BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002K16

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366869.1|  PREDICTED: serine/threonine protein phosphat...    144   4e-37   Solanum tuberosum [potatoes]
ref|XP_009797723.1|  PREDICTED: serine/threonine protein phosphat...    144   4e-37   Nicotiana sylvestris
ref|XP_004251590.1|  PREDICTED: serine/threonine protein phosphat...    134   2e-33   Solanum lycopersicum
emb|CDP21530.1|  unnamed protein product                                130   6e-32   Coffea canephora [robusta coffee]
ref|XP_009630828.1|  PREDICTED: serine/threonine protein phosphat...    124   8e-30   Nicotiana tomentosiformis
ref|XP_007013280.1|  Serine/threonine protein phosphatase 2A 57 k...    119   7e-28   
ref|XP_007013281.1|  Serine/threonine protein phosphatase 2A 57 k...    115   8e-27   Theobroma cacao [chocolate]
ref|XP_010098941.1|  Serine/threonine protein phosphatase 2A 57 k...    115   5e-26   
gb|KJB54144.1|  hypothetical protein B456_009G022600                    113   6e-26   Gossypium raimondii
ref|XP_002515563.1|  protein phosphatase 2a, regulatory subunit, ...    113   1e-25   
gb|KDP32329.1|  hypothetical protein JCGZ_13254                         112   1e-25   Jatropha curcas
gb|KHG08948.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    110   4e-25   Gossypium arboreum [tree cotton]
gb|KJB64864.1|  hypothetical protein B456_010G068400                    108   2e-24   Gossypium raimondii
ref|XP_010249885.1|  PREDICTED: serine/threonine protein phosphat...    105   6e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010656380.1|  PREDICTED: serine/threonine protein phosphat...    103   2e-22   
gb|KHG22084.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    102   4e-22   Gossypium arboreum [tree cotton]
gb|KEH32096.1|  protein phosphatase 2A regulatory B subunit famil...  99.4    2e-21   Medicago truncatula
ref|XP_010254226.1|  PREDICTED: serine/threonine protein phosphat...    100   4e-21   Nelumbo nucifera [Indian lotus]
ref|XP_004508562.1|  PREDICTED: serine/threonine protein phosphat...    100   4e-21   Cicer arietinum [garbanzo]
ref|XP_003609196.1|  Serine/threonine protein phosphatase 2A 57 k...    100   4e-21   Medicago truncatula
ref|XP_011010867.1|  PREDICTED: serine/threonine protein phosphat...    100   4e-21   Populus euphratica
gb|AFK37737.1|  unknown                                                 100   4e-21   Medicago truncatula
ref|XP_002324961.1|  hypothetical protein POPTR_0018s06320g           98.2    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_007204385.1|  hypothetical protein PRUPE_ppa004572mg           98.2    2e-20   Prunus persica
ref|XP_008242686.1|  PREDICTED: serine/threonine protein phosphat...  98.2    2e-20   Prunus mume [ume]
ref|XP_008337354.1|  PREDICTED: serine/threonine protein phosphat...  97.8    2e-20   
ref|XP_004163599.1|  PREDICTED: serine/threonine protein phosphat...  97.4    4e-20   
ref|XP_008458023.1|  PREDICTED: serine/threonine protein phosphat...  97.1    4e-20   Cucumis melo [Oriental melon]
ref|XP_004139334.1|  PREDICTED: serine/threonine protein phosphat...  97.1    4e-20   Cucumis sativus [cucumbers]
ref|XP_006451050.1|  hypothetical protein CICLE_v10007952mg           97.1    5e-20   Citrus clementina [clementine]
ref|XP_003549794.1|  PREDICTED: serine/threonine protein phosphat...  96.3    8e-20   Glycine max [soybeans]
ref|XP_009374054.1|  PREDICTED: serine/threonine protein phosphat...  95.9    1e-19   Pyrus x bretschneideri [bai li]
gb|KDO80420.1|  hypothetical protein CISIN_1g009349mg                 94.4    2e-19   Citrus sinensis [apfelsine]
gb|KCW82763.1|  hypothetical protein EUGRSUZ_C04140                   94.4    2e-19   Eucalyptus grandis [rose gum]
ref|XP_003524519.1|  PREDICTED: serine/threonine protein phosphat...  95.5    2e-19   Glycine max [soybeans]
ref|XP_006451049.1|  hypothetical protein CICLE_v10007952mg           95.1    2e-19   Citrus clementina [clementine]
gb|KJB83138.1|  hypothetical protein B456_013G231300                  94.7    3e-19   Gossypium raimondii
ref|XP_004287389.1|  PREDICTED: serine/threonine protein phosphat...  94.4    5e-19   Fragaria vesca subsp. vesca
ref|XP_008386225.1|  PREDICTED: serine/threonine protein phosphat...  94.0    6e-19   
ref|XP_010049936.1|  PREDICTED: serine/threonine protein phosphat...  94.0    6e-19   Eucalyptus grandis [rose gum]
ref|XP_009371422.1|  PREDICTED: serine/threonine protein phosphat...  93.6    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_009389489.1|  PREDICTED: serine/threonine protein phosphat...  92.8    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007155131.1|  hypothetical protein PHAVU_003G176100g           90.9    8e-18   Phaseolus vulgaris [French bean]
gb|EAY98962.1|  hypothetical protein OsI_20919                        90.1    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_007138335.1|  hypothetical protein PHAVU_009G200100g           90.1    1e-17   Phaseolus vulgaris [French bean]
emb|CAC85920.1|  protein phosphatase 2A B'kappa subunit               90.1    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533199.1|  PREDICTED: serine/threonine protein phosphat...  89.4    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_009385620.1|  PREDICTED: serine/threonine protein phosphat...  89.0    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654758.1|  PREDICTED: serine/threonine protein phosphat...  87.8    7e-17   Oryza brachyantha
ref|XP_009407446.1|  PREDICTED: serine/threonine protein phosphat...  86.7    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925115.1|  PREDICTED: serine/threonine protein phosphat...  86.7    2e-16   Elaeis guineensis
ref|XP_009415355.1|  PREDICTED: serine/threonine protein phosphat...  86.3    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003567932.1|  PREDICTED: serine/threonine protein phosphat...  85.9    3e-16   Brachypodium distachyon [annual false brome]
ref|XP_008811587.1|  PREDICTED: serine/threonine protein phosphat...  85.1    8e-16   Phoenix dactylifera
ref|XP_002440213.1|  hypothetical protein SORBIDRAFT_09g027870        84.7    1e-15   Sorghum bicolor [broomcorn]
ref|NP_001056272.1|  Os05g0555100                                     83.6    2e-15   
ref|NP_001148974.1|  transposon protein                               83.6    2e-15   
gb|ACN30940.1|  unknown                                               83.6    2e-15   Zea mays [maize]
ref|XP_008647861.1|  PREDICTED: transposon protein isoform X1         83.6    2e-15   
ref|XP_010913433.1|  PREDICTED: serine/threonine protein phosphat...  83.6    2e-15   Elaeis guineensis
ref|XP_002458327.1|  hypothetical protein SORBIDRAFT_03g031350        83.2    4e-15   Sorghum bicolor [broomcorn]
gb|AFW81037.1|  hypothetical protein ZEAMMB73_275381                  81.6    1e-14   
ref|XP_004961286.1|  PREDICTED: serine/threonine protein phosphat...  80.9    2e-14   Setaria italica
ref|XP_004969559.1|  PREDICTED: serine/threonine protein phosphat...  79.3    6e-14   Setaria italica
ref|XP_008785874.1|  PREDICTED: serine/threonine protein phosphat...  78.6    1e-13   Phoenix dactylifera
ref|XP_008809266.1|  PREDICTED: serine/threonine protein phosphat...  76.6    6e-13   Phoenix dactylifera
ref|XP_004138753.1|  PREDICTED: serine/threonine protein phosphat...  76.3    7e-13   Cucumis sativus [cucumbers]
ref|XP_008785883.1|  PREDICTED: serine/threonine protein phosphat...  75.1    2e-12   Phoenix dactylifera
ref|XP_010670759.1|  PREDICTED: serine/threonine protein phosphat...  73.9    4e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008445128.1|  PREDICTED: serine/threonine protein phosphat...  72.4    1e-11   Cucumis melo [Oriental melon]
ref|XP_007013747.1|  Phosphatase 2A regulatory B subunit family p...  72.4    2e-11   
ref|XP_009377509.1|  PREDICTED: serine/threonine protein phosphat...  71.6    3e-11   
gb|KHG19967.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...  71.6    3e-11   Gossypium arboreum [tree cotton]
gb|KJB07811.1|  hypothetical protein B456_001G045700                  70.9    4e-11   Gossypium raimondii
ref|XP_009372941.1|  PREDICTED: serine/threonine protein phosphat...  70.9    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_009377393.1|  PREDICTED: serine/threonine protein phosphat...  70.9    5e-11   Pyrus x bretschneideri [bai li]
ref|XP_008383627.1|  PREDICTED: serine/threonine protein phosphat...  70.9    5e-11   
gb|KJB27047.1|  hypothetical protein B456_004G274600                  70.5    6e-11   Gossypium raimondii
ref|XP_010541630.1|  PREDICTED: serine/threonine protein phosphat...  70.5    7e-11   
ref|XP_010925297.1|  PREDICTED: serine/threonine protein phosphat...  70.1    7e-11   Elaeis guineensis
ref|XP_007223260.1|  hypothetical protein PRUPE_ppa004440mg           70.1    9e-11   Prunus persica
gb|KJB27048.1|  hypothetical protein B456_004G274600                  70.1    9e-11   Gossypium raimondii
ref|XP_009129957.1|  PREDICTED: serine/threonine protein phosphat...  69.7    1e-10   Brassica rapa
emb|CDY05497.1|  BnaA02g31940D                                        69.7    1e-10   
ref|XP_010493808.1|  PREDICTED: serine/threonine protein phosphat...  69.3    1e-10   Camelina sativa [gold-of-pleasure]
emb|CDY54903.1|  BnaC02g48620D                                        69.3    2e-10   Brassica napus [oilseed rape]
ref|XP_011087131.1|  PREDICTED: serine/threonine protein phosphat...  68.9    2e-10   Sesamum indicum [beniseed]
dbj|BAK03510.1|  predicted protein                                    68.9    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006394804.1|  hypothetical protein EUTSA_v10004060mg           68.9    2e-10   Eutrema salsugineum [saltwater cress]
ref|XP_008394018.1|  PREDICTED: serine/threonine protein phosphat...  68.2    4e-10   
gb|KDP32288.1|  hypothetical protein JCGZ_13213                       68.2    4e-10   Jatropha curcas
gb|EYU21914.1|  hypothetical protein MIMGU_mgv1a005231mg              67.8    4e-10   Erythranthe guttata [common monkey flower]
ref|XP_006476190.1|  PREDICTED: serine/threonine protein phosphat...  67.0    9e-10   
ref|XP_006450560.1|  hypothetical protein CICLE_v10008015mg           67.0    9e-10   Citrus clementina [clementine]
ref|XP_006476191.1|  PREDICTED: serine/threonine protein phosphat...  67.0    9e-10   Citrus sinensis [apfelsine]
ref|XP_003544625.1|  PREDICTED: serine/threonine protein phosphat...  67.0    1e-09   Glycine max [soybeans]
emb|CDX88186.1|  BnaA06g27770D                                        66.2    1e-09   
emb|CDX80521.1|  BnaC07g29230D                                        66.2    1e-09   
ref|XP_009151080.1|  PREDICTED: serine/threonine protein phosphat...  66.2    2e-09   Brassica rapa
ref|XP_011081886.1|  PREDICTED: serine/threonine protein phosphat...  65.9    2e-09   Sesamum indicum [beniseed]
ref|XP_006287577.1|  hypothetical protein CARUB_v10000786mg           65.9    2e-09   Capsella rubella
ref|NP_001146050.1|  uncharacterized protein LOC100279581             65.1    3e-09   Zea mays [maize]
gb|KFK27832.1|  hypothetical protein AALP_AA8G435800                  65.1    3e-09   Arabis alpina [alpine rockcress]
ref|XP_010109039.1|  Serine/threonine protein phosphatase 2A 57 k...  65.5    3e-09   
ref|XP_004241801.1|  PREDICTED: serine/threonine protein phosphat...  65.1    4e-09   
ref|XP_002308635.2|  hypothetical protein POPTR_0006s26320g           64.3    5e-09   
ref|XP_002516615.1|  protein phosphatase 2a, regulatory subunit, ...  64.7    6e-09   Ricinus communis
ref|NP_197933.1|  protein phosphatase 2A regulatory B subunit         64.3    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421407.1|  PREDICTED: serine/threonine protein phosphat...  64.3    7e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010456709.1|  PREDICTED: serine/threonine protein phosphat...  64.3    7e-09   Camelina sativa [gold-of-pleasure]
gb|EYU29254.1|  hypothetical protein MIMGU_mgv1a005961mg              63.9    8e-09   Erythranthe guttata [common monkey flower]
ref|XP_011019731.1|  PREDICTED: serine/threonine protein phosphat...  63.9    9e-09   Populus euphratica
ref|XP_011026522.1|  PREDICTED: serine/threonine protein phosphat...  63.5    1e-08   Populus euphratica
ref|XP_004292963.1|  PREDICTED: serine/threonine protein phosphat...  63.2    2e-08   Fragaria vesca subsp. vesca
ref|XP_002874266.1|  hypothetical protein ARALYDRAFT_489409           62.8    2e-08   
ref|XP_007161261.1|  hypothetical protein PHAVU_001G055500g           62.0    4e-08   Phaseolus vulgaris [French bean]
gb|KCW80467.1|  hypothetical protein EUGRSUZ_C018111                  61.6    4e-08   Eucalyptus grandis [rose gum]
ref|XP_010048263.1|  PREDICTED: serine/threonine protein phosphat...  61.6    6e-08   Eucalyptus grandis [rose gum]
ref|XP_003588682.1|  Serine/threonine protein phosphatase 2A 57 k...  60.8    1e-07   Medicago truncatula
ref|XP_006353657.1|  PREDICTED: serine/threonine protein phosphat...  60.5    1e-07   Solanum tuberosum [potatoes]
emb|CDP18419.1|  unnamed protein product                              60.5    1e-07   Coffea canephora [robusta coffee]
ref|XP_004498632.1|  PREDICTED: serine/threonine protein phosphat...  60.1    2e-07   Cicer arietinum [garbanzo]
gb|EPS62004.1|  hypothetical protein M569_12788                       60.1    2e-07   Genlisea aurea
ref|XP_008669249.1|  PREDICTED: serine/threonine protein phosphat...  59.7    2e-07   Zea mays [maize]
ref|XP_009798807.1|  PREDICTED: serine/threonine protein phosphat...  59.3    3e-07   Nicotiana sylvestris
ref|XP_009619322.1|  PREDICTED: serine/threonine protein phosphat...  59.3    3e-07   Nicotiana tomentosiformis
ref|XP_004976008.1|  PREDICTED: serine/threonine protein phosphat...  57.8    9e-07   Setaria italica
ref|XP_002448078.1|  hypothetical protein SORBIDRAFT_06g020625        57.4    1e-06   
gb|EPS71240.1|  hypothetical protein M569_03516                       57.4    1e-06   Genlisea aurea
ref|XP_002284526.1|  PREDICTED: serine/threonine protein phosphat...  56.6    2e-06   Vitis vinifera
ref|XP_008222034.1|  PREDICTED: serine/threonine protein phosphat...  55.8    4e-06   Prunus mume [ume]
ref|XP_007137075.1|  hypothetical protein PHAVU_009G097600g           55.8    5e-06   Phaseolus vulgaris [French bean]
ref|XP_003603467.1|  Serine/threonine protein phosphatase 2A 57 k...  55.5    5e-06   Medicago truncatula
ref|XP_009359296.1|  PREDICTED: serine/threonine protein phosphat...  55.5    6e-06   Pyrus x bretschneideri [bai li]
ref|XP_007222861.1|  hypothetical protein PRUPE_ppa004258mg           54.7    9e-06   Prunus persica
ref|NP_001053130.1|  Os04g0485100                                     54.7    1e-05   
ref|XP_008340161.1|  PREDICTED: serine/threonine protein phosphat...  54.3    1e-05   
ref|XP_006652431.1|  PREDICTED: serine/threonine protein phosphat...  53.9    2e-05   Oryza brachyantha
ref|NP_001183245.1|  hypothetical protein                             53.9    2e-05   Zea mays [maize]
ref|XP_003550157.1|  PREDICTED: serine/threonine protein phosphat...  53.9    2e-05   Glycine max [soybeans]
ref|XP_010089442.1|  Serine/threonine protein phosphatase 2A 59 k...  53.9    2e-05   Morus notabilis
gb|EPS70113.1|  hypothetical protein M569_04647                       53.5    2e-05   Genlisea aurea
emb|CAC09487.2|  H0811E11.3                                           53.5    2e-05   Oryza sativa [red rice]
ref|XP_006417120.1|  hypothetical protein EUTSA_v10007450mg           53.5    3e-05   Eutrema salsugineum [saltwater cress]
ref|XP_002301608.1|  serine/threonine protein phosphatase 2A regu...  52.8    4e-05   
ref|XP_002870241.1|  hypothetical protein ARALYDRAFT_329973           52.0    8e-05   
gb|KHG13833.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  52.0    9e-05   Gossypium arboreum [tree cotton]
gb|KJB40702.1|  hypothetical protein B456_007G074200                  51.6    1e-04   Gossypium raimondii
emb|CDP16651.1|  unnamed protein product                              51.2    1e-04   Coffea canephora [robusta coffee]
ref|XP_002266932.1|  PREDICTED: serine/threonine protein phosphat...  51.2    1e-04   Vitis vinifera
ref|XP_004501280.1|  PREDICTED: serine/threonine protein phosphat...  50.8    2e-04   
ref|NP_172803.1|  protein phosphatase 2A B'theta                      50.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61625.1|  B regulatory subunit of protein phosphatase 2A, p...  50.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008230444.1|  PREDICTED: serine/threonine protein phosphat...  50.1    3e-04   Prunus mume [ume]
ref|XP_007215087.1|  hypothetical protein PRUPE_ppa004318mg           50.1    3e-04   Prunus persica
ref|XP_009148646.1|  PREDICTED: serine/threonine protein phosphat...  50.1    3e-04   Brassica rapa
ref|XP_011029624.1|  PREDICTED: serine/threonine protein phosphat...  50.1    4e-04   Populus euphratica
gb|KJB11609.1|  hypothetical protein B456_001G268200                  50.1    4e-04   Gossypium raimondii
ref|XP_006469972.1|  PREDICTED: serine/threonine protein phosphat...  49.7    5e-04   Citrus sinensis [apfelsine]
ref|XP_006447169.1|  hypothetical protein CICLE_v10014898mg           49.7    5e-04   
gb|KJB11611.1|  hypothetical protein B456_001G268200                  49.3    6e-04   Gossypium raimondii
gb|KDO52091.1|  hypothetical protein CISIN_1g0107851mg                49.3    6e-04   Citrus sinensis [apfelsine]
gb|KDO52090.1|  hypothetical protein CISIN_1g0107851mg                48.9    7e-04   Citrus sinensis [apfelsine]
ref|XP_004138464.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  49.3    7e-04   
gb|KGN45729.1|  hypothetical protein Csa_6G008600                     49.3    7e-04   Cucumis sativus [cucumbers]
ref|XP_004169443.1|  PREDICTED: serine/threonine protein phosphat...  49.3    7e-04   
ref|XP_008441374.1|  PREDICTED: serine/threonine protein phosphat...  49.3    7e-04   Cucumis melo [Oriental melon]
emb|CBI27539.3|  unnamed protein product                              48.9    8e-04   Vitis vinifera
ref|XP_009402720.1|  PREDICTED: serine/threonine protein phosphat...  48.9    8e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006307325.1|  hypothetical protein CARUB_v10008945mg           48.9    8e-04   Capsella rubella
ref|XP_002890006.1|  hypothetical protein ARALYDRAFT_471504           48.9    8e-04   
ref|XP_002314559.1|  serine/threonine protein phosphatase 2A regu...  48.9    9e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011042316.1|  PREDICTED: serine/threonine protein phosphat...  48.9    9e-04   Populus euphratica
ref|XP_011021363.1|  PREDICTED: serine/threonine protein phosphat...  48.9    9e-04   Populus euphratica
ref|XP_004981072.1|  PREDICTED: serine/threonine protein phosphat...  48.9    9e-04   Setaria italica
gb|KHG26982.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  48.9    0.001   Gossypium arboreum [tree cotton]
ref|XP_002311732.2|  hypothetical protein POPTR_0008s18020g           48.5    0.001   



