  46   PLVENAACNDENVQIEGLTGVNKYASFLNSDGSVAIHAGE  85



>ref|XP_009147397.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Brassica 
rapa]
Length=530

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = +1

Query  199  LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaaaaai  378
            + S+ILRFPPNFVRQLSIKARRN SNIGVAQIVAA WSNN  +SG+P AA A  + +AA 
Sbjct  41   IPSMILRFPPNFVRQLSIKARRNFSNIGVAQIVAAKWSNN-PSSGLPSAAAAASSVSAAA  99

Query  379  sppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAGE  537
            S P  ++P       + +    ++   +I  L   +  SFLSS GS+ VHAGE
Sbjct  100  SAPAAAAPPVVALNGVDEEVVAAEGAREI-GLKKDSKPSFLSSDGSLTVHAGE  151



>gb|EMT23437.1| Cystathionine gamma-synthase, chloroplastic [Aegilops tauschii]
Length=507

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  163  PNSLSQGSRGYGLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAAS  330
            P S +  + G   S+ ILRFPPNFVRQLS KARRNCSNIGVAQIVAA+WS+ +A +
Sbjct  9    PASFAGDNSGALTSATILRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSDRRAVT  64



>ref|XP_004136690.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN59542.1| hypothetical protein Csa_3G824870 [Cucumis sativus]
Length=543

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 55/86 (64%), Gaps = 4/86 (5%)
 Frame = +1

Query  55   MAISSCSTVF-PSFECRSDPDFS-GRVPRHECPGA-GLRPNSLSQGSRGYGLSSL-ILRF  222
            MA+SS + +  P+F+CRSDP  +     R    G     P S+      +GLSS  I +F
Sbjct  1    MAVSSHARLLSPTFDCRSDPVLALASAHRRNTYGRFAHEPKSVKGTVASHGLSSFPIFKF  60

Query  223  PPNFVRQLSIKARRNCSNIGVAQIVA  300
            PPNFVRQLS KARRNCSNIGVAQ+VA
Sbjct  61   PPNFVRQLSNKARRNCSNIGVAQVVA  86



>ref|XP_004984247.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Setaria 
italica]
Length=511

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +1

Query  157  LRPNSLSQGSRGYGLSS-LILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAA  327
            L P  +     G  LSS  ILRFPPNFVRQLS KARRNCSNIGVAQIVAA+WS+  AA
Sbjct  6    LTPQVVFSTESGGALSSATILRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSDRPAA  63



>ref|XP_004159653.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like, 
partial [Cucumis sativus]
Length=392

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 55/86 (64%), Gaps = 4/86 (5%)
 Frame = +1

Query  55   MAISSCSTVF-PSFECRSDPDFS-GRVPRHECPGA-GLRPNSLSQGSRGYGLSSL-ILRF  222
            MA+SS + +  P+F+CRSDP  +     R    G     P S+      +GLSS  I +F
Sbjct  1    MAVSSHARLLSPTFDCRSDPVLALASAHRRNTYGRFAHEPKSVKGTVASHGLSSFPIFKF  60

Query  223  PPNFVRQLSIKARRNCSNIGVAQIVA  300
            PPNFVRQLS KARRNCSNIGVAQ+VA
Sbjct  61   PPNFVRQLSNKARRNCSNIGVAQVVA  86



>gb|AAS50161.1| chloroplast cystathionine-gamma-synthase [Arabidopsis thaliana]
Length=82

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  217  RFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNN  318
            RFPPNFVRQLSIKARRNCSNIGVAQIVA  WSNN
Sbjct  1    RFPPNFVRQLSIKARRNCSNIGVAQIVAGKWSNN  34



>gb|AFW87953.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_590146 [Zea 
mays]
Length=485

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +1

Query  157  LRPNSLSQGSRGYGLSS-LILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAA  327
            L P ++     G  L+S  ILRFPPNFVRQLS KARRNCSNIGVAQIVAA+WS+  AA
Sbjct  6    LTPQAVFSTESGGALASATILRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSDCPAA  63



>gb|AAB61348.1| cystathionine gamma-synthase [Zea mays]
Length=509

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +1

Query  157  LRPNSLSQGSRGYGLSS-LILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAA  327
            L P ++     G  L+S  ILRFPPNFVRQLS KARRNCSNIGVAQIVAA+WS+  AA
Sbjct  6    LTPQAVFSTESGGALASATILRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSDCPAA  63



