BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002N06

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB84163.1|  hypothetical protein B456_N007500                       167   2e-61   Gossypium raimondii
gb|KJB84159.1|  hypothetical protein B456_N007500                       167   2e-61   Gossypium raimondii
gb|KJB84164.1|  hypothetical protein B456_N007500                       167   4e-61   Gossypium raimondii
gb|KJB84165.1|  hypothetical protein B456_N007500                       167   4e-61   Gossypium raimondii
ref|XP_006365673.1|  PREDICTED: dnaJ protein homolog isoform X2         169   3e-60   
ref|XP_010651845.1|  PREDICTED: dnaJ protein homolog isoform X2         167   1e-59   
gb|KHG01500.1|  Chaperone dnaJ 3 -like protein                          167   3e-58   Gossypium arboreum [tree cotton]
gb|ABG78615.1|  J-domain protein                                        167   1e-57   Triticum aestivum [Canadian hard winter wheat]
emb|CDP09461.1|  unnamed protein product                                160   2e-57   Coffea canephora [robusta coffee]
gb|AGY48885.1|  MIP1.3                                                  171   8e-57   Nicotiana benthamiana
gb|AAD12055.1|  DnaJ protein                                            168   1e-56   Hevea brasiliensis [jebe]
gb|ABX57881.1|  DnaJ                                                    170   2e-56   Viola baoshanensis
ref|XP_009793841.1|  PREDICTED: dnaJ protein homolog isoform X1         169   2e-56   Nicotiana sylvestris
dbj|BAA35121.1|  DnaJ homolog                                           166   2e-56   Salix gilgiana
ref|XP_002466747.1|  hypothetical protein SORBIDRAFT_01g013390          171   4e-56   Sorghum bicolor [broomcorn]
gb|AAX95135.1|  DnaJ protein, putative                                  171   4e-56   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050779.1|  Os03g0648400                                       171   5e-56   
emb|CDO99946.1|  unnamed protein product                                169   5e-56   Coffea canephora [robusta coffee]
ref|XP_004249937.1|  PREDICTED: dnaJ protein homolog                    168   6e-56   
ref|XP_006365672.1|  PREDICTED: dnaJ protein homolog isoform X1         168   6e-56   
ref|NP_001130317.1|  chaperone DNA J2                                   171   7e-56   Zea mays [maize]
gb|AGY48884.1|  MIP1.2                                                  169   7e-56   Nicotiana benthamiana
gb|EMT10718.1|  DnaJ protein-like protein                               161   7e-56   
dbj|BAJ91943.1|  predicted protein                                      161   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011024143.1|  PREDICTED: dnaJ protein homolog                    168   1e-55   Populus euphratica
ref|XP_009600920.1|  PREDICTED: dnaJ protein homolog                    168   1e-55   Nicotiana tomentosiformis
ref|XP_004981504.1|  PREDICTED: dnaJ protein homolog                    169   1e-55   Setaria italica
ref|XP_002316479.1|  DnaJ family protein                                168   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_006378828.1|  hypothetical protein POPTR_0010s24930g             168   1e-55   
ref|XP_009766164.1|  PREDICTED: dnaJ protein homolog 2-like             169   1e-55   Nicotiana sylvestris
ref|XP_009408520.1|  PREDICTED: dnaJ protein homolog isoform X1         162   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB60379.1|  hypothetical protein B456_009G302500                    171   2e-55   Gossypium raimondii
ref|XP_006445792.1|  hypothetical protein CICLE_v10015385mg             170   2e-55   Citrus clementina [clementine]
ref|XP_006485485.1|  PREDICTED: dnaJ protein homolog                    170   2e-55   Citrus sinensis [apfelsine]
ref|NP_001234241.1|  DnaJ-like protein                                  168   3e-55   
ref|XP_002514419.1|  Chaperone protein dnaJ, putative                   170   4e-55   
ref|XP_010907982.1|  PREDICTED: dnaJ protein homolog                    170   4e-55   Elaeis guineensis
ref|NP_001051497.1|  Os03g0787300                                       167   4e-55   
ref|XP_004306421.1|  PREDICTED: dnaJ protein homolog                    164   5e-55   Fragaria vesca subsp. vesca
ref|XP_010248011.1|  PREDICTED: dnaJ protein homolog 2-like             164   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010053981.1|  PREDICTED: dnaJ protein homolog                    166   6e-55   Eucalyptus grandis [rose gum]
ref|XP_009418971.1|  PREDICTED: dnaJ protein homolog isoform X1         170   6e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001774283.1|  predicted protein                                  150   6e-55   
ref|XP_010907714.1|  PREDICTED: dnaJ protein homolog                    168   7e-55   Elaeis guineensis
gb|AGY48883.1|  MIP1.1b                                                 167   9e-55   Nicotiana benthamiana
ref|XP_009397426.1|  PREDICTED: dnaJ protein homolog                    171   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007010484.1|  DNAJ                                               170   1e-54   Theobroma cacao [chocolate]
gb|KJB09149.1|  hypothetical protein B456_001G126200                    147   1e-54   Gossypium raimondii
gb|EAY92107.1|  hypothetical protein OsI_13813                          167   2e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_011008853.1|  PREDICTED: dnaJ protein homolog isoform X2         167   2e-54   Populus euphratica
ref|XP_010090486.1|  DnaJ-like protein                                  168   2e-54   Morus notabilis
ref|XP_008231805.1|  PREDICTED: dnaJ protein homolog                    168   2e-54   Prunus mume [ume]
ref|XP_007211787.1|  hypothetical protein PRUPE_ppa006330mg             168   2e-54   Prunus persica
ref|XP_006650701.1|  PREDICTED: dnaJ protein homolog 2-like             167   2e-54   Oryza brachyantha
ref|XP_007052233.1|  DNAJ                                               165   3e-54   Theobroma cacao [chocolate]
ref|XP_011084248.1|  PREDICTED: dnaJ protein homolog                    166   4e-54   Sesamum indicum [beniseed]
ref|XP_010031320.1|  PREDICTED: dnaJ protein homolog                    167   4e-54   Eucalyptus grandis [rose gum]
ref|XP_008443634.1|  PREDICTED: dnaJ protein homolog                    168   4e-54   Cucumis melo [Oriental melon]
ref|XP_003561819.1|  PREDICTED: dnaJ protein homolog                    173   4e-54   Brachypodium distachyon [annual false brome]
gb|EYU37228.1|  hypothetical protein MIMGU_mgv1a006942mg                146   4e-54   Erythranthe guttata [common monkey flower]
gb|ABI83623.1|  DnaJ-like protein                                       171   5e-54   Setaria italica
ref|XP_004982304.1|  PREDICTED: dnaJ protein homolog 2-like             171   6e-54   Setaria italica
gb|EPS59846.1|  hypothetical protein M569_14958                         149   8e-54   Genlisea aurea
ref|XP_009418972.1|  PREDICTED: dnaJ protein homolog isoform X2         170   8e-54   
ref|XP_009793842.1|  PREDICTED: dnaJ protein homolog isoform X2         170   1e-53   Nicotiana sylvestris
ref|XP_002270362.1|  PREDICTED: dnaJ protein homolog isoform X1         167   1e-53   Vitis vinifera
ref|XP_006590333.1|  PREDICTED: uncharacterized protein LOC100808...    168   1e-53   
ref|NP_001238341.1|  seed maturation protein PM37                       168   1e-53   Glycine max [soybeans]
ref|XP_004169945.1|  PREDICTED: dnaJ protein homolog                    164   1e-53   
gb|EMT20603.1|  DnaJ protein-like protein                               171   2e-53   
gb|EMS59985.1|  Chaperone protein dnaJ 2                                171   2e-53   Triticum urartu
ref|XP_008446732.1|  PREDICTED: dnaJ protein homolog                    164   2e-53   Cucumis melo [Oriental melon]
gb|KDP22008.1|  hypothetical protein JCGZ_03128                         164   2e-53   Jatropha curcas
emb|CBI28261.3|  unnamed protein product                                167   2e-53   Vitis vinifera
gb|AAG24642.1|AF308737_1  J1P                                           168   2e-53   Daucus carota [carrots]
ref|XP_009406563.1|  PREDICTED: dnaJ protein homolog                    169   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001755408.1|  predicted protein                                  152   2e-53   
gb|KDO85584.1|  hypothetical protein CISIN_1g014800mg                   156   2e-53   Citrus sinensis [apfelsine]
ref|XP_009588725.1|  PREDICTED: dnaJ protein homolog                    167   3e-53   
gb|AFR66645.1|  MIP1.1a                                                 166   3e-53   Nicotiana benthamiana
ref|XP_010089281.1|  DnaJ-like protein                                  155   3e-53   Morus notabilis
ref|XP_010933633.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    164   4e-53   Elaeis guineensis
ref|XP_004239737.1|  PREDICTED: dnaJ protein homolog                    160   4e-53   Solanum lycopersicum
ref|XP_010089798.1|  DnaJ-like protein                                  137   4e-53   
ref|XP_009623415.1|  PREDICTED: dnaJ protein homolog                    160   5e-53   Nicotiana tomentosiformis
ref|XP_009398344.1|  PREDICTED: dnaJ protein homolog 2-like             165   8e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010933632.1|  PREDICTED: dnaJ protein homolog isoform X1         164   1e-52   Elaeis guineensis
ref|XP_002313505.1|  seed maturation protein PM37                       167   1e-52   Populus trichocarpa [western balsam poplar]
ref|NP_001267695.1|  dnaJ protein homolog                               161   1e-52   Cucumis sativus [cucumbers]
gb|ABI18985.1|  molecular chaperone DjA2                                168   1e-52   Allium ampeloprasum
ref|XP_011032891.1|  PREDICTED: dnaJ protein homolog                    159   1e-52   Populus euphratica
gb|KDO85583.1|  hypothetical protein CISIN_1g014800mg                   155   1e-52   Citrus sinensis [apfelsine]
ref|XP_011008852.1|  PREDICTED: dnaJ protein homolog isoform X1         167   1e-52   Populus euphratica
ref|XP_006445376.1|  hypothetical protein CICLE_v10020330mg             155   1e-52   Citrus clementina [clementine]
gb|ACN39991.1|  unknown                                                 161   2e-52   Picea sitchensis
ref|NP_001168650.1|  putative dnaJ chaperone family protein             158   2e-52   Zea mays [maize]
ref|XP_002310999.1|  DnaJ family protein                                159   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_004953339.1|  PREDICTED: dnaJ protein homolog 2-like             157   3e-52   Setaria italica
gb|KDP42967.1|  hypothetical protein JCGZ_23909                         167   4e-52   Jatropha curcas
ref|XP_011017419.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    156   5e-52   Populus euphratica
ref|XP_010258832.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    158   5e-52   Nelumbo nucifera [Indian lotus]
ref|NP_001047626.1|  Os02g0656500                                       159   6e-52   
gb|EEC73725.1|  hypothetical protein OsI_08334                          159   6e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_008787761.1|  PREDICTED: dnaJ protein homolog                    159   6e-52   Phoenix dactylifera
gb|AFW67420.1|  putative dnaJ chaperone family protein                  158   7e-52   
emb|CAA63965.1|  DnaJ protein                                           158   1e-51   Solanum tuberosum [potatoes]
gb|EEE57509.1|  hypothetical protein OsJ_07792                          159   1e-51   Oryza sativa Japonica Group [Japonica rice]
gb|AFW67421.1|  putative dnaJ chaperone family protein                  158   1e-51   
ref|XP_002263156.1|  PREDICTED: dnaJ protein homolog                    158   1e-51   Vitis vinifera
gb|EMS60670.1|  DnaJ protein-like protein                               147   1e-51   Triticum urartu
gb|ABA46776.1|  DnaJ-like protein                                       157   3e-51   Solanum tuberosum [potatoes]
ref|XP_006345881.1|  PREDICTED: dnaJ protein homolog                    157   3e-51   Solanum tuberosum [potatoes]
gb|ABB16980.1|  DnaJ-like protein                                       157   4e-51   Solanum tuberosum [potatoes]
ref|NP_001275059.1|  DnaJ-like protein                                  157   5e-51   Solanum tuberosum [potatoes]
ref|NP_001136581.1|  putative dnaJ chaperone family protein             155   6e-51   Zea mays [maize]
ref|XP_008375557.1|  PREDICTED: dnaJ protein homolog                    158   7e-51   
gb|AAF64454.1|AF239932_1  DnaJ protein                                  156   9e-51   Euphorbia esula [wolf's milk]
gb|ACU24346.1|  unknown                                                 149   1e-50   Glycine max [soybeans]
ref|XP_003521084.1|  PREDICTED: dnaJ protein homolog 2-like             149   1e-50   Glycine max [soybeans]
ref|XP_007015641.1|  DNAJ isoform 2                                     162   1e-50   
ref|XP_002454540.1|  hypothetical protein SORBIDRAFT_04g032970          155   1e-50   Sorghum bicolor [broomcorn]
ref|XP_009341572.1|  PREDICTED: dnaJ protein homolog                    158   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_008345828.1|  PREDICTED: dnaJ protein homolog                    158   2e-50   Malus domestica [apple tree]
ref|XP_007015640.1|  DNAJ isoform 1                                     161   2e-50   
ref|XP_008803820.1|  PREDICTED: dnaJ protein homolog 2-like             157   2e-50   
ref|XP_007015642.1|  DNAJ isoform 3                                     161   2e-50   
ref|XP_008354864.1|  PREDICTED: dnaJ protein homolog                    158   3e-50   
ref|XP_006386554.1|  hypothetical protein POPTR_0002s14200g             152   6e-50   
ref|XP_002301248.1|  DnaJ family protein                                152   6e-50   
ref|XP_001782829.1|  predicted protein                                  150   6e-50   
ref|XP_001768102.1|  predicted protein                                  153   8e-50   
sp|P43644.1|DNJH_ATRNU  RecName: Full=DnaJ protein homolog ANJ1; ...    132   1e-49   Atriplex nummularia
dbj|BAD25681.1|  putative DnaJ-like protein MsJ1                        151   1e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003570021.1|  PREDICTED: dnaJ protein homolog 2-like             149   1e-49   Brachypodium distachyon [annual false brome]
gb|ACJ84518.1|  unknown                                                 150   1e-49   Medicago truncatula
ref|XP_003626730.1|  DnaJ protein-like protein                          150   1e-49   Medicago truncatula
emb|CAA04447.1|  DnaJ-like protein                                      150   1e-49   Medicago sativa [alfalfa]
ref|XP_003558043.1|  PREDICTED: dnaJ protein homolog                    152   2e-49   Brachypodium distachyon [annual false brome]
ref|XP_010919645.1|  PREDICTED: dnaJ protein homolog                    154   2e-49   Elaeis guineensis
ref|XP_003529049.1|  PREDICTED: dnaJ protein homolog 2-like             148   3e-49   Glycine max [soybeans]
ref|XP_002515865.1|  Chaperone protein dnaJ, putative                   159   4e-49   Ricinus communis
ref|XP_009408521.1|  PREDICTED: dnaJ protein homolog isoform X2         162   6e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK48766.1|  unknown                                                 148   6e-49   Medicago truncatula
ref|XP_006826444.1|  hypothetical protein AMTR_s00004p00172570          150   7e-49   Amborella trichopoda
gb|KDO48710.1|  hypothetical protein CISIN_1g015695mg                   129   7e-49   Citrus sinensis [apfelsine]
ref|XP_004236804.1|  PREDICTED: dnaJ protein homolog isoform X1         155   8e-49   Solanum lycopersicum
ref|XP_006367020.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    155   9e-49   Solanum tuberosum [potatoes]
ref|XP_010692097.1|  PREDICTED: dnaJ protein homolog 2-like             155   9e-49   Beta vulgaris subsp. vulgaris [field beet]
emb|CAH67501.1|  OSIGBa0134H18.3                                        152   1e-48   Oryza sativa [red rice]
ref|XP_007134513.1|  hypothetical protein PHAVU_010G053900g             146   1e-48   Phaseolus vulgaris [French bean]
ref|XP_010031575.1|  PREDICTED: dnaJ protein homolog                    159   1e-48   Eucalyptus grandis [rose gum]
ref|XP_008359180.1|  PREDICTED: dnaJ protein homolog                    135   2e-48   
emb|CDP15561.1|  unnamed protein product                                133   2e-48   Coffea canephora [robusta coffee]
ref|XP_009388365.1|  PREDICTED: dnaJ protein homolog                    166   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002969107.1|  hypothetical protein SELMODRAFT_267228             145   3e-48   Selaginella moellendorffii
gb|ABY52936.1|  DnaJ family heat shock protein                          152   3e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053485.1|  Os04g0549600                                       152   3e-48   
gb|KHG16063.1|  DnaJ protein                                            169   4e-48   Gossypium arboreum [tree cotton]
gb|AGY48887.1|  MIP1.4b                                                 152   5e-48   Nicotiana benthamiana
ref|NP_001146715.1|  uncharacterized protein LOC100280317               172   5e-48   
gb|AFW68140.1|  putative dnaJ chaperone family protein isoform 1        172   5e-48   
gb|KHG16062.1|  Chaperone protein dnaJ 3                                170   6e-48   Gossypium arboreum [tree cotton]
gb|KJB41003.1|  hypothetical protein B456_007G087000                    145   8e-48   Gossypium raimondii
gb|KHG17902.1|  Chaperone dnaJ 3 -like protein                          147   8e-48   Gossypium arboreum [tree cotton]
ref|XP_006345526.1|  PREDICTED: dnaJ protein homolog isoform X1         149   9e-48   Solanum tuberosum [potatoes]
ref|XP_006400711.1|  hypothetical protein EUTSA_v10013655mg             129   1e-47   Eutrema salsugineum [saltwater cress]
emb|CAC12824.1|  putative DNAJ protein                                  149   3e-47   Nicotiana tabacum [American tobacco]
gb|KJB35427.1|  hypothetical protein B456_006G117100                    145   3e-47   Gossypium raimondii
gb|EYU37227.1|  hypothetical protein MIMGU_mgv1a006922mg                145   4e-47   Erythranthe guttata [common monkey flower]
gb|KJB35426.1|  hypothetical protein B456_006G117100                    145   4e-47   Gossypium raimondii
gb|KHF97331.1|  Chaperone dnaJ 3 -like protein                          143   4e-47   Gossypium arboreum [tree cotton]
ref|XP_009411580.1|  PREDICTED: dnaJ protein homolog                    155   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB35429.1|  hypothetical protein B456_006G117100                    145   4e-47   Gossypium raimondii
gb|AGR45906.1|  DnaJ protein 2-like protein                             141   5e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002511620.1|  Chaperone protein dnaJ, putative                   145   5e-47   
gb|KJB35428.1|  hypothetical protein B456_006G117100                    145   5e-47   Gossypium raimondii
ref|XP_009382439.1|  PREDICTED: dnaJ protein homolog                    152   6e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004229763.1|  PREDICTED: dnaJ protein homolog 2-like             146   7e-47   Solanum lycopersicum
ref|XP_009789005.1|  PREDICTED: dnaJ protein homolog                    148   8e-47   Nicotiana sylvestris
emb|CDX70980.1|  BnaC03g10640D                                          135   9e-47   
ref|XP_010685460.1|  PREDICTED: dnaJ protein homolog ANJ1               151   1e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004976432.1|  PREDICTED: dnaJ protein homolog 2-like             146   1e-46   Setaria italica
ref|XP_006424068.1|  hypothetical protein CICLE_v10028531mg             143   1e-46   Citrus clementina [clementine]
ref|XP_002877319.1|  hypothetical protein ARALYDRAFT_905503             132   2e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_006650350.1|  PREDICTED: dnaJ protein homolog 2-like             168   3e-46   
ref|XP_009592511.1|  PREDICTED: dnaJ protein homolog                    149   3e-46   Nicotiana tomentosiformis
ref|XP_006837307.1|  hypothetical protein AMTR_s00111p00054240          138   3e-46   
gb|EYU36024.1|  hypothetical protein MIMGU_mgv1a007013mg                150   5e-46   Erythranthe guttata [common monkey flower]
ref|XP_009779099.1|  PREDICTED: dnaJ protein homolog                    148   1e-45   Nicotiana sylvestris
ref|XP_002983333.1|  hypothetical protein SELMODRAFT_118063             146   1e-45   Selaginella moellendorffii
ref|XP_010263053.1|  PREDICTED: dnaJ protein homolog                    140   2e-45   Nelumbo nucifera [Indian lotus]
gb|AAB86799.1|  putative                                                128   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568412.1|  chaperone protein dnaJ 2                              128   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004139085.1|  PREDICTED: dnaJ protein homolog                    139   3e-45   Cucumis sativus [cucumbers]
emb|CAD41609.2|  OSJNBb0034G17.1                                        143   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007132506.1|  hypothetical protein PHAVU_011G100000g             139   4e-45   Phaseolus vulgaris [French bean]
gb|AHA84223.1|  seed maturation protein PM37                            139   5e-45   Phaseolus vulgaris [French bean]
emb|CAI64493.1|  OSJNBa0065H10.16                                       143   7e-45   Oryza sativa Japonica Group [Japonica rice]
gb|AHA84264.1|  seed maturation protein PM37                            139   8e-45   Phaseolus vulgaris [French bean]
dbj|BAK03083.1|  predicted protein                                      141   9e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P42824.1|DNJH2_ALLPO  RecName: Full=DnaJ protein homolog 2; Fl...    139   9e-45   Allium ampeloprasum
ref|XP_008232370.1|  PREDICTED: dnaJ protein homolog 2-like             130   1e-44   Prunus mume [ume]
ref|XP_010263054.1|  PREDICTED: dnaJ protein homolog                    137   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_004487721.1|  PREDICTED: dnaJ protein homolog                    138   2e-44   Cicer arietinum [garbanzo]
gb|KDP36478.1|  hypothetical protein JCGZ_08608                         156   2e-44   Jatropha curcas
ref|XP_004251216.1|  PREDICTED: dnaJ protein homolog                    139   4e-44   Solanum lycopersicum
ref|NP_001242510.1|  uncharacterized protein LOC100808604               139   9e-44   
ref|XP_004506241.1|  PREDICTED: dnaJ protein homolog ANJ1-like          134   1e-43   Cicer arietinum [garbanzo]
gb|ACJ85213.1|  unknown                                                 153   1e-43   Medicago truncatula
ref|XP_010493266.1|  PREDICTED: chaperone protein dnaJ 2-like iso...    136   2e-43   Camelina sativa [gold-of-pleasure]
dbj|BAA76883.1|  DnaJ homolog protein                                   130   2e-43   Salix gilgiana
ref|XP_010694477.1|  PREDICTED: dnaJ protein homolog                    133   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006340318.1|  PREDICTED: dnaJ protein homolog ANJ1-like is...    139   2e-43   Solanum tuberosum [potatoes]
ref|XP_003596916.1|  DnaJ                                               138   2e-43   Medicago truncatula
ref|XP_007150008.1|  hypothetical protein PHAVU_005G118100g             133   2e-43   Phaseolus vulgaris [French bean]
gb|AES67168.2|  DnaJ-class molecular chaperone                          138   4e-43   Medicago truncatula
gb|KDO48711.1|  hypothetical protein CISIN_1g015695mg                   129   4e-43   Citrus sinensis [apfelsine]
ref|XP_009131855.1|  PREDICTED: chaperone protein dnaJ 3-like           123   5e-43   Brassica rapa
ref|XP_011093285.1|  PREDICTED: chaperone protein dnaJ 3-like           134   5e-43   Sesamum indicum [beniseed]
gb|KFK26344.1|  hypothetical protein AALP_AA8G235700                    122   6e-43   Arabis alpina [alpine rockcress]
gb|KDO48715.1|  hypothetical protein CISIN_1g015695mg                   129   6e-43   Citrus sinensis [apfelsine]
ref|XP_002446897.1|  hypothetical protein SORBIDRAFT_06g024520          159   8e-43   Sorghum bicolor [broomcorn]
ref|XP_008375745.1|  PREDICTED: dnaJ protein homolog 2-like             125   1e-42   Malus domestica [apple tree]
gb|AAD09517.1|  NTFP2                                                   150   1e-42   Nicotiana tabacum [American tobacco]
ref|XP_009622737.1|  PREDICTED: dnaJ protein homolog 2-like             157   2e-42   Nicotiana tomentosiformis
gb|AFK37703.1|  unknown                                                 134   2e-42   Medicago truncatula