>ref|XP_006366869.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum tuberosum]
Length=506

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQILAK+PRKS K D  DSS SNS NN +N GNG+QFTNSC VIANRLNVVKRMS+AI
Sbjct  1    MLKQILAKLPRKSSKCDTFDSSGSNSCNNTSNLGNGIQFTNSCTVIANRLNVVKRMSTAI  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+IV+ GGES+APH+ FKDVSN EKQ LF+SKLNLCC++YDF+D
Sbjct  61   FPASIVS-GGESVAPHVPFKDVSNAEKQSLFVSKLNLCCTIYDFND  105



>ref|XP_009797723.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana sylvestris]
Length=507

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQILAK+PRKS K D  D+S SNS NN TNSGNG+ FTNSC VIA RLNVVKRMS+AI
Sbjct  1    MLKQILAKLPRKSSKCDSFDTSGSNSCNNTTNSGNGIPFTNSCTVIATRLNVVKRMSTAI  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP +IVAG  ES+APH+ FKDVSNGEKQ LF+SKLNLCCS+YDF+D
Sbjct  61   FPTSIVAGN-ESVAPHVPFKDVSNGEKQSLFISKLNLCCSIYDFND  105



>ref|XP_004251590.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313712.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313713.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313714.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313715.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
Length=506

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQILAK+PRKS K D  DSS SNS NN +N GNG+QFTNSC VIANRLNVVKRMS+AI
Sbjct  1    MLKQILAKLPRKSSKCDTFDSSGSNSSNNTSNLGNGIQFTNSCTVIANRLNVVKRMSTAI  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+IVA GGES+APH+ FKDVSN EKQ LF+SKLNLCC++YDF+D
Sbjct  61   FPASIVA-GGESVAPHVPFKDVSNAEKQSLFVSKLNLCCTIYDFND  105



>emb|CDP21530.1| unnamed protein product [Coffea canephora]
Length=519

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  236  ATMLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSS  415
            ATMLKQILAK+PRK LKSD   S  S+S N   NS NG+QFTN+C+VI++RLNVVKR S 
Sbjct  12   ATMLKQILAKLPRKPLKSDSLTSVGSDSCNTSPNSDNGIQFTNTCSVISSRLNVVKRKSW  71

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            AIFPA+I+A GG+ + PH+ FKDV N +KQ LF+SKLNLCC VYDFSD
Sbjct  72   AIFPASIIA-GGDLVEPHVPFKDVPNADKQSLFVSKLNLCCLVYDFSD  118



>ref|XP_009630828.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana tomentosiformis]
 ref|XP_009630829.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana tomentosiformis]
Length=507

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQILAK+PRKS K D  D+S SNS NN TNSGNG+ F NSC VIA RLNVVKRMS+AI
Sbjct  1    MLKQILAKLPRKSSKCDSFDTSGSNSCNNNTNSGNGIPFANSCTVIATRLNVVKRMSTAI  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP +IVAGG ES+APH+ FKDVSN EKQ LF+SKLNLCCS+YDF+D
Sbjct  61   FPTSIVAGG-ESVAPHIPFKDVSNAEKQSLFVSKLNLCCSIYDFND  105



>ref|XP_007013280.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 1 [Theobroma cacao]
 gb|EOY30899.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 1 [Theobroma cacao]
Length=545

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 91/115 (79%), Gaps = 1/115 (1%)
 Frame = +2

Query  215  LAATSSVATMLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLN  394
            LA +  V+ MLKQIL+K+PRKS KSD  DS+  +S N  +NSGNGVQ TN  N I++RL+
Sbjct  31   LAGSCFVSIMLKQILSKLPRKSQKSDSLDSAGIDSGNQTSNSGNGVQCTNIGNSISSRLS  90

Query  395  VVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            VVKR+SSA+FPA+I+AG  E++ P+L FKDVSN +KQ LF+SKLNLCC V DFSD
Sbjct  91   VVKRVSSAVFPASIMAGV-EAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSD  144



>ref|XP_007013281.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 2 [Theobroma cacao]
 gb|EOY30900.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 2 [Theobroma cacao]
Length=506

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+PRKS KSD  DS+  +S N  +NSGNGVQ TN  N I++RL+VVKR+SSA+
Sbjct  1    MLKQILSKLPRKSQKSDSLDSAGIDSGNQTSNSGNGVQCTNIGNSISSRLSVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I+AG  E++ P+L FKDVSN +KQ LF+SKLNLCC V DFSD
Sbjct  61   FPASIMAGV-EAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSD  105



>ref|XP_010098941.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
 gb|EXB76243.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
Length=736

 Score =   115 bits (287),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +2

Query  227  SSVATMLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKR  406
            SS+ATMLKQIL+K+PRKS KSD  D + S+S +N +  GNG Q T   + ++++LNVVKR
Sbjct  219  SSIATMLKQILSKLPRKSPKSDLLDGAGSDSGSNSSKLGNGFQCTIGGSSLSSKLNVVKR  278

Query  407  MSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +SSA+FPA+I AG  E + PHL FKDVSN +KQ LF+SKLNLCC V D++D
Sbjct  279  VSSAVFPASITAGA-EVVEPHLSFKDVSNPQKQNLFISKLNLCCEVVDYND  328



>gb|KJB54144.1| hypothetical protein B456_009G022600 [Gossypium raimondii]
 gb|KJB54145.1| hypothetical protein B456_009G022600 [Gossypium raimondii]
Length=507

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+PRKS KSD  DS+  +S N+ +NS NGVQ TN  N I +RL+VVKR+SSA+
Sbjct  1    MLKQILSKLPRKSQKSDSLDSAGLDSGNHTSNSSNGVQCTNIGNSITSRLSVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I+AG  E++ P+L FKDVSN +KQ LF+SKLNLCC V DFSD
Sbjct  61   FPASIMAGV-EAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSD  105



>ref|XP_002515563.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF47012.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=543

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +2

Query  233  VATMLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMS  412
            + TMLKQIL+KIPRKS KS+  DS+   S NN +N GNGV  TN  N  ++RLNVVKR+S
Sbjct  38   IGTMLKQILSKIPRKSSKSESFDSAGIESGNNSSNWGNGVPCTNGGNSFSSRLNVVKRVS  97

Query  413  SAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SA+FPA+I+A G E++ PHL FKDVSN +KQ LF+SKLN CC   DFSD
Sbjct  98   SAVFPASIMA-GVEAVEPHLSFKDVSNVQKQSLFISKLNFCCE-SDFSD  144



>gb|KDP32329.1| hypothetical protein JCGZ_13254 [Jatropha curcas]
Length=503

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 82/106 (77%), Gaps = 4/106 (4%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+KIPRKS KSDP DS      N+ TN GNG+  TNS N  ++RLNVVKR+SSA+
Sbjct  1    MLKQILSKIPRKSSKSDPLDSDSG---NSSTNWGNGIPCTNSGNSFSSRLNVVKRVSSAV  57

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I++G  E++ PHL FKDVSN +KQ LF+SKLN CC V DFSD
Sbjct  58   FPASIMSGA-EAVEPHLSFKDVSNMQKQNLFVSKLNFCCEVCDFSD  102



>gb|KHG08948.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=507

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+PRKS KSD  DS+  +S N+ +N  NGVQ TN  N I +RL+VVKR+SSA+
Sbjct  1    MLKQILSKLPRKSQKSDSLDSAGLDSGNHTSNLSNGVQCTNIGNSITSRLSVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I+AG  E++ P+L FKDVSN +KQ LF+SKLNLCC V DFSD
Sbjct  61   FPASIMAGV-EAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSD  105



>gb|KJB64864.1| hypothetical protein B456_010G068400 [Gossypium raimondii]
Length=496

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL K+PRK  KSD  DSS S+S N+ +NSGNGVQ TN  N I++RL+VVKR+SSA+
Sbjct  1    MLKQILIKLPRKLQKSDLLDSSGSDSGNHTSNSGNGVQCTNIGNSISSRLSVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I+  G E++ P+L F DVS  +KQ LF+SKLNLCC V DFSD
Sbjct  61   FPASIMV-GVEAVEPYLSFTDVSILQKQSLFISKLNLCCEVSDFSD  105



>ref|XP_010249885.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
Length=503

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 4/106 (4%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQ L+++PRKS KSD  D++ SNS NN   +GNG+Q TNS N  + R + VK+MSSA+
Sbjct  1    MLKQFLSRLPRKSAKSDAADTAGSNSVNNAATTGNGIQRTNSGNASSGRSSAVKKMSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+++AG    I P L FKDV N EKQ LF+SKLNLCC V+DF+D
Sbjct  61   FPASVIAG----IEPLLSFKDVPNPEKQNLFISKLNLCCVVFDFND  102



>ref|XP_010656380.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 ref|XP_010656381.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 emb|CBI28127.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 81/109 (74%), Gaps = 9/109 (8%)
 Frame = +2

Query  233  VATMLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMS  412
            +ATM+KQIL+K+PRKS KSD   S+ S+S NN TN G+ +Q +N        LNVV+RMS
Sbjct  33   IATMIKQILSKLPRKSSKSDTLASAGSDS-NNNTNLGSSIQCSNG-------LNVVRRMS  84

Query  413  SAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SA+FP+ +VA G E++ PHL FKDV N EKQ LF+SKLNLCC VY F+D
Sbjct  85   SAVFPS-MVAAGAEAVEPHLSFKDVPNTEKQKLFVSKLNLCCVVYHFND  132



>gb|KHG22084.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=496

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL K+PRK  KSD  DSS S+S N+ +N GNGV+ TN  N +++RL+VVKR+SSA+
Sbjct  1    MLKQILIKLPRKLQKSDLLDSSGSDSGNHTSNLGNGVECTNIGNSMSSRLSVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I+ G  E++ P+L F DVS  +KQ LF+SKLNLCC V DFSD
Sbjct  61   FPASIMVGV-EAVEPNLSFTDVSILQKQSLFISKLNLCCEVSDFSD  105



>gb|KEH32096.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=391

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL+K+P+K  KSD  DS+ S+S N+ T+ GN  Q TN  + I+++LNVVKR+SS +
Sbjct  1    MIKQILSKLPKKLPKSDSSDSAKSDSGNSTTSFGNVFQCTNVGSTISSKLNVVKRVSSVV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++ AG  E++ P L FKDVSN +KQ LF+SKLNLCC VYD SD
Sbjct  61   FPASMNAGV-EAVDPSLSFKDVSNTQKQSLFISKLNLCCKVYDMSD  105



>ref|XP_010254226.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
 ref|XP_010254227.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
Length=507

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 79/110 (72%), Gaps = 8/110 (7%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNG----VQFTNSCNVIANRLNVVKRM  409
            MLKQ L+++PRKS KSD  D++ SNS NN   +GNG    +Q TNS N  + R N VK+M
Sbjct  1    MLKQFLSRLPRKSFKSDAADTAGSNSGNNTAAAGNGASNGIQRTNSGNAASGRSNAVKKM  60

Query  410  SSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SSA+FPA++VAG    I P L FKDV N EKQ LF+SKLNLCC V+DF+D
Sbjct  61   SSAVFPASVVAG----IEPLLSFKDVPNQEKQNLFISKLNLCCVVFDFND  106



>ref|XP_004508562.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cicer arietinum]
Length=511

