BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002K12

Length=520
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006355935.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       263   2e-82   Solanum tuberosum [potatoes]
dbj|BAG80546.1|  UDP-glucose:glucosyltransferase                        263   4e-82   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_009797699.1|  PREDICTED: UDP-glycosyltransferase 74B1            259   4e-81   Nicotiana sylvestris
ref|XP_006355936.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       258   2e-80   Solanum tuberosum [potatoes]
ref|XP_009590752.1|  PREDICTED: UDP-glycosyltransferase 74B1            255   2e-79   Nicotiana tomentosiformis
gb|KDP21298.1|  hypothetical protein JCGZ_21769                         254   2e-79   Jatropha curcas
gb|AFK36738.1|  unknown                                                 248   7e-77   Medicago truncatula
emb|CDP00213.1|  unnamed protein product                                247   8e-77   Coffea canephora [robusta coffee]
ref|XP_003517852.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       248   1e-76   Glycine max [soybeans]
ref|XP_003613351.1|  N-hydroxythioamide S-beta-glucosyltransferase      248   1e-76   Medicago truncatula
ref|XP_002520220.1|  UDP-glucosyltransferase, putative                  247   2e-76   Ricinus communis
gb|AES96307.2|  UDP-glucosyltransferase family protein                  246   1e-75   Medicago truncatula
ref|XP_007044514.1|  UDP-glucosyl transferase 74B1                      244   2e-75   
ref|XP_007157504.1|  hypothetical protein PHAVU_002G075200g             243   6e-75   Phaseolus vulgaris [French bean]
ref|XP_003613349.1|  UDP-glucose glucosyltransferase                    246   1e-74   
gb|EYU29695.1|  hypothetical protein MIMGU_mgv1a006214mg                241   4e-74   Erythranthe guttata [common monkey flower]
ref|XP_011086491.1|  PREDICTED: UDP-glycosyltransferase 74B1            238   6e-73   Sesamum indicum [beniseed]
ref|XP_006484310.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       237   6e-72   
ref|XP_003519432.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       235   6e-72   Glycine max [soybeans]
gb|KJB61182.1|  hypothetical protein B456_009G344800                    234   2e-71   Gossypium raimondii
gb|KHN28671.1|  UDP-glycosyltransferase 74B1                            234   2e-71   Glycine soja [wild soybean]
ref|XP_007224980.1|  hypothetical protein PRUPE_ppa020679mg             234   3e-71   Prunus persica
ref|XP_006438479.1|  hypothetical protein CICLE_v10031201mg             234   8e-71   
ref|XP_010695870.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       233   1e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010043823.1|  PREDICTED: UDP-glycosyltransferase 74B1            231   2e-70   Eucalyptus grandis [rose gum]
gb|KJB15210.1|  hypothetical protein B456_002G164900                    230   5e-70   Gossypium raimondii
gb|KHG30812.1|  hypothetical protein F383_15387                         230   9e-70   Gossypium arboreum [tree cotton]
gb|KJB15209.1|  hypothetical protein B456_002G164900                    229   2e-69   Gossypium raimondii
ref|XP_010692817.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       227   2e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|AFJ52950.1|  UDP-glycosyltransferase 1                               226   2e-68   Linum usitatissimum
emb|CAN74227.1|  hypothetical protein VITISV_041748                     225   3e-68   Vitis vinifera
ref|XP_004297667.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       225   7e-68   Fragaria vesca subsp. vesca
ref|XP_002267665.1|  PREDICTED: UDP-glycosyltransferase 74B1            225   7e-68   
ref|XP_004298592.2|  PREDICTED: UDP-glycosyltransferase 74B1-like       222   2e-66   Fragaria vesca subsp. vesca
ref|XP_008361795.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       219   1e-65   
ref|XP_008245156.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       216   3e-64   Prunus mume [ume]
ref|XP_011028616.1|  PREDICTED: UDP-glycosyltransferase 74B1            188   7e-54   Populus euphratica
ref|XP_010552631.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       188   8e-54   Tarenaya hassleriana [spider flower]
gb|KDO69768.1|  hypothetical protein CISIN_1g012645mg                   188   9e-54   Citrus sinensis [apfelsine]
ref|XP_010552632.1|  PREDICTED: UDP-glycosyltransferase 74B1            188   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_006476729.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       187   2e-53   Citrus sinensis [apfelsine]
ref|XP_006439748.1|  hypothetical protein CICLE_v10020081mg             187   3e-53   
emb|CBI15081.3|  unnamed protein product                                184   8e-53   Vitis vinifera
ref|XP_002321569.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    185   9e-53   Populus trichocarpa [western balsam poplar]
ref|XP_002280305.1|  PREDICTED: UDP-glycosyltransferase 74B1            184   3e-52   Vitis vinifera
ref|XP_007036115.1|  UDP-glucosyl transferase 74B1, putative            183   4e-52   
gb|KHN45296.1|  UDP-glycosyltransferase 74B1                            180   5e-52   Glycine soja [wild soybean]
ref|XP_004288732.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       181   6e-52   Fragaria vesca subsp. vesca
dbj|BAF96588.1|  anthocyanin 5-glucosyltransferase                      179   1e-51   Rosa hybrid cultivar
gb|KJB20645.1|  hypothetical protein B456_003G157800                    182   1e-51   Gossypium raimondii
gb|KDP45199.1|  hypothetical protein JCGZ_15064                         181   4e-51   Jatropha curcas
dbj|BAF96597.1|  UDP-glucose:anthocysnin 5-O-glucosyltransferase        178   5e-51   Rosa hybrid cultivar
ref|XP_007199115.1|  hypothetical protein PRUPE_ppa020804mg             180   8e-51   Prunus persica
ref|XP_010091051.1|  UDP-glycosyltransferase                            179   2e-50   Morus notabilis
ref|XP_010242475.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       179   3e-50   Nelumbo nucifera [Indian lotus]
emb|CBI32099.3|  unnamed protein product                                177   6e-50   Vitis vinifera
dbj|BAF96592.1|  flavonoid 5-glucosyltransferase                        175   6e-50   Rosa hybrid cultivar
ref|XP_007049529.1|  UDP-xylose phenolic glycosyltransferase, put...    177   1e-49   
ref|XP_010037076.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       177   2e-49   Eucalyptus grandis [rose gum]
gb|KEH25943.1|  UDP-glucosyltransferase family protein                  176   2e-49   Medicago truncatula
ref|XP_004296695.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       176   3e-49   Fragaria vesca subsp. vesca
ref|XP_010037078.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       174   1e-48   Eucalyptus grandis [rose gum]
ref|XP_007033374.1|  Uridine diphosphate glycosyltransferase 74E2...    176   2e-48   
ref|XP_004489724.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       174   2e-48   Cicer arietinum [garbanzo]
ref|XP_011457820.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    171   3e-48   Fragaria vesca subsp. vesca
gb|KEH25945.1|  UDP-glucosyltransferase family protein                  173   3e-48   Medicago truncatula
ref|XP_007210590.1|  hypothetical protein PRUPE_ppa016463mg             172   4e-48   Prunus persica
gb|KDP31143.1|  hypothetical protein JCGZ_11519                         172   7e-48   Jatropha curcas
ref|XP_004289758.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       172   9e-48   Fragaria vesca subsp. vesca
ref|XP_004299583.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       172   9e-48   Fragaria vesca subsp. vesca
ref|XP_008239719.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       172   9e-48   Prunus mume [ume]
ref|XP_010242477.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       172   1e-47   Nelumbo nucifera [Indian lotus]
gb|KJB71586.1|  hypothetical protein B456_011G131200                    172   1e-47   Gossypium raimondii
ref|XP_007151915.1|  hypothetical protein PHAVU_004G086500g             172   1e-47   Phaseolus vulgaris [French bean]
gb|KDP35131.1|  hypothetical protein JCGZ_10665                         171   2e-47   Jatropha curcas
ref|XP_004289756.1|  PREDICTED: UDP-glycosyltransferase 74E1-like...    171   2e-47   Fragaria vesca subsp. vesca
ref|XP_009366994.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       171   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_002532451.1|  UDP-glucosyltransferase, putative                  170   6e-47   Ricinus communis
ref|XP_009625439.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       170   6e-47   Nicotiana tomentosiformis
dbj|BAO51836.1|  UDP-glycosyltransferase 74Y1                           170   7e-47   Camellia sinensis [black tea]
ref|XP_004290110.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       169   9e-47   Fragaria vesca subsp. vesca
gb|KCW57500.1|  hypothetical protein EUGRSUZ_H00268                     168   9e-47   Eucalyptus grandis [rose gum]
gb|KJB10816.1|  hypothetical protein B456_001G226600                    169   9e-47   Gossypium raimondii
ref|XP_008338819.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       169   1e-46   Malus domestica [apple tree]
ref|XP_007049534.1|  UDP-xylose phenolic glycosyltransferase, put...    169   2e-46   
ref|XP_006447238.1|  hypothetical protein CICLE_v10018164mg             168   2e-46   
ref|XP_010069221.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       168   3e-46   Eucalyptus grandis [rose gum]
ref|XP_002273866.1|  PREDICTED: UDP-glycosyltransferase 74E2            168   3e-46   Vitis vinifera
ref|XP_010095580.1|  UDP-glycosyltransferase 74F2                       167   5e-46   Morus notabilis
ref|XP_010091337.1|  UDP-glycosyltransferase 74E2                       167   6e-46   Morus notabilis
gb|KEH25944.1|  UDP-glucosyltransferase family protein                  167   7e-46   Medicago truncatula
ref|XP_004289755.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       167   7e-46   Fragaria vesca subsp. vesca
gb|KCW57498.1|  hypothetical protein EUGRSUZ_H00263                     167   7e-46   Eucalyptus grandis [rose gum]
ref|XP_010069223.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       167   8e-46   Eucalyptus grandis [rose gum]
ref|XP_010678915.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       166   8e-46   
ref|XP_003548080.2|  PREDICTED: UDP-glycosyltransferase 74E2-like       167   9e-46   Glycine max [soybeans]
gb|KDO43525.1|  hypothetical protein CISIN_1g012194mg                   167   1e-45   Citrus sinensis [apfelsine]
gb|KCW48703.1|  hypothetical protein EUGRSUZ_K02355                     167   1e-45   Eucalyptus grandis [rose gum]
ref|XP_003632443.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       166   1e-45   Vitis vinifera
ref|XP_010242476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       166   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_009783231.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       166   2e-45   Nicotiana sylvestris
ref|XP_010069220.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       166   2e-45   Eucalyptus grandis [rose gum]
ref|XP_006469356.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       166   2e-45   Citrus sinensis [apfelsine]
ref|XP_010037081.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       166   2e-45   Eucalyptus grandis [rose gum]
ref|XP_006447932.1|  hypothetical protein CICLE_v10015140mg             166   2e-45   Citrus clementina [clementine]
gb|KCW49321.1|  hypothetical protein EUGRSUZ_K02875                     165   2e-45   Eucalyptus grandis [rose gum]
ref|XP_002529823.1|  UDP-glucosyltransferase, putative                  166   3e-45   Ricinus communis
ref|XP_010039151.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       165   3e-45   
gb|KJB10815.1|  hypothetical protein B456_001G226500                    165   3e-45   Gossypium raimondii
ref|XP_002278455.1|  PREDICTED: UDP-glycosyltransferase 74F2            165   3e-45   Vitis vinifera
gb|KCW48704.1|  hypothetical protein EUGRSUZ_K02355                     165   4e-45   Eucalyptus grandis [rose gum]
ref|XP_010095579.1|  UDP-glycosyltransferase 74E2                       165   4e-45   
ref|XP_010025874.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       165   4e-45   
gb|AFJ52953.1|  UDP-glycosyltransferase 1                               165   5e-45   Linum usitatissimum
ref|XP_004287163.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       166   5e-45   Fragaria vesca subsp. vesca
ref|XP_010037080.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       165   5e-45   Eucalyptus grandis [rose gum]
ref|XP_010037079.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       164   6e-45   Eucalyptus grandis [rose gum]
gb|AIE12489.1|  UGT9                                                    164   6e-45   Panax ginseng [Asiatic ginseng]
ref|XP_010069222.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       165   6e-45   Eucalyptus grandis [rose gum]
ref|XP_002269003.2|  PREDICTED: UDP-glycosyltransferase 74E2            164   6e-45   Vitis vinifera
gb|AFJ52952.1|  UDP-glycosyltransferase 1                               164   7e-45   Linum usitatissimum
emb|CDP16417.1|  unnamed protein product                                163   7e-45   Coffea canephora [robusta coffee]
emb|CDP21774.1|  unnamed protein product                                162   7e-45   Coffea canephora [robusta coffee]
ref|XP_009335348.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       164   9e-45   Pyrus x bretschneideri [bai li]
ref|XP_007033641.1|  Uridine diphosphate glycosyltransferase 74E2...    164   1e-44   
ref|XP_007033375.1|  Uridine diphosphate glycosyltransferase 74E2...    163   1e-44   
ref|XP_010069226.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       164   2e-44   Eucalyptus grandis [rose gum]
ref|XP_007045533.1|  UDP-xylose phenolic glycosyltransferase, put...    163   2e-44   
ref|XP_002320558.1|  putative glucosyltransferase family protein        163   2e-44   Populus trichocarpa [western balsam poplar]
emb|CAN69453.1|  hypothetical protein VITISV_002845                     162   3e-44   Vitis vinifera
emb|CDP03926.1|  unnamed protein product                                162   3e-44   Coffea canephora [robusta coffee]
gb|KDP45201.1|  hypothetical protein JCGZ_15066                         162   4e-44   Jatropha curcas
gb|EYU17621.1|  hypothetical protein MIMGU_mgv1a006158mg                162   5e-44   Erythranthe guttata [common monkey flower]
ref|XP_011002911.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    162   6e-44   Populus euphratica
ref|XP_011002910.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    162   6e-44   Populus euphratica
emb|CBI33059.3|  unnamed protein product                                161   6e-44   Vitis vinifera
emb|CDP03995.1|  unnamed protein product                                162   6e-44   Coffea canephora [robusta coffee]
ref|XP_004292062.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       162   6e-44   Fragaria vesca subsp. vesca
ref|XP_002529822.1|  UDP-glucosyltransferase, putative                  162   6e-44   Ricinus communis
ref|XP_002532443.1|  UDP-glucosyltransferase, putative                  160   8e-44   
emb|CDP13106.1|  unnamed protein product                                163   1e-43   Coffea canephora [robusta coffee]
ref|XP_008235866.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       161   1e-43   Prunus mume [ume]
ref|XP_006447928.1|  hypothetical protein CICLE_v10017682mg             161   1e-43   Citrus clementina [clementine]
ref|XP_010908661.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       161   1e-43   Elaeis guineensis
ref|XP_009783230.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       161   1e-43   Nicotiana sylvestris
ref|XP_006357097.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       158   2e-43   Solanum tuberosum [potatoes]
emb|CDP13108.1|  unnamed protein product                                160   2e-43   Coffea canephora [robusta coffee]
emb|CDP08070.1|  unnamed protein product                                159   2e-43   Coffea canephora [robusta coffee]
emb|CDP13110.1|  unnamed protein product                                160   2e-43   Coffea canephora [robusta coffee]
ref|XP_010069228.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       160   3e-43   Eucalyptus grandis [rose gum]
ref|XP_010069225.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       160   3e-43   
ref|XP_011082054.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       160   3e-43   Sesamum indicum [beniseed]
gb|KCW57503.1|  hypothetical protein EUGRSUZ_H00275                     160   3e-43   Eucalyptus grandis [rose gum]
ref|XP_011079130.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       160   4e-43   Sesamum indicum [beniseed]
gb|AFJ52951.1|  UDP-glycosyltransferase 1                               159   4e-43   Linum usitatissimum
emb|CDP03994.1|  unnamed protein product                                159   4e-43   Coffea canephora [robusta coffee]
ref|XP_010069229.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    160   4e-43   
ref|XP_006447926.1|  hypothetical protein CICLE_v10015147mg             159   5e-43   Citrus clementina [clementine]
ref|XP_010069224.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       159   5e-43   
ref|XP_011082052.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       159   6e-43   Sesamum indicum [beniseed]
ref|XP_002529825.1|  UDP-glucosyltransferase, putative                  159   6e-43   
ref|XP_006447930.1|  hypothetical protein CICLE_v10015149mg             159   7e-43   Citrus clementina [clementine]
gb|KCW57502.1|  hypothetical protein EUGRSUZ_H00273                     159   7e-43   Eucalyptus grandis [rose gum]
gb|AGD95005.1|  lignan glucosyltransferase                              159   8e-43   Linum usitatissimum
ref|XP_007201501.1|  hypothetical protein PRUPE_ppa016883mg             159   8e-43   
gb|AFJ52958.1|  UDP-glycosyltransferase 1                               159   8e-43   Linum usitatissimum
gb|EYU17634.1|  hypothetical protein MIMGU_mgv1a006216mg                159   9e-43   Erythranthe guttata [common monkey flower]
ref|XP_006469357.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       159   1e-42   Citrus sinensis [apfelsine]
ref|XP_006370131.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    159   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011082053.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       158   1e-42   Sesamum indicum [beniseed]
ref|XP_006351615.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       158   1e-42   Solanum tuberosum [potatoes]
ref|XP_004244486.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       158   1e-42   
gb|KCW57495.1|  hypothetical protein EUGRSUZ_H00261                     158   1e-42   Eucalyptus grandis [rose gum]
gb|KFK44472.1|  hypothetical protein AALP_AA1G260900                    158   1e-42   Arabis alpina [alpine rockcress]
ref|XP_009630995.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       158   2e-42   Nicotiana tomentosiformis
ref|XP_002532442.1|  UDP-glucosyltransferase, putative                  158   2e-42   Ricinus communis
ref|XP_010042371.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       155   2e-42   
ref|XP_006357048.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       157   2e-42   Solanum tuberosum [potatoes]
ref|XP_006469355.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       157   2e-42   Citrus sinensis [apfelsine]
ref|XP_011002951.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    158   3e-42   Populus euphratica
gb|KDO43523.1|  hypothetical protein CISIN_1g012277mg                   157   3e-42   Citrus sinensis [apfelsine]
gb|KHN13207.1|  UDP-glycosyltransferase 74E1                            157   3e-42   Glycine soja [wild soybean]
ref|XP_003543857.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       157   3e-42   Glycine max [soybeans]
ref|XP_007049526.1|  UDP-xylose phenolic glycosyltransferase, put...    157   3e-42   Theobroma cacao [chocolate]
ref|XP_010101352.1|  UDP-glycosyltransferase 74E2                       159   3e-42   
ref|XP_006357100.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       157   5e-42   Solanum tuberosum [potatoes]
ref|XP_006357098.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       156   6e-42   Solanum tuberosum [potatoes]
gb|KDO37942.1|  hypothetical protein CISIN_1g048393mg                   155   7e-42   Citrus sinensis [apfelsine]
gb|KJB60859.1|  hypothetical protein B456_009G328300                    155   7e-42   Gossypium raimondii
ref|XP_003624251.1|  UDP-glucose glucosyltransferase                    156   9e-42   Medicago truncatula
gb|KGN58388.1|  hypothetical protein Csa_3G636370                       155   9e-42   
ref|XP_006469358.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    156   1e-41   
ref|XP_004245060.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       156   1e-41   Solanum lycopersicum
ref|XP_008460408.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       155   1e-41   Cucumis melo [Oriental melon]
emb|CAN67249.1|  hypothetical protein VITISV_008684                     155   1e-41   Vitis vinifera
ref|XP_006307446.1|  hypothetical protein CARUB_v10009070mg             155   1e-41   Capsella rubella
gb|KDP45197.1|  hypothetical protein JCGZ_15062                         155   1e-41   Jatropha curcas
ref|XP_007201692.1|  hypothetical protein PRUPE_ppa016444mg             155   1e-41   Prunus persica
ref|XP_004162644.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       155   1e-41   
ref|XP_003632087.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       155   2e-41   Vitis vinifera
ref|XP_008233915.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       155   2e-41   
ref|XP_004144461.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       155   2e-41   
ref|NP_001274852.1|  UDP-glycosyltransferase 74E2-like                  155   2e-41   Solanum tuberosum [potatoes]
ref|XP_010679010.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    155   2e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009599369.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    155   2e-41   
ref|XP_003624252.1|  UDP-glucosyltransferase, putative                  154   3e-41   Medicago truncatula
ref|XP_006357101.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       155   3e-41   
dbj|BAG80541.1|  UDP-glucose:glucosyltransferase                        155   3e-41   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_009783229.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       154   3e-41   Nicotiana sylvestris
gb|KHN45525.1|  UDP-glycosyltransferase 74E2                            154   4e-41   Glycine soja [wild soybean]
ref|XP_009630994.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       154   4e-41   Nicotiana tomentosiformis
gb|KDP45202.1|  hypothetical protein JCGZ_15067                         154   4e-41   Jatropha curcas
ref|XP_010321783.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       154   4e-41   Solanum lycopersicum
ref|XP_007033644.1|  Uridine diphosphate glycosyltransferase 74E2       155   5e-41   
ref|XP_006388126.1|  hypothetical protein POPTR_0322s00200g             154   5e-41   
gb|KDO41311.1|  hypothetical protein CISIN_1g038830mg                   151   6e-41   Citrus sinensis [apfelsine]
ref|XP_003554595.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       154   6e-41   Glycine max [soybeans]
ref|XP_009776061.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       154   6e-41   Nicotiana sylvestris
ref|XP_008235865.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       154   7e-41   Prunus mume [ume]
emb|CAN70002.1|  hypothetical protein VITISV_033171                     154   7e-41   Vitis vinifera
gb|ACU19612.1|  unknown                                                 154   7e-41   Glycine max [soybeans]
ref|XP_006372895.1|  hypothetical protein POPTR_0017s06080g             151   7e-41   
ref|XP_007151254.1|  hypothetical protein PHAVU_004G031100g             153   8e-41   Phaseolus vulgaris [French bean]
ref|XP_011082055.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       154   8e-41   Sesamum indicum [beniseed]
emb|CBI24721.3|  unnamed protein product                                155   9e-41   Vitis vinifera
gb|KEH25946.1|  UDP-glucosyltransferase family protein                  153   1e-40   Medicago truncatula
ref|XP_011085046.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       153   1e-40   Sesamum indicum [beniseed]
ref|XP_006447933.1|  hypothetical protein CICLE_v10015155mg             153   1e-40   Citrus clementina [clementine]