ref|XP_004510114.1|  PREDICTED: dnaJ protein homolog 2-like             157   3e-42   Cicer arietinum [garbanzo]
ref|XP_006647627.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    157   3e-42   Oryza brachyantha
ref|XP_006647626.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    157   3e-42   Oryza brachyantha
ref|XP_003605980.1|  DnaJ                                               134   3e-42   Medicago truncatula
gb|ACJ85577.1|  unknown                                                 134   3e-42   Medicago truncatula
ref|XP_003605981.1|  DnaJ                                               134   3e-42   
ref|NP_001240264.1|  uncharacterized protein LOC100818805               134   4e-42   Glycine max [soybeans]
ref|XP_002874044.1|  hypothetical protein ARALYDRAFT_489058             129   4e-42   
gb|KHN17991.1|  DnaJ protein like                                       134   5e-42   Glycine soja [wild soybean]
ref|XP_003540271.1|  PREDICTED: dnaJ protein homolog                    134   5e-42   Glycine max [soybeans]
ref|XP_009368443.1|  PREDICTED: dnaJ protein homolog                    136   6e-42   Pyrus x bretschneideri [bai li]
ref|XP_011090296.1|  PREDICTED: dnaJ protein homolog                    135   7e-42   Sesamum indicum [beniseed]
ref|XP_008385581.1|  PREDICTED: dnaJ protein homolog                    136   7e-42   
ref|XP_011088982.1|  PREDICTED: dnaJ protein homolog                    135   8e-42   Sesamum indicum [beniseed]
ref|XP_007205259.1|  hypothetical protein PRUPE_ppa006299mg             136   1e-41   Prunus persica
ref|XP_008230416.1|  PREDICTED: dnaJ protein homolog                    136   1e-41   Prunus mume [ume]
gb|AAB49030.1|  DnaJ homolog                                            130   1e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AAK74013.1|  AT3g44110/F26G5_60                                      130   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189997.1|  chaperone protein dnaJ 3                              130   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535721.1|  PREDICTED: chaperone protein dnaJ 3                135   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_009760224.1|  PREDICTED: dnaJ protein homolog                    155   1e-41   Nicotiana sylvestris
ref|NP_850653.1|  chaperone protein dnaJ 3                              130   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002974881.1|  hypothetical protein SELMODRAFT_232411             125   2e-41   Selaginella moellendorffii
gb|KDO48709.1|  hypothetical protein CISIN_1g015695mg                   130   2e-41   Citrus sinensis [apfelsine]
ref|XP_002275918.1|  PREDICTED: dnaJ protein homolog 2                  125   2e-41   Vitis vinifera
tpg|DAA41207.1|  TPA: putative dnaJ chaperone family protein            128   4e-41   
emb|CAN64325.1|  hypothetical protein VITISV_005641                     124   4e-41   Vitis vinifera
ref|XP_006287824.1|  hypothetical protein CARUB_v10001042mg             130   4e-41   Capsella rubella
emb|CBI16632.3|  unnamed protein product                                125   4e-41   Vitis vinifera
gb|EYU36023.1|  hypothetical protein MIMGU_mgv1a007093mg                130   5e-41   Erythranthe guttata [common monkey flower]
ref|XP_010454471.1|  PREDICTED: chaperone protein dnaJ 2                129   6e-41   Camelina sativa [gold-of-pleasure]
ref|XP_001774301.1|  predicted protein                                  136   8e-41   
ref|XP_006347934.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    153   1e-40   
ref|XP_008361658.1|  PREDICTED: dnaJ protein homolog                    131   2e-40   
ref|XP_004307004.1|  PREDICTED: dnaJ protein homolog 2-like             122   2e-40   Fragaria vesca subsp. vesca
ref|XP_009336413.1|  PREDICTED: dnaJ protein homolog                    134   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_010544327.1|  PREDICTED: dnaJ protein homolog                    129   3e-40   Tarenaya hassleriana [spider flower]
ref|XP_004291531.1|  PREDICTED: dnaJ protein homolog                    125   6e-40   Fragaria vesca subsp. vesca
emb|CDY65546.1|  BnaCnng47600D                                          125   6e-40   Brassica napus [oilseed rape]
ref|XP_006404506.1|  hypothetical protein EUTSA_v10010407mg             130   7e-40   Eutrema salsugineum [saltwater cress]
sp|Q03363.1|DNJH1_ALLPO  RecName: Full=DnaJ protein homolog 1; Sh...    124   2e-39   Allium ampeloprasum
ref|XP_010514755.1|  PREDICTED: chaperone protein dnaJ 3-like           130   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010427107.1|  PREDICTED: chaperone protein dnaJ 3 isoform X1     130   2e-39   
ref|XP_006292339.1|  hypothetical protein CARUB_v10018551mg             130   2e-39   Capsella rubella
gb|AGY48888.1|  MIP1L1                                                  149   3e-39   Nicotiana benthamiana
ref|XP_009596179.1|  PREDICTED: dnaJ protein homolog                    149   5e-39   Nicotiana tomentosiformis
emb|CDX92385.1|  BnaA10g14240D                                          125   1e-38   
ref|XP_004291528.1|  PREDICTED: dnaJ protein homolog                    125   2e-38   Fragaria vesca subsp. vesca
gb|KDP28841.1|  hypothetical protein JCGZ_14612                         115   3e-38   Jatropha curcas
ref|XP_009120689.1|  PREDICTED: chaperone protein dnaJ 3-like           124   3e-38   Brassica rapa
emb|CDY09117.1|  BnaA02g05430D                                          126   4e-38   Brassica napus [oilseed rape]
ref|XP_010520679.1|  PREDICTED: chaperone protein dnaJ 3-like           125   4e-38   
gb|AAD09516.1|  NTFP1                                                   136   6e-38   Nicotiana tabacum [American tobacco]
ref|XP_007220469.1|  hypothetical protein PRUPE_ppa006364mg             110   1e-37   
ref|XP_004170446.1|  PREDICTED: dnaJ protein homolog                    137   3e-37   
ref|XP_009126521.1|  PREDICTED: chaperone protein dnaJ 3                122   5e-37   
emb|CCI48830.1|  unnamed protein product                                118   6e-37   
emb|CCI48831.1|  unnamed protein product                                118   7e-37   
emb|CCI48829.1|  unnamed protein product                                118   7e-37   
ref|XP_003058583.1|  predicted protein                                  117   1e-36   
gb|AGY48886.1|  MIP1.4a                                                 113   7e-36   
emb|CCI48832.1|  unnamed protein product                                114   1e-35   
emb|CCA21495.1|  conserved hypothetical protein                         116   4e-35   
emb|CAL36997.1|  DnaJ-like protein                                      107   8e-35   
ref|XP_009525521.1|  hypothetical protein PHYSODRAFT_345922             116   2e-34   
ref|XP_002507968.1|  predicted protein                                  110   3e-34   
ref|XP_005707432.1|  molecular chaperone DnaJ                           114   4e-34   
ref|XP_005819280.1|  hypothetical protein GUITHDRAFT_121532             131   6e-34   
gb|KHN36510.1|  DnaJ protein like                                       132   6e-34   
ref|XP_011457522.1|  PREDICTED: dnaJ protein homolog                    104   9e-34   
ref|XP_002900006.1|  conserved hypothetical protein                     114   1e-33   
ref|XP_008890293.1|  hypothetical protein PPTG_00631                    113   1e-33   
ref|XP_002364366.1|  DnaJ domain-containing protein                     110   2e-33   
ref|XP_007515206.1|  predicted protein                                  108   4e-33   
ref|XP_008885880.1|  DnaJ family chaperone, putative                    109   5e-33   
ref|XP_010521621.1|  PREDICTED: dnaJ protein homolog ANJ1-like          132   5e-33   
ref|XP_001419206.1|  predicted protein                                  112   1e-32   
emb|CDS21532.1|  dnaJ subfamily A                                     91.3    3e-32   
gb|EUB57005.1|  DnaJ subfamily A member                               91.3    3e-32   
emb|CDI97251.1|  dnaJ subfamily A                                     91.3    3e-32   
ref|XP_010420996.1|  PREDICTED: chaperone protein dnaJ 2 isoform X1     129   5e-32   
ref|XP_002734268.1|  PREDICTED: dnaJ homolog subfamily A member 1...  94.0    6e-32   
ref|XP_002963792.1|  hypothetical protein SELMODRAFT_230221             129   8e-32   
emb|CAN82708.1|  hypothetical protein VITISV_000291                   88.2    4e-31   
ref|XP_005852710.1|  DnaJ subfamily A member 2-like protein             110   4e-31   
ref|XP_003080911.1|  DnaJ-like protein (ISS)                            105   4e-31   
emb|CDS28557.1|  dnaJ subfamily A                                     89.7    5e-31   
ref|XP_008607517.1|  hypothetical protein SDRG_03658                    105   6e-31   
emb|CBK20067.2|  unnamed protein product                                107   8e-31   
ref|XP_009120690.1|  PREDICTED: chaperone protein dnaJ 3-like           125   1e-30   
emb|CDX92386.1|  BnaA10g14250D                                          125   1e-30   
ref|XP_007625571.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...  90.5    2e-30   
ref|XP_002949642.1|  molecular chaperone                                114   2e-30   
gb|KIZ04147.1|  putative DnaJ proteinJ1                                 107   2e-30   
ref|XP_007321427.1|  hypothetical protein SERLADRAFT_474282             100   3e-30   
ref|XP_011416044.1|  PREDICTED: dnaJ homolog subfamily A member 1...  91.7    4e-30   
gb|EWM24221.1|  HSP40/DnaJ heat shock protein                           107   4e-30   
emb|CDO70578.1|  hypothetical protein BN946_scf184636.g10               102   4e-30   
ref|XP_004553185.1|  PREDICTED: dnaJ homolog subfamily A member 1...  93.6    4e-30   
ref|XP_002426657.1|  protein tumorous imaginal discs, putative        91.3    4e-30   
gb|EKC32228.1|  DnaJ-like protein subfamily A member 1                91.3    5e-30   
emb|CDJ57769.1|  DnaJ domain-containing protein, putative               101   5e-30   
emb|CDI76051.1|  DnaJ domain-containing protein, putative               101   6e-30   
ref|XP_010618179.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...  92.4    7e-30   
emb|CDJ42592.1|  DnaJ domain-containing protein, putative               100   7e-30   
gb|ERE91501.1|  putative dnaJ subfamily A member 4-like protein       88.6    8e-30   
ref|NP_001080625.1|  DnaJ subfamily A member 2                        88.6    8e-30   
emb|CDJ62663.1|  DnaJ domain-containing protein, putative               100   8e-30   
ref|NP_001274228.1|  DnaJ (Hsp40) homolog, subfamily A, member 1      92.8    9e-30   
ref|XP_003885120.1|  DnaJ domain containing protein, related            100   1e-29   
ref|XP_007308701.1|  DnaJ-domain-containing protein                     102   1e-29   
gb|EGW13880.1|  DnaJ-like subfamily A member 1                        87.4    1e-29   
gb|KDQ59400.1|  hypothetical protein JAAARDRAFT_32961                   100   1e-29   
ref|XP_005707879.1|  molecular chaperone DnaJ                           107   1e-29   
ref|XP_005283531.1|  PREDICTED: dnaJ homolog subfamily A member 1     92.8    1e-29   
ref|XP_001691598.1|  DnaJ-like protein                                  112   1e-29   
emb|CCA68652.1|  probable YDJ1-mitochondrial and ER import protein    99.4    3e-29   
emb|CDI86776.1|  DnaJ domain-containing protein, putative             99.0    3e-29   
ref|XP_007057982.1|  PREDICTED: dnaJ homolog subfamily A member 1     91.3    3e-29   
ref|XP_006114888.1|  PREDICTED: dnaJ homolog subfamily A member 1     90.5    3e-29   
ref|XP_003224682.1|  PREDICTED: dnaJ homolog subfamily A member 1     90.9    4e-29   
ref|XP_010583355.1|  PREDICTED: dnaJ homolog subfamily A member 2...  91.7    5e-29   
ref|XP_004387526.1|  PREDICTED: dnaJ homolog subfamily A member 4     91.3    5e-29   
ref|XP_007520454.1|  PREDICTED: dnaJ homolog subfamily A member 4     93.6    5e-29   
emb|CAF98323.1|  unnamed protein product                              92.0    5e-29   
ref|NP_001005841.1|  dnaJ homolog subfamily A member 2                91.3    6e-29   
gb|KIK08123.1|  hypothetical protein K443DRAFT_128494                   103   6e-29   
emb|CDS05431.1|  hypothetical protein LRAMOSA07959                    92.4    6e-29   
ref|XP_002591298.1|  hypothetical protein BRAFLDRAFT_264103           83.2    6e-29   
gb|ELV10946.1|  Gamma-aminobutyric acid receptor subunit theta        89.4    7e-29   
gb|KIJ17275.1|  hypothetical protein PAXINDRAFT_162188                  100   7e-29   
ref|XP_005645695.1|  DnaJ-like protein                                  105   7e-29   
ref|XP_006789362.1|  PREDICTED: dnaJ homolog subfamily A member 1...  92.4    8e-29   
ref|XP_005490145.1|  PREDICTED: dnaJ homolog subfamily A member 2     89.4    8e-29   
ref|XP_008607516.1|  hypothetical protein SDRG_03657                  98.6    8e-29   
ref|XP_010727732.1|  PREDICTED: dnaJ homolog subfamily A member 4...  92.0    8e-29   
ref|XP_004833174.1|  DnaJ domain containing protein                   96.7    9e-29   
gb|KDO27145.1|  hypothetical protein SPRG_07853                       97.8    1e-28   
ref|XP_002260632.1|  DNAJ protein                                       107   1e-28   
ref|XP_001616597.1|  DnaJ domain containing protein                     107   1e-28   
gb|KDQ33681.1|  hypothetical protein PLEOSDRAFT_1099644                 104   1e-28   
ref|XP_009028927.1|  hypothetical protein HELRODRAFT_95902            87.8    1e-28   
gb|ETE71759.1|  DnaJ-like subfamily A member 1                        89.4    1e-28   
gb|AFS63890.1|  HSP40A1                                               89.4    1e-28   
ref|XP_005928809.1|  PREDICTED: dnaJ homolog subfamily A member 1...  91.7    1e-28   
gb|KFO76349.1|  DnaJ subfamily A member 1                             85.9    2e-28   
ref|XP_766227.1|  chaperone protein DnaJ                              97.4    2e-28   
ref|XP_005526438.1|  PREDICTED: dnaJ homolog subfamily A member 2     89.4    2e-28   
ref|XP_007478072.1|  PREDICTED: dnaJ homolog subfamily A member 4...  90.5    2e-28   
ref|XP_009559470.1|  PREDICTED: dnaJ homolog subfamily A member 1     85.9    2e-28   
ref|XP_001875492.1|  predicted protein                                  101   2e-28   
emb|CDJ47480.1|  DnaJ domain-containing protein, putative             98.2    2e-28   
ref|XP_009689477.1|  molecular chaperone protein                        105   2e-28   
ref|XP_006888325.1|  PREDICTED: dnaJ homolog subfamily A member 4...  91.7    2e-28   
gb|EMP27743.1|  DnaJ like protein subfamily A member 4                87.4    2e-28   
ref|XP_007427944.1|  PREDICTED: dnaJ homolog subfamily A member 1     89.4    2e-28   
ref|XP_007364587.1|  hypothetical protein DICSQDRAFT_135488           96.7    3e-28   
ref|XP_004581278.1|  PREDICTED: dnaJ homolog subfamily A member 1     89.4    3e-28   
ref|XP_007764824.1|  hypothetical protein CONPUDRAFT_87768              100   3e-28   
gb|AAI48160.1|  DNAJA1 protein                                        88.6    3e-28   
ref|XP_004047967.1|  PREDICTED: dnaJ homolog subfamily A member 1     89.0    3e-28   
ref|XP_954074.1|  molecular chaperone                                 96.7    3e-28   
ref|NP_001012963.1|  dnaJ homolog subfamily A member 1                89.0    3e-28   
ref|XP_005536699.1|  DnaJ homolog, subfamily A                        85.5    3e-28   
ref|NP_001187713.1|  DnaJ-like protein subfamily a member 4           88.2    3e-28   
ref|XP_001515385.1|  PREDICTED: dnaJ homolog subfamily A member 1...  89.4    4e-28   
pir||S34632  dnaJ protein homolog - human                             89.0    4e-28
ref|XP_005530024.1|  PREDICTED: dnaJ homolog subfamily A member 1     89.7    4e-28   
ref|XP_004417871.1|  PREDICTED: LOW QUALITY PROTEIN: DnaJ (Hsp40)...  88.6    4e-28   
ref|XP_005715007.1|  unnamed protein product                          99.8    4e-28   
ref|XP_009095019.1|  PREDICTED: dnaJ homolog subfamily A member 1     89.7    4e-28   
ref|NP_001079772.1|  DnaJ (Hsp40) homolog, subfamily A, member 4,...  87.8    4e-28   
ref|XP_005078961.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    4e-28   
ref|XP_010576416.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.6    4e-28   
ref|XP_009633561.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.6    5e-28   
ref|XP_009481817.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.6    5e-28   
ref|XP_005234859.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    5e-28   
ref|XP_004015779.1|  PREDICTED: dnaJ homolog subfamily A member 1...  88.6    5e-28   
ref|XP_011231823.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...  88.2    5e-28   
ref|XP_010138539.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    5e-28   
ref|XP_001362945.2|  PREDICTED: dnaJ homolog subfamily A member 4...  89.7    5e-28   
ref|XP_007668816.1|  PREDICTED: dnaJ homolog subfamily A member 1...  89.0    5e-28   
ref|XP_783657.1|  PREDICTED: dnaJ homolog subfamily A member 1-like   89.4    5e-28   
ref|XP_007668820.1|  PREDICTED: dnaJ homolog subfamily A member 1...  89.0    5e-28   
gb|EUT78884.1|  hypothetical protein PFAG_05460                         106   6e-28   
emb|CBJ30599.1|  Heat shock protein 40                                  104   6e-28   
ref|XP_010778685.1|  PREDICTED: dnaJ homolog subfamily A member 4     93.6    6e-28   
ref|XP_004817410.1|  PREDICTED: dnaJ homolog subfamily A member 1...  88.2    6e-28   
ref|XP_001348533.1|  HSP40, subfamily A, putative                       106   6e-28   
ref|XP_005859614.1|  PREDICTED: LOW QUALITY PROTEIN: DnaJ (Hsp40)...  88.2    6e-28   
ref|XP_004630503.1|  PREDICTED: dnaJ homolog subfamily A member 1...  88.2    6e-28   
ref|XP_008575009.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
ref|NP_001127102.1|  dnaJ homolog subfamily A member 1                88.2    6e-28   
ref|XP_008140395.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
ref|XP_004765430.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
ref|XP_008840705.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
ref|XP_006758656.1|  PREDICTED: dnaJ homolog subfamily A member 1...  88.2    6e-28   
sp|Q95JF4.1|DNAJ1_CHLAE  RecName: Full=DnaJ homolog subfamily A m...  88.2    6e-28   
ref|XP_004838448.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
ref|XP_004004198.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
ref|XP_007948882.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
gb|AAP88901.1|  DnaJ (Hsp40) homolog, subfamily A, member 1           88.2    6e-28   
ref|XP_004632072.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
ref|XP_008065754.1|  PREDICTED: dnaJ homolog subfamily A member 1     87.4    6e-28   
ref|XP_005684107.1|  PREDICTED: dnaJ homolog subfamily A member 1...  88.2    6e-28   
ref|XP_004275126.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
ref|NP_001530.1|  dnaJ homolog subfamily A member 1                   88.2    6e-28   
ref|XP_009454527.1|  PREDICTED: dnaJ homolog subfamily A member 1...  88.2    6e-28   
ref|XP_005967672.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
dbj|BAA02656.1|  DnaJ protein homolog                                 88.2    6e-28   
ref|XP_001101766.2|  PREDICTED: dnaJ homolog subfamily A member 1...  88.2    6e-28   
tpg|DAA12974.1|  TPA: DnaJ (Hsp40) homolog, subfamily A, member 1...  88.2    6e-28   
ref|XP_003939784.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
gb|KIL69507.1|  hypothetical protein M378DRAFT_20903                  97.1    6e-28   
ref|XP_003407365.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    6e-28   
ref|XP_007131167.1|  PREDICTED: LOW QUALITY PROTEIN: DnaJ (Hsp40)...  88.2    6e-28   
ref|NP_001231092.1|  dnaJ homolog subfamily A member 1                88.2    7e-28   
gb|KIP12385.1|  hypothetical protein PHLGIDRAFT_98388                 96.3    7e-28   
ref|XP_005730066.1|  PREDICTED: dnaJ homolog subfamily A member 1...  89.4    7e-28   
gb|KIK45919.1|  hypothetical protein CY34DRAFT_801078                 98.2    7e-28   
ref|NP_955956.1|  dnaJ homolog subfamily A member 1                   84.7    7e-28   
ref|XP_004485318.1|  PREDICTED: LOW QUALITY PROTEIN: DnaJ (Hsp40)...  88.2    8e-28   
ref|XP_004884251.1|  PREDICTED: dnaJ homolog subfamily A member 1...  88.2    8e-28   
ref|XP_006743045.1|  PREDICTED: dnaJ homolog subfamily A member 1     87.8    8e-28   
ref|XP_003761430.1|  PREDICTED: dnaJ homolog subfamily A member 1     87.4    8e-28   
emb|CDH52210.1|  mitochondrial protein import protein mas5            88.6    9e-28   
gb|AES12470.1|  heat shock protein 40                                 94.0    9e-28   
gb|KDD76066.1|  hypothetical protein H632_c371p1                        103   9e-28   
ref|XP_004398422.1|  PREDICTED: dnaJ homolog subfamily A member 1...  88.2    9e-28   
ref|XP_001364360.1|  PREDICTED: dnaJ homolog subfamily A member 1     87.4    9e-28   
ref|XP_006458405.1|  hypothetical protein AGABI2DRAFT_190689            100   9e-28   
gb|ERG81668.1|  hypothetical protein ASU_09837                        86.7    1e-27   
ref|XP_003440484.1|  PREDICTED: dnaJ homolog subfamily A member 1...  89.7    1e-27   
ref|XP_006027277.1|  PREDICTED: dnaJ homolog subfamily A member 4     85.5    1e-27   
ref|XP_006261401.1|  PREDICTED: dnaJ homolog subfamily A member 4     85.5    1e-27   
ref|NP_001079686.1|  DnaJ (Hsp40) homolog, subfamily A, member 2      80.1    1e-27   
dbj|BAE39284.1|  unnamed protein product                              87.0    1e-27   
ref|XP_007650186.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...  87.0    1e-27   
ref|NP_032324.1|  dnaJ homolog subfamily A member 1                   87.0    1e-27   
ref|XP_007950028.1|  PREDICTED: dnaJ homolog subfamily A member 4     91.3    1e-27   
gb|KIJ29865.1|  hypothetical protein M422DRAFT_214779                   100   1e-27   
ref|XP_006975392.1|  PREDICTED: dnaJ homolog subfamily A member 1...  87.0    1e-27   
ref|XP_010724478.1|  PREDICTED: dnaJ homolog subfamily A member 1     86.7    1e-27   
ref|XP_005822285.1|  hypothetical protein GUITHDRAFT_97880            95.1    1e-27   
ref|XP_008275021.1|  PREDICTED: dnaJ homolog subfamily A member 4...  84.7    1e-27   
gb|AAX46634.1|  DnaJ subfamily A member 2                             87.4    2e-27   
ref|XP_007399859.1|  hypothetical protein PHACADRAFT_262538           98.6    2e-27   
ref|NP_001232499.1|  putative DnaJ subfamily A member 1 variant 3     88.2    2e-27   
ref|XP_006098846.1|  PREDICTED: dnaJ homolog subfamily A member 1     86.7    2e-27   
gb|KDN47527.1|  putative YDJ1-mitochondrial and ER import protein       100   2e-27   
gb|EWC85742.1|  hypothetical protein PFNF54_05408                       104   2e-27   
ref|XP_003754938.1|  PREDICTED: dnaJ homolog subfamily A member 4     89.0    2e-27   
ref|XP_004398392.1|  PREDICTED: dnaJ homolog subfamily A member 1...  88.2    2e-27   
ref|XP_005692691.1|  PREDICTED: dnaJ homolog subfamily A member 1...  86.3    2e-27   
ref|XP_008982474.1|  PREDICTED: dnaJ homolog subfamily A member 4     90.9    2e-27   
ref|XP_002131998.1|  PREDICTED: dnaJ homolog subfamily A member 1...  85.1    2e-27   
ref|XP_007522933.1|  PREDICTED: dnaJ homolog subfamily A member 1     86.7    2e-27   
ref|XP_005514620.1|  PREDICTED: dnaJ homolog subfamily A member 1     86.3    2e-27   
gb|ETW28492.1|  hypothetical protein PFFCH_04123                        104   2e-27   
ref|XP_004628600.1|  PREDICTED: dnaJ homolog subfamily A member 1...  86.3    2e-27   
gb|KIJ69543.1|  hypothetical protein HYDPIDRAFT_172911                99.4    2e-27   
gb|KIM80921.1|  hypothetical protein PILCRDRAFT_97896                   100   2e-27   
ref|XP_004658437.1|  PREDICTED: dnaJ homolog subfamily A member 1     88.2    2e-27   
ref|XP_001507642.1|  PREDICTED: dnaJ homolog subfamily A member 2     87.0    2e-27   
ref|XP_007852278.1|  mitochondrial protein import protein mas5          103   2e-27   
ref|XP_007263805.1|  hypothetical protein FOMMEDRAFT_139033             100   2e-27   
ref|XP_004677774.1|  PREDICTED: dnaJ homolog subfamily A member 1     86.7    2e-27   
gb|EHH57321.1|  Heat shock 40 kDa protein 4                           88.2    2e-27   
ref|XP_006182764.1|  PREDICTED: dnaJ homolog subfamily A member 1     86.3    2e-27   
ref|XP_006749522.1|  PREDICTED: dnaJ homolog subfamily A member 1...  87.0    2e-27   
ref|NP_001015637.1|  dnaJ homolog subfamily A member 1                88.2    2e-27   
ref|XP_005069613.1|  PREDICTED: dnaJ homolog subfamily A member 4     90.5    2e-27   
ref|XP_006863089.1|  PREDICTED: dnaJ homolog subfamily A member 1     86.3    2e-27   
emb|CEF67628.1|  DnaJ-like-2                                          91.3    3e-27   