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL+K+P+K  KSD  DS+ S+S N+ T  GN  Q TN  + I+++LNVVKR+SS +
Sbjct  1    MIKQILSKLPKKLPKSDSSDSARSDSGNSTTTFGNVFQCTNVGSTISSKLNVVKRVSSVV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++ + G E++ P L FKDVSN +KQ LF+SKLNLCC VYD SD
Sbjct  61   FPASM-SAGVEAVDPSLSFKDVSNTQKQNLFISKLNLCCKVYDMSD  105



>ref|XP_003609196.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES91393.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=510

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL+K+P+K  KSD  DS+ S+S N+ T+ GN  Q TN  + I+++LNVVKR+SS +
Sbjct  1    MIKQILSKLPKKLPKSDSSDSAKSDSGNSTTSFGNVFQCTNVGSTISSKLNVVKRVSSVV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++ AG  E++ P L FKDVSN +KQ LF+SKLNLCC VYD SD
Sbjct  61   FPASMNAGV-EAVDPSLSFKDVSNTQKQSLFISKLNLCCKVYDMSD  105



>ref|XP_011010867.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like, partial [Populus euphratica]
Length=557

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = +2

Query  218  AATSSVATMLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNV  397
            A    +  MLKQIL+KIPRK  KSDP DS+  +  N+ T SG     TN  N  ++RLNV
Sbjct  53   AENCCITAMLKQILSKIPRKFPKSDPLDSTGIDCGNDSTCSGPS---TNGGNSFSSRLNV  109

Query  398  VKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            VKR+SSA+FPA+I+AG  E++ PHL FKDVSN +KQ LF+SKLNLCC V D SD
Sbjct  110  VKRVSSAVFPASIMAGM-EAVDPHLSFKDVSNLQKQNLFVSKLNLCCEVSDCSD  162



>gb|AFK37737.1| unknown [Medicago truncatula]
Length=510

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL+K+P+K  KSD  DS+ S+S N+ T+ GN  Q TN  + I+++LNVVKR+SS +
Sbjct  1    MIKQILSKLPKKLPKSDSSDSAKSDSGNSTTSFGNVFQCTNVGSTISSKLNVVKRVSSVV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++ AG  E++ P L FKDVSN +KQ LF+SKLNLCC VYD SD
Sbjct  61   FPASMNAGV-EAVDPSLSFKDVSNTQKQSLFISKLNLCCKVYDMSD  105



>ref|XP_002324961.1| hypothetical protein POPTR_0018s06320g [Populus trichocarpa]
 gb|EEF03526.1| hypothetical protein POPTR_0018s06320g [Populus trichocarpa]
Length=497

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 79/106 (75%), Gaps = 4/106 (4%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+KIPRK  KSDP DS+  +  N+ T SG     TN  N  ++RLNVVKR+SSA+
Sbjct  1    MLKQILSKIPRKFPKSDPLDSTGIDCGNDSTCSGPP---TNGGNSFSSRLNVVKRVSSAV  57

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I+AG  E++ PHL FKDVSN +KQ LF+SKLNLCC V D SD
Sbjct  58   FPASIMAGM-EAVDPHLSFKDVSNLQKQNLFVSKLNLCCEVSDCSD  102



>ref|XP_007204385.1| hypothetical protein PRUPE_ppa004572mg [Prunus persica]
 gb|EMJ05584.1| hypothetical protein PRUPE_ppa004572mg [Prunus persica]
Length=502

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+PRKS KSD  DS+ S+S +N  N GNG Q T   + + ++LNVVKR+SSA+
Sbjct  1    MLKQILSKLPRKSPKSDSLDSAGSDSGSNTPNLGNGFQCTIGGSSLTSKLNVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP++I A G E++ PHL FK+VSN +K  LF+SKLNLCC   D SD
Sbjct  61   FPSSI-AAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFIDSSD  105



>ref|XP_008242686.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
 ref|XP_008242687.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
 ref|XP_008242688.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
Length=502

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+PRKS KSD  DS+ S+S +N  N GNG Q T   + + ++LNVVKR+SSA+
Sbjct  1    MLKQILSKLPRKSPKSDSLDSAGSDSGSNTPNLGNGFQCTIGGSSLTSKLNVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP++I A G E++ PHL FK+VSN +K  LF+SKLNLCC   D SD
Sbjct  61   FPSSI-AAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFIDSSD  105



>ref|XP_008337354.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=502

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+PRKS KSD  DS+ S+S NN  N G+G Q T   + + ++LNVVKR+SSA+
Sbjct  1    MLKQILSKLPRKSSKSDSLDSAGSDSGNNTPNLGSGFQCTIGGSSLTSKLNVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP++I A G E++ PHL FK+VSN +K  LF+SKLNLCC   D SD
Sbjct  61   FPSSI-AAGAEAVEPHLSFKEVSNPQKHSLFISKLNLCCEFVDSSD  105



>ref|XP_004163599.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
Length=500

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+P+K  KS+  DS+ + S NN +  G+  Q TN  +  +++LNVVKR+SSA+
Sbjct  1    MLKQILSKLPKKLQKSETVDSATNESGNNTSRLGHVFQCTNVGSAFSSKLNVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I A   E++ PHL FKDV N +KQ LF+SKLN CC V+D +D
Sbjct  61   FPASIAA---EAVDPHLSFKDVPNPQKQNLFVSKLNYCCEVFDLND  103



>ref|XP_008458023.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis melo]
 ref|XP_008458029.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis melo]
Length=500

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+P+K  KS+  DS+ + S NN +  G+  Q TN  +  +++LNVVKR+SSA+
Sbjct  1    MLKQILSKLPKKLQKSETVDSATNESGNNTSRLGHVFQCTNVGSAFSSKLNVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I A   E++ PHL FKDV N +KQ LF+SKLN CC V+D +D
Sbjct  61   FPASIAA---EAVDPHLSFKDVPNPQKQNLFVSKLNYCCEVFDLND  103



>ref|XP_004139334.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 gb|KGN60641.1| hypothetical protein Csa_2G005870 [Cucumis sativus]
Length=500

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+P+K  KSD  DS+ + S NN +  G+  Q TN  +  +++LNVVKR+SSA+
Sbjct  1    MLKQILSKLPKKLQKSDTVDSATNESGNNTSRLGHVFQCTNVGSAFSSKLNVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I A   E++ PHL FKDV N +KQ LF+SKLN CC V+D +D
Sbjct  61   FPASIAA---EAVDPHLSFKDVPNPQKQNLFVSKLNYCCEVFDLND  103



>ref|XP_006451050.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 ref|XP_006475756.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Citrus sinensis]
 gb|ESR64290.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 gb|KDO80417.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
Length=537

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = +2

Query  227  SSVATMLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKR  406
            S   TMLKQIL+K+PRKS KSD  D   S   +N +N  NG Q TN  N +++RL+VVKR
Sbjct  29   SQFPTMLKQILSKLPRKSPKSDQLDEINSG--SNNSNFSNGSQCTNGGNGLSSRLSVVKR  86

Query  407  MSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +SSA+FP++I+AG  E++ PHL FKDVSN +KQ LF+SKLNLCC V DFSD
Sbjct  87   VSSAVFPSSIMAGV-EAVEPHLSFKDVSNTQKQNLFVSKLNLCCEVSDFSD  136



>ref|XP_003549794.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoformX1 [Glycine max]
 ref|XP_006600772.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Glycine max]
 ref|XP_006600773.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X3 [Glycine max]
Length=514

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL+K+P+K  KSD  DS+ S+S N  T  GN  Q TN  + I+++LNVVKR+SS +
Sbjct  1    MIKQILSKLPKKVPKSDSSDSARSDSSNT-TTFGNVFQCTNVGSTISSKLNVVKRVSSVV  59

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++ + G E++ P L FKDVSN +KQ LF+SKLNLCC VYD SD
Sbjct  60   FPASM-SAGVEAVDPCLSFKDVSNTQKQSLFISKLNLCCKVYDMSD  104



>ref|XP_009374054.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=502

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+PRKS KSD  DS+ S S +N  N G+G Q T   + + ++LNVVKR+SSA+
Sbjct  1    MLKQILSKLPRKSSKSDSLDSAGSESGSNTPNLGSGFQCTIGGSSLTSKLNVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP++I A G E++ PHL FK+VSN +K  LF+SKLNLCC   D SD
Sbjct  61   FPSSI-AAGAEAVEPHLSFKEVSNPQKHSLFISKLNLCCEFVDSSD  105



>gb|KDO80420.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
Length=402

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+PRKS KSD  D   S   +N +N  NG Q TN  N +++RL+VVKR+SSA+
Sbjct  1    MLKQILSKLPRKSPKSDQLDEINSG--SNNSNFSNGSQCTNGGNGLSSRLSVVKRVSSAV  58

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP++I+AG  E++ PHL FKDVSN +KQ LF+SKLNLCC V DFSD
Sbjct  59   FPSSIMAGV-EAVEPHLSFKDVSNTQKQNLFVSKLNLCCEVSDFSD  103



>gb|KCW82763.1| hypothetical protein EUGRSUZ_C04140 [Eucalyptus grandis]
Length=405

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 75/106 (71%), Gaps = 5/106 (5%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL KIPRKS K D +D++     N+P ++ NG Q        ++R NVVKR+SSA+
Sbjct  1    MLKQILNKIPRKSPKGDSQDTAG----NDPGDNSNGFQCMIGGGTFSSRFNVVKRVSSAV  56

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+++ G  +++ P + FKDVSN +KQ LF+SKLN CC VYDF+D
Sbjct  57   FPASMMTGL-DAVEPFMSFKDVSNSQKQNLFVSKLNFCCKVYDFND  101



>ref|XP_003524519.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Glycine max]
 ref|XP_006579740.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Glycine max]
 gb|KHN15139.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Glycine soja]
Length=515

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL+K+P+K  KSD  DS+ S+S N  T  GN  Q TN  + I+++LNVVKR+SS +
Sbjct  1    MIKQILSKLPKKVPKSDSSDSARSDSSNT-TTFGNVFQCTNVGSTISSKLNVVKRVSSVV  59

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++ + G E++ P L FKDVSN +KQ LF+SKLNLCC +YD SD
Sbjct  60   FPASM-SAGVEAVDPGLSFKDVSNTQKQSLFISKLNLCCKLYDMSD  104



>ref|XP_006451049.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 ref|XP_006475757.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Citrus sinensis]
 gb|ESR64289.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 gb|KDO80418.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
 gb|KDO80419.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
Length=504

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+PRKS KSD  D   S   +N +N  NG Q TN  N +++RL+VVKR+SSA+
Sbjct  1    MLKQILSKLPRKSPKSDQLDEINSG--SNNSNFSNGSQCTNGGNGLSSRLSVVKRVSSAV  58

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP++I+AG  E++ PHL FKDVSN +KQ LF+SKLNLCC V DFSD
Sbjct  59   FPSSIMAGV-EAVEPHLSFKDVSNTQKQNLFVSKLNLCCEVSDFSD  103



>gb|KJB83138.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83139.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83140.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83141.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
Length=506

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL K+PRKS KSD  DS+ ++S N+ +NS +GVQ TN  N I++RL VVKR+SSA+
Sbjct  1    MIKQILRKLPRKSQKSDSLDSAGNDSDNHASNSDDGVQCTNFGNKISSRLRVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I+A G E++ P+L F +VSN +K  LF+SKLNLCC   + SD
Sbjct  61   FPASIMA-GVEAVEPNLSFNNVSNPQKPNLFISKLNLCCEACNSSD  105



>ref|XP_004287389.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Fragaria vesca subsp. 
vesca]
Length=502

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 71/106 (67%), Gaps = 2/106 (2%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K PRK        +   +  N+P   G+G Q T   + + ++LNVVKR+SSA+
Sbjct  1    MLKQILSKFPRKPKSESLDSAGSDSGNNSPI-LGSGFQCTIGGSSLTSKLNVVKRVSSAV  59

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+I A G E + PHL FK+VSN +KQ LF+SKLN+CC + D SD
Sbjct  60   FPASI-AAGAEVVEPHLSFKEVSNPQKQNLFISKLNVCCEIIDSSD  104



>ref|XP_008386225.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
 ref|XP_008343968.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
 ref|XP_008362926.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=502

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+PRKS K D  DS  S+S +N +N G+G   T   + + ++LNVVKR+SSA+
Sbjct  1    MLKQILSKLPRKSSKCDSLDSIGSDSGSNTSNLGSGFPCTIGGSSLTSKLNVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP++I A G E++ PHL FK+VSN +K  LF+SKLNLCC   D SD
Sbjct  61   FPSSI-AAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFVDSSD  105



>ref|XP_010049936.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Eucalyptus grandis]
 gb|KCW82762.1| hypothetical protein EUGRSUZ_C04140 [Eucalyptus grandis]
Length=505

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 75/106 (71%), Gaps = 5/106 (5%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL KIPRKS K D +D++     N+P ++ NG Q        ++R NVVKR+SSA+
Sbjct  1    MLKQILNKIPRKSPKGDSQDTAG----NDPGDNSNGFQCMIGGGTFSSRFNVVKRVSSAV  56

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+++ G  +++ P + FKDVSN +KQ LF+SKLN CC VYDF+D
Sbjct  57   FPASMMTGL-DAVEPFMSFKDVSNSQKQNLFVSKLNFCCKVYDFND  101



>ref|XP_009371422.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=502

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+PRKS KSD  DS  S+S +N +N G+G   T   + + ++LNVVKR+SSA+
Sbjct  1    MLKQILSKLPRKSSKSDSLDSIGSDSGSNTSNLGSGFPCTIGGSSLTSKLNVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP++I A G E++ PHL FK+VSN +K  LF+SKLNLCC   D SD
Sbjct  61   FPSSI-AAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFVDSSD  105



>ref|XP_009389489.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkd-sslsnsFNNPTNSGNG--VQFTNSCNVIANRLNVVKRMS  412
            M KQ L+K+PRKS KSD    ++ S+  NN T S NG  +Q T+S NV+ +R   VKR +
Sbjct  1    MWKQFLSKLPRKSSKSDASSGTTRSHPINNGTTSMNGNPIQRTSSGNVVPSRSTAVKRTA  60

Query  413  SAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SAIFP+++V     SI P L FKDV N EKQ LF+SKLNLCC V+DFSD
Sbjct  61   SAIFPSSVVT----SIEPLLLFKDVPNTEKQNLFISKLNLCCVVFDFSD  105



>ref|XP_007155131.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 ref|XP_007155132.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 gb|ESW27125.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 gb|ESW27126.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
Length=509

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 81/106 (76%), Gaps = 2/106 (2%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL+K+P+K  KSD  DSS S+S +N T+ GN  Q TN  + I+++LNVVKR+SS +
Sbjct  1    MIKQILSKLPKKVPKSDSSDSSRSDS-SNSTSFGNVFQCTNVGSTISSKLNVVKRVSSVV  59

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++ + G E++ P L FKDVSN +KQ LF+SKLNLCC +YD SD
Sbjct  60   FPASM-SAGVEAVDPCLSFKDVSNTQKQSLFISKLNLCCKIYDMSD  104



>gb|EAY98962.1| hypothetical protein OsI_20919 [Oryza sativa Indica Group]
Length=510

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 6/108 (6%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVI--ANRLNVVKRMSS  415
            M K  L+K+PRK+  S       S   +N   +GN +Q T+SC  I      + +KRMSS
Sbjct  1    MWKGFLSKLPRKTSASGRGADLDSGQCSNGAGNGNPIQRTSSCGSIPSGRSTSTIKRMSS  60

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            AIFP+++VAG    I P + FKDV N EKQ LF+SKLNLCC+V+DFSD
Sbjct  61   AIFPSSVVAG----IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSD  104



>ref|XP_007138335.1| hypothetical protein PHAVU_009G200100g [Phaseolus vulgaris]
 gb|ESW10329.1| hypothetical protein PHAVU_009G200100g [Phaseolus vulgaris]
Length=506

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (74%), Gaps = 2/103 (2%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+K+P+K  KSD  DS+ S+S  + T   N  Q TN    I+N+LN VKR+SSA+
Sbjct  1    MLKQILSKLPKKVPKSDTSDSAQSDS-GSATTFANVFQCTNVGVAISNKLNAVKRVSSAV  59