>ref|NP_001104875.1| cystathionine gamma-synthase1 [Zea mays]
 gb|AAB61347.1| cystathionine gamma-synthase [Zea mays]
Length=509

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +1

Query  157  LRPNSLSQGSRGYGLSS-LILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAA  327
            L P ++     G  L+S  ILRFPPNFVRQLS KARRNCSNIGVAQIVAA+WS+  AA
Sbjct  6    LTPQAVFSTESGGALASATILRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSDCPAA  63



>dbj|BAE78433.1| cystathionine gamma-synthase precursor [Oryza sativa Japonica 
Group]
Length=135

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSN  315
            ILRFPPNFVRQLS KARRNCSNIGVAQIVAA+WS+
Sbjct  26   ILRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSD  60



>ref|NP_001130426.1| uncharacterized protein LOC100191523 [Zea mays]
 gb|ACF78628.1| unknown [Zea mays]
Length=481

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  157  LRPNSLSQGSRGYGLSS-LILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSN  315
            L P ++     G  L+S  ILRFPPNFVRQLS KARRNCSNIGVAQIVAA+WS+
Sbjct  6    LTPQAVFSTESGGALASATILRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSD  59



>dbj|BAJ84799.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  202  SSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAA  327
            S+ ILRFPPNFVRQLS KARRNCSNIGVAQIVAA+WS+  A 
Sbjct  22   SATILRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSDRSAV  63



>ref|XP_003557832.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Brachypodium 
distachyon]
Length=507

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  163  PNSLSQGSRGYGLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKA  324
            P S +   RG   S+ I RFPPNFVRQLS KARRNCSNIGVAQIVAA+WS+  A
Sbjct  9    PPSFAGDKRGGLTSATIGRFPPNFVRQLSTKARRNCSNIGVAQIVAAAWSDRSA  62



>ref|XP_001772529.1| predicted protein [Physcomitrella patens]
 gb|EDQ62571.1| predicted protein [Physcomitrella patens]
Length=532

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  82   FPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNFVRQLSIKAR  261
             PS      PD SG     +    G     L+  S+G+     I RFPPNFVRQ SIKAR
Sbjct  1    MPSVGYEHRPDASGGAASGKSGLGGGDKTPLNIASKGFFCPPCITRFPPNFVRQSSIKAR  60

Query  262  RNCSNIGVAQIVAASWSN  315
            RNCSNIGVAQ+VAAS ++
Sbjct  61   RNCSNIGVAQVVAASATD  78



>ref|XP_008443381.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Cucumis 
melo]
Length=544

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = +1

Query  55   MAISSCSTVF-PSFECRSDPDFSGRVPRHECPGAGL---RPNSLSQGSRGYGLSSL-ILR  219
            MA+SS + +  P+F+ RS          H     G     P S+      +GLSS  I +
Sbjct  1    MAVSSHARLLSPTFDSRSSDPLLAVASAHRRNTYGRFAHEPKSVKGTVASHGLSSFPIFK  60

Query  220  FPPNFVRQLSIKARRNCSNIGVAQIVA  300
            FPPNFVRQLS KARRNCSNIGVAQ+VA
Sbjct  61   FPPNFVRQLSNKARRNCSNIGVAQVVA  87



>ref|XP_002983120.1| hypothetical protein SELMODRAFT_155550 [Selaginella moellendorffii]
 gb|EFJ15929.1| hypothetical protein SELMODRAFT_155550 [Selaginella moellendorffii]
Length=467

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  208  LILRFPPNFVRQLSIKARRNCSNIGVAQIVAAS  306
            +ILRFPPNF RQLS+K+RRNCSNIGVAQ+VAAS
Sbjct  1    MILRFPPNFARQLSVKSRRNCSNIGVAQVVAAS  33



>ref|XP_002965872.1| hypothetical protein SELMODRAFT_143363 [Selaginella moellendorffii]
 gb|EFJ33292.1| hypothetical protein SELMODRAFT_143363 [Selaginella moellendorffii]
Length=466

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  208  LILRFPPNFVRQLSIKARRNCSNIGVAQIVAAS  306
            +ILRFPPNF RQLS+K+RRNCSNIGVAQ+VAAS
Sbjct  1    MILRFPPNFARQLSVKSRRNCSNIGVAQVVAAS  33



>ref|XP_001761633.1| predicted protein [Physcomitrella patens]
 gb|EDQ73701.1| predicted protein [Physcomitrella patens]
Length=526