>gb|KJB84163.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=248

 Score =   167 bits (423),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN+KYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 95.1 bits (235),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG      R + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGNPFG-AGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|KJB84159.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84160.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84161.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84162.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84166.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   167 bits (422),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN+KYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 95.5 bits (236),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG      R + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGNPFG-AGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|KJB84164.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   167 bits (422),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN+KYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 94.7 bits (234),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG      R + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGNPFG-AGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|KJB84165.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=333

 Score =   167 bits (423),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN+KYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 94.4 bits (233),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG      R + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGNPFG-AGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_006365673.1| PREDICTED: dnaJ protein homolog isoform X2 [Solanum tuberosum]
Length=412

 Score =   169 bits (427),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 90.1 bits (222),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 47/64 (73%), Gaps = 6/64 (9%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG        Q+R        DV+HPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGGSSRARRQRR------GEDVIHPLKVSLEDLYNGTSKKLSLSRNVL  142

Query  510  CPKC  521
            C KC
Sbjct  143  CSKC  146



>ref|XP_010651845.1| PREDICTED: dnaJ protein homolog isoform X2 [Vitis vinifera]
Length=417

 Score =   167 bits (424),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYE LGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 89.0 bits (219),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PF  G   +  + +    DVVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGSPFAGGGSSRG-RRQRRGEDVVHPLKVSLEDLYIGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|KHG01500.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
 gb|KHG06497.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=318

 Score =   167 bits (423),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 84.7 bits (208),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  297  LRKEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGT  476
            L++    GGG HDPFDIFQSFFGGNPFG      R + +    DV+HPLKVSLEDLYNGT
Sbjct  78   LKEGMGSGGGGHDPFDIFQSFFGGNPFG-ASGSSRGRRQRRGEDVIHPLKVSLEDLYNGT  136

Query  477  SKKLSLSRN  503
            SKKLSLSRN
Sbjct  137  SKKLSLSRN  145



>gb|ABG78615.1| J-domain protein [Triticum aestivum]
Length=420

 Score =   167 bits (423),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSD+T+YYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 82.4 bits (202),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGX-XDVVHPLKVSLEDLYNGTS  479
            KE +GGGGMHDPFDIFQSFFGG    +G        +     DVVHPLKVSLE+LYNGTS
Sbjct  79   KEGMGGGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRRGEDVVHPLKVSLEELYNGTS  138

Query  480  KKLSLSRNVLCPKC  521
            KKLSL+RNVLC KC
Sbjct  139  KKLSLARNVLCSKC  152



>emb|CDP09461.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   160 bits (406),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP++S+N+KYYE+LGV K+ASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRRSNNSKYYEVLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKRE+YDQYGEDALKEGMGG
Sbjct  61   LSDPEKRELYDQYGEDALKEGMGG  84


 Score = 89.0 bits (219),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG+HDPFDIF+SFF       G+   R + K G  DVVH LKVSL+DLY GTSK
Sbjct  79   KEGMGGGGVHDPFDIFESFFSPLHRRDGF---RGRKKQGE-DVVHTLKVSLDDLYKGTSK  134

Query  483  KLSLSRNVLCPKC  521
            KLSLSRN LCPKC
Sbjct  135  KLSLSRNKLCPKC  147



>gb|AGY48885.1| MIP1.3 [Nicotiana benthamiana]
Length=418

 Score =   171 bits (432),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 76.3 bits (186),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G    R + +    DVVHPLKVSLED+YNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGEDVVHPLKVSLEDVYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CAKC  152



>gb|AAD12055.1| DnaJ protein [Hevea brasiliensis]
Length=415

 Score =   168 bits (425),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 78.6 bits (192),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 60/74 (81%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVG-GGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +G GGG HDPFDIFQSFFGGNPFG G   +  + K G  DV+HPLKVSLEDLYNGTS
Sbjct  79   KEGMGSGGGAHDPFDIFQSFFGGNPFGGGGSSRG-RRKEGE-DVIHPLKVSLEDLYNGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  137  KKLSLSRNVICSKC  150



>gb|ABX57881.1| DnaJ [Viola baoshanensis]
Length=417

 Score =   170 bits (431),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 75.9 bits (185),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG G   +  + + G  DVVHPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGNPFGGGGSSRGRRQRKGE-DVVHPLKVSLEDLYNGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_009793841.1| PREDICTED: dnaJ protein homolog isoform X1 [Nicotiana sylvestris]
Length=418

 Score =   169 bits (429),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 76.3 bits (186),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G    R + +    DVVHPLKVSLED+YNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGEDVVHPLKVSLEDVYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CTKC  152



>dbj|BAA35121.1| DnaJ homolog [Salix gilgiana]
Length=420

 Score =   166 bits (420),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYE+LGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 79.7 bits (195),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  315  GGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSL  494
            GG G HDPFDIFQSFFGG     G    R + +    DV+HPLKVS EDLYNGTSKKLSL
Sbjct  85   GGSGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRRGEDVIHPLKVSFEDLYNGTSKKLSL  144

Query  495  SRNVLCPKC  521
            SRNV+C KC
Sbjct  145  SRNVICSKC  153



>ref|XP_002466747.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
 gb|EER93745.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
Length=419

 Score =   171 bits (434),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 73.6 bits (179),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGGMH-DPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG H DPFDIF SFFG +  G G   +  + +    DVVHPLKVSLEDLYNGTS
Sbjct  79   KEGMGGGGAHVDPFDIFSSFFGPSFGGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYNGTS  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  138  KKLSLSRNVICSKC  151



>gb|AAX95135.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97900.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
Length=416

 Score =   171 bits (433),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 73.6 bits (179),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 4/74 (5%)
 Frame = +3

Query  303  KEWVGGGGMH-DPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG H DPFDIF SFFG +   +G    R + +    DV+HPLKVSLEDLYNGTS
Sbjct  79   KEGMGGGGSHVDPFDIFSSFFGPS---FGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTS  135

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNVLC KC
Sbjct  136  KKLSLSRNVLCAKC  149



>ref|NP_001050779.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|AAO72551.1| DNAJ-like protein [Oryza sativa Japonica Group]
 gb|AAU89194.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97899.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 gb|ABF97901.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12693.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|EAY94672.1| hypothetical protein OsI_16451 [Oryza sativa Indica Group]
 gb|EAZ27951.1| hypothetical protein OsJ_11911 [Oryza sativa Japonica Group]
 gb|ACA50510.1| DnaJ protein [Oryza sativa Japonica Group]
 dbj|BAG97073.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   171 bits (433),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 73.6 bits (179),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGGGMH-DPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG H DPFDIF SFFG +    G    R + +    DV+HPLKVSLEDLYNGTS
Sbjct  79   KEGMGGGGSHVDPFDIFSSFFGPS--FGGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNVLC KC
Sbjct  137  KKLSLSRNVLCAKC  150



>emb|CDO99946.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   169 bits (427),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPK+SDNTKYYE+LGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKRSDNTKYYEVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 75.9 bits (185),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +3

Query  297  LRKEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGT  476
            L++   GGGG+HDPFDIFQSFFGG+PFG G   +  + +    DV+HPLKVSLEDLYNGT
Sbjct  78   LKEGMGGGGGVHDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGT  136

Query  477  SKKLSLSRNVLCPKC  521
            SKKLSLSRNVLCPKC
Sbjct  137  SKKLSLSRNVLCPKC  151



>ref|XP_004249937.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   168 bits (426),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 75.9 bits (185),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQ-RPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNV  506
            HDPFDIFQSFFGG    +G     R + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV
Sbjct  89   HDPFDIFQSFFGGGGNPFGGGGSSRARRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNV  148

Query  507  LCPKC  521
            LC KC
Sbjct  149  LCSKC  153



>ref|XP_006365672.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum tuberosum]
Length=419

 Score =   168 bits (426),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 75.9 bits (185),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQ-RPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNV  506
            HDPFDIFQSFFGG    +G     R + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV
Sbjct  89   HDPFDIFQSFFGGGGSPFGGGGSSRARRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNV  148

Query  507  LCPKC  521
            LC KC
Sbjct  149  LCSKC  153



>ref|NP_001130317.1| chaperone DNA J2 [Zea mays]
 gb|AAC08009.1| DnaJ-related protein ZMDJ1 [Zea mays]
 gb|ACF78499.1| unknown [Zea mays]
 gb|ACG32917.1| dnaJ protein [Zea mays]
 gb|ACL53813.1| unknown [Zea mays]
 gb|ACN34490.1| unknown [Zea mays]
 gb|ACR38444.1| unknown [Zea mays]
 tpg|DAA50285.1| TPA: chaperone DNA J2 [Zea mays]
Length=419

 Score =   171 bits (433),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 72.8 bits (177),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGGMH-DPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG H DPFDIF SFFG +  G G   +  + +    DVVHPLKVSLEDLYNGTS
Sbjct  79   KEGMGGGGSHVDPFDIFSSFFGPSFGGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYNGTS  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  138  KKLSLSRNVICSKC  151



>gb|AGY48884.1| MIP1.2 [Nicotiana benthamiana]
Length=419

 Score =   169 bits (429),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN+KYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 74.3 bits (181),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG  FG G   +  + + G  DVVHPLKVSLEDLY+GTSKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGGFGGGGSSRGRRQRKGE-DVVHPLKVSLEDLYSGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|EMT10718.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   161 bits (408),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P KKSD+T+YYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGG  85


 Score = 82.8 bits (203),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGX-XDVVHPLKVSLEDLYNGTS  479
            KE +GGGGMHDPFDIFQSFFGG    +G        +     DVVHPLKVSLE+LYNGTS
Sbjct  80   KEGMGGGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRRGEDVVHPLKVSLEELYNGTS  139

Query  480  KKLSLSRNVLCPKC  521
            KKLSL+RNVLC KC
Sbjct  140  KKLSLARNVLCSKC  153



>dbj|BAJ91943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   161 bits (407),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 83/85 (98%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P KKSD+T+YYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGG  85


 Score = 82.4 bits (202),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGX-XDVVHPLKVSLEDLYNGTS  479
            KE +GGGGMHDPFDIFQSFFGG    +G        +     DVVHPLKVSLE+LYNGTS
Sbjct  80   KEGMGGGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRRGEDVVHPLKVSLEELYNGTS  139

Query  480  KKLSLSRNVLCPKC  521
            KKLSL+RNVLC KC
Sbjct  140  KKLSLARNVLCSKC  153



>ref|XP_011024143.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011024144.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=422

 Score =   168 bits (426),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 74.7 bits (182),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G    R + +    DV+HPLKVSLED+YNGTSKKLSLSRNV+
Sbjct  91   HDPFDIFQSFFGGGNPFGGGGSSRGRRQRRGEDVIHPLKVSLEDIYNGTSKKLSLSRNVI  150

Query  510  CPKC  521
            C KC
Sbjct  151  CSKC  154



>ref|XP_009600920.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009600921.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=417

 Score =   168 bits (425),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKR+IYDQYGEDALKEGMGG
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGG  84


 Score = 75.1 bits (183),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + + G  DVVHPLKVSLED+YNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGSPFGGGGSSRGRRQRKGE-DVVHPLKVSLEDVYNGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CAKC  151



>ref|XP_004981504.1| PREDICTED: dnaJ protein homolog [Setaria italica]
Length=418

 Score =   169 bits (429),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 73.6 bits (179),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G    R + +    DVVHPLKVSL++LYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGEDVVHPLKVSLDELYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|XP_002316479.1| DnaJ family protein [Populus trichocarpa]
 gb|ABK95315.1| unknown [Populus trichocarpa]
 gb|EEF02650.1| DnaJ family protein [Populus trichocarpa]
Length=422

 Score =   168 bits (425),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 74.7 bits (182),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G    R + +    DV+HPLKVSLED+YNGTSKKLSLSRNV+
Sbjct  91   HDPFDIFQSFFGGGNPFGGGGSSRGRRQRRGEDVIHPLKVSLEDIYNGTSKKLSLSRNVI  150

Query  510  CPKC  521
            C KC
Sbjct  151  CSKC  154



>ref|XP_006378828.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
 gb|ERP56625.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
Length=459

 Score =   168 bits (426),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 74.3 bits (181),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G    R + +    DV+HPLKVSLED+YNGTSKKLSLSRNV+
Sbjct  91   HDPFDIFQSFFGGGNPFGGGGSSRGRRQRRGEDVIHPLKVSLEDIYNGTSKKLSLSRNVI  150

Query  510  CPKC  521
            C KC
Sbjct  151  CSKC  154



>ref|XP_009766164.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
 ref|XP_009766166.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
Length=419

 Score =   169 bits (429),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN+KYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 73.2 bits (178),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG  FG G   +  + + G  DVVH LKVSLEDLYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGGFGGGGSSRGRRQRKGE-DVVHSLKVSLEDLYNGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_009408520.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   162 bits (409),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPK SD+T+YYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKTSDSTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGM  310
            LSDPEKREIYDQYGEDALKEGM
Sbjct  61   LSDPEKREIYDQYGEDALKEGM  82


 Score = 80.5 bits (197),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+SFFGG+PFG G   +  + +    D +HPLKVSLEDLY+G SKKLSLS+ V+
Sbjct  89   HNPFDIFESFFGGSPFGVGGSSRG-RRQRRGEDAIHPLKVSLEDLYSGISKKLSLSQKVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CQKC  151



>gb|KJB60379.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60380.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60381.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60382.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60383.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
Length=418

 Score =   171 bits (433),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 71.2 bits (173),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSLSRN++
Sbjct  89   HDPFDIFQSFFGGNPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNII  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_006445792.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
 gb|ESR59032.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
Length=416

 Score =   170 bits (431),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 72.0 bits (175),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+   +G    R + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGS--PFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  146

Query  510  CPKC  521
            C KC
Sbjct  147  CTKC  150



>ref|XP_006485485.1| PREDICTED: dnaJ protein homolog [Citrus sinensis]
Length=416

 Score =   170 bits (431),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 72.0 bits (175),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+   +G    R + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGS--PFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  146

Query  510  CPKC  521
            C KC
Sbjct  147  CTKC  150



>ref|NP_001234241.1| DnaJ-like protein [Solanum lycopersicum]
 gb|AAF28382.1|AF124139_1 DnaJ-like protein [Solanum lycopersicum]
Length=419

 Score =   168 bits (426),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 73.6 bits (179),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQ-RPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNV  506
            H+PFDIFQSFFGG    +G     R + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV
Sbjct  89   HEPFDIFQSFFGGGGNPFGGGGSSRVRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNV  148

Query  507  LCPKC  521
            LC KC
Sbjct  149  LCSKC  153



>ref|XP_002514419.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|ABH06547.1| molecular chaperone [Ricinus communis]
 gb|EEF47915.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   170 bits (430),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 71.6 bits (174),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  90   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|XP_010907982.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   170 bits (431),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNT+YYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRPPKKSDNTRYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 71.2 bits (173),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGNPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CQKC  151



>ref|NP_001051497.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|AAT75262.1| putative DnaJ like protein [Oryza sativa Japonica Group]
 gb|ABF99246.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13411.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|EAZ28837.1| hypothetical protein OsJ_12871 [Oryza sativa Japonica Group]
 dbj|BAG87697.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   167 bits (423),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYE+LGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 74.3 bits (181),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 56/74 (76%), Gaps = 4/74 (5%)
 Frame = +3

Query  303  KEWVG-GGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +G GGGMHDPFDIF SFFGG    +G    R + +    DVVHPLKVSLE+LYNGTS
Sbjct  79   KEGMGPGGGMHDPFDIFSSFFGGG---FGGGSSRGRRQRRGEDVVHPLKVSLEELYNGTS  135

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNVLC KC
Sbjct  136  KKLSLSRNVLCSKC  149



>ref|XP_004306421.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=410

 Score =   164 bits (415),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 81/85 (95%), Positives = 82/85 (96%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGR-APKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR  PKKSDN+KYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGVPKKSDNSKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGG  85


 Score = 77.4 bits (189),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 10/64 (16%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG        +          DV+HPLKVSLEDLY+GTSKKLSLSRN++
Sbjct  90   HDPFDIFQSFFGGGSRRQRRGE----------DVIHPLKVSLEDLYSGTSKKLSLSRNII  139

Query  510  CPKC  521
            C KC
Sbjct  140  CSKC  143



>ref|XP_010248011.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
 ref|XP_010248012.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
Length=417

 Score =   164 bits (416),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP+KSDNTKYYEILGV KNASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRKSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSD EKREIYDQYGEDALKEGMGG
Sbjct  61   LSDTEKREIYDQYGEDALKEGMGG  84


 Score = 76.6 bits (187),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG  H+PFDIF+SFFGG   G G  + R + +    DVVH LKVSLEDLYNGTS
Sbjct  79   KEGMGGGGASHNPFDIFESFFGGGFGGGGSSRGRRQKQG--EDVVHTLKVSLEDLYNGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN+LCPKC
Sbjct  137  KKLSLSRNILCPKC  150



>ref|XP_010053981.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW78355.1| hypothetical protein EUGRSUZ_D02530 [Eucalyptus grandis]
Length=433

 Score =   166 bits (421),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P+KSDNTKYYE+LGVPKNASQD+LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRVPRKSDNTKYYEVLGVPKNASQDELKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKR++YDQYGEDALKEGMGG
Sbjct  61   LSDPEKRDMYDQYGEDALKEGMGG  84


 Score = 74.7 bits (182),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 55/83 (66%), Gaps = 11/83 (13%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGW---------GWEQQRPKAKNGXXDVVHPLKVS  452
            KE +GGG   HDPFDIF+SFFGG+ F               +R + K G  DVV  LKVS
Sbjct  79   KEGMGGGSAGHDPFDIFESFFGGDSFFGGGFGGRFGGASSSRRRRQKQGE-DVVQVLKVS  137

Query  453  LEDLYNGTSKKLSLSRNVLCPKC  521
            LEDLYNGT KKLSLSRNVLCPKC
Sbjct  138  LEDLYNGTMKKLSLSRNVLCPKC  160



>ref|XP_009418971.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   170 bits (430),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKRE+YDQYGEDALKEGMGG
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGG  84


 Score = 71.2 bits (173),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIF SFFGG PFG G    R + +    DV+HPLKVSLEDLYNGTSK
Sbjct  79   KEGMGGGGGHDPFDIFSSFFGGGPFGGGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSK  138

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  139  KLSLSRNVICQKC  151



>ref|XP_001774283.1| predicted protein [Physcomitrella patens]
 gb|EDQ60919.1| predicted protein [Physcomitrella patens]
Length=417

 Score =   150 bits (379),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYE LGV K+ASQD+LK+AYRKAAIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSDNTKYYEALGVSKSASQDELKRAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKRE+YDQYGEDALKE
Sbjct  61   LSDPEKRELYDQYGEDALKE  80


 Score = 90.5 bits (223),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG H+PFDIF+SFFGG+ F  G  +   + +    DVVHPLKVSLEDLYNGTSK
Sbjct  79   KEGMGGGGGHNPFDIFESFFGGDSFPGGSGRGGSRRQRRGEDVVHPLKVSLEDLYNGTSK  138

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNVLC KC
Sbjct  139  KLSLSRNVLCSKC  151



>ref|XP_010907714.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=415

 Score =   168 bits (425),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 72.8 bits (177),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIFQSFFGGN   +G    R + +    DV+HPLKVSLEDLYNGTSK
Sbjct  79   KEGMGGGGGHDPFDIFQSFFGGN--PFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  137  KLSLSRNVICQKC  149



>gb|AGY48883.1| MIP1.1b [Nicotiana benthamiana]
Length=418

 Score =   167 bits (422),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK+AS +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 73.6 bits (179),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G    R + +    DVVHPLKVSL+DLYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGGGGGSSRGRRQKRGEDVVHPLKVSLDDLYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            CPKC
Sbjct  149  CPKC  152



>ref|XP_009397426.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=416

 Score =   171 bits (433),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPKNASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 68.9 bits (167),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG H+PFDIF+SFFGGNPFG G   +  + +    DV+HPLKVSLEDLYNGTSK
Sbjct  79   KEGMGGGGGHNPFDIFESFFGGNPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSK  137