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYD  550
            FPA++ + G E++ PH+ FKDVSN +K  LF+SKLNLCCSVY+
Sbjct  60   FPASL-SAGVEAVDPHVSFKDVSNIQKHNLFISKLNLCCSVYN  101



>emb|CAC85920.1| protein phosphatase 2A B'kappa subunit [Oryza sativa Japonica 
Group]
 gb|AAT58738.1| protein phosphatase 2A B'kappa subunit [Oryza sativa Japonica 
Group]
Length=510

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 6/108 (6%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVI--ANRLNVVKRMSS  415
            M K  L+K+PRK+  S       S   +N   +GN +Q T+SC  I      + +KRMSS
Sbjct  1    MWKGFLSKLPRKTSASGRGADLDSGQCSNGAGNGNPIQRTSSCGSIPSGRSTSTIKRMSS  60

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            AIFP+++VAG    I P + FKDV N EKQ LF+SKLNLCC+V+DFSD
Sbjct  61   AIFPSSVVAG----IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSD  104



>ref|XP_010533199.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Tarenaya hassleriana]
Length=500

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQ L+K+P+KS + D   +S  +S N  ++ G   Q TN  NV+ +RL+VVKR+SSA+
Sbjct  1    MLKQFLSKLPKKSTRIDQFHTSGIDSNNQSSSHGIATQCTNVGNVLTSRLSVVKRVSSAV  60

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYD  550
            FPA+I+ GG +S+ P L FKD+S+ ++Q LF+SKLN CC   D
Sbjct  61   FPASIM-GGSDSVDPSLSFKDISSPQRQNLFISKLNFCCQDVD  102



>ref|XP_009385620.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009385621.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=509

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 74/108 (69%), Gaps = 6/108 (6%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTN--SGNGVQFTNSCNVIANRLNVVKRMSS  415
            M KQ L+K+PRKS KSD    S S+  N+ T   +GN +Q T+S NV+ +R   VKR +S
Sbjct  1    MWKQFLSKLPRKSSKSDASSGSDSHPSNDCTGPLNGNPIQRTSSGNVVPSRSTTVKRTAS  60

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            AIFP+++V     SI P L FKDV N +KQ LF+SKLNLCC V+DFSD
Sbjct  61   AIFPSSVVT----SIEPLLLFKDVPNSQKQNLFISKLNLCCVVFDFSD  104



>ref|XP_006654758.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Oryza brachyantha]
Length=508

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 71/108 (66%), Gaps = 7/108 (6%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVI--ANRLNVVKRMSS  415
            M K  L+K+PRK+  S   D       +N T +GN +Q T+SC  I  A   + +KRMSS
Sbjct  1    MWKGFLSKLPRKNSSSGRGDLDSGQC-SNGTANGNPIQRTSSCVSIPSARSTSTIKRMSS  59

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            AIFP+++VAG    I P + FKDV N EKQ LF+SKLNLCC+V+DFSD
Sbjct  60   AIFPSSVVAG----IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSD  103



>ref|XP_009407446.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009407448.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 72/109 (66%), Gaps = 7/109 (6%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNN---PTNSGNGVQFTNSCNVIANRLNVVKRMS  412
            M KQ L+K+PRKS KSD    S  +  +N    + +GN +Q T+S NV+++R   VKR +
Sbjct  1    MWKQFLSKLPRKSSKSDASSGSAHSHLSNNGMASANGNPIQRTSSGNVVSSRSATVKRTA  60

Query  413  SAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SAIFP+++V     SI P L FKDV N EK  LF+SK+ LCC V+DFSD
Sbjct  61   SAIFPSSVVT----SIEPLLLFKDVPNSEKHNLFISKMKLCCVVFDFSD  105



>ref|XP_010925115.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010925116.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=509

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 73/107 (68%), Gaps = 5/107 (5%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpk-dsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSA  418
            M KQ L+K+PR+S KSD   DS+ ++  +N + SGN +Q  +S N    R   VKRMSSA
Sbjct  1    MWKQFLSKLPRRSSKSDSACDSAHNHPGSNASPSGNSIQRASSGNAGPGRSTTVKRMSSA  60

Query  419  IFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +FP+++VAG    I P L FKDV N EKQ L +SKLNLC +V+DFSD
Sbjct  61   VFPSSVVAG----IEPLLSFKDVPNAEKQNLVISKLNLCSAVFDFSD  103



>ref|XP_009415355.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 66/109 (61%), Gaps = 7/109 (6%)
 Frame = +2

Query  242  MLKQILAKIP-RkslksdpkdsslsnsFNNPTNS--GNGVQFTNSCNVIANRLNVVKRMS  412
            M KQ L+K+P +        D +     NN T S  GN +  TNS NV+++R   +KR +
Sbjct  1    MWKQFLSKLPHKSFQSDASLDLTHLPPGNNGTGSVNGNSIHRTNSDNVVSSRSTTMKRTA  60

Query  413  SAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SAIFP+N+V     S  P L FKDV N EKQ LF+SKLN CC V+DFSD
Sbjct  61   SAIFPSNVVT----SAEPLLLFKDVPNAEKQNLFISKLNFCCLVFDFSD  105



>ref|XP_003567932.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Brachypodium distachyon]
Length=506

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 71/108 (66%), Gaps = 9/108 (8%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVI-ANR-LNVVKRMSS  415
            M KQ L+K+PRKS  S   D       N    +G+ +Q T+SC  I A R  + +KRMSS
Sbjct  1    MWKQFLSKLPRKSSGSGRDDFDSGQCSNG---NGSSIQRTSSCGSIPAGRSTSTIKRMSS  57

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            A+FP+++VAG    I P + FKDV N EKQ LF+SKLNLCC+V+DFSD
Sbjct  58   AVFPSSVVAG----IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSD  101



>ref|XP_008811587.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Phoenix dactylifera]
Length=509

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 71/110 (65%), Gaps = 11/110 (10%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNG----VQFTNSCNVIANRLNVVKRM  409
            M KQ L+K+PRKS KSD    S     N+P ++ +     +Q TNS N    R   VKRM
Sbjct  1    MWKQFLSKLPRKSSKSDCASDSAH---NHPGSNASSSGNSIQRTNSGNAGPGRSTSVKRM  57

Query  410  SSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SSA+FP+++VAG    I P L FKDVSN EKQ LF+SKLNLC  V+DFSD
Sbjct  58   SSAVFPSSVVAG----IEPLLSFKDVSNTEKQNLFISKLNLCSVVFDFSD  103



>ref|XP_002440213.1| hypothetical protein SORBIDRAFT_09g027870 [Sorghum bicolor]
 gb|EES18643.1| hypothetical protein SORBIDRAFT_09g027870 [Sorghum bicolor]
Length=501

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 69/108 (64%), Gaps = 15/108 (14%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVI--ANRLNVVKRMSS  415
            M KQ L+K+PRKS  S           +   ++G G+Q T+SC+ I      + ++RMSS
Sbjct  1    MWKQFLSKLPRKSSASGD---------SGQCSNGTGIQRTSSCSSIPSGRPASAIRRMSS  51

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            A+FP+++VAG    I P + FKDV N EKQ LF+SKL+LCC V+DFSD
Sbjct  52   AVFPSSVVAG----IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSD  95



>ref|NP_001056272.1| Os05g0555100 [Oryza sativa Japonica Group]
 dbj|BAF18186.1| Os05g0555100, partial [Oryza sativa Japonica Group]
Length=449

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 6/81 (7%)
 Frame = +2

Query  323  NNPTNSGNGVQFTNSCNVI--ANRLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNG  496
            +N   +GN +Q T+SC  I      + +KRMSSAIFP+++VAG    I P + FKDV N 
Sbjct  60   SNGAGNGNPIQRTSSCGSIPSGRSTSTIKRMSSAIFPSSVVAG----IEPLVSFKDVPNS  115

Query  497  EKQGLFLSKLNLCCSVYDFSD  559
            EKQ LF+SKLNLCC+V+DFSD
Sbjct  116  EKQNLFVSKLNLCCAVFDFSD  136



>ref|NP_001148974.1| transposon protein [Zea mays]
 gb|ACG33695.1| transposon protein [Zea mays]
Length=501

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 68/108 (63%), Gaps = 15/108 (14%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVI--ANRLNVVKRMSS  415
            M KQ+L+K+PRKS              +   ++G G+Q T+SC  I      + ++RMSS
Sbjct  1    MWKQLLSKLPRKSPACGD---------SGQCSNGTGIQRTSSCGSIPPGRPASAIRRMSS  51

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            A+FP+++VAG    I P + FKDV N EKQ LF+SKL+LCC V+DFSD
Sbjct  52   AVFPSSVVAG----IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSD  95



>gb|ACN30940.1| unknown [Zea mays]
Length=501

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 68/108 (63%), Gaps = 15/108 (14%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVI--ANRLNVVKRMSS  415
            M KQ+L+K+PRKS              +   ++G G+Q T+SC  I      + ++RMSS
Sbjct  1    MWKQLLSKLPRKSPACGD---------SGQCSNGTGIQRTSSCGSIPPGRPASAIRRMSS  51

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            A+FP+++VAG    I P + FKDV N EKQ LF+SKL+LCC V+DFSD
Sbjct  52   AVFPSSVVAG----IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSD  95



>ref|XP_008647861.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647862.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647863.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647864.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 gb|ACN27844.1| unknown [Zea mays]
 gb|ACN28036.1| unknown [Zea mays]
 gb|ACN29212.1| unknown [Zea mays]
 gb|AFW79075.1| transposon protein isoform 1 [Zea mays]
 gb|AFW79076.1| transposon protein isoform 2 [Zea mays]
 gb|AFW79077.1| transposon protein isoform 3 [Zea mays]
 gb|AFW79078.1| transposon protein isoform 4 [Zea mays]
Length=501

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 68/108 (63%), Gaps = 15/108 (14%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVI--ANRLNVVKRMSS  415
            M KQ+L+K+PRKS              +   ++G G+Q T+SC  I      + ++RMSS
Sbjct  1    MWKQLLSKLPRKSPACGD---------SGQCSNGTGIQRTSSCGSIPPGRPASAIRRMSS  51

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            A+FP+++VAG    I P + FKDV N EKQ LF+SKL+LCC V+DFSD
Sbjct  52   AVFPSSVVAG----IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSD  95



>ref|XP_010913433.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010913512.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=509

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 69/110 (63%), Gaps = 11/110 (10%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNG----VQFTNSCNVIANRLNVVKRM  409
            M KQ L+K+PRKS K D    S     N+P ++ +     +Q  NS N    R   VKRM
Sbjct  1    MWKQFLSKLPRKSSKLDSVSDSTH---NHPGSNASSSGNSIQRANSGNAGPGRSTTVKRM  57

Query  410  SSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SSA+FP+++VAG    I P L FKD+SN EKQ LF+SKLNLC  V+DFSD
Sbjct  58   SSAVFPSSVVAG----IEPLLSFKDISNTEKQNLFISKLNLCSVVFDFSD  103



>ref|XP_002458327.1| hypothetical protein SORBIDRAFT_03g031350 [Sorghum bicolor]
 gb|EES03447.1| hypothetical protein SORBIDRAFT_03g031350 [Sorghum bicolor]
Length=500

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 71/109 (65%), Gaps = 7/109 (6%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsns-FNNPTNSGNGVQFTNSCNVI--ANRLNVVKRMS  412
            M KQ L K+P+KS  S   D    +S   N T +G  +Q T+SC     A  ++ VKRMS
Sbjct  1    MWKQFLTKLPKKSSASGKGDHGSGSSPGRNATGNGGTIQRTSSCPSAGPARPVSSVKRMS  60

Query  413  SAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SA+FP+++VAG    I P + FKDV NGEKQ LF+SK++LCC V+DFSD
Sbjct  61   SAVFPSSVVAG----IEPLVSFKDVPNGEKQNLFVSKVSLCCVVFDFSD  105



>gb|AFW81037.1| hypothetical protein ZEAMMB73_275381 [Zea mays]
Length=504

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 69/109 (63%), Gaps = 16/109 (15%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIA-NR--LNVVKRMS  412
            M KQ L+K+PR+S  S           +   +SG G+Q T+SC  I   R   + ++RMS
Sbjct  1    MWKQFLSKLPRRSSASGD---------SGHCSSGAGIQRTSSCGSIPPGRPPASAIRRMS  51

Query  413  SAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SA+FP+++VAG    I P + FKDV + EKQ LF+SKL+LCC V+DFSD
Sbjct  52   SAVFPSSVVAG----IEPLVSFKDVPSSEKQSLFVSKLSLCCVVFDFSD  96



>ref|XP_004961286.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Setaria italica]
Length=500

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 68/108 (63%), Gaps = 15/108 (14%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVI--ANRLNVVKRMSS  415
            M KQ L+K+PRKS  S           +   ++G G+Q T+S   I  +   + ++RMSS
Sbjct  1    MWKQFLSKLPRKSSASGD---------SGQCSNGTGIQRTSSLGSIPPSRPASAIRRMSS  51

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            A+FP+++VAG    I P + FKDV N EKQ LF+SKL+LCC V+DFSD
Sbjct  52   AVFPSSVVAG----IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSD  95



>ref|XP_004969559.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Setaria italica]
Length=500

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsns-FNNPTNSGNGVQFTNSCNVI--ANRLNVVKRMS  412
            M KQ L K+PRKS  S   D    +S   N   +G+ +Q T+SC     A   + VKRMS
Sbjct  1    MWKQFLPKLPRKSSASGKGDHVSGSSPGRNAAGNGSAIQRTSSCPSAGPARPASSVKRMS  60

Query  413  SAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SA+FP+++VAG    I P + FKDV NGEK  LF+SK++LCC V+DFSD
Sbjct  61   SAVFPSSVVAG----IEPLVSFKDVPNGEKPNLFVSKVSLCCVVFDFSD  105



>ref|XP_008785874.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Phoenix dactylifera]
Length=526

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 71/109 (65%), Gaps = 5/109 (5%)
 Frame = +2

Query  236  ATMLKQILAKIPRkslksdpkdsslsns-FNNPTNSGNGVQFTNSCNVIANRLNVVKRMS  412
            ATM KQ ++K+PRKS K D   +S  ++  NN    GN ++ T S N + +    +KR++
Sbjct  18   ATMWKQFISKLPRKSSKYDTASNSPPSNPGNNAAACGNPIERTASGNGLPDGAASMKRLA  77

Query  413  SAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SA FP+++V G    I P + FKDV N EKQ +FLSKLNLCC ++DFSD
Sbjct  78   SAEFPSSVVVG----IEPLISFKDVPNFEKQNVFLSKLNLCCIIFDFSD  122



>ref|XP_008809266.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Phoenix dactylifera]
Length=509

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdssls-nsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSA  418
            M KQ L+K+PRKS KSD    S   +S +N ++SGN +Q  +S N    R   VKRMSSA
Sbjct  1    MWKQFLSKLPRKSSKSDSSLDSAHNHSGSNASSSGNSIQRASSGNAGPGRSTTVKRMSSA  60

Query  419  IFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +FP+++VAG    I P L FKDV N EKQ LF+SKLNLC +V DFSD
Sbjct  61   VFPSSVVAG----IEPLLSFKDVPNNEKQNLFISKLNLCSAVLDFSD  103



>ref|XP_004138753.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 ref|XP_004173408.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 gb|KGN62895.1| Protein phosphatase 2a, regulatory subunit [Cucumis sativus]
Length=515

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 70/112 (63%), Gaps = 10/112 (9%)
 Frame = +2

Query  242  MLKQILAKIPRkslksd------pkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVK  403
            MLKQIL+K+PRKS  S          S+ ++  N+ T+SG+G   ++     + R N  K
Sbjct  1    MLKQILSKLPRKSSDSSDSPRTPRSSSNRASPRNSTTSSGHGTPRSSGGASASGRSNATK  60

Query  404  RMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            + SSA+FPA++VAG    I P + FKDV + EK  LF+SKL+LCC  +DF+D
Sbjct  61   KTSSAVFPASLVAG----IEPLVPFKDVPSSEKMNLFVSKLSLCCVTFDFTD  108



>ref|XP_008785883.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Phoenix dactylifera]
 ref|XP_008785890.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Phoenix dactylifera]
Length=507