emb|CDP06918.1|  unnamed protein product                                153   1e-40   Coffea canephora [robusta coffee]
ref|XP_004244485.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       153   1e-40   
gb|AGZ84547.1|  glycosyltransferase KGT18                               153   1e-40   Pueraria montana var. lobata [kudzu]
gb|KDO43524.1|  hypothetical protein CISIN_1g012277mg                   153   1e-40   Citrus sinensis [apfelsine]
gb|AGU14135.1|  UDP-glycosyltransferase                                 152   1e-40   Cicer arietinum [garbanzo]
ref|XP_006447240.1|  hypothetical protein CICLE_v10015138mg             153   1e-40   Citrus clementina [clementine]
ref|XP_003554601.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       152   2e-40   Glycine max [soybeans]
ref|XP_004493042.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       152   2e-40   
ref|XP_007133505.1|  hypothetical protein PHAVU_011G184600g             152   2e-40   Phaseolus vulgaris [French bean]
gb|KDP35132.1|  hypothetical protein JCGZ_10666                         152   2e-40   Jatropha curcas
ref|NP_001234680.1|  UDP-xylose phenolic glycosyltransferase            152   2e-40   
ref|XP_004493041.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       152   3e-40   Cicer arietinum [garbanzo]
ref|XP_008236255.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       152   4e-40   Prunus mume [ume]
gb|KDO43526.1|  hypothetical protein CISIN_1g0406122mg                  146   4e-40   Citrus sinensis [apfelsine]
ref|XP_007033645.1|  UDP-glucosyltransferase 74F2, putative             151   4e-40   
ref|XP_008235864.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       151   4e-40   Prunus mume [ume]
dbj|BAG80538.1|  UDP-glucose:glucosyltransferase                        151   4e-40   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_006342416.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       151   4e-40   
gb|ABK96547.1|  unknown                                                 151   5e-40   Populus trichocarpa x Populus deltoides
gb|KCW57957.1|  hypothetical protein EUGRSUZ_H00691                     151   5e-40   Eucalyptus grandis [rose gum]
emb|CAN68287.1|  hypothetical protein VITISV_017016                     151   5e-40   Vitis vinifera
ref|XP_002529824.1|  UDP-glucosyltransferase, putative                  151   6e-40   Ricinus communis
ref|XP_006447931.1|  hypothetical protein CICLE_v10015145mg             151   7e-40   Citrus clementina [clementine]
ref|XP_010679007.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       151   7e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009590532.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       151   7e-40   Nicotiana tomentosiformis
ref|XP_002309737.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    150   7e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010522243.1|  PREDICTED: UDP-glycosyltransferase 74E2            150   8e-40   Tarenaya hassleriana [spider flower]
ref|XP_007201011.1|  hypothetical protein PRUPE_ppa005386mg             151   8e-40   
ref|XP_011037065.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       150   8e-40   Populus euphratica
ref|XP_010679006.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       150   1e-39   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI24722.3|  unnamed protein product                                150   1e-39   Vitis vinifera
ref|XP_004166473.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    149   1e-39   
emb|CBI24715.3|  unnamed protein product                                149   1e-39   Vitis vinifera
ref|XP_008236256.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       150   1e-39   Prunus mume [ume]
ref|XP_009613938.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       150   1e-39   Nicotiana tomentosiformis
ref|XP_003624250.1|  UDP-glucose glucosyltransferase                    150   2e-39   Medicago truncatula
ref|XP_007222137.1|  hypothetical protein PRUPE_ppa005722mg             150   2e-39   Prunus persica
ref|XP_004309287.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       147   2e-39   Fragaria vesca subsp. vesca
ref|XP_009776895.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       149   2e-39   Nicotiana sylvestris
ref|XP_009410732.1|  PREDICTED: crocetin glucosyltransferase 2-like     150   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK31187.1|  hypothetical protein AALP_AA6G079800                    150   2e-39   Arabis alpina [alpine rockcress]
ref|XP_008243112.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       150   2e-39   Prunus mume [ume]
ref|XP_010672476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    149   2e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007137294.1|  hypothetical protein PHAVU_009G115200g             149   2e-39   Phaseolus vulgaris [French bean]
ref|XP_006372897.1|  putative glucosyltransferase family protein        149   2e-39   
ref|XP_004140238.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       149   4e-39   
ref|XP_007199830.1|  hypothetical protein PRUPE_ppa005475mg             149   4e-39   Prunus persica
gb|KHN13206.1|  UDP-glycosyltransferase 74F1                            149   4e-39   Glycine soja [wild soybean]
ref|XP_003543858.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       149   4e-39   Glycine max [soybeans]
gb|ACB59204.1|  glucosyltransferase                                     149   4e-39   Brassica oleracea
gb|KDP35128.1|  hypothetical protein JCGZ_10662                         149   4e-39   Jatropha curcas
ref|XP_006478567.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       148   5e-39   
ref|XP_008236257.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       149   5e-39   
ref|XP_010542772.1|  PREDICTED: UDP-glycosyltransferase 74D1            148   5e-39   
ref|XP_008243111.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       149   5e-39   
ref|XP_010457662.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       148   6e-39   
ref|XP_011037069.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       148   6e-39   
ref|XP_011047643.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       148   6e-39   
gb|AAL09350.1|  thiohydroximate S-glucosyltransferase                   148   6e-39   
ref|XP_006442124.1|  hypothetical protein CICLE_v10023826mg             148   7e-39   
ref|XP_006858835.1|  hypothetical protein AMTR_s00066p00178850          148   7e-39   
gb|KHN09954.1|  UDP-glycosyltransferase 74E1                            148   7e-39   
ref|XP_010672480.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       148   7e-39   
emb|CDP08071.1|  unnamed protein product                                148   8e-39   
ref|XP_003541519.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       148   8e-39   
emb|CDY60796.1|  BnaC05g50780D                                          148   9e-39   
emb|CDP08069.1|  unnamed protein product                                147   9e-39   
ref|XP_007222164.1|  hypothetical protein PRUPE_ppa005780mg             147   1e-38   
gb|AAZ15016.1|  thiohydroximate S-glucosyltransferase                   148   1e-38   
ref|XP_009115475.1|  PREDICTED: UDP-glycosyltransferase 74B1            148   1e-38   
emb|CBI24719.3|  unnamed protein product                                147   1e-38   
gb|AJA79079.1|  UDP-glycosyltransferase                                 145   1e-38   
ref|XP_010485192.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       147   1e-38   
gb|KDP35129.1|  hypothetical protein JCGZ_10663                         147   2e-38   
ref|XP_010475277.1|  PREDICTED: UDP-glycosyltransferase 74E2            147   2e-38   
ref|XP_007033647.1|  UDP-glycosyltransferase 74 F1, putative            147   2e-38   
gb|EYU20869.1|  hypothetical protein MIMGU_mgv1a005301mg                147   2e-38   
ref|XP_007151237.1|  hypothetical protein PHAVU_004G029500g             147   2e-38   
gb|AFJ52954.1|  UDP-glycosyltransferase 1                               147   2e-38   
emb|CDY15551.1|  BnaA08g28350D                                          145   2e-38   
ref|XP_010672475.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    147   2e-38   
ref|XP_006416029.1|  hypothetical protein EUTSA_v10007574mg             147   3e-38   
gb|KEH25950.1|  UDP-glucosyltransferase family protein                  146   3e-38   
ref|XP_006294187.1|  hypothetical protein CARUB_v10023181mg             146   3e-38   
ref|XP_004244487.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    146   3e-38   
ref|XP_006357047.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       146   3e-38   
gb|KJB27754.1|  hypothetical protein B456_005G007900                    146   3e-38   
ref|XP_007151178.1|  hypothetical protein PHAVU_004G024500g             146   4e-38   
ref|XP_002275194.2|  PREDICTED: UDP-glycosyltransferase 74E2            147   5e-38   
gb|AFK35372.1|  unknown                                                 144   5e-38   
ref|XP_006442123.1|  hypothetical protein CICLE_v10020092mg             145   7e-38   
ref|XP_006410305.1|  hypothetical protein EUTSA_v10016638mg             145   8e-38   
gb|KJB27756.1|  hypothetical protein B456_005G008100                    145   8e-38   
ref|XP_004253028.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       145   8e-38   
ref|XP_010498931.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       145   8e-38   
ref|XP_006307470.1|  hypothetical protein CARUB_v10009096mg             145   9e-38   
ref|XP_009141176.1|  PREDICTED: UDP-glycosyltransferase 74D1            145   9e-38   
ref|XP_009111039.1|  PREDICTED: UDP-glycosyltransferase 74E2            145   1e-37   
emb|CDY70064.1|  BnaC08g46320D                                          144   1e-37   
ref|XP_002892308.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    145   1e-37   
ref|XP_006478564.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       144   1e-37   
dbj|BAG80543.1|  UDP-glucose:glucosyltransferase                        144   1e-37   
emb|CDY10139.1|  BnaC05g03820D                                          144   1e-37   
ref|XP_009119126.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       144   1e-37   
emb|CDY16245.1|  BnaA09g29790D                                          145   1e-37   
ref|XP_006344123.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       144   1e-37   
emb|CDY64375.1|  BnaCnng43810D                                          145   1e-37   
ref|XP_008449397.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       145   2e-37   
ref|XP_006478556.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    144   2e-37   
ref|XP_006478555.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    144   2e-37   
ref|XP_008449394.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       144   2e-37   
ref|XP_010469679.1|  PREDICTED: UDP-glycosyltransferase 74D1            144   2e-37   
ref|XP_002879339.1|  hypothetical protein ARALYDRAFT_482098             144   2e-37   
gb|ADW54462.1|  UDP-glucose glucosyl transferase                        144   2e-37   
ref|XP_006417998.1|  hypothetical protein EUTSA_v10007603mg             144   2e-37   
emb|CAN68288.1|  hypothetical protein VITISV_017017                     147   3e-37   
ref|XP_010101353.1|  UDP-glycosyltransferase 74F2                       144   3e-37   
gb|KJB27755.1|  hypothetical protein B456_005G008000                    144   3e-37   
ref|NP_180734.1|  UDP-glucosyl transferase 74D1                         144   3e-37   
ref|XP_010414087.1|  PREDICTED: UDP-glycosyltransferase 74D1-like       144   3e-37   
gb|ACM09899.2|  glycosyltransferase                                     144   3e-37   
gb|AAM61249.1|  putative glucosyltransferase                            144   3e-37   
ref|XP_008233916.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       144   3e-37   
gb|KFK44473.1|  hypothetical protein AALP_AA1G261000                    144   4e-37   
ref|XP_010522253.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       143   4e-37   
ref|XP_004162653.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       141   4e-37   
ref|NP_172059.1|  Uridine diphosphate glycosyltransferase 74E2          143   4e-37   
emb|CDP13109.1|  unnamed protein product                                141   4e-37   
emb|CDP08068.1|  unnamed protein product                                143   4e-37   
gb|KGN47941.1|  hypothetical protein Csa_6G418410                       143   5e-37   
ref|XP_007199135.1|  hypothetical protein PRUPE_ppa019481mg             140   5e-37   
ref|XP_002529826.1|  UDP-glucosyltransferase, putative                  143   5e-37   
ref|XP_007203876.1|  hypothetical protein PRUPE_ppa005294mg             143   6e-37   
ref|XP_010101354.1|  UDP-glycosyltransferase 74F2                       142   6e-37   
ref|XP_010510162.1|  PREDICTED: UDP-glycosyltransferase 74D1-like       143   7e-37   
gb|KDO40364.1|  hypothetical protein CISIN_1g022744mg                   140   7e-37   
ref|XP_004166474.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       143   7e-37   
ref|XP_010101355.1|  UDP-glycosyltransferase 74F2                       143   7e-37   
ref|XP_008449393.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       143   8e-37   
ref|XP_010672479.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       142   8e-37   
ref|NP_001184915.1|  UDP-Glycosyltransferase superfamily protein        142   8e-37   
gb|AFJ52955.1|  UDP-glycosyltransferase 1                               142   8e-37   
ref|XP_002309739.1|  putative glucosyltransferase family protein        142   1e-36   
emb|CDX79437.1|  BnaC03g17730D                                          142   1e-36   
ref|XP_008384038.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       142   1e-36   
dbj|BAG80534.1|  putative glycosyltransferase                           142   1e-36   
gb|KJB72400.1|  hypothetical protein B456_011G176600                    138   1e-36   
ref|XP_010557055.1|  PREDICTED: UDP-glycosyltransferase 74C1            142   1e-36   
ref|XP_008788244.1|  PREDICTED: crocetin glucosyltransferase 2-li...    142   1e-36   
ref|XP_006304660.1|  hypothetical protein CARUB_v10011842mg             141   2e-36   
ref|XP_006858827.1|  hypothetical protein AMTR_s00066p00177000          142   2e-36   
ref|XP_010477734.1|  PREDICTED: UDP-glycosyltransferase 74B1            142   2e-36   
ref|XP_008788243.1|  PREDICTED: crocetin glucosyltransferase 2-li...    142   2e-36   
ref|XP_010672483.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       141   2e-36   
ref|XP_004140240.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       142   2e-36   
ref|XP_010242509.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       141   2e-36   
ref|NP_173820.1|  UDP-glucosyl transferase 74B1                         141   2e-36   
gb|ABB88578.1|  UDP-glucosyltransferase                                 141   2e-36   
gb|AIT15666.1|  UDP-glycosyltransferase                                 140   2e-36   
ref|XP_004144399.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       141   3e-36   
ref|XP_009366234.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       141   3e-36   
ref|XP_004253027.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       141   3e-36   
ref|XP_010069571.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       141   3e-36   
ref|XP_010100517.1|  UDP-glycosyltransferase 74F2                       137   3e-36   
ref|XP_004504205.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       141   3e-36   
gb|AEM42999.1|  UDP-glucosyltransferase                                 140   4e-36   
ref|XP_009132814.1|  PREDICTED: UDP-glycosyltransferase 74D1            140   4e-36   
ref|XP_002893325.1|  UDP-glucosyl transferase 74B1                      140   5e-36   
gb|AFJ52956.1|  UDP-glycosyltransferase 1                               140   5e-36   
emb|CAF04380.1|  glycosyltransferase                                    137   7e-36   
emb|CDY51326.1|  BnaA10g03470D                                          140   7e-36   
ref|XP_010457690.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       140   7e-36   
gb|KFK37203.1|  hypothetical protein AALP_AA4G227600                    140   7e-36   
gb|EYU17631.1|  hypothetical protein MIMGU_mgv1a006064mg                140   7e-36   
gb|AAD30619.1|AC007153_11  similar to indole-3-acetate beta-gluco...    143   8e-36   
gb|EMS63606.1|  UDP-glycosyltransferase 74F2                            141   8e-36   
gb|KFK42906.1|  hypothetical protein AALP_AA1G053600                    140   9e-36   
ref|XP_009383146.1|  PREDICTED: crocetin glucosyltransferase 2-like     139   1e-35   
ref|XP_007151253.1|  hypothetical protein PHAVU_004G031000g             139   1e-35   
ref|XP_011100878.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       139   1e-35   
ref|XP_002306205.2|  putative glucosyltransferase family protein        139   1e-35   
ref|XP_002310479.2|  putative glucosyltransferase family protein        139   2e-35   
ref|XP_011047630.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       138   2e-35   
ref|XP_003552471.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       139   2e-35   
emb|CAF04389.1|  glycosyltransferase                                    136   2e-35   
emb|CAF04387.1|  glycosyltransferase                                    136   2e-35   
ref|XP_008237299.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       139   2e-35   
gb|KHN40516.1|  UDP-glycosyltransferase 74E1                            138   2e-35   
emb|CAF04385.1|  glycosyltransferase                                    135   3e-35   
emb|CAF04379.1|  glycosyltransferase                                    135   3e-35   
emb|CAF04404.1|  glycosyltransferase                                    135   3e-35   
emb|CAF04403.1|  glycosyltransferase                                    135   3e-35   
ref|XP_009142974.1|  PREDICTED: UDP-glycosyltransferase 74F2            138   3e-35   
ref|XP_002892307.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    142   3e-35   
gb|KDP35130.1|  hypothetical protein JCGZ_10664                         138   3e-35   
ref|XP_010475279.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    137   4e-35   
emb|CAF04397.1|  glycosyltransferase                                    135   5e-35   
emb|CAF04402.1|  glycosyltransferase                                    135   5e-35   
gb|KDO35889.1|  hypothetical protein CISIN_1g042896mg                   133   5e-35   
emb|CAF04399.1|  glycosyltransferase                                    135   5e-35   
ref|XP_010475278.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    137   6e-35   
gb|KHN40518.1|  UDP-glycosyltransferase 74F1                            137   8e-35   
emb|CAF04391.1|  glycosyltransferase                                    134   8e-35   
gb|KDO82600.1|  hypothetical protein CISIN_1g036105mg                   132   8e-35   
emb|CAF04400.1|  glycosyltransferase                                    134   9e-35   
ref|XP_008455265.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    137   1e-34   
ref|XP_010469678.1|  PREDICTED: UDP-glycosyltransferase 74C1-like       137   1e-34   
ref|XP_007151246.1|  hypothetical protein PHAVU_004G030400g             136   1e-34   
emb|CAF04373.1|  glycosyltransferase                                    134   1e-34   
ref|XP_006858826.1|  hypothetical protein AMTR_s00066p00176700          137   1e-34   
emb|CAF04374.1|  glycosyltransferase                                    134   1e-34   
emb|CAF04375.1|  glycosyltransferase                                    134   1e-34   
emb|CBI33056.3|  unnamed protein product                                135   1e-34   
gb|ACU22885.1|  unknown                                                 135   2e-34   
ref|XP_010414084.1|  PREDICTED: UDP-glycosyltransferase 74C1            136   2e-34   
ref|XP_010510154.1|  PREDICTED: UDP-glycosyltransferase 74C1-like       136   2e-34   
ref|XP_011047632.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       136   2e-34   
ref|XP_002879343.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    136   2e-34   
ref|NP_181910.1|  UDP-glucosyltransferase 74F2                          135   2e-34   
gb|AFK43317.1|  unknown                                                 135   3e-34   
ref|XP_003624245.1|  UDP-glucosyltransferase, putative                  135   3e-34   
ref|XP_003629941.1|  UDP-glucose glucosyltransferase                    135   3e-34   
gb|AGI44003.1|  UDP-glucose glucosyltransferase                         135   3e-34   
gb|ACR10263.1|  UDP-glucosyl transferase 74c1                           135   3e-34   
ref|XP_006342417.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       135   4e-34   
emb|CBI24724.3|  unnamed protein product                                134   4e-34   
emb|CDY17908.1|  BnaC04g03110D                                          135   5e-34   
gb|KFK31183.1|  hypothetical protein AALP_AA6G079400                    135   5e-34   
ref|XP_006342195.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       134   6e-34   
ref|NP_180738.1|  UDP-glycosyltransferase 74C1                          134   7e-34   
ref|XP_004144268.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       134   7e-34   
ref|XP_010524193.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       134   8e-34   
ref|XP_002532449.1|  UDP-glucosyltransferase, putative                  129   8e-34   
ref|XP_002880070.1|  UDP-glucosyltransferase 74F2                       134   9e-34   
ref|XP_009141182.1|  PREDICTED: UDP-glycosyltransferase 74C1-like       134   9e-34   
gb|EYU17628.1|  hypothetical protein MIMGU_mgv1a020645mg                134   9e-34   
emb|CDY19104.1|  BnaA04g18440D                                          134   9e-34   
emb|CAF04386.1|  glycosyltransferase                                    132   1e-33   
ref|XP_010460183.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       134   1e-33   
ref|XP_007208259.1|  hypothetical protein PRUPE_ppa016486mg             134   1e-33   
ref|XP_002275387.2|  PREDICTED: UDP-glycosyltransferase 74E1-like       134   1e-33   
gb|ABP49574.1|  UDP-glucose glucosyltransferase                         134   1e-33   
ref|XP_006397555.1|  hypothetical protein EUTSA_v10001440mg             134   1e-33   
ref|XP_011047629.1|  PREDICTED: UDP-glycosyltransferase 74E1-like...    132   1e-33   
ref|XP_010069575.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       133   2e-33   
ref|XP_006858838.1|  hypothetical protein AMTR_s00066p00179760          133   2e-33   
ref|XP_008445481.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       133   2e-33   
ref|XP_009133642.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       132   3e-33   
ref|XP_011047628.1|  PREDICTED: UDP-glycosyltransferase 74E1-like...    133   3e-33   
emb|CAN67248.1|  hypothetical protein VITISV_008683                     132   3e-33   
ref|XP_004144267.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       132   4e-33   
emb|CDX95572.1|  BnaC03g24530D                                          131   4e-33   
ref|XP_010069572.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       132   4e-33   
emb|CDY64613.1|  BnaAnng19430D                                          132   5e-33   
ref|XP_003531287.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       132   6e-33   
emb|CBI23328.3|  unnamed protein product                                128   6e-33   
ref|XP_008445485.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       131   8e-33   
ref|XP_006410308.1|  hypothetical protein EUTSA_v10016636mg             131   9e-33   
emb|CDY34513.1|  BnaC04g12860D                                          131   9e-33   
ref|XP_004144190.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       131   9e-33   
ref|XP_009144048.1|  PREDICTED: UDP-glycosyltransferase 74C1            131   1e-32   
gb|EYU41208.1|  hypothetical protein MIMGU_mgv1a025741mg                131   1e-32   
ref|XP_006295749.1|  hypothetical protein CARUB_v10024869mg             131   1e-32   
gb|AAZ32904.1|  putative glucosyltransferase                            127   1e-32   
emb|CDX83456.1|  BnaA03g20500D                                          131   1e-32   
ref|XP_007159561.1|  hypothetical protein PHAVU_002G247700g             131   1e-32   
ref|XP_006294206.1|  hypothetical protein CARUB_v10023202mg             130   1e-32   
ref|XP_006588331.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       130   2e-32   
ref|XP_006296149.1|  hypothetical protein CARUB_v10025301mg             130   3e-32   
emb|CAN80193.1|  hypothetical protein VITISV_017236                     133   4e-32   
ref|XP_006296254.1|  hypothetical protein CARUB_v10025420mg             129   4e-32   
ref|XP_006397556.1|  hypothetical protein EUTSA_v10001441mg             129   4e-32   