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  138  KLSLSRNVICQKC  150



>ref|XP_007010484.1| DNAJ [Theobroma cacao]
 gb|EOY19294.1| DNAJ [Theobroma cacao]
Length=417

 Score =   170 bits (431),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 69.7 bits (169),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSLSRN++
Sbjct  89   HDPFDIFQSFFGGNPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNII  147

Query  510  CPKC  521
            C KC
Sbjct  148  CFKC  151



>gb|KJB09149.1| hypothetical protein B456_001G126200 [Gossypium raimondii]
Length=416

 Score =   147 bits (370),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNAS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 92.8 bits (229),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGG   HDPFDIF SFFGG+PFG    +   + +    DVVHPLKVSLEDLY GTS
Sbjct  79   KEGMGGGAAAHDPFDIFSSFFGGSPFGGASSRG--RRQRRGEDVVHPLKVSLEDLYLGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  137  KKLSLSRNVICSKC  150



>gb|EAY92107.1| hypothetical protein OsI_13813 [Oryza sativa Indica Group]
Length=417

 Score =   167 bits (423),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYE+LGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 72.0 bits (175),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 54/74 (73%), Gaps = 4/74 (5%)
 Frame = +3

Query  303  KEWVG-GGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +G GGGMHDP DI  SFFGG    +G    R + +    DVVHPLKVSLE+LYNGTS
Sbjct  79   KEGMGPGGGMHDPLDICSSFFGGG---FGGGSSRGRRQRRGEDVVHPLKVSLEELYNGTS  135

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNVLC KC
Sbjct  136  KKLSLSRNVLCSKC  149



>ref|XP_011008853.1| PREDICTED: dnaJ protein homolog isoform X2 [Populus euphratica]
Length=409

 Score =   167 bits (424),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGE+ALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGG  84


 Score = 71.6 bits (174),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 46/64 (72%), Gaps = 8/64 (13%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+SFFGG+  G    +          DVVHPLKVSLEDLY GTSKKLSL+RNV+
Sbjct  89   HNPFDIFESFFGGSSRGRRQRRGE--------DVVHPLKVSLEDLYLGTSKKLSLTRNVI  140

Query  510  CPKC  521
            C KC
Sbjct  141  CSKC  144



>ref|XP_010090486.1| DnaJ-like protein [Morus notabilis]
 gb|EXB39585.1| DnaJ-like protein [Morus notabilis]
Length=417

 Score =   168 bits (425),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYE+LGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTKYYEVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 71.2 bits (173),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DV+HPLKVSLEDLYNGT+KKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTAKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_008231805.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=417

 Score =   168 bits (425),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 70.9 bits (172),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSLSRN++
Sbjct  89   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNII  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_007211787.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
 gb|EMJ12986.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
Length=417

 Score =   168 bits (425),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 70.9 bits (172),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSLSRN++
Sbjct  89   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNII  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_006650701.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=418

 Score =   167 bits (423),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYE+LGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 71.6 bits (174),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVG-GGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +G GGGMHDPFDIF SFFGG   G+G    R + +    DVVHPLKVSL++LYNGTS
Sbjct  79   KEGMGPGGGMHDPFDIFSSFFGGG--GFGGGSSRGRRQRRGEDVVHPLKVSLDELYNGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  137  KKLSLSRNVICSKC  150



>ref|XP_007052233.1| DNAJ [Theobroma cacao]
 gb|EOX96390.1| DNAJ [Theobroma cacao]
Length=421

 Score =   165 bits (418),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRVPKKSDNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 73.2 bits (178),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGG   H+PFDIF+SFFGG  FG G   +  + K G  DVVH LKVSLEDLYNGT+
Sbjct  79   KEGMGGGASSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGE-DVVHSLKVSLEDLYNGTT  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN LC KC
Sbjct  138  KKLSLSRNALCSKC  151



>ref|XP_011084248.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
 ref|XP_011084249.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=418

 Score =   166 bits (420),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNASQDDLKKAYRK+AIKNHPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKSAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 72.0 bits (175),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+SFFGGNPFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  90   HNPFDIFESFFGGNPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            CPKC
Sbjct  149  CPKC  152



>ref|XP_010031320.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 ref|XP_010031321.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50579.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=417

 Score =   167 bits (424),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYY++LGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 70.5 bits (171),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DV+HPLKVSLEDLYNGTSKKL+LSRNV+
Sbjct  89   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLALSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_008443634.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   168 bits (426),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 69.7 bits (169),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIFQSFFGG+   +G    R + +    DVVHPLKVSLEDLY GTSK
Sbjct  79   KEGMGGGGGHDPFDIFQSFFGGS--PFGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTSK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  137  KLSLSRNVICSKC  149



>ref|XP_003561819.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   173 bits (438),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 65.1 bits (157),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  426  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCPKC  521
            DV+HPLK SLEDLYNGTSKKLSLSRNVLC KC
Sbjct  120  DVIHPLKASLEDLYNGTSKKLSLSRNVLCSKC  151



>gb|EYU37228.1| hypothetical protein MIMGU_mgv1a006942mg [Erythranthe guttata]
Length=425

 Score =   146 bits (369),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 76/81 (94%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P KKS+NTKYYEILGV KNAS DDLKKAYRK AIKNHPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRGPPKKSNNTKYYEILGVEKNASPDDLKKAYRKLAIKNHPDKGGDPEKFKEIAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VL+DPEKREIYDQYGEDALKE
Sbjct  61   VLNDPEKREIYDQYGEDALKE  81


 Score = 91.3 bits (225),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 52/66 (79%), Gaps = 2/66 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFG--GNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRN  503
            H+PFDIF+SFFG  GNPFG G   +  +      DVVHPLKVSL+DLYNGTSKKLSLSRN
Sbjct  91   HNPFDIFESFFGASGNPFGGGGGSRGQRRVRRGEDVVHPLKVSLDDLYNGTSKKLSLSRN  150

Query  504  VLCPKC  521
            VLCPKC
Sbjct  151  VLCPKC  156



>gb|ABI83623.1| DnaJ-like protein [Setaria italica]
Length=419

 Score =   171 bits (434),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 66.2 bits (160),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  426  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCPKC  521
            DVVHPLKVSLEDLYNGTSKKLSLSRNV+C KC
Sbjct  120  DVVHPLKVSLEDLYNGTSKKLSLSRNVICSKC  151



>ref|XP_004982304.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=419

 Score =   171 bits (433),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 66.2 bits (160),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  426  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCPKC  521
            DVVHPLKVSLEDLYNGTSKKLSLSRNV+C KC
Sbjct  120  DVVHPLKVSLEDLYNGTSKKLSLSRNVICSKC  151



>gb|EPS59846.1| hypothetical protein M569_14958, partial [Genlisea aurea]
Length=247

 Score =   149 bits (376),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN++YY+ILGVPK+AS DDLK+AYRKAAIKNHPDKGGDPEKFKEL+ AY+V
Sbjct  2    MFGRAPKKSDNSRYYDILGVPKSASPDDLKRAYRKAAIKNHPDKGGDPEKFKELSHAYDV  61

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIY+QYGEDALKE
Sbjct  62   LSDPEKREIYNQYGEDALKE  81


 Score = 87.8 bits (216),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+ FG G   +  + + G  D+V PLKVSLEDLY GTSKKLSLSRNV+
Sbjct  92   HDPFDIFSSFFGGSHFGAGGSSRGRRQRKGD-DLVQPLKVSLEDLYTGTSKKLSLSRNVI  150

Query  510  CPKC  521
            C KC
Sbjct  151  CSKC  154



>ref|XP_009418972.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   170 bits (430),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKRE+YDQYGEDALKEGMGG
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGG  84


 Score = 67.4 bits (163),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIF SFFGG PFG G   +  + +    DV+HPLKVSLEDLYNGTSK
Sbjct  79   KEGMGGGGGHDPFDIFSSFFGGGPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSK  137

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  138  KLSLSRNVICQKC  150



>ref|XP_009793842.1| PREDICTED: dnaJ protein homolog isoform X2 [Nicotiana sylvestris]
Length=412

 Score =   170 bits (430),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 67.0 bits (162),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 48/64 (75%), Gaps = 6/64 (9%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G  Q++        DVVHPLKVSLED+YNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGGSSRGRRQRK------GEDVVHPLKVSLEDVYNGTSKKLSLSRNVL  142

Query  510  CPKC  521
            C KC
Sbjct  143  CTKC  146



>ref|XP_002270362.1| PREDICTED: dnaJ protein homolog isoform X1 [Vitis vinifera]
 emb|CAN64692.1| hypothetical protein VITISV_030671 [Vitis vinifera]
Length=417

 Score =   167 bits (424),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYE LGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 68.9 bits (167),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DVVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYIGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_006590333.1| PREDICTED: uncharacterized protein LOC100808604 isoform X1 [Glycine 
max]
 gb|KHN13055.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   168 bits (425),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 68.6 bits (166),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIF SFFGG          R + +    DVVHPLKVSLEDLY GTSK
Sbjct  79   KEGMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTSK  138

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  139  KLSLSRNVICSKC  151



>ref|NP_001238341.1| seed maturation protein PM37 [Glycine max]
 gb|AAD51625.1|AF169022_1 seed maturation protein PM37 [Glycine max]
 gb|KHN21201.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   168 bits (425),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 68.6 bits (166),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIF SFFGG          R + +    DVVHPLKVSLEDLY GTSK
Sbjct  79   KEGMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTSK  138

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  139  KLSLSRNVICSKC  151



>ref|XP_004169945.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 sp|Q04960.1|DNJH_CUCSA RecName: Full=DnaJ protein homolog; AltName: Full=DNAJ-1; Flags: 
Precursor [Cucumis sativus]
 emb|CAA47925.1| cs DnaJ-1 [Cucumis sativus]
 gb|KGN52169.1| hypothetical protein Csa_5G613470 [Cucumis sativus]
Length=413

 Score =   164 bits (414),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 82/84 (98%), Gaps = 1/84 (1%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  59

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  60   LSDPEKREIYDQYGEDALKEGMGG  83


 Score = 72.4 bits (176),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIFQSFFGG+PFG G   +  + +    DV+HPLKVSLEDLYNGTSK
Sbjct  78   KEGMGGGGGHDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  137  KLSLSRNVICSKC  149



>gb|EMT20603.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   171 bits (433),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYE+LGVPKNA+QDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPKNAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 65.1 bits (157),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  333  DPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVLC  512
            DPFDIF SFFG +  G G    R + +    DVVHPLK SLEDLYNGTSKKLSLSR+VLC
Sbjct  91   DPFDIFSSFFGPSFGGGGGGSSRGRRQRRGEDVVHPLKASLEDLYNGTSKKLSLSRSVLC  150

Query  513  PKC  521
             KC
Sbjct  151  SKC  153



>gb|EMS59985.1| Chaperone protein dnaJ 2 [Triticum urartu]
Length=317

 Score =   171 bits (434),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYE+LGVPKNA+QDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPKNAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 64.7 bits (156),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  333  DPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVLC  512
            DPFDIF SFFG +  G G    R + +    DVVHPLK SLEDLYNGTSKKLSLSR+VLC
Sbjct  91   DPFDIFSSFFGPSFGGGGGGSSRGRRQRRGEDVVHPLKASLEDLYNGTSKKLSLSRSVLC  150

Query  513  PKC  521
             KC
Sbjct  151  SKC  153



>ref|XP_008446732.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   164 bits (414),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 82/84 (98%), Gaps = 1/84 (1%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  59

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  60   LSDPEKREIYDQYGEDALKEGMGG  83


 Score = 72.4 bits (176),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIFQSFFGG+PFG G   +  + +    DV+HPLKVSLEDLYNGTSK
Sbjct  78   KEGMGGGGGHDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  137  KLSLSRNVICSKC  149



>gb|KDP22008.1| hypothetical protein JCGZ_03128 [Jatropha curcas]
Length=326

 Score =   164 bits (416),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LS PEKREIYDQYGEDALKEGMGG
Sbjct  61   LSAPEKREIYDQYGEDALKEGMGG  84


 Score = 71.2 bits (173),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>emb|CBI28261.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   167 bits (424),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYE LGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 68.6 bits (166),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DVVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYIGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|AAG24642.1|AF308737_1 J1P [Daucus carota]
 gb|AAG24643.1|AF308738_1 J2P [Daucus carota]
Length=418

 Score =   168 bits (425),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK AS DDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 67.8 bits (164),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DV+HPLKVSLEDL NGTSKKLSLSRNV+
Sbjct  90   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLCNGTSKKLSLSRNVI  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|XP_009406563.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=414

 Score =   169 bits (427),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKS+NTKYYE+LGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTKYYEVLGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 67.0 bits (162),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIF SFFGG+   +G    R + +    DV+HPLKVSLEDLYNGTSK
Sbjct  79   KEGMGGGGGHDPFDIFSSFFGGS--PFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  137  KLSLSRNVICRKC  149



>ref|XP_001755408.1| predicted protein [Physcomitrella patens]
 gb|EDQ79888.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   152 bits (385),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 75/81 (93%), Positives = 80/81 (99%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGRAP KKSDN+KYY++LGVPK+ASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRAPSKKSDNSKYYDVLGVPKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 83.2 bits (204),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = +3

Query  330  HDPFDIFQSFFGG--NPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRN  503
            H+PFDIF+SFFGG  NPFG    +   + +    DVVHPLKVSL+DLYNGTSKKLSLSRN
Sbjct  90   HNPFDIFESFFGGASNPFGGSSGRGG-RRQRRGEDVVHPLKVSLDDLYNGTSKKLSLSRN  148

Query  504  VLCPKC  521
            V+C KC
Sbjct  149  VICQKC  154



>gb|KDO85584.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=247

 Score =   156 bits (395),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P++S+NTKYYEILGV K+A++D+LKKAYRKAA+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKR+IYDQYGEDALKEGMGG
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGG  84


 Score = 79.3 bits (194),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GG G  H+PFDIF+SFFGG  FG G   +  + K G  DVVH LKVSLEDLYNGT+
Sbjct  79   KEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGE-DVVHTLKVSLEDLYNGTT  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN+LCPKC
Sbjct  138  KKLSLSRNILCPKC  151



>ref|XP_009588725.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009588726.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   167 bits (422),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK AS +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 68.6 bits (166),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  426  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCPKC  521
            DVVHPLKVSL+DLYNGTSKKLSLSRNVLCPKC
Sbjct  123  DVVHPLKVSLDDLYNGTSKKLSLSRNVLCPKC  154



>gb|AFR66645.1| MIP1.1a [Nicotiana benthamiana]
Length=420

 Score =   166 bits (421),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK AS +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 68.6 bits (166),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  426  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCPKC  521
            DVVHPLKVSL+DLYNGTSKKLSLSRNVLCPKC
Sbjct  123  DVVHPLKVSLDDLYNGTSKKLSLSRNVLCPKC  154



>ref|XP_010089281.1| DnaJ-like protein [Morus notabilis]
 gb|EXB37606.1| DnaJ-like protein [Morus notabilis]
Length=419

 Score =   155 bits (392),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRAPKKS-DNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P++S DNTKYYE+LGV K+ASQ++LKKAYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRMPRRSSDNTKYYEVLGVSKSASQEELKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VL+DPEKREIYDQYGEDALKEGMGG
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGG  85


 Score = 79.7 bits (195),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGGG-MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG  H PFDIF+SFFGG     G    R + K    DVVH LKVSLEDLYNGT+
Sbjct  80   KEGMGGGGPSHSPFDIFESFFGGG--FGGGPSSRGRRKKQGEDVVHTLKVSLEDLYNGTT  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN+LCPKC
Sbjct  138  KKLSLSRNILCPKC  151



>ref|XP_010933633.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Elaeis guineensis]
Length=416

 Score =   164 bits (415),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P++SDNTKYYEILGV KNASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPRRSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYD+YGEDALKEGMGG
Sbjct  61   LSDPEKREIYDEYGEDALKEGMGG  84


 Score = 70.9 bits (172),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG  H+PFDIF+ FFGG+ FG G  +   + +    DVVH LKVSLEDLYNGT+
Sbjct  79   KEGMGGGGTSHNPFDIFEQFFGGSAFGGGSSRG--RRQRRGEDVVHSLKVSLEDLYNGTT  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN LC KC
Sbjct  137  KKLSLSRNALCAKC  150



>ref|XP_004239737.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   160 bits (404),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK A+Q+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 74.7 bits (182),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G    R + +    DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            CPKC
Sbjct  149  CPKC  152



>ref|XP_010089798.1| DnaJ-like protein [Morus notabilis]
 gb|EXB38414.1| DnaJ-like protein [Morus notabilis]
Length=440

 Score =   137 bits (346),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 85/99 (86%), Gaps = 5/99 (5%)
 Frame = +2

Query  20   SFSYLFDSKKKSEEKMFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKG  199
            S  Y+  + K S       APKKSDNT+YY+ILGV KNASQDDLKKAY+KAAIKNHPDKG
Sbjct  14   SLRYINSTTKDSS-----LAPKKSDNTRYYDILGVSKNASQDDLKKAYKKAAIKNHPDKG  68

Query  200  GDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGG  316
            GDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGG
Sbjct  69   GDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGG  107


 Score = 97.1 bits (240),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGG   HDPFDIFQSFFGGNPFG   +  R + +    D+VHPLKVSLEDLY GT+
Sbjct  102  KEGMGGGADGHDPFDIFQSFFGGNPFGGSSKGGRRQRRG--EDIVHPLKVSLEDLYLGTT  159

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  160  KKLSLSRNVICSKC  173



>ref|XP_009623415.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009623416.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   160 bits (404),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDN+KYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE+
Sbjct  1    MFGRTPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEI  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 74.3 bits (181),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG  FG G   +  + + G  DVVHPLKVSLEDLY+GTSKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGGFGGGGSSRGRRQRKGE-DVVHPLKVSLEDLYSGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_009398344.1| PREDICTED: dnaJ protein homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   165 bits (418),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALKEGMG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMG  83


 Score = 68.2 bits (165),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+SFFGG+ FG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HNPFDIFESFFGGSTFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CQKC  151



>ref|XP_010933632.1| PREDICTED: dnaJ protein homolog isoform X1 [Elaeis guineensis]
Length=421

 Score =   164 bits (415),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P++SDNTKYYEILGV KNASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPRRSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYD+YGEDALKEGMGG
Sbjct  61   LSDPEKREIYDEYGEDALKEGMGG  84


 Score = 69.3 bits (168),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGX---XDVVHPLKVSLEDLYN  470
            KE +GGGG  H+PFDIF+ FFGG+ FG G                DVVH LKVSLEDLYN
Sbjct  79   KEGMGGGGTSHNPFDIFEQFFGGSAFGGGAFGGGSSRGRRQRRGEDVVHSLKVSLEDLYN  138

Query  471  GTSKKLSLSRNVLCPKC  521
            GT+KKLSLSRN LC KC
Sbjct  139  GTTKKLSLSRNALCAKC  155



>ref|XP_002313505.1| seed maturation protein PM37 [Populus trichocarpa]
 gb|EEE87460.1| seed maturation protein PM37 [Populus trichocarpa]
Length=415

 Score =   167 bits (423),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGE+ALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGG  84


 Score = 66.2 bits (160),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+SFFGGN   +G    R + +    DVVHPLKVSLEDLY GTSKKLSL+RNV+
Sbjct  89   HNPFDIFESFFGGN--PFGGGGSRGRRQRRGEDVVHPLKVSLEDLYLGTSKKLSLTRNVI  146

Query  510  CPKC  521
            C KC
Sbjct  147  CSKC  150



>ref|NP_001267695.1| dnaJ protein homolog [Cucumis sativus]
 gb|ADF30255.1| heat shock protein [Cucumis sativus]
Length=413

 Score =   161 bits (407),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 81/84 (96%), Gaps = 1/84 (1%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAY V
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYGV  59

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  60   LSDPEKREIYDQYGEDALKEGMGG  83


 Score = 72.4 bits (176),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIFQSFFGG+PFG G   +  + + G  DV+HPLKVSLEDLYNGTSK
Sbjct  78   KEGMGGGGGHDPFDIFQSFFGGSPFGGGGSSRG-RRQRGGEDVIHPLKVSLEDLYNGTSK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  137  KLSLSRNVICSKC  149



>gb|ABI18985.1| molecular chaperone DjA2 [Allium ampeloprasum]
Length=418

 Score =   168 bits (426),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPKNAS DDLKKAYRKAAIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 64.7 bits (156),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG  FG G   +  + +    DVVHPLKVSLE+LYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGGGFGGGGSSRG-RRQRRGEDVVHPLKVSLEELYNGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_011032891.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011032892.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=420

 Score =   159 bits (402),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYE+LGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 73.9 bits (180),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G    R + +    DV+HPLKVS EDLYNGTSKKLSLSRNV+
Sbjct  90   HDPFDIFQSFFGGGNPFGGGGSSRGRRQRRGEDVIHPLKVSFEDLYNGTSKKLSLSRNVI  149

Query  510  CPKC  521
            C KC
Sbjct  150  CSKC  153



>gb|KDO85583.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=334

 Score =   155 bits (392),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P++S+NTKYYEILGV K+A++D+LKKAYRKAA+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKR+IYDQYGEDALKEGMGG
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGG  84


 Score = 77.8 bits (190),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GG G  H+PFDIF+SFFGG  FG G   +  + K G  DVVH LKVSLEDLYNGT+
Sbjct  79   KEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGE-DVVHTLKVSLEDLYNGTT  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN+LCPKC
Sbjct  138  KKLSLSRNILCPKC  151



>ref|XP_011008852.1| PREDICTED: dnaJ protein homolog isoform X1 [Populus euphratica]
Length=415

 Score =   167 bits (423),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGE+ALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGG  84


 Score = 65.9 bits (159),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+SFFGGN   +G    R + +    DVVHPLKVSLEDLY GTSKKLSL+RNV+
Sbjct  89   HNPFDIFESFFGGN--PFGGGGSRGRRQRRGEDVVHPLKVSLEDLYLGTSKKLSLTRNVI  146

Query  510  CPKC  521
            C KC
Sbjct  147  CSKC  150



>ref|XP_006445376.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 ref|XP_006464459.1| PREDICTED: dnaJ protein homolog 2-like [Citrus sinensis]
 gb|ESR58616.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|KDO85581.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
 gb|KDO85582.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=418

 Score =   155 bits (391),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P++S+NTKYYEILGV K+A++D+LKKAYRKAA+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKR+IYDQYGEDALKEGMGG
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGG  84


 Score = 78.2 bits (191),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GG G  H+PFDIF+SFFGG  FG G   +  + K G  DVVH LKVSLEDLYNGT+
Sbjct  79   KEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGE-DVVHTLKVSLEDLYNGTT  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN+LCPKC
Sbjct  138  KKLSLSRNILCPKC  151



>gb|ACN39991.1| unknown [Picea sitchensis]
Length=421

 Score =   161 bits (407),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYY+ILGV K+A+ D+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDILGVSKSATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 72.0 bits (175),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKA--KNGXXDVVHPLKVSLEDLYNG  473
            KE +GGGG  H+PFDIF+SFFGG+  G  +     +   +    DVVHPLKVSL+DLYNG
Sbjct  79   KEGMGGGGASHNPFDIFESFFGGSFGGSSFGGGSSRGRRQKQGEDVVHPLKVSLDDLYNG  138

Query  474  TSKKLSLSRNVLCPKC  521
            TS+KLSLSRNV+C KC
Sbjct  139  TSRKLSLSRNVICSKC  154



>ref|NP_001168650.1| putative dnaJ chaperone family protein [Zea mays]
 gb|ACN29044.1| unknown [Zea mays]
 tpg|DAA51803.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=418