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsns-FNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSA  418
            M KQ ++K+PRKS K D   +S  ++  NN    GN ++ T S N + +    +KR++SA
Sbjct  1    MWKQFISKLPRKSSKYDTASNSPPSNPGNNAAACGNPIERTASGNGLPDGAASMKRLASA  60

Query  419  IFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
             FP+++V G    I P + FKDV N EKQ +FLSKLNLCC ++DFSD
Sbjct  61   EFPSSVVVG----IEPLISFKDVPNFEKQNVFLSKLNLCCIIFDFSD  103



>ref|XP_010670759.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Beta vulgaris subsp. vulgaris]
Length=499

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 57/120 (48%), Gaps = 35/120 (29%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQF--------------TNSCNVI  379
            MLKQIL+KIPR                  P  S NG                   + N  
Sbjct  1    MLKQILSKIPR-----------------KPFKSDNGEPILNNNLNGSGNGTPRARNGNAA  43

Query  380  ANRLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            + + N  KR SSA+FP ++VAG    I P + FKDV N EK  LFLSKLNLCC  +DF D
Sbjct  44   SGKANATKRTSSAVFPTSVVAG----IEPLVSFKDVPNSEKMNLFLSKLNLCCVTFDFYD  99



>ref|XP_008445128.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Cucumis melo]
Length=515

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 68/112 (61%), Gaps = 10/112 (9%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTN------SGNGVQFTNSCNVIANRLNVVK  403
            MLKQIL+K+PRKS  S     +  +S N  +       SG+G Q ++     + R N  K
Sbjct  1    MLKQILSKLPRKSSDSSDSPRTPRSSSNRSSPRSSTAPSGHGTQRSSGGASASGRSNATK  60

Query  404  RMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            + SSA+FPA++VAG    I P + FKDV + EK  LF+SKL+LCC  +DF+D
Sbjct  61   KTSSAVFPASLVAG----IEPLVPFKDVPSSEKMNLFVSKLSLCCVTFDFTD  108



>ref|XP_007013747.1| Phosphatase 2A regulatory B subunit family protein [Theobroma 
cacao]
 gb|EOY31366.1| Phosphatase 2A regulatory B subunit family protein [Theobroma 
cacao]
Length=503

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 9/108 (8%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQ--FTNSCNVIANRLNVVKRMSS  415
            ML+Q L+K+PRKS KSD  + + S   N+ T +G+  Q   +NS N  + R    KR SS
Sbjct  1    MLRQFLSKLPRKSGKSDSPELARS---NSCTTAGSTPQTHRSNSLNSGSVRPCAAKRTSS  57

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            A+FPA++VAG    I P L FKDV N EK  LF+SK++LCC  +DF+D
Sbjct  58   AVFPASVVAG----IEPLLPFKDVPNSEKMNLFVSKVSLCCVTFDFTD  101



>ref|XP_009377509.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=503

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 8/107 (7%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIA-NRLNVVKRMSSA  418
            MLKQ L+K+PRK+LKSD +  S       P+  G G   +N  N     + N  KRMSSA
Sbjct  1    MLKQFLSKLPRKALKSDERPDSPR---TGPSGLGGGTPRSNGGNSSGPGKANAPKRMSSA  57

Query  419  IFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +FPA++VAG    I P + FKDV   EK  LF+SK++LCC  +DF+D
Sbjct  58   VFPASVVAG----IEPLVPFKDVPTPEKMNLFVSKVSLCCVTFDFTD  100



>gb|KHG19967.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=502

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 9/108 (8%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQ--FTNSCNVIANRLNVVKRMSS  415
            ML+Q L+K+PRKS KSD  + + S    + T +G+  Q   +NS N+ + R    KR SS
Sbjct  1    MLRQFLSKLPRKSGKSDSPELTRS---TSCTTAGSSPQPHRSNSLNLGSGRPCAPKRTSS  57

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            A+FPA++VAG    I P L FKDV N EK  LF+SK++LCC  +DF+D
Sbjct  58   AVFPASVVAG----IEPLLPFKDVPNSEKMNLFVSKVSLCCVTFDFTD  101



>gb|KJB07811.1| hypothetical protein B456_001G045700 [Gossypium raimondii]
Length=502

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 9/108 (8%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQ--FTNSCNVIANRLNVVKRMSS  415
            ML+Q L+K+PRKS KSD  + + S    + T +G+  Q   +NS N+ + R    KR SS
Sbjct  1    MLRQFLSKLPRKSGKSDSPELTRS---TSCTTAGSTPQPHRSNSLNLGSGRPCAPKRTSS  57

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            A+FPA++VAG    I P L FKDV N EK  LF+SK++LCC  +DF+D
Sbjct  58   AVFPASVVAG----IEPLLPFKDVPNSEKMNLFVSKVSLCCVTFDFTD  101



>ref|XP_009372941.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=512

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 11/113 (10%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsn------sFNNPTNSGNGVQFTNSCNVIA-NRLNVV  400
            MLKQ L+K+PRK+LKSD +  S         S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTNTPRSGSRTGPSGLGGGTPRSNGANSSGPGKANAP  60

Query  401  KRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            KRMSSA+FPA++VAG    I P + FKDV   EK  LF+SK++LCC  +DF+D
Sbjct  61   KRMSSAVFPASVVAG----IEPLVPFKDVPTSEKMNLFVSKVSLCCVTFDFTD  109



>ref|XP_009377393.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
 ref|XP_009377396.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=512

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 11/113 (10%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsn------sFNNPTNSGNGVQFTNSCNVIA-NRLNVV  400
            MLKQ L+K+PRK+LKSD +  S         S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTNTPRSGSRTGPSGLGGGTPRSNGANSSGPGKANAP  60

Query  401  KRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            KRMSSA+FPA++VAG    I P + FKDV   EK  LF+SK++LCC  +DF+D
Sbjct  61   KRMSSAVFPASVVAG----IEPLVPFKDVPTSEKMNLFVSKVSLCCVTFDFTD  109



>ref|XP_008383627.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=512

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 11/113 (10%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdss------lsnsFNNPTNSGNGVQFTNSCNVIA-NRLNVV  400
            MLKQ L+K+PRK+LKSD +  S       S S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRXNTPRSGSRTGPSGLGGGTPRSNGANSSGPGKANAP  60

Query  401  KRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            KRMSSA+FPA++VAG    I P + FKDV   EK  LF+SK++LCC  +DF+D
Sbjct  61   KRMSSAVFPASVVAG----IEPLVPFKDVPTSEKMNLFVSKVSLCCVTFDFTD  109



>gb|KJB27047.1| hypothetical protein B456_004G274600 [Gossypium raimondii]
Length=429

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 63/106 (59%), Gaps = 7/106 (7%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            ML+Q L+KIPR    SD  + +  NSF     +G     +NS N    R    KR SS+I
Sbjct  1    MLRQFLSKIPRSFGNSDSPELTRPNSF---MTAGLHTHRSNSFNSGCGRPCATKRTSSSI  57

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++VAG    I P L FK+  N EK  LF+SK++LCC+ +DFSD
Sbjct  58   FPASVVAG----IEPLLPFKNAPNSEKMNLFVSKVSLCCATFDFSD  99



>ref|XP_010541630.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Tarenaya hassleriana]
 ref|XP_010541631.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Tarenaya hassleriana]
Length=504

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 65/111 (59%), Gaps = 14/111 (13%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGV-----QFTNSCNVIANRLNVVKR  406
            M KQ L+K PR+S K+D  + +        + SG+G+     Q + +      R N  KR
Sbjct  1    MFKQFLSKFPRRSSKADSGELT-----RTSSGSGSGLVPSPGQRSVTSGSAPARSNSAKR  55

Query  407  MSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            MSSA+FP ++VAG    I P + FKDV N EK  LF+SK++LCC  +DFSD
Sbjct  56   MSSAVFPTSVVAG----IEPLVPFKDVPNTEKMNLFVSKVSLCCVTFDFSD  102



>ref|XP_010925297.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010925298.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=507

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 27/118 (23%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNS------------GNGVQFTNSCNVIAN  385
            M KQ ++K+PRKS K           ++N +NS            GN V+ T S N + +
Sbjct  1    MWKQFISKLPRKSSK-----------YDNGSNSPPNNAGNNAAACGNPVERTASGNGLPD  49

Query  386  RLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
                +KR++SA FP+++VAG    I P + FKDV N EKQ +FLSKLNLCC ++DFSD
Sbjct  50   GAASLKRLASAEFPSSVVAG----IEPLISFKDVPNLEKQNVFLSKLNLCCIIFDFSD  103



>ref|XP_007223260.1| hypothetical protein PRUPE_ppa004440mg [Prunus persica]
 ref|XP_008219855.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Prunus mume]
 gb|EMJ24459.1| hypothetical protein PRUPE_ppa004440mg [Prunus persica]
Length=509

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 11/113 (10%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdp------kdsslsnsFNNPTNSGNGVQFTNSC-NVIANRLNVV  400
            MLKQ L+K+PRK+LKSD         +  S+S   P+  G G   +N   N+   R N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTSTPRSSSRTGPSGVGGGTPRSNGGGNLGPVRSNGP  60

Query  401  KRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            KRMSSA+FPA++VAG    I P + FKDV   EK  LF+SK++LCC  +DF+D
Sbjct  61   KRMSSAVFPASVVAG----IEPLVPFKDVPTSEKMNLFVSKVSLCCVTFDFTD  109



>gb|KJB27048.1| hypothetical protein B456_004G274600 [Gossypium raimondii]
Length=501

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 63/106 (59%), Gaps = 7/106 (7%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            ML+Q L+KIPR    SD  + +  NSF     +G     +NS N    R    KR SS+I
Sbjct  1    MLRQFLSKIPRSFGNSDSPELTRPNSF---MTAGLHTHRSNSFNSGCGRPCATKRTSSSI  57

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++VAG    I P L FK+  N EK  LF+SK++LCC+ +DFSD
Sbjct  58   FPASVVAG----IEPLLPFKNAPNSEKMNLFVSKVSLCCATFDFSD  99



>ref|XP_009129957.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Brassica rapa]
Length=487

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 61/106 (58%), Gaps = 23/106 (22%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M KQ L+K+PRKS              ++P  SG+ V  +NS          VKRMSSA+
Sbjct  3    MFKQFLSKLPRKSSSKPDST-------SDP--SGSSVVRSNS----------VKRMSSAV  43

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP+++VAG    I P + FKDV   EK  LF+SKL+LCC  +DFSD
Sbjct  44   FPSSVVAG----IEPLVPFKDVPTSEKLNLFVSKLSLCCVTFDFSD  85



>emb|CDY05497.1| BnaA02g31940D [Brassica napus]
Length=485

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 61/106 (58%), Gaps = 23/106 (22%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M KQ L+K+PRKS              ++P  SG+ V  +NS          VKRMSSA+
Sbjct  1    MFKQFLSKLPRKSSSKPDST-------SDP--SGSSVVRSNS----------VKRMSSAV  41

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP+++VAG    I P + FKDV   EK  LF+SKL+LCC  +DFSD
Sbjct  42   FPSSVVAG----IEPLVPFKDVPTSEKLNLFVSKLSLCCVTFDFSD  83



>ref|XP_010493808.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Camelina sativa]
Length=506

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 69/112 (62%), Gaps = 15/112 (13%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGN---GVQFTNSCNVIAN---RLNVVK  403
            M KQ L+K+PRKS KS+     L     N ++SG     VQ + + +V+ +   R N  K
Sbjct  1    MFKQFLSKLPRKSSKSESGGGEL-----NRSSSGQVPSPVQRSGAGSVVGSGPVRSNSGK  55

Query  404  RMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            RMSSA+FPA++VAG    I P + FKDV   EK  LF+SK++LCC  +DFSD
Sbjct  56   RMSSAVFPASVVAG----IEPLVPFKDVPTSEKLNLFVSKVSLCCVTFDFSD  103



>emb|CDY54903.1| BnaC02g48620D [Brassica napus]
Length=486

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 63/106 (59%), Gaps = 24/106 (23%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M KQ L+K+PRKS K D          ++P  SG+ V  +NS          VKRMSSA+
Sbjct  1    MFKQFLSKLPRKSSKPDST--------SDP--SGSSVVRSNS----------VKRMSSAV  40

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP+++VAG    I P + FKDV   EK  LF+SKL+LCC  +DFSD
Sbjct  41   FPSSVVAG----IEPLVPFKDVPTSEKLNLFVSKLSLCCVTFDFSD  82



>ref|XP_011087131.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Sesamum indicum]
Length=491

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 62/106 (58%), Gaps = 12/106 (11%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M KQIL+K+PRKS K D           NP +  N     +     AN     KR S+A+
Sbjct  1    MWKQILSKLPRKSQKPDQDLQ------RNPDSGPNTPSLGSGRIGAAN--PAAKRASAAV  52

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+++AG    I P L FKDVS+ EK  LF+SKL+LCC V+DF+D
Sbjct  53   FPASVIAG----IEPLLPFKDVSSSEKMNLFISKLSLCCVVFDFTD  94



>dbj|BAK03510.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 59/108 (55%), Gaps = 9/108 (8%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIA--NRLNVVKRMSS  415
            M KQ L+K+PR                     +GN +Q T+S          + +KRMSS
Sbjct  1    MWKQFLSKLPRTKSSGGGGGGDSG---QCSGGNGNPIQRTSSVPAGGGGRSASTIKRMSS  57

Query  416  AIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            A+FP+++VAG    I   + FKDV + E+  LF+SKL LCC+V+DFSD
Sbjct  58   AVFPSSVVAG----IESLVSFKDVPSSERHNLFVSKLGLCCAVFDFSD  101



>ref|XP_006394804.1| hypothetical protein EUTSA_v10004060mg [Eutrema salsugineum]
 gb|ESQ32090.1| hypothetical protein EUTSA_v10004060mg [Eutrema salsugineum]
Length=500

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 66/106 (62%), Gaps = 7/106 (7%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M KQ L+K+PRKS K+D  + + S+S   P+ +        S  V   R N  KRMSSA+
Sbjct  1    MFKQFLSKLPRKSSKADSGELTRSSSGPVPSPAQRSGTGGGSAPV---RSNSGKRMSSAV  57

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++VAG    I P + FKDV N EK  LF+SK++LCC  +DFSD
Sbjct  58   FPASVVAG----IEPLVPFKDVPNSEKLNLFVSKVSLCCVTFDFSD  99



>ref|XP_008394018.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=512

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 11/113 (10%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsn------sFNNPTNSGNGVQFTNSCNVIA-NRLNVV  400
            MLKQ L+K+PRK+LKSD +  S         S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTNXPRSGSRTGPSGLGGGTPRSNGGNXSGPGKANAP  60

Query  401  KRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            KRMSSA+FPA+ VAG    I P + FKDV   EK  LF+SK++LCC  +DF+D
Sbjct  61   KRMSSAVFPASXVAG----IEPLVPFKDVPTPEKMNLFVSKVSLCCVTFDFTD  109



>gb|KDP32288.1| hypothetical protein JCGZ_13213 [Jatropha curcas]
Length=498

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 65/107 (61%), Gaps = 13/107 (12%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTN-SCNVIANRLNVVKRMSSA  418
            MLKQIL+K+PRKS K +  +         P +    +Q +N S N    + N  KR SSA
Sbjct  1    MLKQILSKLPRKSSKPEATE------LTRPESPS--IQRSNGSSNGSVAKSNGPKRTSSA  52

Query  419  IFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +FPA++VAG    I P + FKDV  GE+  LF+SK++LCC  +DF+D
Sbjct  53   VFPASVVAG----IEPLVPFKDVPAGERMNLFVSKVSLCCVTFDFTD  95



>gb|EYU21914.1| hypothetical protein MIMGU_mgv1a005231mg [Erythranthe guttata]
Length=492

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 60/106 (57%), Gaps = 12/106 (11%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M KQIL KIP+KS K D   S       NP NSG       S     N     KR S+A+
Sbjct  2    MWKQILGKIPKKSQKPDQDSS------RNP-NSGPNTSSPGSIRANTN-TPAAKRASAAV  53