>ref|XP_006355935.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Solanum tuberosum]
Length=458

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDVA++HG++GA+FFTNSA VCAVFAHIH G+  LPV+IEEN   L+         
Sbjct  114  FPWALDVAKKHGIYGASFFTNSAMVCAVFAHIHHGTFSLPVKIEENEPLLLPGLPCLYPN  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P FI  P+SYPAYLAMKM QFSNV NADWIF N++QELE E+  GVSK WPAKLIGP
Sbjct  174  -DVPGFIKEPESYPAYLAMKMSQFSNVENADWIFDNSFQELEGEIARGVSKFWPAKLIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS YLDGRIE DKGYGASLWKPL EECL WLK+KP QSV+YISFGSMVSL
Sbjct  233  MVPSLYLDGRIENDKGYGASLWKPLSEECLNWLKTKPKQSVIYISFGSMVSL  284



>dbj|BAG80546.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=493

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWAL VA++HG++GAAFFTNSA VCAVFAHIH G+  LPV IEEN   L+LPG+P LY 
Sbjct  113  FPWALHVAKQHGIYGAAFFTNSATVCAVFAHIHQGTFSLPVRIEEN-EPLLLPGLPSLYP  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P FI  P+SYPAYLAMKM QFSNV NADWIF N++QELE E+  GVS +WPAKLIGP
Sbjct  172  LDVPGFIRDPESYPAYLAMKMSQFSNVENADWIFDNSFQELEGEIARGVSNLWPAKLIGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPSSYLDGRIEGDKGYGASLWKPL EECLKWLK+KP QSV+YISFGSMV+L
Sbjct  232  MVPSSYLDGRIEGDKGYGASLWKPLSEECLKWLKTKPIQSVIYISFGSMVAL  283



>ref|XP_009797699.1| PREDICTED: UDP-glycosyltransferase 74B1 [Nicotiana sylvestris]
Length=463

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 147/172 (85%), Gaps = 1/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++HG++GAAFFTNSA VC VFAHIH  +  LP +IEEN   L+LPG+P LY 
Sbjct  113  LPWALDVAKKHGIYGAAFFTNSATVCVVFAHIHYKTFSLPAKIEEN-EPLLLPGLPSLYP  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P FI  P+SYPAYLAMKM QFSN+ NADW+F N++QELE E+ +GVS +WPA+LIGP
Sbjct  172  IDVPGFIREPESYPAYLAMKMSQFSNLENADWVFDNSFQELEGEIASGVSNIWPARLIGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPSSYLD RIEGDKGYGASLWKPL EECLKWLK+KPNQSV+YISFGSMVSL
Sbjct  232  MVPSSYLDNRIEGDKGYGASLWKPLSEECLKWLKTKPNQSVIYISFGSMVSL  283



>ref|XP_006355936.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Solanum tuberosum]
Length=469

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WALDVA++HG++GA+FFTNSA VCAVFAHIH G+  LPV+IEEN   L+LPG+P LY  D
Sbjct  115  WALDVAKKHGIYGASFFTNSATVCAVFAHIHHGTFSLPVKIEEN-EPLLLPGLPCLYPID  173

Query  189  IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMV  368
            +P FI  P+SYPAYLAMKM QFSN+ NADWIF N++QELE E+  G+SK WPAKLIGPMV
Sbjct  174  VPGFIREPESYPAYLAMKMSQFSNLENADWIFDNSFQELEGEIARGISKFWPAKLIGPMV  233

Query  369  PSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            PSSYLDGRIE DKGYGASLWKPL EECL WLK+KP QSV+YISFGSMVSL
Sbjct  234  PSSYLDGRIENDKGYGASLWKPLSEECLNWLKTKPKQSVIYISFGSMVSL  283



>ref|XP_009590752.1| PREDICTED: UDP-glycosyltransferase 74B1 [Nicotiana tomentosiformis]
Length=463

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 147/172 (85%), Gaps = 1/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++HG+ GAAFFTNSA VCAVFAHIH  +  LP +IEEN   L+LPG+P LY 
Sbjct  113  LPWALDVAKKHGIDGAAFFTNSATVCAVFAHIHYKTFSLPAKIEEN-EPLLLPGLPCLYP  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P FI  P+SYPAYLAMKM QFSNV NADWIF N++QELE E+   VS++WPA+LIGP
Sbjct  172  IDVPGFIREPESYPAYLAMKMSQFSNVENADWIFDNSFQELEGEIAREVSEIWPARLIGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPSSYLDGRIEGDKGYGASLW+PL EECLKWLK+KP++SV+YISFGSMVSL
Sbjct  232  MVPSSYLDGRIEGDKGYGASLWEPLSEECLKWLKTKPSKSVIYISFGSMVSL  283



>gb|KDP21298.1| hypothetical protein JCGZ_21769 [Jatropha curcas]
Length=462

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR+HG++GA+FFTNSA+V  +F  +H G L LP+E E     LVLPGIPPL  
Sbjct  113  LPWALDVARQHGIYGASFFTNSASVSHIFCRLHHGLLTLPLEPE--NMPLVLPGIPPLNY  170