 Score =   158 bits (399),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 74.3 bits (181),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G    R + +    DVVHPLKVSLEDLYNGTSKKLSLSR+VL
Sbjct  89   HDPFDIFQSFFGGGSPFGGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGTSKKLSLSRSVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|XP_002310999.1| DnaJ family protein [Populus trichocarpa]
 gb|EEE88366.1| DnaJ family protein [Populus trichocarpa]
Length=420

 Score =   159 bits (402),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYE+LGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 73.2 bits (178),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G    R + +    DV+HPLKVS ED+YNGTSKKLSLSRNV+
Sbjct  90   HDPFDIFQSFFGGGNPFGGGGSSRGRRQRRGEDVIHPLKVSFEDIYNGTSKKLSLSRNVI  149

Query  510  CPKC  521
            C KC
Sbjct  150  CSKC  153



>ref|XP_004953339.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=421

 Score =   157 bits (396),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRAPKK-SDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P+K S+NTKYYE+LGV K+ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYE
Sbjct  1    MFGRMPRKTSNNTKYYEVLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGG  85


 Score = 75.1 bits (183),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGG     H PFDIF+  F G+    G   +  + K G  DVVH +KVSLEDLYNG
Sbjct  80   KEGMGGGSSSDFHSPFDIFEQLFPGSGTFGGGSSRGRRQKRGE-DVVHTMKVSLEDLYNG  138

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSR+VLC KC
Sbjct  139  TTKKLSLSRSVLCSKC  154



>gb|KDP42967.1| hypothetical protein JCGZ_23909 [Jatropha curcas]
Length=418

 Score =   167 bits (424),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/84 (96%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 63.5 bits (153),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H PFDIF+SFFGG+PFG G   +  + +    DVVHPLKVSLEDLY GT+KKLSLSRNV+
Sbjct  89   HSPFDIFESFFGGSPFGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYLGTTKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_011017419.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Populus euphratica]
Length=423

 Score =   156 bits (394),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP++SDN KYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNNKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDP+KR+IYDQYGEDALKEGMG
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMG  83


 Score = 75.1 bits (183),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
 Frame = +3

Query  303  KEWVGGGGM--HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGT  476
            KE +G GG   H+P+DIF+SFFGG  FG G   +  + K G  DVVHPLKVSLEDLYNGT
Sbjct  79   KEGMGPGGSDGHNPYDIFESFFGGGGFGGGGSSRGRRQKQGE-DVVHPLKVSLEDLYNGT  137

Query  477  SKKLSLSRNVLCPKC  521
            SKKLSLSRN+LC KC
Sbjct  138  SKKLSLSRNILCAKC  152



>ref|XP_010258832.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Nelumbo nucifera]
Length=413

 Score =   158 bits (400),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MF  AP+KSDNTKYYEILGV KNASQD+LKKAYRKAAIKNHPDKGGDPEKFK+LAQAYEV
Sbjct  1    MFSCAPRKSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKDLAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKR+IYDQYGEDALKEGMG
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMG  83


 Score = 72.8 bits (177),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 54/74 (73%), Gaps = 7/74 (9%)
 Frame = +3

Query  303  KEWVG-GGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +G GG  H+PFDIF+SFFGG     G  Q++        DVVH LKVSLEDLYNGTS
Sbjct  79   KEGMGVGGASHNPFDIFESFFGGGGSSRGRRQKQ------GEDVVHTLKVSLEDLYNGTS  132

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN+LCPKC
Sbjct  133  KKLSLSRNILCPKC  146



>ref|NP_001047626.1| Os02g0656500 [Oryza sativa Japonica Group]
 emb|CAC39071.1| DnaJ-like protein [Oryza sativa]
 dbj|BAF09540.1| Os02g0656500 [Oryza sativa Japonica Group]
Length=420

 Score =   159 bits (402),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            M+GR PKKS+NTKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            L+DPEKREIYDQYGEDALKEGMGG
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGG  84


 Score = 71.6 bits (174),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 7/76 (9%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGG     H PFD+F+  F       G   ++ + +    DVVH +KVSLEDLYNG
Sbjct  79   KEGMGGGSSSDFHSPFDLFEQIFQNRGGFGGRGHRQKRGE----DVVHTMKVSLEDLYNG  134

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSRN LC KC
Sbjct  135  TTKKLSLSRNALCTKC  150



>gb|EEC73725.1| hypothetical protein OsI_08334 [Oryza sativa Indica Group]
Length=420

 Score =   159 bits (402),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            M+GR PKKS+NTKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            L+DPEKREIYDQYGEDALKEGMGG
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGG  84


 Score = 71.6 bits (174),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 7/76 (9%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGG     H PFD+F+  F       G   ++ + +    DVVH +KVSLEDLYNG
Sbjct  79   KEGMGGGSSSDFHSPFDLFEQIFQNRGGFGGRGHRQKRGE----DVVHTMKVSLEDLYNG  134

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSRN LC KC
Sbjct  135  TTKKLSLSRNALCTKC  150



>ref|XP_008787761.1| PREDICTED: dnaJ protein homolog [Phoenix dactylifera]
Length=415

 Score =   159 bits (402),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 71.6 bits (174),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIFQSFFGGN   +G    R + +    DV+HPLKVSLEDLYNGT+K
Sbjct  79   KEGMGGGGGHDPFDIFQSFFGGN--PFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTAK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  137  KLSLSRNVICQKC  149



>gb|AFW67420.1| putative dnaJ chaperone family protein [Zea mays]
Length=415

 Score =   158 bits (399),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 72.8 bits (177),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 49/64 (77%), Gaps = 3/64 (5%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G   +R +  +   DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGSPFGGIRGRRQRRGD---DVVHPLKVSLEDLYNGTSKKLSLSRNVL  145

Query  510  CPKC  521
            C KC
Sbjct  146  CSKC  149



>emb|CAA63965.1| DnaJ protein [Solanum tuberosum]
Length=419

 Score =   158 bits (400),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP+KSDNTKYYEILGVPK A+Q+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPEKSDNTKYYEILGVPKTAAQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 72.0 bits (175),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G    R + +    DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>gb|EEE57509.1| hypothetical protein OsJ_07792 [Oryza sativa Japonica Group]
Length=452

 Score =   159 bits (401),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            M+GR PKKS+NTKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  33   MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  92

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            L+DPEKREIYDQYGEDALKEGMGG
Sbjct  93   LNDPEKREIYDQYGEDALKEGMGG  116


 Score = 71.2 bits (173),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 7/76 (9%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGG     H PFD+F+  F       G   ++ + +    DVVH +KVSLEDLYNG
Sbjct  111  KEGMGGGSSSDFHSPFDLFEQIFQNRGGFGGRGHRQKRGE----DVVHTMKVSLEDLYNG  166

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSRN LC KC
Sbjct  167  TTKKLSLSRNALCTKC  182



>gb|AFW67421.1| putative dnaJ chaperone family protein [Zea mays]
Length=417

 Score =   158 bits (399),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 72.0 bits (175),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG     G   +  + +    DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGSPFGGGSSRG-RRQRRGDDVVHPLKVSLEDLYNGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_002263156.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 ref|XP_010658892.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 emb|CBI24994.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   158 bits (400),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYY++LGV KNASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDVLGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 71.6 bits (174),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGNPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|EMS60670.1| DnaJ protein-like protein [Triticum urartu]
Length=446

 Score =   147 bits (372),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 83/110 (75%), Gaps = 26/110 (24%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEK---------  214
            MFGR P KKSD+T+YYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEK         
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKVSARRISHP  60

Query  215  ----------------FKELAQAYEVLSDPEKREIYDQYGEDALKEGMGG  316
                            FKELAQAYEVLSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   STTDLFPIGITRLVDLFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGG  110


 Score = 82.4 bits (202),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGX-XDVVHPLKVSLEDLYNGTS  479
            KE +GGGGMHDPFDIFQSFFGG    +G        +     DVVHPLKVSLE+LYNGTS
Sbjct  105  KEGMGGGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRRGEDVVHPLKVSLEELYNGTS  164

Query  480  KKLSLSRNVLCPKC  521
            KKLSL+RNVLC KC
Sbjct  165  KKLSLARNVLCSKC  178



>gb|ABA46776.1| DnaJ-like protein [Solanum tuberosum]
Length=443

 Score =   157 bits (397),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK A+ +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 71.2 bits (173),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G    R + +    DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|XP_006345881.1| PREDICTED: dnaJ protein homolog [Solanum tuberosum]
 gb|ABB16989.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   157 bits (396),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK A+ +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 71.6 bits (174),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G    R + +    DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>gb|ABB16980.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   157 bits (396),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK A+ +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 71.6 bits (174),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G    R + +    DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|NP_001275059.1| DnaJ-like protein [Solanum tuberosum]
 gb|ABB55383.1| DnaJ-like protein-like [Solanum tuberosum]
Length=445

 Score =   157 bits (396),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK A+ +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 70.9 bits (172),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G    R + +    DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|NP_001136581.1| putative dnaJ chaperone family protein [Zea mays]
 gb|ACF82216.1| unknown [Zea mays]
 gb|AFW72634.1| putative dnaJ chaperone family protein [Zea mays]
Length=422

 Score =   155 bits (392),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRAPKKS-DNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P+KS +NTKYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAY+
Sbjct  1    MFGRMPRKSSNNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYD  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGG  85


 Score = 72.0 bits (175),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 50/76 (66%), Gaps = 4/76 (5%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGG     H PFDIF+  F G+    G   +  + K G  DVVH +KVSL+DLYNG
Sbjct  80   KEGMGGGSSSDFHSPFDIFEQLFPGSSTFGGGSSRGRRQKRGE-DVVHTMKVSLDDLYNG  138

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSR+ LC KC
Sbjct  139  TTKKLSLSRSALCSKC  154



>ref|XP_008375557.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   158 bits (400),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN+KYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 68.9 bits (167),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSLSRN +
Sbjct  89   HDPFDIFQSFFGGNPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNKI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|AAF64454.1|AF239932_1 DnaJ protein [Euphorbia esula]
Length=418

 Score =   156 bits (395),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN+KYYEILGV K+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKR+IYDQYGEDALKE
Sbjct  61   LSDPEKRDIYDQYGEDALKE  80


 Score = 70.5 bits (171),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DV HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVTHPLKVSLEDLYNGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|ACU24346.1| unknown [Glycine max]
Length=420

 Score =   149 bits (376),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRA-PKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR  P++SDN+KYY+ILG+ KNAS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGISKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEK+E+YDQYGEDALKEGMGG
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGG  85


 Score = 77.8 bits (190),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGG-MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG  H+PFDIF+SFFGG  FG G   +  + K+G  DVVH LKVSLED+YNGT+
Sbjct  80   KEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE-DVVHSLKVSLEDVYNGTT  138

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN+LCPKC
Sbjct  139  KKLSLSRNILCPKC  152



>ref|XP_003521084.1| PREDICTED: dnaJ protein homolog 2-like [Glycine max]
 gb|KHN43746.1| Chaperone protein dnaJ 2 [Glycine soja]
Length=420

 Score =   149 bits (376),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRA-PKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR  P++SDN+KYY+ILG+ KNAS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGISKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEK+E+YDQYGEDALKEGMGG
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGG  85


 Score = 77.8 bits (190),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGG-MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG  H+PFDIF+SFFGG  FG G   +  + K+G  DVVH LKVSLED+YNGT+
Sbjct  80   KEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE-DVVHSLKVSLEDVYNGTT  138

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN+LCPKC
Sbjct  139  KKLSLSRNILCPKC  152



>ref|XP_007015641.1| DNAJ isoform 2 [Theobroma cacao]
 gb|EOY33260.1| DNAJ isoform 2 [Theobroma cacao]
Length=414

 Score =   162 bits (409),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAY+K A KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALK+GMG 
Sbjct  61   LSDPEKREIYDQYGEDALKDGMGA  84


 Score = 64.7 bits (156),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            K+ +G  G HDPFDIF SFFGG+   +G    R + +    DV+H +KVSLEDLY GTSK
Sbjct  79   KDGMGATGAHDPFDIFSSFFGGS--PFGGGSSRGRRQRRGEDVIHNMKVSLEDLYLGTSK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRN+LC KC
Sbjct  137  KLSLSRNILCSKC  149



>ref|XP_002454540.1| hypothetical protein SORBIDRAFT_04g032970 [Sorghum bicolor]
 gb|EES07516.1| hypothetical protein SORBIDRAFT_04g032970 [Sorghum bicolor]
Length=420

 Score =   155 bits (392),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRAPKKS-DNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P+KS +NTKYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAY+
Sbjct  1    MFGRMPRKSSNNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYD  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGG  85


 Score = 71.2 bits (173),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGGG    H PFDIF+  F G+    G  + R + +    DVVH +KVSLEDLYNG
Sbjct  80   KEGMGGGGSSDFHSPFDIFEQLFPGSSGFGGGSRGRRQKRG--EDVVHTMKVSLEDLYNG  137

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSR+ LC KC
Sbjct  138  TTKKLSLSRSALCSKC  153



>ref|XP_009341572.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=417

 Score =   158 bits (400),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN+KYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 68.2 bits (165),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSL+RN +
Sbjct  89   HDPFDIFQSFFGGNPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLARNKI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_008345828.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   158 bits (399),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN+KYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 68.2 bits (165),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSL+RN +
Sbjct  89   HDPFDIFQSFFGGNPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLARNKI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_007015640.1| DNAJ isoform 1 [Theobroma cacao]
 gb|EOY33259.1| DNAJ isoform 1 [Theobroma cacao]
Length=431

 Score =   161 bits (408),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAY+K A KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALK+GMG
Sbjct  61   LSDPEKREIYDQYGEDALKDGMG  83


 Score = 64.3 bits (155),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            K+ +G  G HDPFDIF SFFGG+   +G    R + +    DV+H +KVSLEDLY GTSK
Sbjct  79   KDGMGATGAHDPFDIFSSFFGGS--PFGGGSSRGRRQRRGEDVIHNMKVSLEDLYLGTSK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRN+LC KC
Sbjct  137  KLSLSRNILCSKC  149



>ref|XP_008803820.1| PREDICTED: dnaJ protein homolog 2-like [Phoenix dactylifera]
Length=417

 Score =   157 bits (398),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP+KS+NTKYYEILGV KNASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRKSNNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 68.2 bits (165),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+ FFGG  FG    +   + +    DVVH LKVSLEDLYNGTSKKLSLSRNVL
Sbjct  90   HNPFDIFEQFFGGGAFGGSSSRGHRQRRG--EDVVHTLKVSLEDLYNGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CAKC  151



>ref|XP_007015642.1| DNAJ isoform 3 [Theobroma cacao]
 gb|EOY33261.1| DNAJ isoform 3 [Theobroma cacao]
Length=320

 Score =   161 bits (408),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAY+K A KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDPEKREIYDQYGEDALK+GMG
Sbjct  61   LSDPEKREIYDQYGEDALKDGMG  83


 Score = 63.9 bits (154),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            K+ +G  G HDPFDIF SFFGG+   +G    R + +    DV+H +KVSLEDLY GTSK
Sbjct  79   KDGMGATGAHDPFDIFSSFFGGS--PFGGGSSRGRRQRRGEDVIHNMKVSLEDLYLGTSK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRN+LC KC
Sbjct  137  KLSLSRNILCSKC  149



>ref|XP_008354864.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=322

 Score =   158 bits (399),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN+KYYEILGV K ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 67.4 bits (163),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGNPFG G   +  + +    DV+HPLKVSLEDLYNGTSKKLSL+RN +
Sbjct  89   HDPFDIFQSFFGGNPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLARNKI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_006386554.1| hypothetical protein POPTR_0002s14200g [Populus trichocarpa]
 gb|ERP64351.1| hypothetical protein POPTR_0002s14200g [Populus trichocarpa]
Length=424

 Score =   152 bits (383),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP++SDNTKYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDP+KR+IYDQYGEDALKE
Sbjct  61   LSDPDKRDIYDQYGEDALKE  80


 Score = 72.4 bits (176),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+P+DIF+SFFGG  FG G   +  + K G  DVVHPLKVSLEDLYNGTSKKLSLSRN+L
Sbjct  91   HNPYDIFESFFGGGGFGGGGSSRGRRQKQGE-DVVHPLKVSLEDLYNGTSKKLSLSRNIL  149

Query  510  CPKC  521
            C KC
Sbjct  150  CAKC  153



>ref|XP_002301248.1| DnaJ family protein [Populus trichocarpa]
 gb|EEE80521.1| DnaJ family protein [Populus trichocarpa]
Length=425

 Score =   152 bits (383),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP++SDNTKYYE+LGV K ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDP+KR+IYDQYGEDALKE
Sbjct  61   LSDPDKRDIYDQYGEDALKE  80


 Score = 72.4 bits (176),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+P+DIF+SFFGG  FG G   +  + K G  DVVHPLKVSLEDLYNGTSKKLSLSRN+L
Sbjct  91   HNPYDIFESFFGGGGFGGGGSSRGRRQKQGE-DVVHPLKVSLEDLYNGTSKKLSLSRNIL  149

Query  510  CPKC  521
            C KC
Sbjct  150  CAKC  153



>ref|XP_001782829.1| predicted protein [Physcomitrella patens]
 gb|EDQ52343.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   150 bits (378),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYY++LGV K+ASQD+LK+AYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRMPKKSDNTKYYDVLGVSKSASQDELKRAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKR++YDQYGEDALKE
Sbjct  61   LSDPEKRDLYDQYGEDALKE  80


 Score = 74.3 bits (181),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 3/64 (5%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+SFFGG         +  + +    DVVHPLKVSLE+LYNGTSKKLSLSRN++
Sbjct  89   HNPFDIFESFFGGG---GSGSGRGSRRQRRGEDVVHPLKVSLEELYNGTSKKLSLSRNII  145

Query  510  CPKC  521
            C KC
Sbjct  146  CSKC  149



>ref|XP_001768102.1| predicted protein [Physcomitrella patens]
 gb|EDQ66975.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   153 bits (386),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYE LGV K+ASQD+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRMPKKSDNTKYYETLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKRE+YDQYGEDALKE
Sbjct  61   LSDPEKRELYDQYGEDALKE  80


 Score = 70.9 bits (172),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGX-XDVVHPLKVSLEDLYNGTSKKLSLSRNV  506
            H+PFDIF+SFFGG    +G   +    +     DVVHPLKVSLEDLYNGTSKKLSLSRNV
Sbjct  89   HNPFDIFESFFGGGGSPFGGNGRGGGRRQRRGEDVVHPLKVSLEDLYNGTSKKLSLSRNV  148

Query  507  LCPKC  521
            LC KC
Sbjct  149  LCSKC  153



>sp|P43644.1|DNJH_ATRNU RecName: Full=DnaJ protein homolog ANJ1; Flags: Precursor [Atriplex 
nummularia]
Length=417

 Score =   132 bits (333),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSD+T+YYEILGVPK+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 90.5 bits (223),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G    R + +    DVVHPLKVSLEDL+ GT+KKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGSPFG-GVGSSRGRRQRRGEDVVHPLKVSLEDLFTGTTKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>dbj|BAD25681.1| putative DnaJ-like protein MsJ1 [Oryza sativa Japonica Group]
Length=416

 Score =   151 bits (382),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +2

Query  80   PKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPE  259
            PKKS+NTKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVL+DPE
Sbjct  2    PKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLNDPE  61

Query  260  KREIYDQYGEDALKEGMGG  316
            KREIYDQYGEDALKEGMGG
Sbjct  62   KREIYDQYGEDALKEGMGG  80


 Score = 71.6 bits (174),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 7/76 (9%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGG     H PFD+F+  F       G   ++ + +    DVVH +KVSLEDLYNG
Sbjct  75   KEGMGGGSSSDFHSPFDLFEQIFQNRGGFGGRGHRQKRGE----DVVHTMKVSLEDLYNG  130

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSRN LC KC
Sbjct  131  TTKKLSLSRNALCTKC  146



>ref|XP_003570021.1| PREDICTED: dnaJ protein homolog 2-like [Brachypodium distachyon]
Length=423

 Score =   149 bits (377),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRAPKK-SDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR PKK S+NTKYYE+LGV K A+ D+LKKAYRKAAIKNHPDKGGDPEKFKELA AY+
Sbjct  1    MFGRMPKKTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYD  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VL+DPEKREIYDQYGEDALKEGMGG
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGG  85


 Score = 73.6 bits (179),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +3

Query  303  KEWVGGGG--MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGT  476
            KE +GGG   MH PFDIF+  FGG   G+G    R + +    DVVH +KVSLEDLYNG 
Sbjct  80   KEGMGGGSSDMHSPFDIFEQLFGGGGGGFGGGSSRGRRQKRGEDVVHTMKVSLEDLYNGA  139

Query  477  SKKLSLSRNVLCPKC  521
            +KKLSLSRNVLC KC
Sbjct  140  TKKLSLSRNVLCGKC  154



>gb|ACJ84518.1| unknown [Medicago truncatula]
Length=423

 Score =   150 bits (380),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P +KSDNTKYY+ILGV K+AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEK+E+YDQYGEDALKEGMGG
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGG  85


 Score = 72.4 bits (176),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 54/76 (71%), Gaps = 5/76 (7%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGG     H+PFDIF+SFFG    G G  + R + K G  DVVH +KVSLED+YNG
Sbjct  80   KEGMGGGAGSSFHNPFDIFESFFGAGFGGGGPSRAR-RQKQGE-DVVHSIKVSLEDVYNG  137

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSRN LC KC
Sbjct  138  TTKKLSLSRNALCSKC  153



>ref|XP_003626730.1| DnaJ protein-like protein [Medicago truncatula]
 gb|AET01206.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=423

 Score =   150 bits (380),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P +KSDNTKYY+ILGV K+AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEK+E+YDQYGEDALKEGMGG
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGG  85


 Score = 72.4 bits (176),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 54/76 (71%), Gaps = 5/76 (7%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGG     H+PFDIF+SFFG    G G  + R + K G  DVVH +KVSLED+YNG
Sbjct  80   KEGMGGGAGSSFHNPFDIFESFFGAGFGGGGPSRAR-RQKQGE-DVVHSIKVSLEDVYNG  137

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSRN LC KC
Sbjct  138  TTKKLSLSRNALCSKC  153



>emb|CAA04447.1| DnaJ-like protein [Medicago sativa]
 gb|AAC19391.1| DnaJ-like protein MsJ1 [Medicago sativa]
Length=423

 Score =   150 bits (380),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P +KSDNTKYY+ILGV K+AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEK+E+YDQYGEDALKEGMGG
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGG  85


 Score = 72.0 bits (175),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 54/76 (71%), Gaps = 5/76 (7%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGG     H+PFDIF+SFFG    G G  + R + K G  DVVH +KVSLED+YNG
Sbjct  80   KEGMGGGAGSSFHNPFDIFESFFGAGFGGGGPSRAR-RQKQGE-DVVHSIKVSLEDVYNG  137

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSRN LC KC
Sbjct  138  TTKKLSLSRNALCSKC  153



>ref|XP_003558043.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   152 bits (383),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/81 (93%), Positives = 78/81 (96%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P KKSDNT+YYEILGVPK ASQDDLKKAYRK+AIKNHPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRGPPKKSDNTRYYEILGVPKEASQDDLKKAYRKSAIKNHPDKGGDPEKFKEIAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 70.5 bits (171),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DVVHPLKVSLE+LYNGTSKKLSLSRNVL
Sbjct  90   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVVHPLKVSLEELYNGTSKKLSLSRNVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|XP_010919645.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
 ref|XP_010919646.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   154 bits (388),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRA ++S+NTKYYEILGV KNASQD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAQRRSNNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 68.2 bits (165),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+ FFGG  FG    +   + +    DVVH LKVSLEDLYNGTSKKLSLSRNVL
Sbjct  90   HNPFDIFEQFFGGGAFGGSSSRGHRQRRG--EDVVHTLKVSLEDLYNGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CAKC  151