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP  ++AG    I P L FKDVS+ EK  LF+SKL+LCC V+DF+D
Sbjct  54   FPTCVIAG----IEPLLAFKDVSSSEKMNLFISKLSLCCVVFDFTD  95



>ref|XP_006476190.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Citrus sinensis]
Length=539

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 46/78 (59%), Gaps = 10/78 (13%)
 Frame = +2

Query  326  NPTNSGNGVQFTNSCNVIANRLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQ  505
            N +N G         NV        KR SSA+FPA++VAG    I P L FKDV NGEK 
Sbjct  70   NKSNGGEKYSSAGKSNV------ATKRTSSAVFPASVVAG----IEPLLPFKDVPNGEKM  119

Query  506  GLFLSKLNLCCSVYDFSD  559
             LF+SK++LCC  +DF+D
Sbjct  120  NLFVSKVSLCCVTFDFTD  137



>ref|XP_006450560.1| hypothetical protein CICLE_v10008015mg [Citrus clementina]
 gb|ESR63800.1| hypothetical protein CICLE_v10008015mg [Citrus clementina]
Length=518

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 46/78 (59%), Gaps = 10/78 (13%)
 Frame = +2

Query  326  NPTNSGNGVQFTNSCNVIANRLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQ  505
            N +N G         NV        KR SSA+FPA++VAG    I P L FKDV NGEK 
Sbjct  49   NKSNGGEKYSSAGKSNV------ATKRTSSAVFPASVVAG----IEPLLPFKDVPNGEKM  98

Query  506  GLFLSKLNLCCSVYDFSD  559
             LF+SK++LCC  +DF+D
Sbjct  99   NLFVSKVSLCCVTFDFTD  116



>ref|XP_006476191.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Citrus sinensis]
 gb|KDO79624.1| hypothetical protein CISIN_1g010120mg [Citrus sinensis]
Length=518

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 46/78 (59%), Gaps = 10/78 (13%)
 Frame = +2

Query  326  NPTNSGNGVQFTNSCNVIANRLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQ  505
            N +N G         NV        KR SSA+FPA++VAG    I P L FKDV NGEK 
Sbjct  49   NKSNGGEKYSSAGKSNV------ATKRTSSAVFPASVVAG----IEPLLPFKDVPNGEKM  98

Query  506  GLFLSKLNLCCSVYDFSD  559
             LF+SK++LCC  +DF+D
Sbjct  99   NLFVSKVSLCCVTFDFTD  116



>ref|XP_003544625.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Glycine max]
Length=492

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 65/109 (60%), Gaps = 12/109 (11%)
 Frame = +2

Query  242  MLKQILAKIPRkslk---sdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMS  412
            MLKQIL+K+PRKSLK    +      + S ++P  +G   +     +  A R +     S
Sbjct  1    MLKQILSKLPRKSLKPDSDELTRGDSARSADSPRAAGRSYKLHGVSSSTAKRAS-----S  55

Query  413  SAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SA+FPA++V+G    I P + FKDV N EK  LF+SKL+LCC  +DF+D
Sbjct  56   SAVFPASMVSG----IEPLVPFKDVPNAEKMNLFVSKLSLCCVTFDFTD  100



>emb|CDX88186.1| BnaA06g27770D [Brassica napus]
Length=495

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 4/58 (7%)
 Frame = +2

Query  386  RLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            R N  KRMSSA+FPA++V+G    I P L FKDV N EK  LF+SK++LCC  +DFSD
Sbjct  42   RSNSGKRMSSAVFPASVVSG----IEPLLPFKDVPNSEKLNLFVSKVSLCCVTFDFSD  95



>emb|CDX80521.1| BnaC07g29230D [Brassica napus]
Length=496

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 4/58 (7%)
 Frame = +2

Query  386  RLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            R N  KRMSSA+FPA++V+G    I P L FKDV N EK  LF+SK++LCC  +DFSD
Sbjct  43   RSNSGKRMSSAVFPASVVSG----IEPLLPFKDVPNSEKLNLFVSKVSLCCVTFDFSD  96



>ref|XP_009151080.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Brassica rapa]
Length=495

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 4/58 (7%)
 Frame = +2

Query  386  RLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            R N  KRMSSA+FPA++V+G    I P L FKDV N EK  LF+SK++LCC  +DFSD
Sbjct  42   RSNSGKRMSSAVFPASVVSG----IEPLLPFKDVPNSEKLNLFVSKVSLCCVAFDFSD  95



>ref|XP_011081886.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Sesamum indicum]
Length=490

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 20/110 (18%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNV----VKRM  409
            M KQIL K+PRKS K             +  ++ N     NS +  ++R+N      KR 
Sbjct  1    MWKQILGKLPRKSQKP------------DQDSTRNPSLGPNSSSPGSSRVNASSPAAKRA  48

Query  410  SSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            S+A+FPA+++AG    I P L FKDV + EK  LF+SKL+LCC V+DF+D
Sbjct  49   SAAVFPASVIAG----IEPLLAFKDVPSSEKMNLFISKLSLCCVVFDFTD  94



>ref|XP_006287577.1| hypothetical protein CARUB_v10000786mg [Capsella rubella]
 gb|EOA20475.1| hypothetical protein CARUB_v10000786mg [Capsella rubella]
Length=501

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 33/120 (28%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIAN------------  385
            M KQ+L+K+PRK               ++ ++SG  +  ++S  + +             
Sbjct  1    MFKQLLSKLPRK---------------SSKSDSGGELNRSSSGQIASPVQRSGASGGGSG  45

Query  386  --RLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
              R N  KRMSSA+FPA++VAG    I P + FKDV + EK  LF+SK++LCC  +DFSD
Sbjct  46   PVRSNSGKRMSSAVFPASVVAG----IEPLVPFKDVPSSEKLNLFVSKVSLCCVTFDFSD  101



>ref|NP_001146050.1| uncharacterized protein LOC100279581 [Zea mays]
 gb|ACL53110.1| unknown [Zea mays]
Length=455

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 4/51 (8%)
 Frame = +2

Query  407  MSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            MSSA+FP+++VAG    I P + FKDV + EKQ LF+SKL+LCC V+DFSD
Sbjct  1    MSSAVFPSSVVAG----IEPLVSFKDVPSSEKQSLFVSKLSLCCVVFDFSD  47



>gb|KFK27832.1| hypothetical protein AALP_AA8G435800 [Arabis alpina]
Length=502

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 67/112 (60%), Gaps = 17/112 (15%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSG---NGVQFTNSCNVIAN---RLNVVK  403
            M KQ L+K+PRKS K D  +        N T+SG   + VQ + +     +   R N  K
Sbjct  1    MFKQFLSKLPRKSSKPDSNEL-------NRTSSGPVSSPVQRSGASGGGGSGPVRSNSGK  53

Query  404  RMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            RMSSA+FPA++VAG    I P + FKDV + EK  LF+SK++LCC  +DFSD
Sbjct  54   RMSSAVFPASVVAG----IEPLVPFKDVPSSEKLNLFVSKVSLCCVTFDFSD  101



>ref|XP_010109039.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
 gb|EXC20791.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
Length=668

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPT--NSGNGVQFTNSCNVIANRLNV--VKRM  409
            M KQIL+K+PRKS KS+   SS   S +N    +SG+G++ + S    +        KRM
Sbjct  1    MFKQILSKLPRKSSKSESPRSSSPRSQSNSRAGSSGSGLENSKSNGGNSGSSRSNSTKRM  60

Query  410  SSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SS +FPA++VAG    I P + FKDV N EK  LF+SK++LCC  +DF+D
Sbjct  61   SSVVFPASMVAG----IEPLVPFKDVPNAEKMNLFVSKVSLCCVTFDFTD  106



>ref|XP_004241801.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Solanum lycopersicum]
Length=498

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 63/111 (57%), Gaps = 21/111 (19%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIAN----RLNVV-KR  406
            M K  L+K+P+KSLK            +   +SG G   +NS N  +N    R N V +R
Sbjct  1    MWKHFLSKLPKKSLK------------SESVDSGRGNSDSNSPNASSNLGPGRPNSVPRR  48

Query  407  MSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
             SS +FPA+++AG    I P + FKDV + EK  LF+SKL+LCC  +DF D
Sbjct  49   TSSVVFPASVIAG----IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRD  95



>ref|XP_002308635.2| hypothetical protein POPTR_0006s26320g, partial [Populus trichocarpa]
 gb|EEE92158.2| hypothetical protein POPTR_0006s26320g, partial [Populus trichocarpa]
Length=383

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 4/53 (8%)
 Frame = +2

Query  401  KRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            KR SS +FPA++VAG    I P + FKDVSN EK  LF+SK++LCC  +DFSD
Sbjct  50   KRTSSVVFPASVVAG----IEPLVPFKDVSNAEKMNLFVSKVSLCCVTFDFSD  98



>ref|XP_002516615.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF45956.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=498

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 62/106 (58%), Gaps = 11/106 (10%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M KQ L+K+PRKS K +  +       +  T S +  +  NS      + N  KR SSA+
Sbjct  1    MFKQFLSKLPRKSSKPESTE-------STRTESPSVQRCNNSSPASGVKSNGPKRTSSAV  53

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++VAG    I P + FKDV + E+  LF+SK++LCC  +DF+D
Sbjct  54   FPASVVAG----IEPLVPFKDVPSAERMNLFVSKVSLCCVTFDFTD  95



>ref|NP_197933.1| protein phosphatase 2A regulatory B subunit [Arabidopsis thaliana]
 sp|Q93YV6.1|2A5I_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 57 kDa 
regulatory subunit B' iota isoform; Short=AtB' iota; Short=PP2A, 
B' subunit, iota isoform [Arabidopsis thaliana]
 gb|AAL24096.1| putative AtBgamma protein [Arabidopsis thaliana]
 gb|AAN13126.1| putative AtBgamma protein [Arabidopsis thaliana]
 gb|AED93456.1| protein phosphatase 2A regulatory B subunit [Arabidopsis thaliana]
Length=500

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 4/58 (7%)
 Frame = +2

Query  386  RLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            R N  KRMSSA+FPA++VAG    I P + FKDV + EK  LF+SK++LCC  +DFSD
Sbjct  47   RSNSGKRMSSAVFPASVVAG----IEPLVPFKDVPSSEKLNLFVSKVSLCCVTFDFSD  100



>ref|XP_010421407.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Camelina sativa]
Length=506

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 4/58 (7%)
 Frame = +2

Query  386  RLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            R N  KRMSSA+FPA++VAG    I P + FKDV   EK  LF+SK++LCC  +DFSD
Sbjct  50   RSNSGKRMSSAVFPASVVAG----IEPLVPFKDVPTSEKLNLFVSKVSLCCVTFDFSD  103



>ref|XP_010456709.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like, partial [Camelina sativa]
Length=471

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 4/58 (7%)
 Frame = +2

Query  386  RLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            R N  KRMSSA+FPA++VAG    I P + FKDV   EK  LF+SK++LCC  +DFSD
Sbjct  50   RSNSGKRMSSAVFPASVVAG----IEPLVPFKDVPTSEKLNLFVSKVSLCCVTFDFSD  103



>gb|EYU29254.1| hypothetical protein MIMGU_mgv1a005961mg [Erythranthe guttata]
Length=463

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 60/106 (57%), Gaps = 22/106 (21%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M KQ L K+PRKS KSD          + P N   G    N+ N  A      KR S+A+
Sbjct  1    MWKQFLGKLPRKSPKSDQ---------DLPRNPNLG---PNAANPAA------KRASAAV  42

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+++AG    I P L FKDV N E+  LF+SKL+LC  V+DF+D
Sbjct  43   FPASVIAG----IEPLLAFKDVPNSERMNLFISKLSLCSVVFDFTD  84



>ref|XP_011019731.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Populus euphratica]
Length=499

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 62/106 (58%), Gaps = 10/106 (9%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            ML+QIL+K+P+KS K+D  +S        P +     +   S   +    +  KR SS +
Sbjct  1    MLRQILSKLPKKSSKTDSAES------TRPESPLTQQRSNGSTAGLGKSSSGPKRTSSVV  54

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++VAG    I P + FKDV N EK  LF+SK++LCC  +DFSD
Sbjct  55   FPASVVAG----IEPLVPFKDVPNAEKMNLFVSKVSLCCVTFDFSD  96



>ref|XP_011026522.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Populus euphratica]
Length=500

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 61/106 (58%), Gaps = 10/106 (9%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            ML+QIL+K+PRKS K+D  +S+       P +         S        N  KR SS +
Sbjct  2    MLRQILSKLPRKSSKTDLAESA------RPESPVTQQISNGSSAGSGKSSNGPKRTSSVV  55

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++VAG    I P + FKDV N EK  LF+SK++LCC  +DFSD
Sbjct  56   FPASVVAG----IEPLVPFKDVPNAEKMNLFVSKVSLCCVTFDFSD  97



>ref|XP_004292963.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Fragaria vesca subsp. vesca]
Length=525

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 4/53 (8%)
 Frame = +2

Query  401  KRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            KRMSSA+FPA++VAG    I P + FKDV   EK  LF+SK++LCC  +DF+D
Sbjct  74   KRMSSAVFPASVVAG----IEPLVPFKDVPGSEKMNLFVSKVSLCCVTFDFTD  122



>ref|XP_002874266.1| hypothetical protein ARALYDRAFT_489409 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50525.1| hypothetical protein ARALYDRAFT_489409 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 4/58 (7%)
 Frame = +2

Query  386  RLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            R N  KRMSSA+FPA++VAG    I P + FKDV + EK  LF+SK++LCC  +DFS+
Sbjct  46   RSNSGKRMSSAVFPASVVAG----IEPLVPFKDVPSSEKLNLFVSKVSLCCVTFDFSE  99



>ref|XP_007161261.1| hypothetical protein PHAVU_001G055500g [Phaseolus vulgaris]
 gb|ESW33255.1| hypothetical protein PHAVU_001G055500g [Phaseolus vulgaris]
Length=491

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (59%), Gaps = 12/109 (11%)
 Frame = +2

Query  242  MLKQILAKIPRkslk---sdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMS  412
            ML+QIL+K+PRKSLK    +      + S ++P  +G   +     +  A R +     S
Sbjct  1    MLRQILSKLPRKSLKPDSDESTWGDSARSADSPRVAGKSQRPHGGSSTAAKRAS-----S  55

Query  413  SAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            SA+FPA++V+G      P + FKDV+N EK  LF+SKL+LCC  +DF D
Sbjct  56   SAVFPASMVSG----FEPLVPFKDVANAEKMNLFVSKLSLCCVTFDFCD  100



>gb|KCW80467.1| hypothetical protein EUGRSUZ_C018111, partial [Eucalyptus grandis]
Length=386

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 60/106 (57%), Gaps = 5/106 (5%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+KIPR++ + D  +     S  +P  +          N  + R   ++R SS +
Sbjct  1    MLKQILSKIPRRTPRLDSGELIQPAS-GSPDGAQKSGGGGGGSNSSSARSGGLRRASSVV  59

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+++AG    I P + FKDV   EK  L +SKL+LCC  +DF+D
Sbjct  60   FPASVIAG----IEPLVPFKDVPASEKMNLLVSKLSLCCVTFDFTD  101



>ref|XP_010048263.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Eucalyptus grandis]
Length=504

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 60/106 (57%), Gaps = 5/106 (5%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+KIPR++ + D  +     S  +P  +          N  + R   ++R SS +
Sbjct  1    MLKQILSKIPRRTPRLDSGELIQPAS-GSPDGAQKSGGGGGGSNSSSARSGGLRRASSVV  59

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA+++AG    I P + FKDV   EK  L +SKL+LCC  +DF+D
Sbjct  60   FPASVIAG----IEPLVPFKDVPASEKMNLLVSKLSLCCVTFDFTD  101



>ref|XP_003588682.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES58933.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=494

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 60/106 (57%), Gaps = 12/106 (11%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQI  K+PRK+ K+   +SS     ++   +G   Q          R +     SSA+
Sbjct  1    MLKQIFNKLPRKTSKTYSDESSRV---DSSRAAGKSHQRPQGAAASLKRAS-----SSAV  52