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P+F+  PDSYPAYLAMK+ QFS++  ADWIFANT+++LES+   G+SK+WPAKLIGP
Sbjct  171  CDLPTFLRYPDSYPAYLAMKLNQFSDLDTADWIFANTFEDLESKEAGGISKLWPAKLIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS YLDGRIEGDKGYGASLWKPLGEECL+WL++K  QSVVYISFGSMVSL
Sbjct  231  MVPSFYLDGRIEGDKGYGASLWKPLGEECLRWLETKQPQSVVYISFGSMVSL  282



>gb|AFK36738.1| unknown [Medicago truncatula]
Length=466

 Score =   248 bits (634),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 143/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++H ++GAAFFTNSAAVC +F  IH G +E PV+       L++PG+PPL  
Sbjct  117  LPWALDVAKQHRIYGAAFFTNSAAVCNIFCRIHHGLIETPVD----ELPLIVPGLPPLNS  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI  P+SYPAY+AMK+ QFSN+  ADW+F NT++ LE+EVV G+++V+PAKLIGP
Sbjct  173  RDLPSFIRFPESYPAYMAMKLNQFSNLNQADWMFVNTFEALEAEVVKGLTEVFPAKLIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDGRI+GDKGYGA+LWKPL E+C+ WL +KP+QSVVYISFGSMVSL
Sbjct  233  MVPSAYLDGRIKGDKGYGANLWKPLSEDCINWLNAKPSQSVVYISFGSMVSL  284



>emb|CDP00213.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   247 bits (631),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 139/166 (84%), Gaps = 2/166 (1%)
 Frame = +3

Query  21   VARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPDIPSF  200
            ++++HG++GA+FFTNS AVCA+F HIH GSL LPV+ E+    L LPG+P L  PD+PSF
Sbjct  93   ISKQHGIYGASFFTNSVAVCAIFCHIHHGSLALPVKQED--VPLQLPGLPALNSPDMPSF  150

Query  201  ITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMVPSSY  380
            I AP+SYPAYLAMKM Q+SN+  ADWIF N+++ELE E    VS++WPAKLIGPMVPS+Y
Sbjct  151  IKAPESYPAYLAMKMSQYSNLEKADWIFNNSFEELEGEAAKSVSELWPAKLIGPMVPSAY  210

Query  381  LDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            LDGRIEGD+GYGASLWKPL E C++WLK KP +SVVYISFGSMVSL
Sbjct  211  LDGRIEGDRGYGASLWKPLSEHCIRWLKMKPQKSVVYISFGSMVSL  256



>ref|XP_003517852.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Glycine max]
Length=465

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPW LDVA++HG++GAAFFTNSAAVC +F  +H G ++LPV++E     L +PG+PPL  
Sbjct  115  FPWVLDVAKQHGIYGAAFFTNSAAVCNIFCRLHHGFIQLPVKMEH--LPLRVPGLPPLDS  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
              +PSF+  P+SYPAY+AMK+ QFSN+ NADW+F NT++ LESEV+ G+++++PAK+IGP
Sbjct  173  RALPSFVRFPESYPAYMAMKLSQFSNLNNADWMFVNTFEALESEVLKGLTELFPAKMIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS YLDGRI+GDKGYGASLWKPL EEC  WL+SKP QSVVYISFGSMVSL
Sbjct  233  MVPSGYLDGRIKGDKGYGASLWKPLTEECSNWLESKPPQSVVYISFGSMVSL  284



>ref|XP_003613351.1| N-hydroxythioamide S-beta-glucosyltransferase [Medicago truncatula]
 gb|AES96309.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 143/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++H ++GAAFFTNSAAVC +F  IH G +E PV+       L++PG+PPL  
Sbjct  117  LPWALDVAKQHRIYGAAFFTNSAAVCNIFCRIHHGLIETPVD----ELPLIVPGLPPLNS  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI  P+SYPAY+AMK+ QFSN+  ADW+F NT++ LE+EVV G+++++PAKLIGP
Sbjct  173  RDLPSFIRFPESYPAYMAMKLNQFSNLNQADWMFVNTFEALEAEVVKGLTEMFPAKLIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDGRI+GDKGYGA+LWKPL E+C+ WL +KP+QSVVYISFGSMVSL
Sbjct  233  MVPSAYLDGRIKGDKGYGANLWKPLSEDCINWLNAKPSQSVVYISFGSMVSL  284



>ref|XP_002520220.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF42275.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=471

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 143/172 (83%), Gaps = 1/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR+HG+ GA FFTNSAAV ++F  +H G L LP+++E +   L+    P  Y 
Sbjct  114  LPWALDVARQHGIFGAPFFTNSAAVSSIFCRLHHGFLSLPLDVEGDKPLLLPGLPPLYYS  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P+F+  P+SYPAYLAMK+ QFSN+  ADWIFANT++ELES+VV GVSK+WPAKLIGP
Sbjct  174  -DLPTFLKIPESYPAYLAMKLNQFSNLDMADWIFANTFEELESKVVGGVSKLWPAKLIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPSSYLDGRI+GDKGYGASLWKPLGEECLKWL++K  QSVVYISFGSMVSL
Sbjct  233  MVPSSYLDGRIDGDKGYGASLWKPLGEECLKWLETKQPQSVVYISFGSMVSL  284



>gb|AES96307.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=501

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++HG++GAAFFTNSAAVC +F  IH G +E+PV+       LV+P +PPL  
Sbjct  115  LPWALDVAKQHGIYGAAFFTNSAAVCNIFCRIHHGLIEIPVD----ELPLVVPDLPPLNS  170

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI  P+SYPAY+AMK+ QFSN+  ADW+F NT++ LE EVV G+++++PAK+IGP
Sbjct  171  RDLPSFIRFPESYPAYMAMKLSQFSNLDQADWMFVNTFEALEGEVVKGLTELFPAKMIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDGRI+GDKGYGA+LWKPL E C+ WL SKP+QSVVYISFGSMVSL
Sbjct  231  MVPSAYLDGRIKGDKGYGANLWKPLSEYCINWLNSKPSQSVVYISFGSMVSL  282



>ref|XP_007044514.1| UDP-glucosyl transferase 74B1 [Theobroma cacao]
 gb|EOY00346.1| UDP-glucosyl transferase 74B1 [Theobroma cacao]
Length=462

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++HG++GA FFTNSA VC++F+HIH G L LP+  E     + LPG+PPL  
Sbjct  113  LPWALDVAKQHGIYGAPFFTNSATVCSIFSHIHRGLLPLPLMPE--STPVKLPGLPPLNY  170

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
            PD+P+F+  PDSYPAYLAMK+ Q+SN+  ADWIF NT+++LE +   GVS++WPAKLIGP
Sbjct  171  PDLPTFLRFPDSYPAYLAMKLSQYSNLDEADWIFDNTFEDLEGKEARGVSEIWPAKLIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD RI+GD+GYG+SLWKPL EEC++WL++KP QSVVY SFGSMVSL
Sbjct  231  MVPSAYLDERIKGDRGYGSSLWKPLSEECMEWLETKPFQSVVYASFGSMVSL  282



>ref|XP_007157504.1| hypothetical protein PHAVU_002G075200g [Phaseolus vulgaris]
 gb|ESW29498.1| hypothetical protein PHAVU_002G075200g [Phaseolus vulgaris]
Length=465

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDVA+ HGV+GAAFFTNSAAVC++F  IH G +ELPV  E+    L +PG+PPL  
Sbjct  115  FPWALDVAKEHGVYGAAFFTNSAAVCSIFCRIHRGLIELPVGAED--LPLRVPGLPPLES  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
              +PSF+  P SYPAY+AMK+ QFSN+  ADW+F NT++ LES+VV G+++++PAK+IGP
Sbjct  173  RALPSFVRFPQSYPAYMAMKLSQFSNLDEADWMFVNTFEALESQVVEGLTELFPAKMIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDGRI+GDKGYGASLWKPL EEC  WL+ K  QSVVYISFGSMVSL
Sbjct  233  MVPSAYLDGRIKGDKGYGASLWKPLNEECSTWLEEKAPQSVVYISFGSMVSL  284



>ref|XP_003613349.1| UDP-glucose glucosyltransferase [Medicago truncatula]
Length=627

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++HG++GAAFFTNSAAVC +F  IH G +E+PV+       LV+P +PPL  
Sbjct  115  LPWALDVAKQHGIYGAAFFTNSAAVCNIFCRIHHGLIEIPVD----ELPLVVPDLPPLNS  170

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI  P+SYPAY+AMK+ QFSN+  ADW+F NT++ LE EVV G+++++PAK+IGP
Sbjct  171  RDLPSFIRFPESYPAYMAMKLSQFSNLDQADWMFVNTFEALEGEVVKGLTELFPAKMIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDGRI+GDKGYGA+LWKPL E C+ WL SKP+QSVVYISFGSMVSL
Sbjct  231  MVPSAYLDGRIKGDKGYGANLWKPLSEYCINWLNSKPSQSVVYISFGSMVSL  282



>gb|EYU29695.1| hypothetical protein MIMGU_mgv1a006214mg [Erythranthe guttata]
Length=452

 Score =   241 bits (614),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR HGV GA+FFTNSAAVCA+F+HIH G+L LPV+ +E    L    +PPL  
Sbjct  109  LPWALDVAREHGVLGASFFTNSAAVCAIFSHIHGGALSLPVDAKEKPLVLPG--LPPLNS  166

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P F+ AP+SYPAYLAMKM QFSN+  AD++FANT+QELES+    V+K WPAKLIGP
Sbjct  167  CDLPGFLRAPESYPAYLAMKMSQFSNLEKADFVFANTFQELESQEARSVAKTWPAKLIGP  226

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPSSYLDGRIEGDKGYGASLWKPL  +C +WL++KP +SV+YISFGSMVSL
Sbjct  227  MVPSSYLDGRIEGDKGYGASLWKPLSNQCREWLQNKPPKSVIYISFGSMVSL  278



>ref|XP_011086491.1| PREDICTED: UDP-glycosyltransferase 74B1 [Sesamum indicum]
Length=458

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++HG+ GA+FFTNSA VCAVF+HIH G+L LPV++E     L    +PPLY 
Sbjct  109  LPWALDVAKQHGIFGASFFTNSATVCAVFSHIHRGTLTLPVKMEHEPLLLPG--LPPLYD  166

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             DIP FI  P+SYPAYLAMKM QF N+  AD++F N++QELE +    V K WPAKLIGP
Sbjct  167  CDIPGFIKVPESYPAYLAMKMNQFLNLDKADFVFDNSFQELEGQEATSVEKWWPAKLIGP  226

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDGRIEGDKGYGASLWKPL E+C  WLK+KP +SV+YISFGSMVSL
Sbjct  227  MVPSAYLDGRIEGDKGYGASLWKPLSEQCTSWLKTKPQESVIYISFGSMVSL  278



>ref|XP_006484310.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Citrus sinensis]
Length=525

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+ +G++GAAFFTNSA VC +F  +H G L LPV++E+    L +PG+P L  
Sbjct  155  LPWALDVAKEYGLYGAAFFTNSATVCNIFCRMHHGLLTLPVKLED--TPLSIPGLPSLNF  212

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P+F+  P+SYPAYLAMK+ Q+SN+  ADWIF NT+QELE E    +S++WP KLIGP
Sbjct  213  IDLPTFVKFPESYPAYLAMKLGQYSNLDKADWIFGNTFQELEGEGARSISELWPGKLIGP  272

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDGRI+GD GYG+SLW+PL EEC +WL++KP QSVVYISFGSMVSL
Sbjct  273  MVPSAYLDGRIKGDSGYGSSLWQPLSEECSEWLETKPQQSVVYISFGSMVSL  324



>ref|XP_003519432.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Glycine max]
Length=457

 Score =   235 bits (600),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDVA+++G++GAAFFTNSAAVC +F  IH G L+LPV+ E+    L          
Sbjct  115  FPWALDVAKQNGLYGAAFFTNSAAVCNIFCRIHHGFLQLPVKTEDLPLRLPGLPPLD--S  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
              +PSF+  P+SYPAY+AMK+ QFSN+ NADWIF NT+Q LESEVV G+++++PAK+IGP
Sbjct  173  RSLPSFVKFPESYPAYMAMKLSQFSNLNNADWIFVNTFQALESEVVKGLTELFPAKMIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPSSYLDGRI+GDKGYGASLWKPL EEC  WL++K  QSVVYISFGSMVSL
Sbjct  233  MVPSSYLDGRIKGDKGYGASLWKPLAEECSNWLEAKAPQSVVYISFGSMVSL  284



>gb|KJB61182.1| hypothetical protein B456_009G344800 [Gossypium raimondii]
Length=461

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++HG++GAAFFTNSA VC++FAHIH G L LP+  E     L          
Sbjct  113  LPWALDVAKQHGIYGAAFFTNSATVCSIFAHIHHGLLTLPLTPETTPLLLPGLPPLYFP-  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+  PDSYPAYLAMK+ Q+SN+  ADW+F+NT++ELE +   GVS++WPAKLIGP
Sbjct  172  -DLPSFLRFPDSYPAYLAMKLSQYSNLNQADWVFSNTFEELEGKEARGVSEIWPAKLIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD RI+GD+GYG+SLWKPL EEC++WL++KP+ SVVY+SFGSMVSL
Sbjct  231  MVPSAYLDERIKGDRGYGSSLWKPLSEECIEWLETKPSNSVVYVSFGSMVSL  282



>gb|KHN28671.1| UDP-glycosyltransferase 74B1 [Glycine soja]
Length=457

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDVA+++G++GAAFFTNSAAVC +F  IH G L+LPV+ E+    L          
Sbjct  115  FPWALDVAKQNGLYGAAFFTNSAAVCNIFCRIHHGFLQLPVKTEDLPLRLPGLPPLD--S  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
              +PSF+  P+SYPAY+AMK+ QFSN+ NADW+F NT+Q LESEVV G+++++PAK+IGP
Sbjct  173  RSLPSFVKFPESYPAYMAMKLSQFSNLNNADWMFVNTFQALESEVVKGLTELFPAKMIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPSSYLDGRI+GDKGYGASLWKPL EEC  WL++K  QSVVYISFGSMVSL
Sbjct  233  MVPSSYLDGRIKGDKGYGASLWKPLAEECSNWLEAKAPQSVVYISFGSMVSL  284



>ref|XP_007224980.1| hypothetical protein PRUPE_ppa020679mg [Prunus persica]
 gb|EMJ26179.1| hypothetical protein PRUPE_ppa020679mg [Prunus persica]
Length=470

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++  ++GA+FFTNSA VC++F  IH G L LP ++E+    L +PG+PPL  
Sbjct  115  LPWALDVAKKRRIYGASFFTNSATVCSIFCRIHHGLLSLPCKLED--MPLFVPGLPPLNF  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
            PD+P+F+  PDSYPAYL MK+ QF ++  ADW+F NT++ LE +   G+SK++  KLIGP
Sbjct  173  PDLPTFLKKPDSYPAYLKMKLNQFPDLDRADWVFVNTFEALEGQAANGLSKLFSGKLIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDG+I GD+GYGASLWKPLGEEC KWL++KP +SVVY+SFGSMVSL
Sbjct  233  MVPSAYLDGQITGDRGYGASLWKPLGEECTKWLEAKPPKSVVYVSFGSMVSL  284



>ref|XP_006438479.1| hypothetical protein CICLE_v10031201mg [Citrus clementina]
 gb|ESR51719.1| hypothetical protein CICLE_v10031201mg [Citrus clementina]
Length=533

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+ +G++GA FFTNSA VC +F  +H G L LPV++E+    L +PG+P L  
Sbjct  163  LPWALDVAKEYGLYGATFFTNSATVCNIFCRMHHGLLTLPVKLED--TPLSIPGLPSLNF  220

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P+F+  P+SYPAYLAMK+ Q+SN+  ADWIF NT+QELE E    +S++WP KLIGP
Sbjct  221  IDLPTFVKFPESYPAYLAMKLGQYSNLDKADWIFGNTFQELEGEEARSISELWPGKLIGP  280

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDGRI+GD GYG+SLW+PL EEC +WL++KP QSVVYISF SMVSL
Sbjct  281  MVPSAYLDGRIKGDSGYGSSLWQPLSEECSEWLETKPQQSVVYISFASMVSL  332



>ref|XP_010695870.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Beta vulgaris subsp. 
vulgaris]
Length=480

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 140/172 (81%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+ +G+ GAAFFTNSA+VCA+FA +  G + LP+E ++   AL  P +P   G
Sbjct  129  LPWALDVAKEYGLLGAAFFTNSASVCAIFACVSRGLINLPLEPDQVKCAL--PKMPLFKG  186