>ref|XP_003529049.1| PREDICTED: dnaJ protein homolog 2-like [Glycine max]
 gb|KHN34491.1| Chaperone protein dnaJ 2 [Glycine soja]
Length=420

 Score =   148 bits (374),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRA-PKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR  P++SDN+KYY+ILGV KNAS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEK+++YDQYGEDALKEGMGG
Sbjct  61   VLSDPEKKDLYDQYGEDALKEGMGG  85


 Score = 73.6 bits (179),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGG-MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG  H+PFDIF+SFFGG  FG G   +  + K+G  DVVH LKVSLED+YNGT+
Sbjct  80   KEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE-DVVHSLKVSLEDVYNGTT  138

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV C KC
Sbjct  139  KKLSLSRNVFCSKC  152



>ref|XP_002515865.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF46534.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   159 bits (402),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNA+QDDLKKAY++AAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNATQDDLKKAYKRAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 62.0 bits (149),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+SFFGG+PFG G  +   + +    DVVHPLKVSLEDLY GT KKLSLSRN++
Sbjct  89   HNPFDIFESFFGGSPFGGGSSRGG-RRQRRGEDVVHPLKVSLEDLYLGTIKKLSLSRNMI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CAKC  151



>ref|XP_009408521.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   162 bits (410),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/82 (95%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPK SD+T+YYEILGV KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKTSDSTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGM  310
            LSDPEKREIYDQYGEDALKEGM
Sbjct  61   LSDPEKREIYDQYGEDALKEGM  82


 Score = 58.9 bits (141),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+SFFGG+   +G    R + +    D +HPLKVSLEDLY+G SKKLSLS+ V+
Sbjct  89   HNPFDIFESFFGGS--PFGGGSSRGRRQRRGEDAIHPLKVSLEDLYSGISKKLSLSQKVI  146

Query  510  CPKC  521
            C KC
Sbjct  147  CQKC  150



>gb|AFK48766.1| unknown [Medicago truncatula]
Length=423

 Score =   148 bits (374),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 80/85 (94%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P +KSDN KYY+ILGV K+AS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNAKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VLSDPEK+E+YDQYGEDALKEGMGG
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGG  85


 Score = 72.4 bits (176),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 54/76 (71%), Gaps = 5/76 (7%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGG     H+PFDIF+SFFG    G G  + R + K G  DVVH +KVSLED+YNG
Sbjct  80   KEGMGGGAGSSFHNPFDIFESFFGAGFGGGGPSRAR-RQKQGE-DVVHSIKVSLEDVYNG  137

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSRN LC KC
Sbjct  138  TTKKLSLSRNALCSKC  153



>ref|XP_006826444.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
 gb|ERM93681.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
Length=419

 Score =   150 bits (380),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 75/81 (93%), Positives = 78/81 (96%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRA-PKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGRA PKKSDNT+YYEILGV KNASQ+DLK+AYRKAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRAAPKKSDNTRYYEILGVSKNASQEDLKRAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSD EKREIYDQYGEDALKE
Sbjct  61   VLSDREKREIYDQYGEDALKE  81


 Score = 70.1 bits (170),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGGN   +G    R + +    DVVHPLKVSLE+LYNGTSKKLSLSRN++
Sbjct  90   HDPFDIFQSFFGGN--PFGGGSSRGRRQRRGEDVVHPLKVSLEELYNGTSKKLSLSRNII  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|KDO48710.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=401

 Score =   129 bits (325),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +2

Query  128  KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  307
            KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG
Sbjct  8    KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  67

Query  308  MGG  316
            MGG
Sbjct  68   MGG  70


 Score = 91.3 bits (225),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG        + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  75   HDPFDIFQSFFGGSPFGGSSRG---RRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  131

Query  510  CPKC  521
            C KC
Sbjct  132  CTKC  135



>ref|XP_004236804.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum lycopersicum]
Length=418

 Score =   155 bits (392),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVP  AS DDLKKAYRKAAIKNHPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPNTASPDDLKKAYRKAAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            L+DPEKREIYDQYGEDALKE
Sbjct  61   LNDPEKREIYDQYGEDALKE  80


 Score = 65.1 bits (157),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG  FG G   +  + +    DVVHPLKVSLEDLYNG SKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGGFGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYNGISKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_006367020.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Solanum tuberosum]
Length=419

 Score =   155 bits (392),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVP  AS DDLKKAYRKAAIKNHPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPNTASPDDLKKAYRKAAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            L+DPEKREIYDQYGEDALKE
Sbjct  61   LNDPEKREIYDQYGEDALKE  80


 Score = 65.1 bits (157),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG  FG G   +  + +    DVVHPLKVSLEDLYNG SKKLSLSRNVL
Sbjct  89   HDPFDIFQSFFGGGGFGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYNGISKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CTKC  151



>ref|XP_010692097.1| PREDICTED: dnaJ protein homolog 2-like [Beta vulgaris subsp. 
vulgaris]
Length=420

 Score =   155 bits (393),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYE+LGV K+ASQD+LKKAYRK+AIKNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDELKKAYRKSAIKNHPDKGGDPEKFKELGQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 64.7 bits (156),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+ FF  +  G+G      + +    DV+H +KVSLEDLYNGT+KK+S+SRN+L
Sbjct  91   HNPFDIFEQFFSTS--GFGGGSSSRRRQQQGEDVIHTMKVSLEDLYNGTTKKVSISRNIL  148

Query  510  CPKC  521
            CP+C
Sbjct  149  CPRC  152



>emb|CAH67501.1| OSIGBa0134H18.3 [Oryza sativa Indica Group]
 gb|EAY95074.1| hypothetical protein OsI_16890 [Oryza sativa Indica Group]
Length=416

 Score =   152 bits (385),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 81/84 (96%), Gaps = 1/84 (1%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P+ S+NTKYYE+LGVPK AS+D+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            L+DPEKR+IYDQYGEDALK+GMGG
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGG  83


 Score = 67.4 bits (163),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = +3

Query  315  GGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSL  494
            GG   H+PFDIF+ FFGG    +G    R + +    DVVH LKVSLED+YNG+ KKLSL
Sbjct  83   GGSDFHNPFDIFEQFFGGG--AFGGSSSRVRRQRRGEDVVHTLKVSLEDVYNGSMKKLSL  140

Query  495  SRNVLCPKC  521
            SRN+LCPKC
Sbjct  141  SRNILCPKC  149



>ref|XP_007134513.1| hypothetical protein PHAVU_010G053900g [Phaseolus vulgaris]
 gb|ESW06507.1| hypothetical protein PHAVU_010G053900g [Phaseolus vulgaris]
Length=423

 Score =   146 bits (368),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 80/85 (94%), Gaps = 1/85 (1%)
 Frame = +2

Query  65   MFGRA-PKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR  P+KSDN+KYY+ILGV KNA++D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRKSDNSKYYDILGVSKNATEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMGG  316
            VL DPEK+E+YDQYGEDALK+GMGG
Sbjct  61   VLGDPEKKEMYDQYGEDALKDGMGG  85


 Score = 73.9 bits (180),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 3/75 (4%)
 Frame = +3

Query  303  KEWVGGGG--MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGT  476
            K+ +GGGG   H+PFDIF+SFFGG+ FG G   +  + K G  DVVH LKVSLED+YNG 
Sbjct  80   KDGMGGGGSSFHNPFDIFESFFGGSSFGGGGSSRGRRQKQGE-DVVHSLKVSLEDVYNGA  138

Query  477  SKKLSLSRNVLCPKC  521
            +KKLSLSRNVLCPKC
Sbjct  139  NKKLSLSRNVLCPKC  153



>ref|XP_010031575.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50935.1| hypothetical protein EUGRSUZ_J00583 [Eucalyptus grandis]
Length=416

 Score =   159 bits (402),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYE+LGV KNASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 60.5 bits (145),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+  G+G    R + +    DVVHPLK SLEDLY GT+KKLSLSRNV+
Sbjct  89   HDPFDIFSSFFGGS--GFGGGSSRGRRQRRGEDVVHPLKASLEDLYLGTTKKLSLSRNVI  146

Query  510  CPKC  521
            C KC
Sbjct  147  CVKC  150



>ref|XP_008359180.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=424

 Score =   135 bits (340),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV K+AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 84.0 bits (206),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 49/67 (73%), Gaps = 3/67 (4%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGW---GWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSR  500
            HDPFDIF SFFGG+PFG    G    R + +    DVVH LKVSLEDLY GTSKKLSLSR
Sbjct  90   HDPFDIFSSFFGGSPFGXKNPGGGSSRGRRQRRGEDVVHALKVSLEDLYLGTSKKLSLSR  149

Query  501  NVLCPKC  521
            NVLC KC
Sbjct  150  NVLCSKC  156



>emb|CDP15561.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   133 bits (335),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNAS +DLKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 85.9 bits (211),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQ+FF G+PF  G  + R   +    DVVHPLKVSLEDLY+GT+KKLSLSRNV+
Sbjct  89   HDPFDIFQTFFNGDPFNRGSSRGR--RQRRGEDVVHPLKVSLEDLYSGTTKKLSLSRNVI  146

Query  510  CPKC  521
            C KC
Sbjct  147  CTKC  150



>ref|XP_009388365.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=150

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/84 (98%), Positives = 84/84 (100%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK+ASQ+DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKDASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84



>ref|XP_002969107.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
 ref|XP_002973957.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ24912.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ30223.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
Length=414

 Score =   145 bits (367),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P++S+ TKYY+ILGV K+ S +DLKKAYRKAAIKNHPDKGGDPE+FKE++QAYEV
Sbjct  1    MFGRGPRRSNETKYYDILGVSKDVSPEDLKKAYRKAAIKNHPDKGGDPEQFKEISQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEK+EIYDQYGE+ LKEGMGG
Sbjct  61   LSDPEKKEIYDQYGEEGLKEGMGG  84


 Score = 73.2 bits (178),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 46/73 (63%), Gaps = 5/73 (7%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GG     PFDIF+S F       G   +    K    DVVH LKVSLEDLYNGTSK
Sbjct  79   KEGMGGPSAGSPFDIFESLFS-----GGGGSRGGSRKRRGEDVVHTLKVSLEDLYNGTSK  133

Query  483  KLSLSRNVLCPKC  521
            KL+LSRN+LCP C
Sbjct  134  KLTLSRNILCPSC  146



>gb|ABY52936.1| DnaJ family heat shock protein [Oryza sativa Japonica Group]
Length=416

 Score =   152 bits (385),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 81/84 (96%), Gaps = 1/84 (1%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P+ S+NTKYYE+LGVPK AS+D+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            L+DPEKR+IYDQYGEDALK+GMGG
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGG  83


 Score = 66.2 bits (160),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +3

Query  315  GGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSL  494
            GG   H+PFDIF+ FFGG    +G    R + +    DV H LKVSLED+YNG+ KKLSL
Sbjct  83   GGSDFHNPFDIFEQFFGGG--AFGGSSSRVRRQRRGEDVAHTLKVSLEDVYNGSMKKLSL  140

Query  495  SRNVLCPKC  521
            SRN+LCPKC
Sbjct  141  SRNILCPKC  149



>ref|NP_001053485.1| Os04g0549600 [Oryza sativa Japonica Group]
 dbj|BAF15399.1| Os04g0549600 [Oryza sativa Japonica Group]
 dbj|BAG95310.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61449.1| hypothetical protein OsJ_15688 [Oryza sativa Japonica Group]
Length=416

 Score =   152 bits (385),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 81/84 (96%), Gaps = 1/84 (1%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P+ S+NTKYYE+LGVPK AS+D+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            L+DPEKR+IYDQYGEDALK+GMGG
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGG  83


 Score = 65.9 bits (159),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +3

Query  315  GGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSL  494
            GG   H+PFDIF+ FFGG    +G    R + +    DV H LKVSLED+YNG+ KKLSL
Sbjct  83   GGSDFHNPFDIFEQFFGGG--AFGGSSSRVRRQRRGEDVAHTLKVSLEDVYNGSMKKLSL  140

Query  495  SRNVLCPKC  521
            SRN+LCPKC
Sbjct  141  SRNILCPKC  149



>gb|KHG16063.1| DnaJ protein [Gossypium arboreum]
Length=299

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84



>gb|AGY48887.1| MIP1.4b [Nicotiana benthamiana]
Length=418

 Score =   152 bits (384),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNT+YYEILGVPKNAS+D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVPKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSD +KREIYDQYGEDALKE
Sbjct  61   LSDSQKREIYDQYGEDALKE  80


 Score = 65.5 bits (158),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF+SFFGGNPFG G   +  + +    DVVHPLKVSLEDLY+G +KKLSLSRNV+
Sbjct  89   HDPFDIFESFFGGNPFGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYSGITKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|NP_001146715.1| uncharacterized protein LOC100280317 [Zea mays]
 gb|ACL54611.1| unknown [Zea mays]
Length=419

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGGWRWYA  331
            LSDPEKREIYDQYGEDALKEGMGG   +A
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHA  89


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGGMH-DPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG H DPFDIF SFFG +  G G   +  + +    DVVH LKVSLEDLYNG S
Sbjct  79   KEGMGGGGSHADPFDIFSSFFGPSFGGGGGSSRG-RRQRRGEDVVHSLKVSLEDLYNGIS  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  138  KKLSLSRNVICSKC  151



>gb|AFW68140.1| putative dnaJ chaperone family protein isoform 1 [Zea mays]
 gb|AFW68141.1| putative dnaJ chaperone family protein isoform 2 [Zea mays]
Length=419

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK+ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGGWRWYA  331
            LSDPEKREIYDQYGEDALKEGMGG   +A
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHA  89


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGGMH-DPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG H DPFDIF SFFG +  G G   +  + +    DVVH LKVSLEDLYNG S
Sbjct  79   KEGMGGGGSHADPFDIFSSFFGPSFGGGGGSSRG-RRQRRGEDVVHSLKVSLEDLYNGIS  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  138  KKLSLSRNVICSKC  151



>gb|KHG16062.1| Chaperone protein dnaJ 3 [Gossypium arboreum]
Length=321

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/84 (99%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK ASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84



>gb|KJB41003.1| hypothetical protein B456_007G087000 [Gossypium raimondii]
 gb|KJB41005.1| hypothetical protein B456_007G087000 [Gossypium raimondii]
Length=423

 Score =   145 bits (365),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTK+YE+LGVPK+ASQD+LKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRVPKKSDNTKFYEVLGVPKSASQDELKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 72.4 bits (176),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG  H+PFDIF+SFFGG  FG G   +  + K G  DVVH LKVSLE+LYNGT+
Sbjct  79   KEGMGGGGSSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGE-DVVHALKVSLEELYNGTT  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN +C KC
Sbjct  138  KKLSLSRNAICSKC  151



>gb|KHG17902.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=417

 Score =   147 bits (371),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKS+NT+YYEILGV KNASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 69.7 bits (169),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGG-GMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGG G HDPFDIF SFFGG+   +G    R + +    DVVHPLKVSLEDLY GTS
Sbjct  79   KEGMGGGAGAHDPFDIFSSFFGGS--PFGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  137  KKLSLSRNVICSKC  150



>ref|XP_006345526.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum tuberosum]
 ref|XP_006345527.1| PREDICTED: dnaJ protein homolog isoform X2 [Solanum tuberosum]
 ref|XP_006345528.1| PREDICTED: dnaJ protein homolog isoform X3 [Solanum tuberosum]
 ref|XP_006345529.1| PREDICTED: dnaJ protein homolog isoform X4 [Solanum tuberosum]
Length=419

 Score =   149 bits (375),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR  ++SDN+KYYE+LGV KN+SQD+LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGARRSDNSKYYEVLGVSKNSSQDELKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKRE+YDQYGEDALKE
Sbjct  61   LSDPEKRELYDQYGEDALKE  80


 Score = 67.8 bits (164),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG H+PFDIF+SFFGG   G G  +   K K    DVVH L+VSLEDLYNGT+K
Sbjct  79   KEGMGGGGGHNPFDIFESFFGGAFGGGGSFRGSRKKKG--EDVVHTLRVSLEDLYNGTTK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRN+LCPKC
Sbjct  137  KLSLSRNILCPKC  149



>ref|XP_006400711.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
 gb|ESQ42164.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
Length=420

 Score =   129 bits (324),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 77/81 (95%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P +KSDNTK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKRE+YDQYGEDALKE
Sbjct  61   VLSDPEKREVYDQYGEDALKE  81


 Score = 87.4 bits (215),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 49/66 (74%), Gaps = 4/66 (6%)
 Frame = +3

Query  330  HDPFDIFQSFFG--GNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRN  503
            HDPFDIF SFFG  GNPFG G  + R + +    DVVHPLKVSLEDLY GT+KKLSLSR 
Sbjct  90   HDPFDIFSSFFGQSGNPFGGGSSRARRQRRG--EDVVHPLKVSLEDLYLGTTKKLSLSRK  147

Query  504  VLCPKC  521
             LC KC
Sbjct  148  ALCSKC  153



>emb|CAC12824.1| putative DNAJ protein [Nicotiana tabacum]
Length=418

 Score =   149 bits (376),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNT+YYEILGV KNAS D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSD +KREIYDQYGEDALKE
Sbjct  61   LSDSQKREIYDQYGEDALKE  80


 Score = 66.2 bits (160),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF+SFFGGNPFG G   +  + +    DVVHPLKVSLEDLY+G +KKLSLSRNV+
Sbjct  89   HDPFDIFESFFGGNPFGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYSGITKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|KJB35427.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=248

 Score =   145 bits (367),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKS NT+YYEILGV  NASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 69.7 bits (169),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGG-GMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGG G HDPFDIF SFF      +G    R + +    DVVHPLKVSLEDLY GTS
Sbjct  79   KEGMGGGAGAHDPFDIFSSFF--GGSPFGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  137  KKLSLSRNVICSKC  150



>gb|EYU37227.1| hypothetical protein MIMGU_mgv1a006922mg [Erythranthe guttata]
Length=426

 Score =   145 bits (366),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGRAP KKSDN KYYEILGV K AS DDLKKAYRK AIKNHPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRAPPKKSDNNKYYEILGVEKTASPDDLKKAYRKLAIKNHPDKGGDPEKFKEIAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VL+DPEKREIYDQYGEDALKE
Sbjct  61   VLNDPEKREIYDQYGEDALKE  81


 Score = 69.7 bits (169),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGX--XDVVHPLKVSLEDLYNGTSKKLSLSRN  503
            H+PFDIF+SFFGG+   +G        +      DVVHPLKVSL++LYNGTSKKLSLSRN
Sbjct  91   HNPFDIFESFFGGSGHPFGGGGGSRGQRRQRRGEDVVHPLKVSLDNLYNGTSKKLSLSRN  150

Query  504  VLCPKC  521
            VLCPKC
Sbjct  151  VLCPKC  156



>gb|KJB35426.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=417

 Score =   145 bits (365),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKS NT+YYEILGV  NASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 69.7 bits (169),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGG-GMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGG G HDPFDIF SFFGG+   +G    R + +    DVVHPLKVSLEDLY GTS
Sbjct  79   KEGMGGGAGAHDPFDIFSSFFGGS--PFGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  137  KKLSLSRNVICSKC  150



>gb|KHF97331.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=422

 Score =   143 bits (360),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTK+YE+LGVPK+ASQD+LKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRVPKKSDNTKFYEVLGVPKSASQDELKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKR+IYDQYGEDALKEGMGG
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGG  84


 Score = 72.0 bits (175),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG  H+PFDIF+SFFGG  FG G   +  + K G  DVVH LKVSLE+LYNGT+
Sbjct  79   KEGMGGGGSSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGE-DVVHALKVSLEELYNGTA  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN +C KC
Sbjct  138  KKLSLSRNAICSKC  151



>ref|XP_009411580.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=425

 Score =   155 bits (391),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYE+LGVP +A+QD+LKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPNSANQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYD+YGEDALKE
Sbjct  61   LSDPEKREIYDKYGEDALKE  80


 Score = 59.7 bits (143),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKA---KNGXXDVVHPLKVSLEDLYNGTSKKLSLSR  500
            H PFDIF+ FFGG+ FG G           +    DVVH LKVSLED+YNGTSKKLSLSR
Sbjct  93   HSPFDIFEQFFGGSTFGGGSFGGGSSRGRRQKQGEDVVHSLKVSLEDVYNGTSKKLSLSR  152

Query  501  NVLCPKC  521
            + LC KC
Sbjct  153  SALCQKC  159



>gb|KJB35429.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=444

 Score =   145 bits (366),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKS NT+YYEILGV  NASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 69.3 bits (168),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGG-GMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGG G HDPFDIF SFFGG+   +G    R + +    DVVHPLKVSLEDLY GTS
Sbjct  79   KEGMGGGAGAHDPFDIFSSFFGGS--PFGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  137  KKLSLSRNVICSKC  150



>gb|AGR45906.1| DnaJ protein 2-like protein [Triticum aestivum]
Length=421

 Score =   141 bits (356),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  83   KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEK  262
            K S+NTKYYE+LGV K A+ D+LKKAYRKAAIKNHPDKGGDPEKFKELAQAY+VL+DPEK
Sbjct  4    KTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYDVLNDPEK  63

Query  263  REIYDQYGEDALKEGMGG  316
            REIYDQYGEDA+KEGMGG
Sbjct  64   REIYDQYGEDAIKEGMGG  81


 Score = 73.2 bits (178),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 52/76 (68%), Gaps = 3/76 (4%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GG G   MH PFDIF+  FGG   G+G    R + +    DVVH +KVSLEDLYNG
Sbjct  76   KEGMGGSGGADMHSPFDIFEQLFGGGGGGFGGGSSRGRRQKRGEDVVHTMKVSLEDLYNG  135

Query  474  TSKKLSLSRNVLCPKC  521
             +KKLSLSRNVLC KC
Sbjct  136  ATKKLSLSRNVLCGKC  151



>ref|XP_002511620.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF50289.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=391

 Score =   145 bits (366),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFG  P++SDNTKYYE+LGVPKNASQD++KKAYRKAAIKNHPDKGGD EKFKEL+ AYEV
Sbjct  1    MFGYGPRRSDNTKYYEVLGVPKNASQDEMKKAYRKAAIKNHPDKGGDSEKFKELSHAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDP+KREIYDQYGE ALKE
Sbjct  61   LSDPQKREIYDQYGEAALKE  80


 Score = 69.3 bits (168),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF S FG   FG G   +  + K G  DV+H  KVSLEDLYNGT++KLSLSRNV 
Sbjct  89   HNPFDIFDSLFGRGAFGGGGSSRGRRQKRGE-DVLHATKVSLEDLYNGTTRKLSLSRNVF  147

Query  510  CPKC  521
            CPKC
Sbjct  148  CPKC  151



>gb|KJB35428.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=318

 Score =   145 bits (366),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKS NT+YYEILGV  NASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 68.9 bits (167),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGG-GMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGG G HDPFDIF SFF      +G    R + +    DVVHPLKVSLEDLY GTS
Sbjct  79   KEGMGGGAGAHDPFDIFSSFF--GGSPFGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  137  KKLSLSRNVICSKC  150