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA++V+G    I P + FKDV N EK  LF+SKL+LCC  +DF+D
Sbjct  53   FPASMVSG----IEPLVPFKDVPNAEKMNLFVSKLSLCCVTFDFTD  94



>ref|XP_006353657.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum tuberosum]
Length=498

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 62/111 (56%), Gaps = 21/111 (19%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIAN----RLNVV-KR  406
            M K  L+K+P+KSLK            +   + G G   ++S N  +N    R N V +R
Sbjct  1    MWKHFLSKLPKKSLK------------SESVDLGRGNSDSHSPNASSNLGPGRPNSVPRR  48

Query  407  MSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
             SS +FPA+++AG    I P + FKDV + EK  LF+SKL+LCC  +DF D
Sbjct  49   TSSVVFPASVIAG----IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRD  95



>emb|CDP18419.1| unnamed protein product [Coffea canephora]
Length=496

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 4/54 (7%)
 Frame = +2

Query  398  VKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +KR SSA+FPA++VAG      P + FKDV + EK  LF+SKL+LCC V+DF++
Sbjct  43   LKRASSAVFPASVVAG----FEPLVPFKDVPSSEKMNLFISKLSLCCVVFDFTN  92



>ref|XP_004498632.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cicer arietinum]
Length=500

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (62%), Gaps = 8/107 (7%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSS-A  418
            MLKQI  K+PRKS K+D  +S+     ++P ++ +      S + +      +KR SS A
Sbjct  1    MLKQIFNKLPRKSSKTDTDESNRV---DSPRSTDSPPAAGKSNHRLQGGGASLKRASSSA  57

Query  419  IFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +FPA++V+G    I P + FKDV N EK  LF+SKL+LCC  +DF+D
Sbjct  58   VFPASMVSG----IEPLVPFKDVPNAEKMNLFVSKLSLCCVTFDFTD  100



>gb|EPS62004.1| hypothetical protein M569_12788, partial [Genlisea aurea]
Length=473

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 15/106 (14%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M KQ L K+PRK+ K DP     +++  +P   G+G   TN+ N         K  S+A+
Sbjct  1    MWKQFLGKLPRKTQKPDPDSPISASATLSP---GSGR--TNAVNA------AYKLASAAV  49

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FPA ++AG    + P L FKDV   EK  LF+SKL+LCC V+DF+D
Sbjct  50   FPACVIAG----VEPLLAFKDVPCSEKLNLFISKLSLCCVVFDFTD  91



>ref|XP_008669249.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Zea mays]
 tpg|DAA37270.1| TPA: hypothetical protein ZEAMMB73_719926 [Zea mays]
Length=510

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 58/115 (50%), Gaps = 17/115 (15%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL ++PRK  K+                +GNG + +NS +V+       KR  +  
Sbjct  1    MIKQILGRLPRKPGKAGDS--------REAAAAGNGTEPSNSYSVVRGMDPGNKRAGNGD  52

Query  422  FP------ANIVAGGG---ESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +P      +N V  G     S  P   FKDV   EKQ LF+ K+NLCC+VYDF+D
Sbjct  53   YPVPSGLTSNPVMNGAVVYHSSEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFAD  107



>ref|XP_009798807.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Nicotiana sylvestris]
Length=499

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 4/54 (7%)
 Frame = +2

Query  398  VKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            ++R SS +FPA+++AG    I P + FKDV + EK  LF+SKL+LCC  +DF D
Sbjct  47   LRRTSSVVFPASVIAG----IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRD  96



>ref|XP_009619322.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Nicotiana tomentosiformis]
Length=499

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 4/54 (7%)
 Frame = +2

Query  398  VKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            ++R SS +FPA+++AG    I P + FKDV + EK  LF+SKL+LCC  +DF D
Sbjct  47   LRRTSSVVFPASVIAG----IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRD  96



>ref|XP_004976008.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Setaria italica]
Length=513

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 36/126 (29%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+K IL ++PRK  K+     + +      T++GNG++ +NS +V           + ++
Sbjct  1    MIKNILGRLPRKPGKAGDSRDAAAA-----TSAGNGMEPSNSYSV-----------ARSM  44

Query  422  FPANIVAGGGE--------------------SIAPHLCFKDVSNGEKQGLFLSKLNLCCS  541
             PAN  AG G+                    S  P   FKDV+  EKQ LF+ K+NLCC+
Sbjct  45   DPANKRAGNGDYAVPPGVAPNPVMNGAVVYHSNEPLPAFKDVAASEKQNLFVKKVNLCCA  104

Query  542  VYDFSD  559
            VYDF+D
Sbjct  105  VYDFTD  110



>ref|XP_002448078.1| hypothetical protein SORBIDRAFT_06g020625 [Sorghum bicolor]
 gb|EES12406.1| hypothetical protein SORBIDRAFT_06g020625 [Sorghum bicolor]
Length=407

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 57/115 (50%), Gaps = 17/115 (15%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL ++PRK  K+                +GNG + +NS +V  +     KR  +  
Sbjct  16   MIKQILGRLPRKPGKAGDS--------REAAAAGNGTEPSNSYSVARSMDPGNKRAGNGD  67

Query  422  FPA------NIVAGGG---ESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +P       N V  G     S  P   FKDV   EKQ LF+ K+NLCC+VYDF+D
Sbjct  68   YPVPSGVTPNPVMNGAVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFAD  122



>gb|EPS71240.1| hypothetical protein M569_03516, partial [Genlisea aurea]
Length=471

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 4/53 (8%)
 Frame = +2

Query  401  KRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            KR SSA+FP  ++AG    I P L FKDV + E+  LF+ KLNLC  V+DF+D
Sbjct  33   KRASSAVFPTCLIAG----IEPLLAFKDVPSSERMNLFVGKLNLCSVVFDFTD  81



>ref|XP_002284526.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 ref|XP_010648553.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
Length=492

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 59/106 (56%), Gaps = 15/106 (14%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            MLKQIL+++PRK+LK++  D          T++G     + S            + +S++
Sbjct  1    MLKQILSRLPRKALKAESGDLVR-------TDTGTPRSSSGSPGSRPTS----AKKTSSV  49

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FP N VAG    + P   F DV   EK  LF+SKLNLCC+V+DF+D
Sbjct  50   FPTNAVAG----VEPSAAFNDVPIAEKLNLFVSKLNLCCTVFDFND  91



>ref|XP_008222034.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Prunus mume]
Length=520

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 59/120 (49%), Gaps = 16/120 (13%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQF--TNSCNVIA-----NRLNVV  400
            M KQIL+K+PRKS K+          ++NP N+     F  + S N++      N ++ V
Sbjct  1    MFKQILSKLPRKSSKNSESRDGSHTMYSNPPNTSRSSDFGTSKSGNLVTSFPAGNPVSDV  60

Query  401  KR-------MSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
             +         + + P   V        P   F+DV N EKQ LF+ KLNLCC V+DF+D
Sbjct  61   GKSYGNKNVRGANLKPNGFVLSSSYEALP--GFRDVPNSEKQSLFIKKLNLCCVVFDFTD  118



>ref|XP_007137075.1| hypothetical protein PHAVU_009G097600g [Phaseolus vulgaris]
 gb|ESW09069.1| hypothetical protein PHAVU_009G097600g [Phaseolus vulgaris]
Length=497

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 63/107 (59%), Gaps = 6/107 (6%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSS-A  418
            MLKQ L+++PRK+ K D  +S  ++S +   +S       +  + +A   N  KR SS A
Sbjct  1    MLKQFLSRLPRKTPKPDSDESCRADS-SRSDDSPRAAGRHSRAHGVAAASNAAKRTSSSA  59

Query  419  IFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +FPA+ V+     I P + FKDV + EK  LF+SKL+LCC  +DF D
Sbjct  60   VFPASTVS----VIEPLVPFKDVPSAEKMNLFVSKLSLCCVSFDFRD  102



>ref|XP_003603467.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES73718.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=499

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 11/109 (10%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSG--NGVQFTNSCNVIANRLNVVKRMSS  415
            MLKQ L+K+PRK+ K D  +S   +S ++   +G  N  Q  N       + N  KR SS
Sbjct  1    MLKQFLSKLPRKASKHDSDESCRVDSHDSHRVTGKNNRSQGGND----GGKANAAKRNSS  56

Query  416  A-IFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            A +FP + V+     I P + FKDV + EK  LF+SKL+LCC  +DF+D
Sbjct  57   AAVFPTSTVS----LIEPLVPFKDVPSSEKMNLFVSKLSLCCVAFDFTD  101



>ref|XP_009359296.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
 ref|XP_009359297.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
 ref|XP_009359298.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
Length=520

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 59/121 (49%), Gaps = 18/121 (15%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNP-----------TNSGNGVQFTNSCNVIANR  388
            ML+QIL K+PRKS K           ++NP           + SGN      S NV+AN 
Sbjct  1    MLRQILNKLPRKSSKKAENRDGAHTLYSNPPTSSRSNDSGTSKSGNLTTSFPSGNVVAN-  59

Query  389  LNVVKRMSSAIFP-ANIVAGG---GESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFS  556
              VVK  S+     AN+   G     S      F+DV N EKQ LF+ KL+LCC  +DF+
Sbjct  60   --VVKSYSNKNAKGANMKPNGFAFSSSYEALPGFRDVPNAEKQSLFIKKLSLCCVAFDFT  117

Query  557  D  559
            D
Sbjct  118  D  118



>ref|XP_007222861.1| hypothetical protein PRUPE_ppa004258mg [Prunus persica]
 gb|EMJ24060.1| hypothetical protein PRUPE_ppa004258mg [Prunus persica]
Length=520

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQF--TNSCNVIA-----NRLNVV  400
            M KQIL+K+PRKS K+          ++NP  S     F  + S N++      N ++ V
Sbjct  1    MFKQILSKLPRKSSKNSESRDGSHTMYSNPPTSSRSSDFGISKSGNLVTSFPAGNPVSDV  60

Query  401  KR-------MSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
             +         + + P   V        P   F+DV N EKQ LF+ KLNLCC V+DF+D
Sbjct  61   GKSYGNKNVRGANLKPNGFVLSSSYEALP--GFRDVPNSEKQSLFIKKLNLCCVVFDFTD  118



>ref|NP_001053130.1| Os04g0485100 [Oryza sativa Japonica Group]
 emb|CAE03154.2| OSJNBa0081L15.16 [Oryza sativa Japonica Group]
 emb|CAD41393.2| OJ000223_09.6 [Oryza sativa Japonica Group]
 dbj|BAF15044.1| Os04g0485100 [Oryza sativa Japonica Group]
 gb|EAY94598.1| hypothetical protein OsI_16375 [Oryza sativa Indica Group]
 gb|EAZ31144.1| hypothetical protein OsJ_15242 [Oryza sativa Japonica Group]
 dbj|BAG95856.1| unnamed protein product [Oryza sativa Japonica Group]
Length=509

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL ++PRK  K+     +   + N P+NS +  +     N  +   + V  + + +
Sbjct  1    MIKQILGRLPRKPGKAGDSRDAAGPNGNEPSNSYSVARSVEQGNKRSGNGDYV--VPAGL  58

Query  422  FPANIVAGG--GESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
             P  ++ G     S  P   FKDV   EKQ LF+ K+NLCC+VYDF+D
Sbjct  59   TPNPMMNGTVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFAD  106



>ref|XP_008340161.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=521

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 17/120 (14%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNP-----------TNSGNGVQFTNSCNVIANR  388
            ML+QIL K+PRKS K+          ++NP           + SGN      S N +A+ 
Sbjct  1    MLRQILNKLPRKSSKNAENRDGAQTLYSNPPTSSRSSDLGTSKSGNLTTSFPSGNAVAD-  59

Query  389  LNVVKRMSSAIFPANIVAGGGESIAPHLC---FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
               VK  S+       +   G +I+ +     F+DV N EKQ LF+ KL+LCC V+DF+D
Sbjct  60   --XVKSYSNKSARGANMKPNGFAISSYEALPGFRDVPNAEKQSLFIKKLSLCCVVFDFTD  117



>ref|XP_006652431.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Oryza brachyantha]
Length=507

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 55/109 (50%), Gaps = 6/109 (6%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL ++PRK  K+         + N P+NS +  +     N  +     V     A 
Sbjct  1    MIKQILGRLPRKPGKNGDSRDVAGPNGNEPSNSYSVARSVEQGNKRSGNGEYVVPAGPA-  59

Query  422  FPANIVAGGG---ESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
              +N++  G     S  P   FKDV   EKQ LF+ K+NLCC+VYDF+D
Sbjct  60   --SNLMMNGSVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFTD  106



>ref|NP_001183245.1| hypothetical protein [Zea mays]
 gb|ACR36180.1| unknown [Zea mays]
 gb|AFW58631.1| hypothetical protein ZEAMMB73_760675 [Zea mays]
Length=510

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 56/115 (49%), Gaps = 17/115 (15%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL ++PRK  K+                +GNG + +NS +V  +     KR  +  
Sbjct  1    MIKQILGRLPRKPGKAGDS--------REAAAAGNGTEPSNSYSVARSMDPGNKRAGNGD  52

Query  422  FPA------NIVAGGG---ESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +P       N V  G     S  P   FKDV   EKQ LF+ K++LCC+VYDF D
Sbjct  53   YPVPSGVIPNPVMNGAVVYHSNEPLPAFKDVPMSEKQNLFVKKVSLCCAVYDFVD  107



>ref|XP_003550157.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform 1 [Glycine max]
Length=492

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = +2

Query  419  IFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            +FPA++V+G    I P + FKDV N EK  LF+SKL+LCC  +DF+D
Sbjct  58   VFPASMVSG----IEPLVPFKDVPNAEKMNLFVSKLSLCCVTFDFTD  100



>ref|XP_010089442.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' zeta isoform [Morus notabilis]
 gb|EXB37815.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' zeta isoform [Morus notabilis]
Length=545

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 71/134 (53%), Gaps = 31/134 (23%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkds----------slsnsFNNPTNSGNGVQ------------  355
            M+KQIL KIPRK  KS   DS          S  NS+N P NS NG++            
Sbjct  1    MIKQILGKIPRKPSKSTQDDSYGDGGVDNGYSSVNSYNGP-NSSNGLKPSSTQSKSSISG  59

Query  356  --FTNSCN-VIA--NRLNVVKRMSSAIFPAN-IVAGGGESIAPHLCFKDVSNGEKQGLFL  517
               + S N  IA  N+ N  K+ ++++   + ++A GG    P   F+DV + EKQ LF+
Sbjct  60   LGISRSSNGTIAGGNKSNQAKKSAASVTQVDPLLASGGYEALP--SFRDVPSSEKQNLFI  117

Query  518  SKLNLCCSVYDFSD  559
             KLN+CC V++FSD
Sbjct  118  KKLNMCCVVFNFSD  131



>gb|EPS70113.1| hypothetical protein M569_04647, partial [Genlisea aurea]
Length=465

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 27/112 (24%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSA-  418
            M KQ L K+P+                  P  +      T   + ++NR+N     +S  
Sbjct  1    MWKQFLGKLPK-----------------KPQKADPDSARTPLSSPVSNRINATAAAASKR  43

Query  419  -----IFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
                 +FP +++AG    I P + F++V + EK  LF+SKLNLCC V+DF+D
Sbjct  44   ASSSAVFPTSLIAG----IEPLVSFREVPSSEKMNLFVSKLNLCCVVFDFTD  91



>emb|CAC09487.2| H0811E11.3 [Oryza sativa Indica Group]
 emb|CAH67484.1| H0805A05.14 [Oryza sativa Indica Group]
Length=509

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (53%), Gaps = 4/108 (4%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL ++PRK  K+     +   + N P+NS +  +     N  +   + V  + + +
Sbjct  1    MIKQILGRLPRKPGKAGDSRDAAGPNGNEPSNSYSVARSVEQGNKRSGNGDYV--VPAGL  58

Query  422  FPANIVAGG--GESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
             P  ++ G     S  P   FKDV   EKQ LF+ K+NLCC VYDF+D
Sbjct  59   TPNPMMNGTVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCVVYDFAD  106