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P+F+  P+SYPAYLAMK+ QF+N+  AD++F N++Q+LESEV+ GV+  WPAKLIGP
Sbjct  187  NDLPTFLRKPESYPAYLAMKLSQFTNLHLADYVFCNSFQDLESEVIEGVTDKWPAKLIGP  246

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDGRIEGD GYG+SLWKPL E+C +WL+SKP +SV+YISFGSMVSL
Sbjct  247  MVPSAYLDGRIEGDIGYGSSLWKPLSEKCKEWLQSKPTKSVIYISFGSMVSL  298



>ref|XP_010043823.1| PREDICTED: UDP-glycosyltransferase 74B1 [Eucalyptus grandis]
 gb|KCW85820.1| hypothetical protein EUGRSUZ_B02563 [Eucalyptus grandis]
Length=464

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 135/172 (78%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWAL+VA++HG++GAAFFTNS  +  +F  +HCG L+LP+E  +   AL++PG+PPL  
Sbjct  115  FPWALNVAKQHGIYGAAFFTNSVTISNIFYRLHCGLLKLPLEFHDE--ALLVPGLPPLNS  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+ +P +YPAYLAMK+RQF+N   ADWIF N+++ LE E    +S +WPAKLIGP
Sbjct  173  RDLPSFLQSPGTYPAYLAMKLRQFTNTDKADWIFGNSFEALECEEAKSISDLWPAKLIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD RI+ D  YGASLWKPL  EC  WL++KP +SVVY+SFGSM+SL
Sbjct  233  MVPSAYLDCRIDKDDTYGASLWKPLNIECANWLETKPPKSVVYVSFGSMISL  284



>gb|KJB15210.1| hypothetical protein B456_002G164900 [Gossypium raimondii]
Length=459

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++HG++GA+FFTNSAAVC++F+ IH G L LP+  E     L          
Sbjct  113  LPWALDVAKQHGIYGASFFTNSAAVCSIFSRIHHGRLALPLTPESKPLMLPGLPPLNFR-  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P+F+  PDSYPAYLAMK+ Q+SN+  ADW+F NT+++LE +V  GVS++W AKLIGP
Sbjct  172  -DLPTFLRFPDSYPAYLAMKLSQYSNLNEADWVFDNTFEDLEGKVSKGVSELWQAKLIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD RI+GD+GYG+SLWKPL EEC++WL++KP+QSVVYISFGSMVSL
Sbjct  231  MVPSAYLDERIKGDRGYGSSLWKPLSEECMEWLETKPSQSVVYISFGSMVSL  282



>gb|KHG30812.1| hypothetical protein F383_15387 [Gossypium arboreum]
Length=487

 Score =   230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++HG++GAAFFTNSA VC++FAHIH G L LP+  E     L          
Sbjct  139  LPWALDVAKQHGIYGAAFFTNSATVCSIFAHIHHGLLTLPLTPETTPLLLPGLPPLNFP-  197

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+  PDSYPAYLAMK+ Q+S +  ADW+F+NT++ELE +   GVS++WPAKLIGP
Sbjct  198  -DLPSFLGFPDSYPAYLAMKLSQYSTLNQADWVFSNTFEELEGKEARGVSEIWPAKLIGP  256

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD RI+GD+GYG+SLWKPL EEC++WL++KP+ SV+Y+SFGSM+SL
Sbjct  257  MVPSAYLDERIKGDRGYGSSLWKPLSEECIEWLETKPSNSVIYVSFGSMISL  308



>gb|KJB15209.1| hypothetical protein B456_002G164900 [Gossypium raimondii]
Length=459

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++HG++GA+FFTNSAAVC++F+ IH G L LP+  E     L          
Sbjct  113  LPWALDVAKQHGIYGASFFTNSAAVCSIFSRIHHGRLALPLTPESKPLMLPGLPPLNFR-  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P+F+  PDSYPAYLAMK+ Q+SN+  ADW+F NT+++LE +   GVS++W AKLIGP
Sbjct  172  -DLPTFLRFPDSYPAYLAMKLSQYSNLNEADWVFDNTFEDLEGKEAKGVSELWQAKLIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD RI+GD+GYG+SLWKPL EEC++WL++KP+QSVVYISFGSMVSL
Sbjct  231  MVPSAYLDERIKGDRGYGSSLWKPLSEECMEWLETKPSQSVVYISFGSMVSL  282



>ref|XP_010692817.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Beta vulgaris subsp. 
vulgaris]
Length=485

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+ +G+ GAAFFTNSA+VCA+F+ +  G + LP++ ++   AL  P +P   G
Sbjct  134  LPWALDVAKEYGLLGAAFFTNSASVCAIFSCVSRGLINLPLKPDQVRCAL--PKMPLFKG  191

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+  P+SYPAYLAMK+ QF+N+  AD++F N++Q+LESEV+ GV   WPAKLIGP
Sbjct  192  NDLPSFLRKPESYPAYLAMKLSQFTNLHLADYVFCNSFQDLESEVIEGVIDKWPAKLIGP  251

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPSSYLDGRIEGD  YG+SLWKPL E+C +WL+SKP +SV+YISFGSMVSL
Sbjct  252  MVPSSYLDGRIEGDISYGSSLWKPLSEKCKEWLQSKPTKSVIYISFGSMVSL  303



>gb|AFJ52950.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=462

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 131/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+++GV+GAAFFTNSAAVC +F  +  G + L +  +E G  L  PG+P L  
Sbjct  116  LPWALDVAKQYGVYGAAFFTNSAAVCGIFCRVSRGEVALEMAAKEGG--LDFPGLPSLGL  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+  P+SYP YL MK+ Q+SN+   DWIF N++QELES+    V + WPAKLIGP
Sbjct  174  SDLPSFLRFPESYPTYLGMKLCQYSNLEEVDWIFCNSFQELESKEAGSVKEHWPAKLIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPSSYLD RIEGD GYGASLWKPL +EC KWL++KP +SV +ISFGSMVSL
Sbjct  234  MVPSSYLDSRIEGDNGYGASLWKPLNDECTKWLEAKPAESVAFISFGSMVSL  285



>emb|CAN74227.1| hypothetical protein VITISV_041748 [Vitis vinifera]
Length=448

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR HG+HGAAFFTNSA VCA+F  IH G L LPV++E+    L          
Sbjct  100  LPWALDVAREHGIHGAAFFTNSATVCAIFCRIHHGLLTLPVKLEDTPLLLPGLPPLNFP-  158

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P+F+  P+SYPAYL MK+ Q+SN+   DW+  N+++ELE E    +S++WP  L+GP
Sbjct  159  -DLPTFVKFPESYPAYLTMKLSQYSNLDKVDWVIGNSFEELEGEAAKSISELWPGMLVGP  217

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDGRI+GDKGYGASLWKPL ++C+KWL++K  QSVVY+SFGSMVSL
Sbjct  218  MVPSAYLDGRIDGDKGYGASLWKPLSDKCIKWLETKAPQSVVYVSFGSMVSL  269



>ref|XP_004297667.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Fragaria vesca 
subsp. vesca]
Length=467

 Score =   225 bits (573),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+ HG++GA+FFTNSA+VC++  HIH G + LP  +E+   +L       +  
Sbjct  114  LPWALDVAKEHGIYGASFFTNSASVCSILLHIHHGLISLPFSLEDIPLSLPGLPPLDI--  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P  +  PDS PAYL M+M Q+SN+  ADWIFANT+Q LES+ V GV K+WPAKLIGP
Sbjct  172  ADLPGMLKKPDSNPAYLRMQMNQYSNLSKADWIFANTFQALESDAVKGVEKLWPAKLIGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            M+PS+YLDG+I+GD+GYGASLWKPLGEEC+ WL +K  +SVVY+SFGSMVSL
Sbjct  232  MIPSAYLDGQIKGDRGYGASLWKPLGEECINWLVAKAPKSVVYVSFGSMVSL  283



>ref|XP_002267665.1| PREDICTED: UDP-glycosyltransferase 74B1 [Vitis vinifera]
Length=458

 Score =   225 bits (573),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWAL+VAR HG+HGAAFFTNSA VCA+F  IH G L LPV++E+    L          
Sbjct  110  LPWALNVAREHGIHGAAFFTNSATVCAIFCRIHHGLLTLPVKLEDTPLLLPGLPPLNFP-  168

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P+F+  P+SYPAYL MK+ Q+SN+ N DW+  N+++ELE E    +S++WP  L+GP
Sbjct  169  -DLPTFVKFPESYPAYLTMKLSQYSNLDNVDWVIGNSFEELEGEAAKSISELWPGMLVGP  227

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDGRI+GDKGYGASLWKPL ++C+KWL+ K  QSVVY+SFGSMVSL
Sbjct  228  MVPSAYLDGRIDGDKGYGASLWKPLSDKCIKWLEKKAPQSVVYVSFGSMVSL  279



>ref|XP_004298592.2| PREDICTED: UDP-glycosyltransferase 74B1-like [Fragaria vesca 
subsp. vesca]
Length=493

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+ HG++GA FFTNSAAVC++ + IH G L LP + ++    +       L  
Sbjct  152  LPWALDVAKEHGIYGATFFTNSAAVCSIVSQIHHGLLSLPFKPQDMPLLIPGLPPLNLV-  210

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PS +  PDS+PAYL MK+ Q+SN+  ADWIF NT+Q LE E   GV+K+WPAKLIGP
Sbjct  211  -DLPSMLQKPDSHPAYLKMKLNQYSNLDQADWIFGNTFQALEGEAAKGVAKLWPAKLIGP  269

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDG+I+GD+GYGASLWKPLGEEC  WL +K  +SVVY+SFGSMVSL
Sbjct  270  MVPSAYLDGQIKGDRGYGASLWKPLGEECTNWLDTKAPKSVVYVSFGSMVSL  321



>ref|XP_008361795.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Malus domestica]
Length=465

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++HGV+GA+FFTNSA VC +F+HIH G + LP ++E+    L++PG+PPL  
Sbjct  110  LPWALDVAKKHGVYGASFFTNSATVCVIFSHIHRGLISLPCKLED--MPLLVPGLPPLNL  167

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
            PD+PSF+  PDS PAYL MK+ Q+ N+  ADWIFANT++ LE E   G+S++WP KLIGP
Sbjct  168  PDLPSFLKKPDSNPAYLKMKLNQYPNLDKADWIFANTFEALEGEAARGISELWPVKLIGP  227

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDG+I+GD+GYGASLWKPLGEEC KWL+ K  +SVVY+SFGSMVSL
Sbjct  228  MVPSAYLDGKIKGDRGYGASLWKPLGEECAKWLEEKLPKSVVYVSFGSMVSL  279



>ref|XP_008245156.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Prunus mume]
Length=470

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++  ++GA+FFTNSA VC++F  IH G L LP ++E+    +          
Sbjct  115  LPWALDVAKKRRIYGASFFTNSATVCSIFYRIHHGLLSLPCKLEDMPLLVPGLPPLNF--  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
            PD+P+F+  PDSYPAYL MK+ Q+ ++  ADW+F NT++ LE +   G+SK++  KLIGP
Sbjct  173  PDLPTFLKKPDSYPAYLKMKLNQYPDLDKADWVFINTFEALEGQAANGLSKLFSGKLIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLDG+I GD+GYGASLWKPLGEEC KWL++KP +SVVY+SFGSMVSL
Sbjct  233  MVPSAYLDGQITGDRGYGASLWKPLGEECTKWLEAKPPKSVVYVSFGSMVSL  284



>ref|XP_011028616.1| PREDICTED: UDP-glycosyltransferase 74B1 [Populus euphratica]
Length=454

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR  G++ AAF T SA+VC+++  I  G L LP  +++  A + LPG+PPL  
Sbjct  111  LPWALDVARDLGIYAAAFMTTSASVCSMYWRIDLGLLSLP--LKQQTATVSLPGLPPLGC  168

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+  P S  AYL + M +F ++   DW+F N++++LE E+V  +   WP  ++GP
Sbjct  169  CDLPSFLAEPTSQTAYLEVVMEKFHSLNEDDWVFCNSFEDLEIELVRAMRGKWPLVMVGP  228

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD RI+GD+ YGASLWKP   +C  WL +KP +SV+Y+SFGSM S+
Sbjct  229  MVPSAYLDQRIDGDRAYGASLWKPTSSQCFTWLDTKPPRSVIYVSFGSMGSI  280



>ref|XP_010552631.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Tarenaya hassleriana]
Length=458

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 125/171 (73%), Gaps = 4/171 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA+++GV  AAFFTN+  +C+V A IH G L +PV+ E   A   + G+PPL  
Sbjct  116  LPWGLDVAKQNGVLAAAFFTNNITMCSVMAQIHGGQLPIPVDPET--APFRIRGLPPLNF  173

Query  183  PDIPSFITAPD-SYPAYLAMKMRQFSNVGNADWIFANTYQELES-EVVAGVSKVWPAKLI  356
             D+PSF+T    S+P +LA+ M QF N+  ADW+F N+++ LE+ E   G S+V+P KLI
Sbjct  174  SDLPSFVTKHRLSHPGHLAVLMDQFPNLEEADWLFVNSFEGLETQEDGTGESEVFPGKLI  233

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            GPMVPS+YLDGRI+ DKGYG+S WKPL  EC++WL++KP +SV ++SFGSM
Sbjct  234  GPMVPSAYLDGRIKDDKGYGSSXWKPLSTECMEWLETKPARSVAFVSFGSM  284



>gb|KDO69768.1| hypothetical protein CISIN_1g012645mg [Citrus sinensis]
Length=459

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              WALDVAR+ G++GAA  TNSA+VC+++  I+ G L LPV  E     L LPG+P L  
Sbjct  113  LTWALDVARQFGIYGAAMMTNSASVCSMYWQINHGLLTLPVNQET--VPLTLPGLPSLAS  170

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+  P S PAYLA  + QF ++   DW+  N+++ELE E++  +  +WP  +IGP
Sbjct  171  SDLPSFLAQPASNPAYLAAILEQFGSLNKNDWVLCNSFEELEKELLRAMLGLWPLVMIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +VPS+YLD +I GD  YGA++W+P G++C++WL +KP +SV+Y+SFGSM  +
Sbjct  231  LVPSAYLDQQIAGDSAYGANIWEPTGDQCMRWLATKPEKSVIYVSFGSMADI  282



>ref|XP_010552632.1| PREDICTED: UDP-glycosyltransferase 74B1 [Tarenaya hassleriana]
Length=461

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 124/174 (71%), Gaps = 4/174 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVAR  GV  AAFFTN+  VC+V +    G  E P+ ++ N A   + G+PPL  
Sbjct  116  LPWGLDVARGTGVSAAAFFTNNLTVCSVLSRFSSG--EFPLPVDPNAAPFRIRGLPPLNV  173

Query  183  PDIPSFITAPD-SYPAYLAMKMRQFSNVGNADWIFANTYQELESEV-VAGVSKVWPAKLI  356
             D+PSF+T    S+PA+  M + QF+N  NADW+F N++Q LE++   +G S+   AKLI
Sbjct  174  DDLPSFVTRHRLSHPAHRQMLLGQFTNHENADWLFVNSFQGLETQDDESGDSEAIRAKLI  233

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            GPM+PS+YLDGRI+GDKGYGASLWKPL +EC+ WL+SKP+QSV ++SFGS  ++
Sbjct  234  GPMIPSAYLDGRIKGDKGYGASLWKPLSKECMDWLESKPSQSVAFVSFGSFANV  287



>ref|XP_006476729.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Citrus sinensis]
Length=459

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              WALDVAR+ G++GAA  TNSA+VC+++  I+ G L LPV  E     L LPG+P L  
Sbjct  113  LTWALDVARQFGIYGAAMMTNSASVCSMYWQINHGLLTLPVNQET--VPLTLPGLPSLAS  170

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+  P S PAYLA  + QF ++   DW+  N+++ELE E++  +  +WP  +IGP
Sbjct  171  SDLPSFLAQPASNPAYLAAILEQFGSLNKNDWVLCNSFEELEKELLRAMLGLWPLVMIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +VPS+YLD +I GD  YGA++W+P G+ C++WL +KP +SV+Y+SFGSM  +
Sbjct  231  LVPSAYLDQQIAGDSAYGANIWEPTGDRCMRWLATKPEKSVIYVSFGSMADI  282



>ref|XP_006439748.1| hypothetical protein CICLE_v10020081mg [Citrus clementina]
 gb|ESR52988.1| hypothetical protein CICLE_v10020081mg [Citrus clementina]
Length=459

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              WALDVAR+ G++GAA  TNSA+VC+++  I+ G L LPV  E     + LPG+P L  
Sbjct  113  LTWALDVARQFGIYGAAMMTNSASVCSMYWQINHGLLTLPVNQET--VPVTLPGLPSLAS  170