>ref|XP_009382439.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=423

 Score =   152 bits (383),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MF RA +KSDNTKYYEILGVPK+ASQD+LKKAYRKAAI+NHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFARAQRKSDNTKYYEILGVPKSASQDELKKAYRKAAIRNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYD+YGEDALKE
Sbjct  61   LSDPEKREIYDKYGEDALKE  80


 Score = 62.4 bits (150),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKA---KNGXXDVVHPLKVSLEDLYNGTSKKLSLSR  500
            H+PF+IF+ FFGG+ FG G           +    DVVH LKVSLEDLYNGTSKKLSLSR
Sbjct  91   HNPFEIFEQFFGGSSFGGGSFGGGSSRGRRQKRGEDVVHSLKVSLEDLYNGTSKKLSLSR  150

Query  501  NVLCPKC  521
            N LC KC
Sbjct  151  NALCQKC  157



>ref|XP_004229763.1| PREDICTED: dnaJ protein homolog 2-like [Solanum lycopersicum]
Length=424

 Score =   146 bits (369),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFG+AP++SDN+KYYE+LGV K+ASQD+LKKAYRKAAI+NHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGQAPRRSDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDPEKFKELGQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            L DPEKR+IYDQYGEDALKE
Sbjct  61   LIDPEKRDIYDQYGEDALKE  80


 Score = 67.4 bits (163),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +3

Query  327  MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNV  506
            +H+ FDIF+SFFGG+  G G   +  + K G  DVVH L+VSLEDLYNGT+KKLSLSR++
Sbjct  93   VHNHFDIFESFFGGSFGGGGSHFRASRQKRGE-DVVHTLRVSLEDLYNGTTKKLSLSRSI  151

Query  507  LCPKC  521
            LCPKC
Sbjct  152  LCPKC  156



>ref|XP_009789005.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=418

 Score =   148 bits (373),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNT+YYEILGV KNAS D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSD +KREIYDQYGEDALKE
Sbjct  61   LSDSQKREIYDQYGEDALKE  80


 Score = 65.5 bits (158),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF+SFFGGNPFG G   +  + +    DVVHPLKVSLEDLY+G +KKLSLSRNV+
Sbjct  89   HDPFDIFESFFGGNPFGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYSGITKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>emb|CDX70980.1| BnaC03g10640D [Brassica napus]
Length=407

 Score =   135 bits (341),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = +2

Query  65   MFGRAPK-KSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MF R P  KSDNTK+YEILGVPK+AS +DLKKAY++AAIKNHPDKGGDPEKFKEL +AY 
Sbjct  1    MFRRGPSSKSDNTKFYEILGVPKSASPEDLKKAYKRAAIKNHPDKGGDPEKFKELGEAYG  60

Query  242  VLSDPEKREIYDQYGEDALKEGM  310
            VLSDPEKREIYDQYGE+ +K+G+
Sbjct  61   VLSDPEKREIYDQYGEEGIKDGI  83


 Score = 77.8 bits (190),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 44/68 (65%), Gaps = 10/68 (15%)
 Frame = +3

Query  318  GGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLS  497
            G   HDPFDIF SFFG N           + +    DVVHPL+VSLEDLY GT+KKLSLS
Sbjct  82   GIDRHDPFDIFSSFFGRNE----------RRQRRGEDVVHPLRVSLEDLYLGTTKKLSLS  131

Query  498  RNVLCPKC  521
            RN LC KC
Sbjct  132  RNALCSKC  139



>ref|XP_010685460.1| PREDICTED: dnaJ protein homolog ANJ1 [Beta vulgaris subsp. vulgaris]
Length=417

 Score =   151 bits (381),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSD+T+YYEILGVPK+AS +DLK+AY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASPEDLKRAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 62.4 bits (150),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G   +  + +    DV+HPLKVSLEDL+ GTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLFMGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_004976432.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=419

 Score =   146 bits (369),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P++S+NTKYYE+LGV   ASQD+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPRRSNNTKYYEVLGVSSTASQDELKKAYRKAAIKSHPDKGGDPEKFKELSQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGED LKE
Sbjct  61   LSDPEKREIYDQYGEDGLKE  80


 Score = 66.6 bits (161),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+ FFGG  FG    + R + K G  DVVH LKVSLED+YNG +KKLSLSRNVL
Sbjct  89   HNPFDIFEQFFGGGSFGGSRSRVR-RQKRGE-DVVHSLKVSLEDVYNGATKKLSLSRNVL  146

Query  510  CPKC  521
            C KC
Sbjct  147  CSKC  150



>ref|XP_006424068.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 ref|XP_006487844.1| PREDICTED: dnaJ protein homolog ANJ1-like [Citrus sinensis]
 gb|ESR37308.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 gb|KDO48965.1| hypothetical protein CISIN_1g014903mg [Citrus sinensis]
Length=416

 Score =   143 bits (360),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKS+NT+YYEILGV KNAS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTRYYEILGVSKNASAEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGEDALKEGMGG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGG  84


 Score = 69.7 bits (169),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGG-GMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGG G HDPFDIF SFFGG+   +G    R + +    DVVHPLKVSLEDLY GTS
Sbjct  79   KEGMGGGAGAHDPFDIFSSFFGGS--PFGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNV+C KC
Sbjct  137  KKLSLSRNVICSKC  150



>ref|XP_002877319.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53578.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   132 bits (331),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/81 (93%), Positives = 78/81 (96%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P KKSDNTK+YEILGVPKNAS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 80.5 bits (197),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFG +PFG      R + +    DVVHPLKVSLED+Y GT KKLSLSRN L
Sbjct  90   HDPFDIFSSFFGRSPFG-DGGSSRGRRQRRGEDVVHPLKVSLEDVYLGTMKKLSLSRNAL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|XP_006650350.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=417

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGVPK+ASQDDLKKAYRKAAIKN PDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNPPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGGWRWYA  331
            LSDPEKREIYDQYGEDALKEGMGG   +A
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHA  89


 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGGGMH-DPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGGG H DPFDIF SFFG +    G    R + +    DV+HPLKVSLEDLYNGTS
Sbjct  79   KEGMGGGGSHADPFDIFSSFFGPS--FGGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNVLC KC
Sbjct  137  KKLSLSRNVLCAKC  150



>ref|XP_009592511.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=418

 Score =   149 bits (375),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNT+YYEILGV KNAS D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSD +KREIYDQYGEDALKE
Sbjct  61   LSDSQKREIYDQYGEDALKE  80


 Score = 63.2 bits (152),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF+SFFGGNPFG G   +  + +    DVVH LKVSLEDLY+G +KKLSLSRNV+
Sbjct  89   HDPFDIFESFFGGNPFGGGGSSRG-RRQRRGEDVVHTLKVSLEDLYSGITKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_006837307.1| hypothetical protein AMTR_s00111p00054240 [Amborella trichopoda]
 gb|ERN00161.1| hypothetical protein AMTR_s00111p00054240 [Amborella trichopoda]
Length=304

 Score =   138 bits (347),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP++ DN++YY+ILGV KNASQD+LKKAY+KAAIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPRRGDNSRYYDILGVSKNASQDELKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKRE+YDQYGEDALKEGMGG
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGG  84


 Score = 73.9 bits (180),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGGG-MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GG G  H+PFDIF+SFFGG  FG G  + R + +    DVVH LKVSLEDLYNGTS
Sbjct  79   KEGMGGAGPSHNPFDIFESFFGGGGFGGGSSRGRRQKQG--DDVVHSLKVSLEDLYNGTS  136

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNVLCPKC
Sbjct  137  KKLSLSRNVLCPKC  150



>gb|EYU36024.1| hypothetical protein MIMGU_mgv1a007013mg [Erythranthe guttata]
Length=422

 Score =   150 bits (379),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/81 (93%), Positives = 76/81 (94%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGRAP  KSDNTKYYE+LGVPK AS DDLKKAYRKAAIKNHPDKGGDPEKFKELA AYE
Sbjct  1    MFGRAPPSKSDNTKYYEVLGVPKTASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAHAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 60.8 bits (146),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G   +  + +    DVVH LKVSLEDLY GTSKKLSLSRNVL
Sbjct  92   HDPFDIFSSFFGGSPFGGGGSSRG-RRQRRGEDVVHALKVSLEDLYLGTSKKLSLSRNVL  150

Query  510  CPKC  521
            C KC
Sbjct  151  CKKC  154



>ref|XP_009779099.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009779100.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=423

 Score =   148 bits (374),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR  ++S+N+KYYE+LGVPKN+SQD+LKKAYRKAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRGARRSENSKYYEVLGVPKNSSQDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDAL E
Sbjct  61   LSDPEKREIYDQYGEDALNE  80


 Score = 61.6 bits (148),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  411  KNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVLCPKC  521
            K    + VH L+VSLEDLYNGT+KKLSLSRN+LCPKC
Sbjct  118  KKQGENAVHALRVSLEDLYNGTTKKLSLSRNILCPKC  154



>ref|XP_002983333.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
 ref|XP_002987616.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ11191.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ15675.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
Length=419

 Score =   146 bits (369),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDN+KYY+ILGV K+AS D+LKKAYRKAAIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRPPKKSDNSKYYDILGVSKSASADELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEK+EIYDQYGEDALKE
Sbjct  61   LSDPEKKEIYDQYGEDALKE  80


 Score = 63.2 bits (152),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG H+PFDIF SFFGG PFG G  +   + +    DVVHPLKVSLEDLYNG+ K
Sbjct  79   KEGMGGGGGHNPFDIFDSFFGGKPFGGGSSRGG-RRQRRGEDVVHPLKVSLEDLYNGSVK  137

Query  483  KLSLSRNVLCPKC  521
            KLSLSRN +C KC
Sbjct  138  KLSLSRNAICSKC  150



>ref|XP_010263053.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=417

 Score =   140 bits (354),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQ+DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSDP+KR+IYDQYGEDALKEGM 
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMS  83


 Score = 68.6 bits (166),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+PFG G   +  + +    DV+HPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  89   HDPFDIFQSFFGGSPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYMGTSKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|AAB86799.1| putative [Arabidopsis thaliana]
 prf||2118338A AtJ2 protein
Length=419

 Score =   128 bits (321),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 77/81 (95%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P +KSDNTK+YEILGVPK A+ +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 80.9 bits (198),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 47/66 (71%), Gaps = 5/66 (8%)
 Frame = +3

Query  330  HDPFDIFQSFFG--GNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRN  503
            HDPFDIF SFFG  G+PFG      R + +    DVVHPLKVSLED+Y GT+KKLSLSR 
Sbjct  90   HDPFDIFSSFFGSGGHPFGS---HSRGRRQRRGEDVVHPLKVSLEDVYLGTTKKLSLSRK  146

Query  504  VLCPKC  521
             LC KC
Sbjct  147  ALCSKC  152



>ref|NP_568412.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
 sp|P42825.2|DNAJ2_ARATH RecName: Full=Chaperone protein dnaJ 2; Short=AtDjA2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC34499.1| DNAJ PROTEIN HOMOLOG ATJ [Arabidopsis thaliana]
 dbj|BAC42997.1| putative DnaJ protein homolog ATJ [Arabidopsis thaliana]
 gb|ABH04586.1| At5g22060 [Arabidopsis thaliana]
 gb|AED92977.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
Length=419

 Score =   128 bits (321),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 77/81 (95%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P +KSDNTK+YEILGVPK A+ +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 80.9 bits (198),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 47/66 (71%), Gaps = 5/66 (8%)
 Frame = +3

Query  330  HDPFDIFQSFFG--GNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRN  503
            HDPFDIF SFFG  G+PFG      R + +    DVVHPLKVSLED+Y GT+KKLSLSR 
Sbjct  90   HDPFDIFSSFFGSGGHPFGS---HSRGRRQRRGEDVVHPLKVSLEDVYLGTTKKLSLSRK  146

Query  504  VLCPKC  521
             LC KC
Sbjct  147  ALCSKC  152



>ref|XP_004139085.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 gb|KGN66611.1| DnaJ [Cucumis sativus]
Length=413

 Score =   139 bits (349),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSD+T+YYEILGV KNASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 69.7 bits (169),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIFQSFFGG+   +G    R + +    DVVHPLKVSLEDLY GTSK
Sbjct  79   KEGMGGGGGHDPFDIFQSFFGGS--PFGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTSK  136

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  137  KLSLSRNVICSKC  149



>emb|CAD41609.2| OSJNBb0034G17.1 [Oryza sativa Japonica Group]
Length=704

 Score =   143 bits (361),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +2

Query  86   KSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKR  265
            +S+NTKYYE+LGVPK AS+D+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEVL+DPEKR
Sbjct  295  ESNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEVLTDPEKR  354

Query  266  EIYDQYGEDALKEGMGG  316
            +IYDQYGEDALK+GMGG
Sbjct  355  DIYDQYGEDALKDGMGG  371


 Score = 65.1 bits (157),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +3

Query  315  GGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSL  494
            GG   H+PFDIF+ FFGG    +G    R + +    DV H LKVSLED+YNG+ KKLSL
Sbjct  371  GGSDFHNPFDIFEQFFGGG--AFGGSSSRVRRQRRGEDVAHTLKVSLEDVYNGSMKKLSL  428

Query  495  SRNVLCPKC  521
            SRN+LCPKC
Sbjct  429  SRNILCPKC  437



>ref|XP_007132506.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
 gb|ESW04500.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
Length=418

 Score =   139 bits (351),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKRE+YDQYGEDALKE
Sbjct  61   LSDPEKREVYDQYGEDALKE  80


 Score = 68.6 bits (166),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIF SFFGG          R + +    DVVHPLKVSLEDLY GTSK
Sbjct  79   KEGMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTSK  138

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  139  KLSLSRNVICSKC  151



>gb|AHA84223.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   139 bits (351),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKRE+YDQYGEDALKE
Sbjct  61   LSDPEKREVYDQYGEDALKE  80


 Score = 68.2 bits (165),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIF SFFGG          R + +    DVVHPLKVSLEDLY GTSK
Sbjct  79   KEGMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTSK  138

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  139  KLSLSRNVICSKC  151



>emb|CAI64493.1| OSJNBa0065H10.16 [Oryza sativa Japonica Group]
Length=439

 Score =   143 bits (360),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +2

Query  86   KSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKR  265
            +S+NTKYYE+LGVPK AS+D+LKKAYRKAAIKNHPDKGGDPEKFKEL+QAYEVL+DPEKR
Sbjct  295  ESNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEVLTDPEKR  354

Query  266  EIYDQYGEDALKEGMGG  316
            +IYDQYGEDALK+GMGG
Sbjct  355  DIYDQYGEDALKDGMGG  371


 Score = 64.3 bits (155),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +3

Query  315  GGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSL  494
            GG   H+PFDIF+ FFGG    +G    R + +    DV H LKVSLED+YNG+ KKLSL
Sbjct  371  GGSDFHNPFDIFEQFFGGG--AFGGSSSRVRRQRRGEDVAHTLKVSLEDVYNGSMKKLSL  428

Query  495  SRNVLCPKC  521
            SRN+LCPKC
Sbjct  429  SRNILCPKC  437



>gb|AHA84264.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   139 bits (350),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV KNASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKRE+YDQYGEDALKE
Sbjct  61   LSDPEKREVYDQYGEDALKE  80


 Score = 67.8 bits (164),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIF SFFGG          R + +    DVVHPLKVSLEDLY GTSK
Sbjct  79   KEGMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTSK  138

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  139  KLSLSRNVICSKC  151



>dbj|BAK03083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score =   141 bits (355),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAPKK-SDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P+K S+NTKYYE+LGV K A+ D+LKKAYRKAAIKNHPDKGGDPEKFKELAQAY+
Sbjct  1    MFGRMPRKTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYD  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VL+DPEKREIYDQYGEDALKE
Sbjct  61   VLNDPEKREIYDQYGEDALKE  81


 Score = 65.9 bits (159),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  318  GGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLS  497
               MH PFDIF+  FGG   G+G    R + +    DVVH +KVSLEDLYNG +KKLSLS
Sbjct  88   SSDMHSPFDIFEQLFGGGGGGFGGGSSRGRRQKRGEDVVHTMKVSLEDLYNGATKKLSLS  147

Query  498  RNVLC  512
            RNVLC
Sbjct  148  RNVLC  152



>sp|P42824.1|DNJH2_ALLPO RecName: Full=DnaJ protein homolog 2; Flags: Precursor [Allium 
ampeloprasum]
 emb|CAA54720.1| LDJ2 [Allium ampeloprasum]
Length=418

 Score =   139 bits (349),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYE+LGV KNA+ +DLKKAYRKAAIKNHPDKGGDPEKFKE+ QAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKNATPEDLKKAYRKAAIKNHPDKGGDPEKFKEIGQAYEV  60

Query  245  LSDPEKREIYDQY  283
            L+DPEKREIYDQY
Sbjct  61   LNDPEKREIYDQY  73


 Score = 67.8 bits (164),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +3

Query  327  MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNV  506
            +HDPFDIFQSFFGG  FG G   +  + +    DVVHPLKVSLEDLYNGTSKKLSLSRNV
Sbjct  88   VHDPFDIFQSFFGGGGFGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYNGTSKKLSLSRNV  146

Query  507  LCPKC  521
            LC KC
Sbjct  147  LCTKC  151



>ref|XP_008232370.1| PREDICTED: dnaJ protein homolog 2-like [Prunus mume]
Length=415

 Score =   130 bits (328),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFG A +KSDNTKYY +LGV KN+S D+LKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGHASRKSDNTKYYGVLGVSKNSSADELKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYDQYGED LKEG GG
Sbjct  61   LSDPEKREIYDQYGEDGLKEGAGG  84


 Score = 75.9 bits (185),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 7/74 (9%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE  GGG   H+PFD+F++F   NP    +     + K G  DVVH L+VSLEDLYNGT+
Sbjct  79   KEGAGGGSTSHNPFDLFEAFL--NP---RYRSHVRRQKQGE-DVVHTLRVSLEDLYNGTT  132

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRN+LC KC
Sbjct  133  KKLSLSRNILCLKC  146



>ref|XP_010263054.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=416

 Score =   137 bits (344),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNT+YYEILGVPKNAS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRQPKKSDNTRYYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 68.9 bits (167),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIFQSFFGGNPFG G   +  + +    DV+HPLKVSLEDLY GTSK
Sbjct  79   KEGMGGGGGHDPFDIFQSFFGGNPFGGGGSSRG-RRQRRGEDVIHPLKVSLEDLYVGTSK  137

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  138  KLSLSRNVICSKC  150



>ref|XP_004487721.1| PREDICTED: dnaJ protein homolog [Cicer arietinum]
Length=343

 Score =   138 bits (347),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP KSDNTKYYEILGV K+ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPTKSDNTKYYEILGVSKSASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 67.8 bits (164),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG  F  G  + R + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGGGFSGGGGRVRRQRRG--EDVVHPLKVSLEDLYLGTSKKLSLSRNVL  146

Query  510  CPKC  521
            C KC
Sbjct  147  CSKC  150



>gb|KDP36478.1| hypothetical protein JCGZ_08608 [Jatropha curcas]
Length=172

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSDNTKYYEILG+ KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTKYYEILGISKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPE+REIYDQYGEDALKE
Sbjct  61   LSDPERREIYDQYGEDALKE  80



>ref|XP_004251216.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=418

 Score =   139 bits (351),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRA-PKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR   KKSDNTK+YEILGV KNAS+D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGGKKKSDNTKFYEILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSD +KREIYDQYGE+ALKE
Sbjct  61   VLSDSQKREIYDQYGEEALKE  81


 Score = 65.5 bits (158),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFD+F SFF G+   +G   +R + +    DVVHPLKVSLEDLYNG +KKLSLSRNV+
Sbjct  90   HDPFDLFNSFFSGS--PFGGGGRRGQRERRGDDVVHPLKVSLEDLYNGMTKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|NP_001242510.1| uncharacterized protein LOC100808604 [Glycine max]
 gb|ACU21221.1| unknown [Glycine max]
Length=410

 Score =   139 bits (349),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT++YEILGV KNASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRHYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 64.7 bits (156),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 50/73 (68%), Gaps = 7/73 (10%)
 Frame = +3

Query  303  KEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSK  482
            KE +GGGG HDPFDIF S        +G    R + +    DVVHPLKVSLEDLY GTSK
Sbjct  79   KEGMGGGGGHDPFDIFSS-------FFGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTSK  131

Query  483  KLSLSRNVLCPKC  521
            KLSLSRNV+C KC
Sbjct  132  KLSLSRNVICSKC  144



>ref|XP_004506241.1| PREDICTED: dnaJ protein homolog ANJ1-like [Cicer arietinum]
Length=418

 Score =   134 bits (338),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSD+T+YYEILGV KNASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRQPKKSDSTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYD YGEDALKE
Sbjct  61   LSDPEKREIYDTYGEDALKE  80


 Score = 68.9 bits (167),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGGN FG G   +  + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGNHFGGGGGSRG-RRQRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|ACJ85213.1| unknown [Medicago truncatula]
Length=122

 Score =   153 bits (386),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNAS DDLKKAY KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASPDDLKKAYEKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKRE+YDQYGEDALKE
Sbjct  61   LSDPEKREVYDQYGEDALKE  80



>ref|XP_010493266.1| PREDICTED: chaperone protein dnaJ 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010493267.1| PREDICTED: chaperone protein dnaJ 2-like isoform X2 [Camelina 
sativa]
Length=420

 Score =   136 bits (342),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 1/84 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P +KSDNTK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKEGMG  313
            VLSDPEKREIYDQYGEDALKEGMG
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMG  84


 Score = 66.6 bits (161),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +3

Query  303  KEWVG-GGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +G   G HDPFDIF SFFGG    +G    R + +    DVVHPLKVSLED+Y GT+
Sbjct  80   KEGMGPASGGHDPFDIFSSFFGGGGHPFGGGSSRGRRQRRGEDVVHPLKVSLEDVYLGTT  139

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSR  LC KC
Sbjct  140  KKLSLSRKALCSKC  153



>dbj|BAA76883.1| DnaJ homolog protein [Salix gilgiana]
 dbj|BAA76888.1| DnaJ homolog protein [Salix gilgiana]
Length=423

 Score =   130 bits (328),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP++SDNTKYYE+L V K ASQD+LKKAY+KAAIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLAVSKGASQDELKKAYKKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDP+KREIYDQYGEDALKE
Sbjct  61   LSDPDKREIYDQYGEDALKE  80


 Score = 72.0 bits (175),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            H+PFDIF+SFFGG  FG G   +  + K G  DV HPLKVSLEDLYNGTSKKLSLSRN+L
Sbjct  91   HNPFDIFESFFGGGGFGGGSSSRGRRQKQGE-DVAHPLKVSLEDLYNGTSKKLSLSRNIL  149

Query  510  CPKC  521
            C KC
Sbjct  150  CAKC  153



>ref|XP_010694477.1| PREDICTED: dnaJ protein homolog [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   133 bits (334),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/80 (91%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKSD+T+YYEILGVPKNAS +DLKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRPPKKSDSTRYYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 69.7 bits (169),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G    R + +    DV+HPLKVSLED+YNGTSKKLSLSRNV+
Sbjct  89   HDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGEDVIHPLKVSLEDIYNGTSKKLSLSRNVI  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|XP_006340318.1| PREDICTED: dnaJ protein homolog ANJ1-like isoform X1 [Solanum 
tuberosum]
Length=419

 Score =   139 bits (349),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRA-PKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR   KKSDNT++YEILGV KNAS+D++KKAYRKAA+KNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGGKKKSDNTRFYEILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSD +KREIYDQYGE+ALKE
Sbjct  61   VLSDSQKREIYDQYGEEALKE  81