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  82   FPSFECRSDPDFSGRVPRHECPGAGLRPNSLSQGSRGYGLSSLILRFPPNFVRQLSIKAR  261
             PS      PD SG     +    G     ++   +G+     I RFPPNFVRQ SIKAR
Sbjct  1    MPSAGYEYRPDASGGAASGKSGFGGSEQVPVNVARKGFFCPPCITRFPPNFVRQSSIKAR  60

Query  262  RNCSNIGVAQIVAASWSN  315
            RNCSNIGVAQ+VAAS ++
Sbjct  61   RNCSNIGVAQVVAASATD  78



>gb|ABF96221.1| Cys/Met metabolism PLP-dependent enzyme family protein, expressed 
[Oryza sativa Japonica Group]
Length=502

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQIVAAS  306
            ILRFPPNFVRQLS KARRNCSNIGVAQI  A 
Sbjct  26   ILRFPPNFVRQLSTKARRNCSNIGVAQIATAE  57



>gb|AAL82522.1|AC084766_8 putative cystathionine gamma synthase [Oryza sativa Japonica 
Group]
Length=446

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  211  ILRFPPNFVRQLSIKARRNCSNIGVAQI  294
            ILRFPPNFVRQLS KARRNCSNIGVAQI
Sbjct  26   ILRFPPNFVRQLSTKARRNCSNIGVAQI  53



>emb|CDX90997.1| BnaC02g06000D [Brassica napus]
Length=490

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 56/116 (48%), Gaps = 19/116 (16%)
 Frame = +1

Query  190  GYG-LSSLILRFPPNFVRQLSIKARRNCSNIGVAQIVAASWSNNKAASGIppaakaldaa  366
            GYG +SS ILRFPPN  RQLS KAR NC N  VAQ V A WSN+   SG+          
Sbjct  23   GYGRVSSFILRFPPNIARQLSTKARGNC-NFSVAQTVVAKWSNS-TRSGLTSVPAVTSVD  80

Query  367  aaaisppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAG  534
               +   E    +                +++ +D+ H    SFL S GS+ VHAG
Sbjct  81   EEVLVAAESVKEMV---------------SIKSEDVTHMK-PSFLKSDGSLTVHAG  120



>gb|AAF64422.1|AF206626_1 cystathionine-gamma synthase [Cucumis melo]
Length=81

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 45/81 (56%), Gaps = 5/81 (6%)
 Frame = +1

Query  55   MAISSCSTVF-PSFECRSDPDFSGRVPRHECPGAGL---RPNSLSQGSRGYGLSSL-ILR  219
            MA+SS + +  P+F+ RS          H     G     P S+      +GLSS  I +
Sbjct  1    MAVSSHARLLSPTFDSRSSDPLLAVASAHRRNTYGRFAHEPKSVKGTVASHGLSSFPIFK  60

Query  220  FPPNFVRQLSIKARRNCSNIG  282
            FPPNFVRQLS KARRNCSNIG
Sbjct  61   FPPNFVRQLSNKARRNCSNIG  81



>ref|XP_007024261.1| Uncharacterized protein TCM_028849 [Theobroma cacao]
 gb|EOY26883.1| Uncharacterized protein TCM_028849 [Theobroma cacao]
Length=168

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  196  GLSSLILRFPPNFVRQLSIKARRNCSNIGVAQIV  297
            GLSSLI RF P FVRQLSIKA  NCSNIGV QIV
Sbjct  46   GLSSLIFRFSPKFVRQLSIKACPNCSNIGVPQIV  79



>ref|XP_010453667.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010453668.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=520

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 53/121 (44%), Gaps = 25/121 (21%)
 Frame = +1

Query  178  QGSRGYGLSSLILRFPPNFVRQLSIKARR-NCSNIGVAQIVAASWSNNKAASGIppaaka  354
            Q S   G S + LRFPP   + LS KARR NCSNIG AQI AA WSNN  +         
Sbjct  17   QPSSFTGNSPINLRFPP--CQLLSSKARRRNCSNIGAAQIFAARWSNNPGSG--------  66

Query  355  ldaaaaaisppevsspvaeeevvlvDNGSCSDPNVQIQDLAHANYASFLSSXGSVAVHAG  534
                             A     L +     +   +I +L      SFL S GS+ +HAG
Sbjct  67   --------------LASAPAASSLSEEVLVDEEVKEIVELEEDFKLSFLKSDGSLTIHAG  112

Query  535  E  537
            E
Sbjct  113  E  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800