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+  P S PAYLA  + QF ++   DW+  N+++ELE E++  +  +WP  +IGP
Sbjct  171  SDLPSFLAQPASNPAYLAAILEQFGSLNKNDWVLCNSFEELEKELLRAMLGLWPLVMIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +VPS+YLD +I GD  YGA++W+P G++C++WL +KP +SV+Y+SFGSM  +
Sbjct  231  LVPSAYLDQQIAGDSAYGANIWEPTGDQCMRWLATKPEKSVIYVSFGSMADI  282



>emb|CBI15081.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   184 bits (467),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW L VAR+ G++GAAF+T SA+VC+++  +  G L LPV+ E     + +PG+PPL  
Sbjct  111  LPWGLSVARQFGIYGAAFWTTSASVCSMYWQLRQGVLSLPVKQEP--VPVSMPGLPPLRL  168

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P F+  P    AY++  M Q S +   DW+F N++  LESE+V  +S +W   +IGP
Sbjct  169  SDLPDFLAQPGHLSAYMSAVMEQISTLEQNDWVFMNSFDALESELVKAMSGLWSVAMIGP  228

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD +IEGD  YGASLWKP  +ECL WL++KP +SVVYISFGSM  +
Sbjct  229  MVPSAYLDQQIEGDTVYGASLWKPTNDECLGWLETKPPKSVVYISFGSMAEI  280



>ref|XP_002321569.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|EEF05696.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=454

 Score =   185 bits (470),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR  G++ AAF T SA+VC+++  I  G L LP  +++  A + LPG+PPL  
Sbjct  111  LPWALDVARDLGIYAAAFMTTSASVCSMYWRIDLGLLSLP--LKQQTATVSLPGLPPLGC  168

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+  P S  AYL + M +F ++   DW+F N++++LE E+V  +   WP  ++GP
Sbjct  169  CDLPSFLAEPTSQTAYLEVIMEKFHSLNEDDWVFCNSFEDLEIELVKAMRGKWPLVMVGP  228

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            MVPS+YLD +I+GD+ YGASLWKP   +C  WL +KP +SV+Y+SFGSM
Sbjct  229  MVPSAYLDQQIDGDRAYGASLWKPTSSQCFTWLDTKPPRSVIYVSFGSM  277



>ref|XP_002280305.1| PREDICTED: UDP-glycosyltransferase 74B1 [Vitis vinifera]
Length=457

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW L VAR+ G++GAAF+T SA+VC+++  +  G L LPV+ E     + +PG+PPL  
Sbjct  111  LPWGLSVARQFGIYGAAFWTTSASVCSMYWQLRQGVLSLPVKQEP--VPVSMPGLPPLRL  168

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P F+  P    AY++  M Q S +   DW+F N++  LESE+V  +S +W   +IGP
Sbjct  169  SDLPDFLAQPGHLSAYMSAVMEQISTLEQNDWVFMNSFDALESELVKAMSGLWSVAMIGP  228

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD +IEGD  YGASLWKP  +ECL WL++KP +SVVYISFGSM  +
Sbjct  229  MVPSAYLDQQIEGDTVYGASLWKPTNDECLGWLETKPPKSVVYISFGSMAEI  280



>ref|XP_007036115.1| UDP-glucosyl transferase 74B1, putative [Theobroma cacao]
 gb|EOY20616.1| UDP-glucosyl transferase 74B1, putative [Theobroma cacao]
Length=456

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WA+DVA+  G+  A   TNSA+VC+++  I+ G L LP++ E   A++  PG+P L   D
Sbjct  113  WAVDVAKEFGIRAAMMLTNSASVCSLYWQINQGRLALPLDQETLAASV--PGLPSLSFSD  170

Query  189  IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMV  368
            +PSF+  P S  AYLA+ M +   +G  DW+F N+++ELESE+V  + ++WP   IGP+V
Sbjct  171  MPSFLAHPTSQSAYLALIMDKIRTLGRNDWVFCNSFEELESELVKALKELWPVITIGPLV  230

Query  369  PSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            PS YLD +IEGD  YGASLWK   ++CL+WL SKP +SVVY+SFGSM S+
Sbjct  231  PSFYLDHQIEGDTSYGASLWKQNNDQCLRWLDSKPLRSVVYVSFGSMASI  280



>gb|KHN45296.1| UDP-glycosyltransferase 74B1 [Glycine soja]
Length=335

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +3

Query  96   IHCGSLELPVEIEENGAALVLPGIPPLYGPDIPSFITAPDSYPAYLAMKMRQFSNVGNAD  275
            IH G L+LPV+ E+    L            +PSF+  P+SYPAY+AMK+ QFSN+ NAD
Sbjct  16   IHHGFLQLPVKTEDLPLRLPGLPPLD--SRSLPSFVKFPESYPAYMAMKLSQFSNLNNAD  73

Query  276  WIFANTYQELESEVVAGVSKVWPAKLIGPMVPSSYLDGRIEGDKGYGASLWKPLGEECLK  455
            W+F NT++ LESEV+ G+++++PAK+IGPMVPS YLDGRI+GDKGYGASLWKPL EEC  
Sbjct  74   WMFVNTFEALESEVLKGLTELFPAKMIGPMVPSGYLDGRIKGDKGYGASLWKPLTEECSN  133

Query  456  WLKSKPNQSVVYISFGSMVSL  518
            WL+SKP QSVVYISFGSMVSL
Sbjct  134  WLESKPPQSVVYISFGSMVSL  154



>ref|XP_004288732.1| PREDICTED: UDP-glycosyltransferase 74E1-like, partial [Fragaria 
vesca subsp. vesca]
Length=376

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 119/173 (69%), Gaps = 1/173 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALD+AR+HG+ GA FFTNSAA  A++ H   G+L++P E + +   L LP +PPL  
Sbjct  32   MPWALDIARQHGIDGAPFFTNSAAYVAIYQHFLQGALKIPSENDRSTTTLSLPSMPPLCF  91

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGV-SKVWPAKLIG  359
             D+PSF+   DSYPAYL + + Q+SN+G   W+F  T+ +LE EV+  + ++ WP + IG
Sbjct  92   DDLPSFLRDFDSYPAYLQLALSQYSNIGTLKWLFICTFHKLEEEVLEWMRNQEWPVRTIG  151

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS +LD +++ DK YG S++KP  E C++WL S+   SVVY SFGS+ SL
Sbjct  152  PTVPSMFLDKQLKDDKEYGLSMFKPNVELCMEWLDSRETSSVVYASFGSLASL  204



>dbj|BAF96588.1| anthocyanin 5-glucosyltransferase [Rosa hybrid cultivar]
Length=345

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 118/173 (68%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVARR G+ GA FFT S AV  +F H+H G+L+LP+E    G   ++P +PPL  
Sbjct  107  MPWVLDVARRQGIDGAPFFTTSCAVATIFHHVHEGTLQLPLE----GPRAIMPSMPPLEL  162

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGV-SKVWPAKLIG  359
             D+P+F++  +SYPA+L + M Q+SN+   + IF +++ +LE EV+  + S+ WP K+IG
Sbjct  163  NDLPTFLSDVESYPAFLKLAMNQYSNLNQVNCIFYSSFDKLEKEVLKWMESQDWPVKMIG  222

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R+E DK YG SL+KP  E C+KWL SK   SVVY SFGS+  L
Sbjct  223  PTIPSVFLDKRLEDDKDYGLSLFKPNVETCMKWLDSKKPGSVVYASFGSLADL  275



>gb|KJB20645.1| hypothetical protein B456_003G157800 [Gossypium raimondii]
Length=456

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 117/172 (68%), Gaps = 1/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G+  A   TNSA+VC+++ H + GSL L  + +E  AA  +PG+P L  
Sbjct  114  LPWALDVAKDFGISAAMMLTNSASVCSLYWHNNQGSLNLLAK-QETLAAPPMPGLPFLDV  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+  P S  AYLA+ +  F N    DW+F N+++ELESE+V  +   WP  +IGP
Sbjct  173  SDLPSFLAQPTSQSAYLALILDVFGNSEENDWVFCNSFEELESELVEALMAKWPVVMIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS YLD RIEGD  YGASLW    ++CLKWL SKP +SVVY+SFGSM S+
Sbjct  233  MVPSFYLDSRIEGDTSYGASLWNFDNDQCLKWLDSKPLKSVVYVSFGSMASI  284



>gb|KDP45199.1| hypothetical protein JCGZ_15064 [Jatropha curcas]
Length=469

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 114/172 (66%), Gaps = 3/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA +  +  AAFFT S AV +++ HIH   +ELPV    N   L +PG+PPL  
Sbjct  122  MPWGLDVAEKFQLFSAAFFTQSCAVDSIYYHIHKKLIELPVS---NSEILRVPGLPPLQL  178

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF++   SYPA+  M + Q SN+  ADW+F NT+ +LE EVV  ++K+WP K IGP
Sbjct  179  QDLPSFVSDFGSYPAFFDMLVDQCSNIDKADWVFCNTFYDLEKEVVDWLAKIWPFKTIGP  238

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD ++E DK YG S++KP  E C+ WL  +P  SV Y+SFGS+V L
Sbjct  239  CIPSIYLDKQLENDKDYGISIFKPNNEACMNWLSKRPKGSVAYVSFGSLVDL  290



>dbj|BAF96597.1| UDP-glucose:anthocysnin 5-O-glucosyltransferase [Rosa hybrid 
cultivar]
Length=354

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 119/172 (69%), Gaps = 1/172 (1%)
 Frame = +3

Query  6    PWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGP  185
            PWALD+AR+HG+ GA FFTNS++V A++ H   G+L++P E + +   L LP +PPL   
Sbjct  118  PWALDIARQHGIDGAPFFTNSSSVVAIYEHFLQGALKIPSENDRSTTTLSLPSMPPLGFA  177

Query  186  DIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVA-GVSKVWPAKLIGP  362
            D+PSF+   DSYPAYL + + Q+SN+G   W+F  T+++LE EVV   +++ WP + IGP
Sbjct  178  DLPSFLCDVDSYPAYLELTLSQYSNIGTLKWLFICTFEKLEEEVVKWMINQEWPVRTIGP  237

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS +L  R+E DK Y  S++KP  E  ++WL S+ + SVVY SFGS+ +L
Sbjct  238  TVPSMFLGKRLEDDKEYSLSMFKPNVETYMEWLDSRESSSVVYASFGSLANL  289



>ref|XP_007199115.1| hypothetical protein PRUPE_ppa020804mg [Prunus persica]
 gb|EMJ00314.1| hypothetical protein PRUPE_ppa020804mg [Prunus persica]
Length=463

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 116/172 (67%), Gaps = 3/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+R G+ GA FFT S AV  +++ +H G L+LP+  +   + ++LPG+P L  
Sbjct  123  LPWALDVAKRVGIAGAPFFTVSCAVTNIYSLVHNGLLKLPLNPD---SEILLPGLPTLQP  179

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D PSF+ AP+SYPA+  + M QFSN+  ADW+F +T+ ELE E V  ++K WP + IGP
Sbjct  180  SDTPSFVHAPESYPAFFKLSMEQFSNLDKADWVFYSTFYELEQEAVDWMAKFWPLRTIGP  239

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R E DK YG SL  P  + C+KWL +KP  SV Y+SFGS+  L
Sbjct  240  TIPSMYLDKRHEEDKEYGLSLLNPNSDACMKWLNAKPKGSVAYVSFGSVAKL  291



>ref|XP_010091051.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXB42069.1| UDP-glycosyltransferase [Morus notabilis]
Length=458

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR HGV  AAF TNSA+ C+++  +  G L+L     E G+ LV+PG+PPL  
Sbjct  115  LPWALDVARAHGVLCAAFMTNSASCCSLYWRVDRGGLDLE---REKGSVLVVPGVPPLGV  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             ++PSF+    +   YLA+ M +F  +   DW+F N+++ELE E+V  +  +WP +++GP
Sbjct  172  NEMPSFLNGEIAQSPYLALIMEKFKRLEENDWVFCNSFEELEGELVKAMQGLWPLQMVGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD +IEGD  YGASLWK   ++ + WL +KP  SV+Y+SFGSM  +
Sbjct  232  MVPSAYLDQQIEGDTSYGASLWKLTSDQHMTWLSTKPPNSVIYVSFGSMADI  283



>ref|XP_010242475.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nelumbo nucifera]
Length=465

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 118/174 (68%), Gaps = 6/174 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GA FFT S AV +++ H+H G L++PV    + + + +PG+PPL  
Sbjct  117  MPWALDVAKQFGLLGAPFFTQSCAVNSIYNHVHQGVLKVPV----SDSIISIPGLPPLEV  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKL--I  356
             D PS I+   SYPAY  M + QFSNV NADWI AN++ ELESEVV  ++K  P  L  I
Sbjct  173  MDRPSLISVSASYPAYTTMVLNQFSNVENADWILANSFNELESEVVEWMTKRLPTPLLTI  232

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            GP VPS YLD R+ GDK YG +L+KP    C+ WL  +  +SVVY+SFGSM +L
Sbjct  233  GPAVPSMYLDKRVAGDKDYGLNLFKPDKGSCMNWLDKRAARSVVYVSFGSMAAL  286



>emb|CBI32099.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 109/154 (71%), Gaps = 4/154 (3%)
 Frame = +3

Query  30   RHGVH--GAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPDIPSFI  203
            +H  H   +AFFTNSA VCA+F  IH G L LPV++E+    L           D+P+F+
Sbjct  95   QHTTHPINSAFFTNSATVCAIFCRIHHGLLTLPVKLEDTPLLLPGLPPLNFP--DLPTFV  152

Query  204  TAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMVPSSYL  383
              P+SYPAYL MK+ Q+SN+ N DW+  N+++ELE E    +S++WP  L+GPMVPS+YL
Sbjct  153  KFPESYPAYLTMKLSQYSNLDNVDWVIGNSFEELEGEAAKSISELWPGMLVGPMVPSAYL  212

Query  384  DGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSV  485
            DGRI+GDKGYGASLWKPL ++C+KWL+ K  QSV
Sbjct  213  DGRIDGDKGYGASLWKPLSDKCIKWLEKKAPQSV  246



>dbj|BAF96592.1| flavonoid 5-glucosyltransferase [Rosa hybrid cultivar]
Length=347

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 117/173 (68%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             P  LDVARR G+ GA FFT S AV  +F H+H G+L+LP+E    G   ++P +PPL  
Sbjct  109  MPRVLDVARRQGIDGAPFFTTSCAVATIFHHVHEGTLQLPLE----GPRAIMPSMPPLEL  164

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGV-SKVWPAKLIG  359
             D+P+F++  +SYPA+L + M Q+SN+   + IF +++ +LE EV+  + S+ WP K+IG
Sbjct  165  NDLPTFLSDVESYPAFLKLAMNQYSNLNQVNCIFYSSFDKLEKEVLKWMESQDWPVKMIG  224

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R+E DK YG SL+KP  E C+KWL SK   SVVY SFGS+  L
Sbjct  225  PTIPSVFLDKRLEDDKDYGLSLFKPNVETCMKWLDSKKPGSVVYASFGSLADL  277



>ref|XP_007049529.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
 gb|EOX93686.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
Length=459

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 112/172 (65%), Gaps = 3/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+  A FFT S AV +V+ H+  G L+LP++       + LPG+PPL  
Sbjct  118  LPWALDVAKQFGIRSAVFFTQSCAVNSVYYHVSRGLLQLPLQ---GSNVISLPGLPPLEV  174

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             ++PSF+    SYPA+L + + QFSNV  ADW+F N + ELE E V  +SK W    +GP
Sbjct  175  SELPSFVFRHGSYPAWLDVVVNQFSNVDEADWVFFNIFYELEKEAVDWMSKFWKVMTVGP  234

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS YLDGR+E DK YG +L+KP    C+ WL  KP  SVVY+SFGS  SL
Sbjct  235  TVPSLYLDGRLENDKDYGMNLFKPSTSACMSWLNGKPKSSVVYVSFGSFASL  286



>ref|XP_010037076.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW48701.1| hypothetical protein EUGRSUZ_K02352 [Eucalyptus grandis]
Length=458

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 116/172 (67%), Gaps = 5/172 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA+++G+ GA FFT S AV +VF H   G LE+PV  +     ++LPG+PPL  
Sbjct  119  LPWVLDVAQKYGLVGAVFFTMSCAVSSVFYHCQKGLLEVPVRKQ-----VLLPGMPPLEP  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PS+++ P+SYPAYL M + QFSN+   DW+  NT  ELE E+V    KV P + IGP
Sbjct  174  QDMPSYVSDPESYPAYLGMLVGQFSNLDKVDWVLCNTVYELEQELVDWFMKVMPFRTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS YLD R+E D+ YG S+++P  +  +KWL +KP  SVVY+SFGS+  L
Sbjct  234  TVPSFYLDNRLEQDREYGLSIFQPEHDTTMKWLSTKPKGSVVYVSFGSVAEL  285