 Score = 63.5 bits (153),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFD+F + F       G   +R + +    DVVHPLKVSLEDLY G +KKLSLSRNV+
Sbjct  90   HDPFDLF-NSFFSGSPFGGGGGRRGQRERRGDDVVHPLKVSLEDLYTGITKKLSLSRNVI  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|XP_003596916.1| DnaJ [Medicago truncatula]
 gb|AES67167.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=417

 Score =   138 bits (347),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNAS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKRE+YDQYGEDALKE
Sbjct  61   LSDPEKREVYDQYGEDALKE  80


 Score = 64.3 bits (155),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG  F  G   +  + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGGGFPGGGSSRG-RRQRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_007150008.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
 gb|ESW22002.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
Length=418

 Score =   133 bits (335),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSD+T+YYEILGV KNAS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVAKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMG  313
            LSD EKREIYD YGEDALKEGM 
Sbjct  61   LSDAEKREIYDTYGEDALKEGMS  83


 Score = 68.6 bits (166),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF S F G     G    R + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  89   HDPFDIF-SSFFGGNPFGGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|AES67168.2| DnaJ-class molecular chaperone [Medicago truncatula]
Length=327

 Score =   138 bits (347),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEILGV KNAS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKRE+YDQYGEDALKE
Sbjct  61   LSDPEKREVYDQYGEDALKE  80


 Score = 63.5 bits (153),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG  F  G   +  + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGGGFPGGGSSRG-RRQRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|KDO48711.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48712.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48713.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=402

 Score =   129 bits (325),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +2

Query  128  KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  307
            KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG
Sbjct  8    KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  67

Query  308  MGG  316
            MGG
Sbjct  68   MGG  70


 Score = 72.0 bits (175),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+   +G    R + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  75   HDPFDIFQSFFGGS--PFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  132

Query  510  CPKC  521
            C KC
Sbjct  133  CTKC  136



>ref|XP_009131855.1| PREDICTED: chaperone protein dnaJ 3-like [Brassica rapa]
 emb|CDX88812.1| BnaA03g08370D [Brassica napus]
Length=408

 Score =   123 bits (308),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +2

Query  65   MFGRAPK-KSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MF R P  KSDNTK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKEL +AY 
Sbjct  1    MFRRGPSSKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELGEAYG  60

Query  242  VLSDPEKREIYDQYGEDALKEGM  310
            VLSDPEKREIYDQYGED LKEGM
Sbjct  61   VLSDPEKREIYDQYGEDGLKEGM  83


 Score = 77.8 bits (190),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 44/69 (64%), Gaps = 10/69 (14%)
 Frame = +3

Query  315  GGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSL  494
            G    HDPFDIF SFFG N           + +    DVVHPL+VSLEDLY GT+KKLSL
Sbjct  82   GMSDRHDPFDIFSSFFGRNE----------RRQRRGEDVVHPLRVSLEDLYLGTTKKLSL  131

Query  495  SRNVLCPKC  521
            SRN LC KC
Sbjct  132  SRNALCSKC  140



>ref|XP_011093285.1| PREDICTED: chaperone protein dnaJ 3-like [Sesamum indicum]
 ref|XP_011093286.1| PREDICTED: chaperone protein dnaJ 3-like [Sesamum indicum]
Length=421

 Score =   134 bits (338),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKS++ K+YEILGVP +ASQD+LKKAY+KAAIKNHPDKGGDPEKFKELA AYE+
Sbjct  1    MFGRAPKKSNDLKFYEILGVPISASQDELKKAYKKAAIKNHPDKGGDPEKFKELAHAYEI  60

Query  245  LSDPEKREIYDQYGEDALKEGMGG  316
            LSDPEKREIYD+YGEDA+KEGMGG
Sbjct  61   LSDPEKREIYDEYGEDAVKEGMGG  84


 Score = 66.6 bits (161),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKA-KNGXXDVVHPLKVSLEDLYNGT  476
            KE +GGG   +DPF+IF+SFFGG   G     +  ++ K    DVVHPL+VSLEDLYNGT
Sbjct  79   KEGMGGGSHSYDPFNIFESFFGGGFGGGFGGGRSSRSRKRQGEDVVHPLRVSLEDLYNGT  138

Query  477  SKKLSLSRNVLCPKC  521
            ++KLS+SRN LC KC
Sbjct  139  TRKLSISRNALCNKC  153



>gb|KFK26344.1| hypothetical protein AALP_AA8G235700 [Arabis alpina]
Length=421

 Score =   122 bits (306),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 76/86 (88%), Gaps = 2/86 (2%)
 Frame = +2

Query  65   MFGRAP--KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAY  238
            MFGR P  K SDNTK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKE+A+AY
Sbjct  1    MFGRGPSRKASDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKEIAKAY  60

Query  239  EVLSDPEKREIYDQYGEDALKEGMGG  316
            E LSDPEKREIYDQYGE+ L +G GG
Sbjct  61   EALSDPEKREIYDQYGEEGLNDGAGG  86


 Score = 78.6 bits (192),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 50/71 (70%), Gaps = 3/71 (4%)
 Frame = +3

Query  312  VGGGGMHDPFDIFQSFF-GGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKL  488
             GG G HDPFDIFQ+FF G +PF      +R + +    DVVHPLKVSLEDLY GT+KKL
Sbjct  84   AGGRGGHDPFDIFQNFFHGDSPFSG--HGRRARRERRGEDVVHPLKVSLEDLYLGTTKKL  141

Query  489  SLSRNVLCPKC  521
            SLSR  LC KC
Sbjct  142  SLSRKALCSKC  152



>gb|KDO48715.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=315

 Score =   129 bits (325),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +2

Query  128  KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  307
            KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG
Sbjct  8    KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  67

Query  308  MGG  316
            MGG
Sbjct  68   MGG  70


 Score = 71.2 bits (173),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIFQSFFGG+   +G    R + +    DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  75   HDPFDIFQSFFGGS--PFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVI  132

Query  510  CPKC  521
            C KC
Sbjct  133  CTKC  136



>ref|XP_002446897.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor]
 gb|EES11225.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor]
Length=418

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 86/102 (84%), Gaps = 5/102 (5%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP++S+NTKYYE+LGV   ASQD+LKKAYRKAAIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSNNTKYYEVLGVSNTASQDELKKAYRKAAIKSHPDKGGDPEKFKELSQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGGWRWYA*SI*HFPIFLWWQ  370
            LSDPEKREIYDQYGED LKEGMGG   Y     H P  ++ Q
Sbjct  61   LSDPEKREIYDQYGEDGLKEGMGGGSDY-----HNPFDIFEQ  97


 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 3/74 (4%)
 Frame = +3

Query  303  KEWVGGGG-MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGG   H+PFDIF+ FFGG  FG    + R + K G  DVVH LKVSLED+YNG +
Sbjct  79   KEGMGGGSDYHNPFDIFEQFFGGGAFGGSSSRVR-RQKRGD-DVVHSLKVSLEDVYNGAT  136

Query  480  KKLSLSRNVLCPKC  521
            K+LSLSRNVLC KC
Sbjct  137  KRLSLSRNVLCSKC  150



>ref|XP_008375745.1| PREDICTED: dnaJ protein homolog 2-like [Malus domestica]
Length=419

 Score =   125 bits (314),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  68   FGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVL  247
            FG A +KSDNTKYY +LGVPK+AS D+LKKAY+KAAIKNHPDKGGDPEKFKEL QAYEVL
Sbjct  5    FGHAARKSDNTKYYGVLGVPKSASADELKKAYKKAAIKNHPDKGGDPEKFKELGQAYEVL  64

Query  248  SDPEKREIYDQYGEDALKEGMGG  316
            S+PEKREIYD+YGED LKEG GG
Sbjct  65   SNPEKREIYDEYGEDGLKEGAGG  87


 Score = 74.7 bits (182),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 50/74 (68%), Gaps = 7/74 (9%)
 Frame = +3

Query  303  KEWVGGGGM-HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE  GGG   H+PFD+F++F   NP    +     + K G  DVVH LKVSLEDLYNGT+
Sbjct  82   KEGAGGGSTSHNPFDLFETFL--NPR---YRSHVRRQKQGE-DVVHTLKVSLEDLYNGTT  135

Query  480  KKLSLSRNVLCPKC  521
            KKLSLS N+LC KC
Sbjct  136  KKLSLSLNILCTKC  149



>gb|AAD09517.1| NTFP2, partial [Nicotiana tabacum]
Length=118

 Score =   150 bits (378),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRA KKSDNTKYYEILGVPK AS +DLKKAYRKAAIKNHPDKGGDPE FKELAQAYEV
Sbjct  1    MFGRATKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEMFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80



>ref|XP_009622737.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
 ref|XP_009622738.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
Length=421

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 2/98 (2%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAP++SDN+KYYE+LGV K+ASQD+LKKAYRKAAI+NHPDKGGDPEKFK LAQAY+V
Sbjct  1    MFGRAPRRSDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDPEKFKGLAQAYDV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGGWRWYA*SI*HFPIF  358
            LSDPEKR+IYDQYGEDALKEGMG       S  HF IF
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGSSGGGVHS--HFDIF  96


 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +3

Query  303  KEWVG--GGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGT  476
            KE +G  GGG+H  FDIF+SFFGG  FG G  + R   +    DVVH L+VSLEDLYNGT
Sbjct  79   KEGMGSSGGGVHSHFDIFESFFGGGSFGGGSSRFRASRQKQGEDVVHTLRVSLEDLYNGT  138

Query  477  SKKLSLSRNVLCPKC  521
            +KKLSLSRN LC KC
Sbjct  139  TKKLSLSRNRLCSKC  153



>gb|AFK37703.1| unknown [Medicago truncatula]
Length=417

 Score =   134 bits (338),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNTKYYEI GV KNAS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEIPGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKRE+YDQYGEDALKE
Sbjct  61   LSDPEKREVYDQYGEDALKE  80


 Score = 64.3 bits (155),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG  F  G   +  + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGGGFPGGGSSRG-RRQRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_004510114.1| PREDICTED: dnaJ protein homolog 2-like [Cicer arietinum]
Length=421

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR P+KSDNTKYY+ILGV KNAS+D++KKAYRKAA+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRGPRKSDNTKYYDILGVAKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGGWRWY  328
            LSDPEK+E+YDQYGEDALKEGMGG   +
Sbjct  61   LSDPEKKEMYDQYGEDALKEGMGGGSSF  88


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 2/74 (3%)
 Frame = +3

Query  303  KEWVGGGG-MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTS  479
            KE +GGG   H+PFDIF+SFFGG  FG G   +  + K G  DVVH LKVSLED+YNGT+
Sbjct  79   KEGMGGGSSFHNPFDIFESFFGGAGFGGGGPSRGRRQKQGE-DVVHSLKVSLEDVYNGTT  137

Query  480  KKLSLSRNVLCPKC  521
            KKLSLSRNVLCPKC
Sbjct  138  KKLSLSRNVLCPKC  151



>ref|XP_006647627.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Oryza brachyantha]
Length=422

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 87/102 (85%), Gaps = 3/102 (3%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKS+NTKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGGWRWYA*SI*HFPIFLWWQ  370
            L+DPEKR+IYDQYGEDALKEGMGG      S  H P  L+ Q
Sbjct  61   LNDPEKRDIYDQYGEDALKEGMGGGSS---SDFHSPFDLFEQ  99


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 49/76 (64%), Gaps = 7/76 (9%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNG  473
            KE +GGG     H PFD+F+  F G   G+G    R K      DVVH +KVSLEDLYNG
Sbjct  79   KEGMGGGSSSDFHSPFDLFEQLFQGRS-GFGGRGHRQKR---GEDVVHTMKVSLEDLYNG  134

Query  474  TSKKLSLSRNVLCPKC  521
            T+KKLSLSRN LC KC
Sbjct  135  TTKKLSLSRNALCTKC  150



>ref|XP_006647626.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Oryza brachyantha]
Length=423

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 87/102 (85%), Gaps = 3/102 (3%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGR PKKS+NTKYYE+LGV K A+QD+LKKAYRKAAIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKEGMGGWRWYA*SI*HFPIFLWWQ  370
            L+DPEKR+IYDQYGEDALKEGMGG      S  H P  L+ Q
Sbjct  61   LNDPEKRDIYDQYGEDALKEGMGGGSS---SDFHSPFDLFEQ  99


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 51/77 (66%), Gaps = 8/77 (10%)
 Frame = +3

Query  303  KEWVGGGG---MHDPFDIFQSFFGGNP-FGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYN  470
            KE +GGG     H PFD+F+  F G   FG G   ++ + +    DVVH +KVSLEDLYN
Sbjct  79   KEGMGGGSSSDFHSPFDLFEQLFQGRSGFGVGRGHRQKRGE----DVVHTMKVSLEDLYN  134

Query  471  GTSKKLSLSRNVLCPKC  521
            GT+KKLSLSRN LC KC
Sbjct  135  GTTKKLSLSRNALCTKC  151



>ref|XP_003605980.1| DnaJ [Medicago truncatula]
 gb|AES88177.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=416

 Score =   134 bits (337),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSD+T+YYEILGV K ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYD YGEDALKE
Sbjct  61   LSDPEKREIYDTYGEDALKE  80


 Score = 64.3 bits (155),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG   G    +++ + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  90   HDPFDIFSSFFGGGGGGSSRGRRQRRGE----DVVHPLKVSLEDLYLGTSKKLSLSRNVL  145

Query  510  CPKC  521
            C KC
Sbjct  146  CSKC  149



>gb|ACJ85577.1| unknown [Medicago truncatula]
Length=263

 Score =   134 bits (337),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSD+T+YYEILGV K ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYD YGEDALKE
Sbjct  61   LSDPEKREIYDTYGEDALKE  80


 Score = 63.9 bits (154),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG   G    +++ + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  90   HDPFDIFSSFFGGGGGGSSRGRRQRRGE----DVVHPLKVSLEDLYLGTSKKLSLSRNVL  145

Query  510  CPKC  521
            C KC
Sbjct  146  CSKC  149



>ref|XP_003605981.1| DnaJ [Medicago truncatula]
Length=413

 Score =   134 bits (337),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSD+T+YYEILGV K ASQDDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYD YGEDALKE
Sbjct  61   LSDPEKREIYDTYGEDALKE  80


 Score = 63.9 bits (154),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 43/64 (67%), Gaps = 7/64 (11%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF S        +G    R + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  90   HDPFDIFSS-------FFGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVL  142

Query  510  CPKC  521
            C KC
Sbjct  143  CSKC  146



>ref|NP_001240264.1| uncharacterized protein LOC100818805 [Glycine max]
 gb|ACU23708.1| unknown [Glycine max]
Length=417

 Score =   134 bits (336),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSD+T+YYEILGV KNAS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYD YGEDALKE
Sbjct  61   LSDPEKREIYDTYGEDALKE  80


 Score = 64.3 bits (155),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G   +  + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGSGGSSRG-RRQRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_002874044.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50303.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   129 bits (325),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 77/81 (95%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P +KSDNTK+YEILGVPK AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 68.6 bits (166),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG    +G   +  + + G  DVVHPLKVSLED+Y GT+KKLSLSR VL
Sbjct  90   HDPFDIFSSFFGGGGNPFGGHSRGRRQRRGE-DVVHPLKVSLEDVYLGTTKKLSLSRKVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>gb|KHN17991.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   134 bits (336),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSD+T+YYEILGV KNAS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYD YGEDALKE
Sbjct  61   LSDPEKREIYDTYGEDALKE  80


 Score = 64.3 bits (155),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G   +  + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGSGGSSRG-RRQRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_003540271.1| PREDICTED: dnaJ protein homolog [Glycine max]
Length=417

 Score =   134 bits (336),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSD+T+YYEILGV KNAS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYD YGEDALKE
Sbjct  61   LSDPEKREIYDTYGEDALKE  80


 Score = 64.3 bits (155),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G   +  + +    DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGSGGSSRG-RRQRRGEDVVHPLKVSLEDLYLGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_009368443.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   136 bits (342),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV K+AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 61.2 bits (147),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G   +  + +    DVVH LKVSLEDLY GTSKKLSLSRNVL
Sbjct  90   HDPFDIFSSFFGGSPFGGGGSSRG-RRQRRGEDVVHALKVSLEDLYLGTSKKLSLSRNVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|XP_011090296.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=417

 Score =   135 bits (339),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YY+ILGVPK AS DDLKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYDILGVPKTASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 62.0 bits (149),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G   +  + +    DVVHPLKVSLEDLY GT+KKLSLSRNV+
Sbjct  89   HDPFDIFSSFFGGSPFGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYLGTTKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_008385581.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   136 bits (342),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV K+AS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 61.2 bits (147),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G   +  + +    DVVH LKVSLEDLY GTSKKLSLSRNVL
Sbjct  90   HDPFDIFSSFFGGSPFGGGGSSRG-RRQRRGEDVVHALKVSLEDLYLGTSKKLSLSRNVL  148

Query  510  CPKC  521
            C KC
Sbjct  149  CSKC  152



>ref|XP_011088982.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=413

 Score =   135 bits (339),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDN++YYEILGVPK AS DDLKKAY+KAAIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNSRYYEILGVPKTASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 62.0 bits (149),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G   +  + +    DVVHPLKVSLEDLY GT+KKLSLSRNV+
Sbjct  89   HDPFDIFSSFFGGSPFGGGGSSRG-RRQRRGEDVVHPLKVSLEDLYLGTTKKLSLSRNVI  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_007205259.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
 gb|EMJ06458.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
Length=418

 Score =   136 bits (343),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV +NAS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 60.1 bits (144),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G   +  + +    DVVH LKVSLED+Y GTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGGGGSSRG-RRQRRGEDVVHSLKVSLEDIYLGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_008230416.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=418

 Score =   136 bits (343),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRAPKKSDNT+YYEILGV +NAS DDLKKAY+KAAIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 60.1 bits (144),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG+PFG G   +  + +    DVVH LKVSLED+Y GTSKKLSLSRNVL
Sbjct  89   HDPFDIFSSFFGGSPFGGGGSSRG-RRQRRGEDVVHSLKVSLEDIYLGTSKKLSLSRNVL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|AAB49030.1| DnaJ homolog [Arabidopsis thaliana]
Length=420

 Score =   130 bits (327),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 78/81 (96%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P KKSDNTK+YEILGVPK+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 66.2 bits (160),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG PFG    +QR + +    DVVHPLKVSLED+Y GT KKLSLSRN L
Sbjct  90   HDPFDIFSSFFGGGPFGGNTSRQRRQRRG--EDVVHPLKVSLEDVYLGTMKKLSLSRNAL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>gb|AAK74013.1| AT3g44110/F26G5_60 [Arabidopsis thaliana]
Length=420

 Score =   130 bits (327),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 78/81 (96%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P KKSDNTK+YEILGVPK+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 65.9 bits (159),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG PFG    +QR + +    DVVHPLKVSLED+Y GT KKLSLSRN L
Sbjct  90   HDPFDIFSSFFGGGPFGGNTSRQRRQRRG--EDVVHPLKVSLEDVYLGTMKKLSLSRNAL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|NP_189997.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
 sp|Q94AW8.2|DNAJ3_ARATH RecName: Full=Chaperone protein dnaJ 3; Short=AtDjA3; Short=AtJ3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB86892.1| AtJ3 [Arabidopsis thaliana]
 emb|CAB88419.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAK59592.1| putative dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAM44926.1| putative DnaJ-like protein atj3 [Arabidopsis thaliana]
 gb|AAM65624.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 dbj|BAE98606.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AEE77863.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
Length=420

 Score =   130 bits (327),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 78/81 (96%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P KKSDNTK+YEILGVPK+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 65.9 bits (159),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG PFG    +QR + +    DVVHPLKVSLED+Y GT KKLSLSRN L
Sbjct  90   HDPFDIFSSFFGGGPFGGNTSRQRRQRRG--EDVVHPLKVSLEDVYLGTMKKLSLSRNAL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_010535721.1| PREDICTED: chaperone protein dnaJ 3 [Tarenaya hassleriana]
Length=423

 Score =   135 bits (340),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 79/81 (98%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P KKSDNTK+YEILGVPKNASQ+DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKNASQEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 60.8 bits (146),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG    +G    R + +    DVVHPLKVSLEDLY GT+KKLSL+RN L
Sbjct  90   HDPFDIFSSFFGGG--PFGGGSSRGRRQRRGEDVVHPLKVSLEDLYLGTTKKLSLTRNAL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_009760224.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009760225.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=420

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  65   MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  244
            MFGRA KKSDNTKYYEILGVPK AS +DLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRATKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  245  LSDPEKREIYDQYGEDALKE  304
            LSDPEKREIYDQYGEDALKE
Sbjct  61   LSDPEKREIYDQYGEDALKE  80


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  426  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCPKC  521
            DVVHPLKVSL+DLYNGTSKKLSLSRNVLCPKC
Sbjct  123  DVVHPLKVSLDDLYNGTSKKLSLSRNVLCPKC  154



>ref|NP_850653.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
 gb|AEE77864.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
Length=343

 Score =   130 bits (327),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 78/81 (96%), Gaps = 1/81 (1%)
 Frame = +2

Query  65   MFGRAP-KKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  241
            MFGR P KKSDNTK+YEILGVPK+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  242  VLSDPEKREIYDQYGEDALKE  304
            VLSDPEKREIYDQYGEDALKE
Sbjct  61   VLSDPEKREIYDQYGEDALKE  81


 Score = 65.9 bits (159),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  330  HDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGTSKKLSLSRNVL  509
            HDPFDIF SFFGG PFG    +QR + +    DVVHPLKVSLED+Y GT KKLSLSRN L
Sbjct  90   HDPFDIFSSFFGGGPFGGNTSRQRRQRRG--EDVVHPLKVSLEDVYLGTMKKLSLSRNAL  147

Query  510  CPKC  521
            C KC
Sbjct  148  CSKC  151



>ref|XP_002974881.1| hypothetical protein SELMODRAFT_232411 [Selaginella moellendorffii]
 gb|EFJ24401.1| hypothetical protein SELMODRAFT_232411 [Selaginella moellendorffii]
Length=412

 Score =   125 bits (314),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  95   NTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIY  274
            +T+YYEILGV KNAS DDLKKAY++AAI NHPDKGGD EKFKELAQAYEVLSDPEKREIY
Sbjct  6    STRYYEILGVSKNASPDDLKKAYKRAAILNHPDKGGDVEKFKELAQAYEVLSDPEKREIY  65

Query  275  DQYGEDALKEGMGGW  319
            D++GE  LK+GM G 
Sbjct  66   DEHGEGGLKQGMPGC  80


 Score = 70.9 bits (172),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +3

Query  297  LRKEWVGGGGMHDPFDIFQSFFGGNPFGWGWEQQRPKAKNGXXDVVHPLKVSLEDLYNGT  476
            L++   G     +PFDIF+SFF GNPF  G  +   +      DV+HPL+VSLE++Y GT
Sbjct  73   LKQGMPGCSSRSNPFDIFESFFSGNPFVGGSSRG--RRHRRGEDVIHPLQVSLEEVYTGT  130

Query  477  SKKLSLSRNVLCPKC  521
            SKKL L R+V+C  C
Sbjct  131  SKKLILMRSVICSSC  145



>gb|KDO48709.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=381

 Score =   130 bits (326),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +2

Query  128  KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  307
            KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG
Sbjct  8    KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  67

Query  308  MGG  316
            MGG
Sbjct  68   MGG  70


 Score = 65.9 bits (159),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  426  DVVHPLKVSLEDLYNGTSKKLSLSRNVLCPKC  521
            DV+HPLKVSLEDLYNGTSKKLSLSRNV+C KC
Sbjct  84   DVIHPLKVSLEDLYNGTSKKLSLSRNVICTKC  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720