>ref|XP_006417120.1| hypothetical protein EUTSA_v10007450mg [Eutrema salsugineum]
 gb|ESQ35473.1| hypothetical protein EUTSA_v10007450mg [Eutrema salsugineum]
Length=497

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 28/44 (64%), Gaps = 3/44 (7%)
 Frame = +2

Query  437  VAGGGESIAPHLC---FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            + G G    P+     FKDV N EKQ LFL KLNLCC V+DFSD
Sbjct  65   LKGNGNGFTPYEALPSFKDVPNAEKQNLFLKKLNLCCVVFDFSD  108



>ref|XP_002301608.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
 gb|EEE80881.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
Length=514

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 58/119 (49%), Gaps = 32/119 (27%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQIL K+PRK  K            +N +N+  G+   +S    A+RLN     + ++
Sbjct  1    MIKQILGKLPRKPSKPS----------SNDSNNDGGLHAYSSG---ASRLN-----NGSL  42

Query  422  FPANIVAGGGESIAPHL-------------CFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
             P N     G+  AP L              F+DV N EK  LF+ KLN+CC V+DFSD
Sbjct  43   VP-NSKGNQGKKSAPQLDPLMTSGVYEALPSFRDVPNSEKHNLFMKKLNMCCVVFDFSD  100



>ref|XP_002870241.1| hypothetical protein ARALYDRAFT_329973 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46500.1| hypothetical protein ARALYDRAFT_329973 [Arabidopsis lyrata subsp. 
lyrata]
Length=948

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 38/106 (36%), Positives = 54/106 (51%), Gaps = 10/106 (9%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSAI  421
            M+KQI  K+PRK  KS   D       +NP   G     +++ N       V+   S++ 
Sbjct  443  MIKQIFGKLPRKPSKSSHND-------SNPNGEGGPTSKSSASNSNGANGTVIAPSSTSS  495

Query  422  FPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
               N V G  E++     F+DV + EK  LF+ KL+LCC V+DFSD
Sbjct  496  NRTNQVNGVYEALPS---FRDVPSSEKPNLFIKKLSLCCVVFDFSD  538



>gb|KHG13833.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=523

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 68/122 (56%), Gaps = 19/122 (16%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdp-----kdsslsnsFNNPTNS---------GNGVQFT--NSCN  373
            M+KQIL ++PRK  KS         +S SN++ +  NS          +G  F+  +S N
Sbjct  1    MIKQILNRLPRKPSKSSDNREGGTSTSSSNAYTSSRNSDLASNHYANSSGASFSGFHSTN  60

Query  374  VIANRLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDF  553
               N+ N + ++ +A    N VA   E++ P+  F+DV N EKQ LF+ KLN+CC V+DF
Sbjct  61   SGLNQGNKISQVVNAKLNGNTVATSFEAL-PN--FRDVPNSEKQNLFIRKLNICCIVFDF  117

Query  554  SD  559
            +D
Sbjct  118  TD  119



>gb|KJB40702.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40703.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40704.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40705.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
Length=523

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 65/122 (53%), Gaps = 19/122 (16%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdp-----kdsslsnsFNNPTNS---------GNGVQFT--NSCN  373
            M+KQIL ++PRK  KS         +S SN++ +  NS          +G  F+  +S N
Sbjct  1    MIKQILNRLPRKPSKSSDNREGGTSTSSSNAYTSSRNSDLASNHYANSSGASFSGFHSTN  60

Query  374  VIANRLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDF  553
               N+ N + ++ +A    N VA    S  P   F+DV N EKQ LF+ KLN+CC V+DF
Sbjct  61   SGLNQGNKISQVVNAKLNGNTVAT---SFEPLPNFRDVPNSEKQNLFIRKLNICCIVFDF  117

Query  554  SD  559
            +D
Sbjct  118  TD  119



>emb|CDP16651.1| unnamed protein product [Coffea canephora]
Length=521

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 62/120 (52%), Gaps = 17/120 (14%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdsslsnsF----------NNPTNSGNGVQFTNSCNVIANR-  388
            M+KQIL ++PRK  KS         +F          N+ +NS +G     S  V +N  
Sbjct  1    MIKQILNRLPRKPSKSAEGRDGGPPTFSSNASTSSRNNDLSNSRSGNSNATSLAVASNPG  60

Query  389  LNVVKRMSSAIFPANIVAGGGESIAPHLC---FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            LN   ++  A+   N+   G  +++P+     F+DV N EKQ LF+ KLNLC  V+DF+D
Sbjct  61   LNHGNKLPQAL---NMKVNGNLAVSPYEALPSFRDVPNSEKQNLFIKKLNLCSVVFDFTD  117



>ref|XP_002266932.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Vitis vinifera]
Length=515

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 62/124 (50%), Gaps = 21/124 (17%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdssl-snsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSA  418
            M+KQI +K+PRK  K+        + +F+N +N   G    +  N  AN LNV    +S 
Sbjct  1    MIKQIFSKLPRKLSKAVENRELGGTTAFSNNSNRSRGSDVES--NQFAN-LNVTSLAASN  57

Query  419  IFP-------ANIVAGG-----GESIAPHL-----CFKDVSNGEKQGLFLSKLNLCCSVY  547
              P       + I  GG     G  + P+       F+DV + EKQ LF+ KLNLCC V+
Sbjct  58   STPITGNNLGSKIPQGGNSKVNGNYMTPNTYEALPAFRDVPSSEKQNLFIGKLNLCCVVF  117

Query  548  DFSD  559
            DF+D
Sbjct  118  DFTD  121



>ref|XP_004501280.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Cicer arietinum]
 ref|XP_004501281.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Cicer arietinum]
Length=498

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 4/53 (8%)
 Frame = +2

Query  401  KRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            K  S+A+FPA+ V+     I P + FKDV + EK  LF+SKL+LCC  +DF+D
Sbjct  55   KNSSAAVFPASTVS----LIEPLVPFKDVPSSEKMNLFVSKLSLCCVSFDFTD  103



>ref|NP_172803.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 ref|NP_973816.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 sp|Q8LF36.2|2A5T_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 57 kDa 
regulatory subunit B' theta isoform; Short=AtB' theta; Short=PP2A, 
B' subunit, theta isoform [Arabidopsis thaliana]
 gb|AAG09562.1|AC011810_21 Putative protein phosphatase 2A regulatory subunit B [Arabidopsis 
thaliana]
 gb|ABH04491.1| At1g13460 [Arabidopsis thaliana]
 gb|AEE29021.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 gb|AEE29022.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
Length=492

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 33/57 (58%), Gaps = 3/57 (5%)
 Frame = +2

Query  398  VKRMSSAIFPANIVAGGGESIAPHLC---FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            VK  + + F    + G G    P+     FKDV N EKQ LF+ KL+LCC V+DFSD
Sbjct  47   VKPSADSGFKEGNLKGNGNGFTPYEALPGFKDVPNAEKQNLFVRKLSLCCVVFDFSD  103



>gb|AAM61625.1| B regulatory subunit of protein phosphatase 2A, putative [Arabidopsis 
thaliana]
Length=492

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 33/57 (58%), Gaps = 3/57 (5%)
 Frame = +2

Query  398  VKRMSSAIFPANIVAGGGESIAPHLC---FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            VK  + + F    + G G    P+     FKDV N EKQ LF+ KL+LCC V+DFSD
Sbjct  47   VKPSADSGFKEGNLKGNGNGFTPYEALPGFKDVPNAEKQNLFVRKLSLCCVVFDFSD  103



>ref|XP_008230444.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Prunus mume]
Length=516

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDV N EKQ LF+ KLNLCC ++DFSD
Sbjct  85   FKDVPNAEKQNLFIKKLNLCCVIFDFSD  112



>ref|XP_007215087.1| hypothetical protein PRUPE_ppa004318mg [Prunus persica]
 gb|EMJ16286.1| hypothetical protein PRUPE_ppa004318mg [Prunus persica]
Length=516

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDV N EKQ LF+ KLNLCC ++DFSD
Sbjct  85   FKDVPNAEKQNLFIKKLNLCCVIFDFSD  112



>ref|XP_009148646.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Brassica rapa]
 ref|XP_009148647.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Brassica rapa]
Length=493

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDVSN EKQ LFL KL+LCC ++DFSD
Sbjct  76   FKDVSNAEKQTLFLKKLSLCCVLFDFSD  103



>ref|XP_011029624.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=526

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (59%), Gaps = 6/56 (11%)
 Frame = +2

Query  410  SSAIFPANIV---AGGGESIAPHLC---FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            S  + P  +V     GG   AP+     F+DV N EKQ LF+ KLNLCC V+DF+D
Sbjct  67   SHGMKPTQVVNPKLNGGSVSAPYEALPGFRDVPNSEKQNLFIRKLNLCCLVFDFTD  122



>gb|KJB11609.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
 gb|KJB11610.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
Length=516

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKD+ N EKQ LF+ KLNLCC V+DFSD
Sbjct  88   FKDIPNSEKQNLFIRKLNLCCVVFDFSD  115



>ref|XP_006469972.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Citrus sinensis]
Length=501

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDV N EKQ LF+ KLNLCC V+DF+D
Sbjct  93   FKDVPNAEKQNLFVRKLNLCCVVFDFTD  120



>ref|XP_006447169.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 ref|XP_006447170.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 ref|XP_006469971.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Citrus sinensis]
 gb|ESR60409.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 gb|ESR60410.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
Length=524

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDV N EKQ LF+ KLNLCC V+DF+D
Sbjct  93   FKDVPNAEKQNLFVRKLNLCCVVFDFTD  120



>gb|KJB11611.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
Length=419

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKD+ N EKQ LF+ KLNLCC V+DFSD
Sbjct  88   FKDIPNSEKQNLFIRKLNLCCVVFDFSD  115



>gb|KDO52091.1| hypothetical protein CISIN_1g0107851mg, partial [Citrus sinensis]
Length=382

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDV N EKQ LF+ KLNLCC V+DF+D
Sbjct  93   FKDVPNAEKQNLFVRKLNLCCVVFDFTD  120



>gb|KDO52090.1| hypothetical protein CISIN_1g0107851mg [Citrus sinensis]
Length=413

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDV N EKQ LF+ KLNLCC V+DF+D
Sbjct  93   FKDVPNAEKQNLFVRKLNLCCVVFDFTD  120



>ref|XP_004138464.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine protein phosphatase 
2A 59 kDa regulatory subunit B' eta isoform-like [Cucumis 
sativus]
Length=524

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDV N EKQ LF+ KLN+CC V+DF+D
Sbjct  93   FKDVPNSEKQSLFIKKLNMCCVVFDFTD  120



>gb|KGN45729.1| hypothetical protein Csa_6G008600 [Cucumis sativus]
Length=524

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDV N EKQ LF+ KLN+CC V+DF+D
Sbjct  93   FKDVPNSEKQSLFIKKLNMCCVVFDFTD  120



>ref|XP_004169443.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Cucumis sativus]
Length=524

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDV N EKQ LF+ KLN+CC V+DF+D
Sbjct  93   FKDVPNSEKQSLFIKKLNMCCVVFDFTD  120



>ref|XP_008441374.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Cucumis melo]
 gb|ADN34067.1| protein phosphatase 2a [Cucumis melo subsp. melo]
Length=524

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDV N EKQ LF+ KLN+CC V+DF+D
Sbjct  93   FKDVPNSEKQSLFIKKLNMCCVVFDFTD  120



>emb|CBI27539.3| unnamed protein product [Vitis vinifera]
Length=451

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 53/107 (50%), Gaps = 15/107 (14%)
 Frame = +2

Query  242  MLKQILAKIPRkslksdpkdssl-snsFNNPTNSGNGVQFTNSCNVIANRLNVVKRMSSA  418
            M+KQI +K+PRK  K+        + +F+N +N   G       N  AN LNV       
Sbjct  1    MIKQIFSKLPRKLSKAVENRELGGTTAFSNNSNRSRGSDV--ESNQFAN-LNV-------  50

Query  419  IFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
                N +        P   F+DV + EKQ LF+ KLNLCC V+DF+D
Sbjct  51   --NGNYMTPNTYEALP--AFRDVPSSEKQNLFIGKLNLCCVVFDFTD  93



>ref|XP_009402720.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402721.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402722.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
Length=522

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 30/49 (61%), Gaps = 4/49 (8%)
 Frame = +2

Query  425  PANIVAGGGESIAPHL----CFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            PA  V   G ++ P       FKDV N EKQ LF+ KL+LCC V+DF+D
Sbjct  70   PAVNVKLNGNNVVPVFEALPSFKDVPNSEKQSLFMRKLDLCCVVFDFTD  118



>ref|XP_006307325.1| hypothetical protein CARUB_v10008945mg [Capsella rubella]
 gb|EOA40223.1| hypothetical protein CARUB_v10008945mg [Capsella rubella]
Length=495

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 28/44 (64%), Gaps = 3/44 (7%)
 Frame = +2

Query  437  VAGGGESIAPHLC---FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            + G G   +P+     FKDV N EKQ L L KLNLCC V+DFSD
Sbjct  63   LKGNGTGFSPYEALPSFKDVPNAEKQNLCLRKLNLCCLVFDFSD  106



>ref|XP_002890006.1| hypothetical protein ARALYDRAFT_471504 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66265.1| hypothetical protein ARALYDRAFT_471504 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 32/57 (56%), Gaps = 3/57 (5%)
 Frame = +2

Query  398  VKRMSSAIFPANIVAGGGESIAPHLC---FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            VK  + + F    + G G    P+     FKDV N EKQ LF+ KL+LCC  +DFSD
Sbjct  50   VKPAADSGFKDGNLKGNGNGFTPYEALPGFKDVPNAEKQNLFVKKLSLCCVTFDFSD  106



>ref|XP_002314559.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
 gb|EEF00730.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
Length=526

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            F+DV N EKQ LF+ KLNLCC V+DF+D
Sbjct  95   FRDVPNSEKQNLFIRKLNLCCVVFDFAD  122



>ref|XP_011042316.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042318.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042319.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042320.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042321.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=547

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            F+DV N EKQ LF+ KLNLCC V+DF+D
Sbjct  116  FRDVPNSEKQNLFIRKLNLCCVVFDFAD  143



>ref|XP_011021363.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021364.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021365.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021366.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021367.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=547

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            F+DV N EKQ LF+ KLNLCC V+DF+D
Sbjct  116  FRDVPNSEKQNLFIRKLNLCCVVFDFAD  143



>ref|XP_004981072.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Setaria italica]
 ref|XP_004981073.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Setaria italica]
Length=519

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            FKDV N EKQ LF+ KLNLCC+ +DF+D
Sbjct  89   FKDVPNSEKQSLFIKKLNLCCTQFDFTD  116



>gb|KHG26982.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=516

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 63/119 (53%), Gaps = 18/119 (15%)
 Frame = +2

Query  242  MLKQILAKIPRkslk---------sdpkdsslsnsFNNPTNSG----NGVQFTNSCNVIA  382
            M+KQI  ++PRK  K         +    S+   S  N  NSG    +GV  +++ N+  
Sbjct  2    MIKQIFNRLPRKQSKSSDNREGGGTSASSSNAYTSSRNNANSGGPASSGV--SSTPNLGL  59

Query  383  NRLNVVKRMSSAIFPANIVAGGGESIAPHLCFKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            N+ N V ++ +     +++A   E++     FKD+ N EKQ LF+ KLNLC  V+DFSD
Sbjct  60   NQGNKVSQVVNTKLNGDVLASSFETLP---SFKDIPNSEKQNLFIRKLNLCRVVFDFSD  115



>ref|XP_002311732.2| hypothetical protein POPTR_0008s18020g, partial [Populus trichocarpa]
 gb|EEE89099.2| hypothetical protein POPTR_0008s18020g, partial [Populus trichocarpa]
Length=407

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  476  FKDVSNGEKQGLFLSKLNLCCSVYDFSD  559
            F+DV N EKQ LF+ KLNLCC V+DF+D
Sbjct  95   FRDVPNSEKQNLFIRKLNLCCVVFDFTD  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880