>gb|KEH25943.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=457

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 112/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G+ G AFFT S +V +++ H H   +ELP+   E     +LPG+P L  
Sbjct  119  MPWALDVAKSFGLVGVAFFTQSCSVNSIYFHTHEKLIELPLTQSE----YLLPGLPKLAQ  174

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYP Y  + + QFSN+G ADWI ANT+ ELE EVV  + K+WP + IGP
Sbjct  175  GDLPSFLYKYGSYPGYFDIVVNQFSNIGKADWILANTFYELEKEVVDWMVKIWPLRTIGP  234

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS +LD R++ DK YG S+  P  E C+KWL  KP  SVVY+SFGSM  L
Sbjct  235  SIPSIFLDKRLKDDKEYGVSISDPNTEICIKWLNEKPKGSVVYVSFGSMAGL  286



>ref|XP_004296695.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 120/173 (69%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVARR G+ GA FFT S AV  VF H+H G+L+LP  +EE  A  ++P +PPL  
Sbjct  132  MPWILDVARRQGIDGAPFFTTSLAVATVFHHVHEGTLKLP--LEEPRA--IMPSMPPLEL  187

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGV-SKVWPAKLIG  359
             D+P+F++  +SYPA+L + M Q+SN+   + IF +++ +LE E++  + S+ WP K+IG
Sbjct  188  NDLPTFVSDVESYPAFLKLAMNQYSNLKKVNCIFFSSFDKLEKELLKWMESQDWPVKMIG  247

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS++LD R+E DK YG SL+KP  E C+KWL SK   SVVY SFGS+  L
Sbjct  248  PTIPSTFLDKRLEDDKDYGLSLFKPNVETCMKWLDSKKPGSVVYASFGSLADL  300



>ref|XP_010037078.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW48702.1| hypothetical protein EUGRSUZ_K02353 [Eucalyptus grandis]
Length=458

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 116/172 (67%), Gaps = 5/172 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+++G+ GA FFT S AV +VF H   G LE+PV  +     ++LPG+PPL  
Sbjct  119  LPWALDVAQKYGLVGAVFFTMSCAVSSVFYHCQKGLLEVPVRKQ-----VLLPGMPPLEP  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PS+++ P+SYPA L + + QFSN+   DW+  NT  ELE E+V    KV P + IGP
Sbjct  174  QDMPSYVSDPESYPANLGVLVGQFSNLDKVDWVLCNTVYELEQELVDWFMKVMPFRTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPSSYLD R+E D  YG S+++P  +  +KWL +KP  SVVY+SFGS+  L
Sbjct  234  TVPSSYLDNRLEQDTEYGLSIFQPEHDTTMKWLSTKPKGSVVYVSFGSVAEL  285



>ref|XP_007033374.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
1 [Theobroma cacao]
 gb|EOY04300.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
1 [Theobroma cacao]
Length=645

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+HGA+FFT S +  +++ H++ G+L++P  +EEN A + LP +P L  
Sbjct  305  LPWALDVAKQCGLHGASFFTQSWSNSSIYYHLNQGTLKVP--LEEN-AVVSLPSMPVLGI  361

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF++   SYP+ L M + +FSN   ADW+F NT++ELE EV+  ++  WP K +GP
Sbjct  362  NDLPSFVSDTGSYPSLLKMVVDRFSNFQEADWLFCNTFKELEHEVINCMASKWPIKTVGP  421

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD RI+ D  YG  L+KP  E C+KWL SK   SVVY+SFGS+  L
Sbjct  422  TIPSMYLDKRIKDDNDYGLHLFKPDSELCIKWLDSKETDSVVYVSFGSLAGL  473


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 63/109 (58%), Gaps = 5/109 (5%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWAL VA+  GV GA+FFT S AV A+F H+  G+  +P E       + LP +P L  
Sbjct  112  MPWALAVAKNFGVQGASFFTQSWAVNAIFYHLKQGTFRVPPE----EPVVSLPSMPELRL  167

Query  183  PDIPSFITAPD-SYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAG  326
             D+PSF+     SYP    +   QFSN   A+W+F NTY ELE EV+ G
Sbjct  168  SDLPSFVCDNSGSYPGLCKLVKNQFSNFEEANWVFCNTYDELEDEVMQG  216



>ref|XP_004489724.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Cicer arietinum]
 gb|AGU14099.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDV++  G+ G AFFT S +V +++ H H   +ELP+    + +  +LPG+P L+ 
Sbjct  119  LPWVLDVSKTFGLLGVAFFTQSCSVNSIYYHTHQKLIELPL----SKSDYLLPGLPKLHQ  174

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYP Y  + + QF+N+G ADWI ANT  ELE EVV  + K+WP K IGP
Sbjct  175  SDLPSFLYKYGSYPGYFDIVVNQFANIGKADWILANTIYELEPEVVDWLVKIWPLKTIGP  234

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS  LD R++ DK YG S+  P  E C+KWL  KP  SVVY+SFGSM  L
Sbjct  235  SVPSMLLDKRLKDDKEYGVSISNPNTEVCIKWLNEKPKGSVVYVSFGSMAGL  286



>ref|XP_011457820.1| PREDICTED: UDP-glycosyltransferase 74F2-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=355

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 111/171 (65%), Gaps = 4/171 (2%)
 Frame = +3

Query  6    PWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGP  185
            PW LD+A++ G+ GA FFT S AV  ++ H++ G L+LP+   E    + LPG+ PL   
Sbjct  123  PWPLDIAKKFGIVGAVFFTQSCAVDNIYNHVNKGVLKLPLTDSE----ISLPGMLPLEPL  178

Query  186  DIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            D+PSF++   SYPAY  + + QF NV  ADW+  NT+ ELE +VV  ++K WP + IGP 
Sbjct  179  DLPSFLSDFGSYPAYFEVVVGQFCNVDKADWVLCNTFYELEEQVVDWLAKFWPVRTIGPT  238

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS+YLD R++ DKGYG  L+K   + C+KWL   P  SV YISFGS   L
Sbjct  239  IPSNYLDNRLKDDKGYGVDLFKSSNDACMKWLNKHPKNSVAYISFGSAAQL  289



>gb|KEH25945.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=457

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G+ G  FFT S +V +++ H H   +ELP+   E     +LPG+P L  
Sbjct  119  MPWALDVAKNFGLLGVPFFTQSCSVNSIYFHTHQKLIELPISQSE----YLLPGLPKLAQ  174

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYP    + + QFSN+G ADWI ANT+ ELE EVV  +SK+WP K IGP
Sbjct  175  GDLPSFLYKYGSYPIIFDVVVNQFSNIGKADWILANTFYELEPEVVDWLSKIWPLKTIGP  234

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPSS+LD RI+ DK YG S+  P  E  +KWL  KP +SVVY+SFGS   L
Sbjct  235  SVPSSHLDKRIKDDKEYGVSVSDPNTESSIKWLNEKPKRSVVYVSFGSNARL  286



>ref|XP_007210590.1| hypothetical protein PRUPE_ppa016463mg [Prunus persica]
 gb|EMJ11789.1| hypothetical protein PRUPE_ppa016463mg [Prunus persica]
Length=451

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              WA+DVA++  ++GA FFTNSA+VC+++ HI  G    PV+ E     +    +PPL  
Sbjct  111  LSWAIDVAKKFNIYGAVFFTNSASVCSMYWHIIHGHQAFPVKQETEPLLMPG--LPPLAL  168

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF++ P  +  YLA+ + QFS++   DW+F N+++ELESE+V  +  +WP  +IGP
Sbjct  169  SDLPSFLSQPAPHSPYLALILEQFSSLEENDWVFCNSFEELESELVKEMLGLWPLVMIGP  228

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPSSY D  I+GD+ YGA+LWKP  ++C+KWL+ KP +SV+YISFGSM  +
Sbjct  229  MVPSSYFDQEIDGDRDYGANLWKPTTDQCMKWLEKKPPESVIYISFGSMADI  280



>gb|KDP31143.1| hypothetical protein JCGZ_11519 [Jatropha curcas]
Length=462

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 116/172 (67%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              W LDVA R  V+ A F TNSA+VC+++ H   G L+ PV+ E     +  PG+PPL  
Sbjct  112  LTWVLDVATRLRVYSALFLTNSASVCSMYWHFDKGVLDFPVKKET--LPVSFPGLPPLGF  169

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+  P ++ AYL      F  +   DW+F N++++LE E+V  ++ +WP  ++GP
Sbjct  170  FDLPSFLAFPTNHSAYLDAVFDGFHCLDETDWVFCNSFEDLEIELVKAMNGLWPVVMVGP  229

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD +I+GD  YGASLW+   ++CLKWL +KP+QSV+Y+SFGSM ++
Sbjct  230  MVPSAYLDQQIDGDTAYGASLWETETDQCLKWLDTKPSQSVIYVSFGSMANI  281



>ref|XP_004289758.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 112/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LD+A++ G+ GA FFT S AV  ++ H++ G L+LP+   E    + LPG+PPL  
Sbjct  122  MPWPLDIAKKFGIVGAVFFTQSCAVDNIYNHVNKGVLKLPLTDSE----ISLPGMPPLEP  177

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF++   SYPA+  + + QF NV  ADW+  NT+ +LE +VV  ++K WP + IGP
Sbjct  178  LDLPSFLSHFGSYPAFFEVVIGQFCNVDKADWVLCNTFYDLEEQVVDWLAKFWPVRTIGP  237

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS+YLD R++ DKGYG  L+K   + C+KWL   P  SV YISFGS   L
Sbjct  238  TIPSNYLDNRLKDDKGYGVDLFKSSNDACMKWLNKHPKNSVAYISFGSAAQL  289



>ref|XP_004299583.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Fragaria vesca 
subsp. vesca]
Length=454

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++  ++GA F TNSA+VC+++ HI+ G +  PV  +E+GA L++PG+PPL  
Sbjct  112  LPWALDVAKKFNIYGAVFLTNSASVCSMYWHINHGHMSFPV-TQESGAPLLMPGLPPLDL  170

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
            PD+PSF++ P  +  YLA+ + +FS +   DW+F N+++ELESE+V  +  +WP  +IGP
Sbjct  171  PDLPSFLSQPAPHSPYLALILEKFSRLQENDWVFCNSFEELESELVNEMLGLWPLVMIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+YLD +I+GD  YGASLW P  ++C+KWL  KP QSV+YISFGSM ++
Sbjct  231  MVPSAYLDQQIDGDIAYGASLWVPTTDKCIKWLDKKPPQSVIYISFGSMANV  282



>ref|XP_008239719.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Prunus mume]
Length=457

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              WA+DVA++  ++GA F TNSA+VC+++ HI  G    PV+ E     +    +PPL  
Sbjct  111  LSWAIDVAKKFNIYGAVFLTNSASVCSMYWHIIHGHQAFPVKQETEPLLMPG--LPPLAL  168

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P FI+ P  +  YLA+ + QFS++   DW+F N+++ELESE+V  +  +WP  +IGP
Sbjct  169  SDLPIFISQPAPHSPYLALILEQFSSLEENDWVFCNSFEELESELVKEMLGLWPLVMIGP  228

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPSSYLD  IEGD+ YGA+LWKP  ++C+KWL+ KP +SV+YISFGSM  +
Sbjct  229  MVPSSYLDQEIEGDRDYGANLWKPTTDQCMKWLEKKPPESVIYISFGSMADI  280



>ref|XP_010242477.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nelumbo nucifera]
Length=464

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDVA++ G+ GA FFT   AV  ++ H+H G L LPV        + +PG+P +  
Sbjct  117  FPWALDVAKQFGLVGAPFFTQMCAVNNIYYHVHQGLLHLPV----REPVVSIPGLPAIDI  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PS+I+ P SYPAY AM M QFSN    DWIF NT+ +LE E++  + K +P + IGP
Sbjct  173  GDMPSYISDPQSYPAYHAMIMSQFSNTEKVDWIFVNTFNKLEEEMIEWMEKRFPLRAIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD ++E D  YG  L+KP   +C+ WL  +   SVVY+SFGSM +L
Sbjct  233  TIPSMYLDKQVEDDSDYGLHLYKPDSGDCINWLNKRAEGSVVYVSFGSMAAL  284



>gb|KJB71586.1| hypothetical protein B456_011G131200 [Gossypium raimondii]
Length=454

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 110/174 (63%), Gaps = 2/174 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALV-LPGIPPLY  179
             PWALDVA++ G+ GA+FFT   AV A+F H+  GSL +P+E E  G  +V LP +P L 
Sbjct  109  MPWALDVAKQFGLQGASFFTQCWAVNAIFIHLKEGSLRVPLEDENKGNVVVSLPSMPELG  168

Query  180  GPDIPSFITAPD-SYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLI  356
              D+PSF++    SYP    +   QFSN   ADW+F NTY +LE E++  +   WP K +
Sbjct  169  MSDLPSFVSDKSGSYPCLSKLVRSQFSNFQEADWVFCNTYDKLEHEIIKWMRSKWPIKTV  228

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            GP +PS YLD R+E D  YG  L+KP  + CL WL SK   SVVY+SFGS+  L
Sbjct  229  GPTIPSMYLDKRLEDDNDYGLHLFKPDTDLCLNWLNSKEASSVVYVSFGSIADL  282



>ref|XP_007151915.1| hypothetical protein PHAVU_004G086500g [Phaseolus vulgaris]
 gb|ESW23909.1| hypothetical protein PHAVU_004G086500g [Phaseolus vulgaris]
Length=460

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 108/172 (63%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G+ GA FFT +     ++ H +   LELP+   E     +LPG+P L  
Sbjct  117  LPWALDVAKDFGLLGATFFTQTCTTNNIYFHAYKKWLELPLTQTE----YLLPGLPKLAA  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    +YP Y A+ M QF+N+  ADW+ ANT+ ELE  VV  + K+WP K IGP
Sbjct  173  GDLPSFLNKYGTYPGYFAVVMNQFANIDKADWVLANTFYELEQGVVDWLVKIWPLKPIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R++ DK YG  ++ P  E C+KWL  KP  SVVY+SFGSM  L
Sbjct  233  TLPSMYLDKRVQDDKDYGVDMYIPKSEACIKWLDDKPKGSVVYVSFGSMAGL  284



>gb|KDP35131.1| hypothetical protein JCGZ_10665 [Jatropha curcas]
Length=462

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVAR+ G  GA+FFT + AVCA++     GSL++PVE  ++  + +LP +P L  
Sbjct  111  LPWVLDVARKFGAFGASFFTQNVAVCALYYLAFDGSLKVPVE--KDKMSFLLPSLPELEF  168

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P F+  P +Y A   M   QFSN+ + DW+F NT+ ELE E+V  +++ WP K IGP
Sbjct  169  NDLPPFVNGPGAYRAIYDMVFSQFSNIDDVDWLFWNTFYELEDEIVNWMARKWPTKPIGP  228

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS +LD ++E DK YG SL+KP  + C+ WL +K   SVVYISFGS+ +L
Sbjct  229  TIPSMFLDKQLEDDKDYGLSLFKPNSDACMNWLNAKEPNSVVYISFGSLAAL  280



>ref|XP_004289756.1| PREDICTED: UDP-glycosyltransferase 74E1-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=461

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LD+A++ G+ GA FFT S AV  ++ H++ G L+LP+   E    + LPG+ PL  
Sbjct  122  MPWPLDIAKKFGIVGAVFFTQSCAVDNIYNHVNKGVLKLPLTDSE----ISLPGMLPLEP  177

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF++   SYPAY  + + QF NV  ADW+  NT+ ELE +VV  ++K WP + IGP
Sbjct  178  LDLPSFLSDFGSYPAYFEVVVGQFCNVDKADWVLCNTFYELEEQVVDWLAKFWPVRTIGP  237

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS+YLD R++ DKGYG  L+K   + C+KWL   P  SV YISFGS   L
Sbjct  238  TIPSNYLDNRLKDDKGYGVDLFKSSNDACMKWLNKHPKNSVAYISFGSAAQL  289



>ref|XP_009366994.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366995.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366996.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366997.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
Length=463

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LD A+  G+ GA+FFT+S AV AV+ ++H G L +P++       + LPG+P L  
Sbjct  117  MPWVLDTAKGLGIFGASFFTHSCAVGAVYYNVHEGLLRVPLK----EPTISLPGLPLLEP  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI  P SYP++L + + +FSN+  ADWIF NT+  LE EVV  +   WP K IGP
Sbjct  173  QDLPSFIYDPGSYPSFLNLVVSRFSNITGADWIFFNTFHGLEKEVVNWMRTQWPIKTIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E DK YG S++ P  E C KWL+SK   +VVY+SFGSM +L
Sbjct  233  TLPSMYLDKRLEDDKEYGLSVFNPNTEACNKWLESKETGTVVYVSFGSMANL  284



>ref|XP_002532451.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29937.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=458

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 115/172 (67%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW L+VA++ G++GA +FT S AV  ++ H + G +ELP++       + +PG+PPL  
Sbjct  119  LPWCLEVAKKFGIYGAVYFTQSCAVDIIYYHANQGLIELPLK----EIKISVPGLPPLQP  174

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    +YPA   M + QFSN+G ADW+  NT+ ELE E    ++K+WP + IGP
Sbjct  175  QDLPSFLYQFGTYPAAFEMLVDQFSNIGKADWVLCNTFYELEYEAADWLAKLWPLRTIGP  234

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD +++ D+ YG +++KP  + C+ WLK KP  SVVY+SFGS+ +L
Sbjct  235  TIPSMYLDKQLQDDRDYGFNIFKPNDDACMNWLKDKPKGSVVYVSFGSLATL  286



>ref|XP_009625439.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana tomentosiformis]
Length=456

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 118/173 (68%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELP-VEIEENGAALVLPGIPPLY  179
             PWA++VA+++G+  AAFFT S AV  ++ H+H G L+LP  E++E    + +PG+  + 
Sbjct  112  LPWAVEVAKKYGLASAAFFTQSCAVDNIYYHVHNGVLKLPPTEVDEE---ISIPGLVTIE  168

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF++ P+S  A L M + QFSN+ N DW+  N++ ELE EV+  +SK++P K IG
Sbjct  169  SSDVPSFVSTPESARA-LEMLVNQFSNLENIDWVLINSFYELEKEVIDWMSKLYPIKTIG  227

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SVVY+SFGS+  L
Sbjct  228  PTIPSIYLDKRLPDDKEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLTKL  280



>dbj|BAO51836.1| UDP-glycosyltransferase 74Y1 [Camellia sinensis]
Length=463

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 116/173 (67%), Gaps = 2/173 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALD+A + G+ GA FFT    VCA++ H+H G  ++P++++++G  + LP +P +  
Sbjct  118  IPWALDIAHKFGLRGACFFTQPCGVCAIYYHLHEGEFKVPLDLDQSGV-VSLPALPGIGF  176

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVS-KVWPAKLIG  359
             D+PSF++   SYP  L + + QFSN   ADWI  NT+ +LE ++V  ++ +    K IG
Sbjct  177  DDMPSFVSDMGSYPVMLGLLVNQFSNFRKADWILFNTFDKLEEQIVKWMAIQRSSIKTIG  236

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R+E DK YG SL+KP  E+C+KWL +KP  SVVY SFGS+ SL
Sbjct  237  PAIPSKFLDKRLEDDKDYGLSLFKPSVEDCMKWLDTKPKASVVYASFGSLASL  289



>ref|XP_004290110.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
Length=468

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 111/174 (64%), Gaps = 3/174 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PW LDVA+R G+ GA FFT S AV  ++ ++  G L++P   +E    LV PG+  PL 
Sbjct  117  MPWPLDVAKRFGIVGATFFTQSCAVDNIYYNVQQGLLKVPPSTDEADEILV-PGVRVPLR  175

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWP-AKLI  356
              D+PSF++ P  YPA+L M + QFSNV  ADWIF NT+ ELE E    +SK WP  + I
Sbjct  176  ASDMPSFVSVPSQYPAFLRMVVDQFSNVDKADWIFCNTFYELEVEEADWMSKFWPLLRTI  235

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            GP +PS YLD R E DK YG SL+KP  + CLKWL  +   SV Y+SFGS+  L
Sbjct  236  GPTIPSMYLDKRHEDDKEYGYSLFKPNSDACLKWLNERQKGSVAYVSFGSLAEL  289



>gb|KCW57500.1| hypothetical protein EUGRSUZ_H00268 [Eucalyptus grandis]
Length=389

 Score =   168 bits (425),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 108/172 (63%), Gaps = 2/172 (1%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEE-NGAALVLPGIPPLYGP  185
            WALD+A +HG+HGA FFT S  VC  +  IH G ++LP+E     G  +  P +  + GP
Sbjct  42   WALDIAIQHGMHGAPFFTQSCVVCCTYYMIHQGRVKLPLEAAHGQGHVVSDPPVMSVLGP  101

Query  186  D-IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
            D  PSF+   +SYP  L   + QFSN+  A W   N++ ELE E+V  +   W    IGP
Sbjct  102  DDFPSFVVDVNSYPGALPFVLGQFSNIQRAKWFLFNSFAELEEEIVKWMGNQWSIMTIGP  161

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E DK YG SL+KP  E CLKWL SKP +SV+Y+SFGSM SL
Sbjct  162  TIPSVYLDKRLEDDKDYGLSLFKPEAEACLKWLDSKPPKSVLYVSFGSMASL  213



>gb|KJB10816.1| hypothetical protein B456_001G226600 [Gossypium raimondii]
Length=458

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 113/172 (66%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+  A FFT S AV +V+ H++ G L+LP+ +      + LPG+PPL  
Sbjct  119  LPWALDVAKQFGIPSAVFFTQSCAVNSVYYHVNKGLLQLPLPVPH----VSLPGLPPLQV  174

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             ++PSF+    SYPA+  + + QFSNV  ADW+F N + +LE EVV  +S+ W    +GP
Sbjct  175  SELPSFVARYGSYPAWFDVVVNQFSNVDGADWVFFNIFYDLEKEVVNWMSRFWNVMTVGP  234

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD RIE DK YG +L+KP  + C+ WL  KP  SV+Y+SFGS  SL
Sbjct  235  TIPSMYLDKRIENDKDYGMNLFKPNVDACMSWLGRKPKDSVLYVSFGSFASL  286



>ref|XP_008338819.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Malus domestica]
 ref|XP_008338820.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Malus domestica]
Length=456

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 113/172 (66%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LD A+  G+ GA+FFT+S AV AV+ ++H G L +P++       + LPG+P L  
Sbjct  117  MPWVLDTAKGLGIFGASFFTHSCAVGAVYYNVHEGLLRVPLK----EPTISLPGLPLLEP  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI  P SYP++L + + +FSN+  ADWIF NT+  LE EVV  +   WP K IGP
Sbjct  173  QDLPSFIYDPGSYPSFLNLVVSRFSNISGADWIFFNTFHGLEKEVVNWMRTRWPIKTIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E DK YG S++    E C KWL+SK   +VVY+SFGSM +L
Sbjct  233  TLPSMYLDKRLEDDKDYGFSIFNSNTEACKKWLESKETGTVVYVSFGSMANL  284



>ref|XP_007049534.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
 gb|EOX93691.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
Length=459

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 113/172 (66%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ GV G AFFT S AV +++ H+H G L+LP+ +    + + LPG+P L  
Sbjct  120  LPWALDVAKQFGVAGVAFFTQSCAVNSIYYHVHKGLLQLPLSV----SNVSLPGLPELNV  175

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             ++PS+++   SYPA+  M + QFSN+   DW+  + + ELE++VV  +SK+W    IGP
Sbjct  176  SELPSYVSLYGSYPAFFDMVVNQFSNLDLVDWVLFDNFYELETQVVDWMSKLWKLGTIGP  235

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD RIE DK YG +L+KP    C+ WL  KP  SVVY SFGSM  +
Sbjct  236  TLPSMYLDKRIEDDKDYGVNLFKPDTGTCMSWLNGKPKGSVVYASFGSMAEV  287



>ref|XP_006447238.1| hypothetical protein CICLE_v10018164mg, partial [Citrus clementina]
 gb|ESR60478.1| hypothetical protein CICLE_v10018164mg, partial [Citrus clementina]
Length=428

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 113/173 (65%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GAAF T S AV  ++ H++ G ++LP+     G  +++PG+ PL  
Sbjct  85   LPWALDVAKKFGLIGAAFLTQSCAVAGIYHHMNKGLIKLPL----TGDQVLVPGLRPLDP  140

Query  183  PDIPSFITAPDSYPAYLAMKM-RQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D PSFI    SYPA+  M + RQFSN+  ADWI  NT+ ELE EV   + K W  + IG
Sbjct  141  QDTPSFINDSASYPAFFDMIITRQFSNIDKADWILCNTFYELEKEVTEWLGKHWLLRTIG  200

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD +IE DK YG S+++P  E  +KWL  + N SVVY+SFGSM +L
Sbjct  201  PTLPSIYLDKQIEDDKEYGFSIFEPDIESSMKWLNDRANGSVVYVSFGSMATL  253



>ref|XP_010069221.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=464

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 108/172 (63%), Gaps = 2/172 (1%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEE-NGAALVLPGIPPLYGP  185
            WALD+A +HG+HGA FFT S  VC  +  IH G ++LP+E     G  +  P +  + GP
Sbjct  117  WALDIAIQHGMHGAPFFTQSCVVCCTYYMIHQGRVKLPLEAAHGQGHVVSDPPVMSVLGP  176

Query  186  D-IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
            D  PSF+   +SYP  L   + QFSN+  A W   N++ ELE E+V  +   W    IGP
Sbjct  177  DDFPSFVVDVNSYPGALPFVLGQFSNIQRAKWFLFNSFAELEEEIVKWMGNQWSIMTIGP  236

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E DK YG SL+KP  E CLKWL SKP +SV+Y+SFGSM SL
Sbjct  237  TIPSVYLDKRLEDDKDYGLSLFKPEAEACLKWLDSKPPKSVLYVSFGSMASL  288



>ref|XP_002273866.1| PREDICTED: UDP-glycosyltransferase 74E2 [Vitis vinifera]
Length=456

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GA FFT S  V  ++ H+H G L+LP+   E    +V+PG+ PL  
Sbjct  117  LPWALDVAKKLGLVGAVFFTQSCTVNNIYYHVHQGMLKLPLSEPE----VVVPGLFPLQA  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYPA+  M + QFSN+   DW+F NT+ +LE +VV  ++K+ P + IGP
Sbjct  173  CDLPSFVYLYGSYPAFFDMVVNQFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS+YLD R+  DK YG ++ KP+   C++WL SKPN SVVY S+GS   L
Sbjct  233  TLPSAYLDKRLGDDKDYGLNMLKPVTGACMEWLDSKPNGSVVYASYGSFAVL  284



>ref|XP_010095580.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
 gb|EXB61153.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
Length=455

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 109/172 (63%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G+ GA FFT S  V  ++ H+H G L +PV   E+G  + +PG PP   
Sbjct  118  LPWALDVAKEFGLVGAVFFTQSCTVDCIYYHVHRGLLRVPVS--ESG--ISIPGCPPFRP  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    S+ A + M + QFSNV  ADW+  NTY ELE EV   + K+ P + IGP
Sbjct  174  SDLPSFVYDTVSHQAVIKMVVDQFSNVEKADWVLCNTYYELEEEVANWMMKILPLRTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+EGD  YG SL+    E CLKWL S+P  SV Y+SFGS+V +
Sbjct  234  TIPSMYLDKRLEGDDQYGFSLFPSQSEACLKWLNSRPKGSVAYLSFGSLVDV  285



>ref|XP_010091337.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
 gb|EXB44327.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
Length=453

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LD+A+RHG+ GA+FFT+S AV  ++ ++H   L +P++       + L G+P L  
Sbjct  112  MPWILDLAKRHGLSGASFFTHSCAVACIYYYLHQDLLRVPLK----EPQVSLAGLPSLKA  167

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI  P SYP++L + + +FSN+  ADWIF +++  LE EVV+ +  +W  K IGP
Sbjct  168  HDLPSFIYDPGSYPSFLKLVISRFSNLTKADWIFFSSFDNLEKEVVSWMRTLWRIKTIGP  227

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E DK YG  L+ P  + C+KWL SK   SVVY+SFGS+ +L
Sbjct  228  TIPSMYLDKRLEEDKDYGFGLFNPNADACIKWLDSKEVDSVVYLSFGSIANL  279



>gb|KEH25944.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=456

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 107/172 (62%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDV +  G+ G AFFT S +V +V+ H H   +ELP+   E     +LPG+P L  
Sbjct  118  LPWVLDVGKSFGLVGVAFFTQSCSVNSVYYHTHEKLIELPLTQSE----YLLPGLPKLAP  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYP Y  + + QF+N+G ADWI AN+  ELE EVV  + K+WP K IGP
Sbjct  174  GDLPSFLYKYGSYPGYFDIVVNQFANIGKADWILANSIYELEPEVVDWLVKIWPLKTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS  LD R++ DK YG SL  P  E C+KWL  KP  SVVY SFGSM  L
Sbjct  234  SVPSMLLDKRLKDDKEYGVSLSDPNTEFCIKWLNDKPKGSVVYASFGSMAGL  285



>ref|XP_004289755.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011457818.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LD+A++ G+ GA FFT S AV  ++ H++ G L+LP+   E    + LPG+PPL  
Sbjct  122  MPWPLDIAKKFGIVGAVFFTQSCAVDNIYNHVNKGVLKLPLTDSE----ISLPGMPPLEP  177

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF++   SYPA+  + + QF N+  ADW+  NT+ ELE +VV  ++K WP + IGP
Sbjct  178  LDLPSFLSDFGSYPAFFEVVIGQFCNIDKADWVLCNTFYELEEQVVDWLAKFWPVRTIGP  237

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS+YLD  ++ D+GYG  L+K   + C+KWL   P  +V YISFGS   L
Sbjct  238  TIPSNYLDNLLKDDQGYGVDLFKSSNDACMKWLNKHPKNTVAYISFGSGAQL  289



>gb|KCW57498.1| hypothetical protein EUGRSUZ_H00263 [Eucalyptus grandis]
Length=475

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 114/177 (64%), Gaps = 8/177 (5%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPP---  173
             PWALD+A RHG+HGA+FFT S AV A++ H+H G+L+ P+E +  G   V   +PP   
Sbjct  124  MPWALDIAIRHGMHGASFFTESCAVSAIYHHVHRGTLKFPLE-DSRGQEHV--SVPPVML  180

Query  174  -LYGPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAK  350
             L   D+PSF+   D+YPA++ + + QFSNV  A+W   NT+ ELE EVV  +    P  
Sbjct  181  NLKLNDLPSFVADVDAYPAFVKLVLDQFSNVMRANWRLFNTFAELEDEVVKWMGSQCPVL  240

Query  351  LIGPMVPSSYLDGRIEGDKGYGASLWKPL-GEECLKWLKSKPNQSVVYISFGSMVSL  518
             +GP +PS YLD RI+ DK YG SL+KP   E C+ WL SK   SVVY SFGS+ SL
Sbjct  241  TVGPTIPSMYLDKRIQHDKDYGLSLFKPNDAETCIGWLDSKDADSVVYASFGSLASL  297



>ref|XP_010069223.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=476

 Score =   167 bits (423),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 114/177 (64%), Gaps = 8/177 (5%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPP---  173
             PWALD+A RHG+HGA+FFT S AV A++ H+H G+L+ P+E +  G   V   +PP   
Sbjct  125  MPWALDIAIRHGMHGASFFTESCAVSAIYHHVHRGTLKFPLE-DSRGQEHV--SVPPVML  181

Query  174  -LYGPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAK  350
             L   D+PSF+   D+YPA++ + + QFSNV  A+W   NT+ ELE EVV  +    P  
Sbjct  182  NLKLNDLPSFVADVDAYPAFVKLVLDQFSNVMRANWRLFNTFAELEDEVVKWMGSQCPVL  241

Query  351  LIGPMVPSSYLDGRIEGDKGYGASLWKPL-GEECLKWLKSKPNQSVVYISFGSMVSL  518
             +GP +PS YLD RI+ DK YG SL+KP   E C+ WL SK   SVVY SFGS+ SL
Sbjct  242  TVGPTIPSMYLDKRIQHDKDYGLSLFKPNDAETCIGWLDSKDADSVVYASFGSLASL  298



>ref|XP_010678915.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Beta vulgaris subsp. 
vulgaris]
Length=410

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 111/172 (65%), Gaps = 3/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWA+DVA+  GV  AAF TNSA+VC+++ + H   L LP  +  +   LVLPG+P L  
Sbjct  71   LPWAVDVAKEMGVCKAAFMTNSASVCSLYWYFHNSLLSLP--LTPDRFPLVLPGLPELRL  128

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI  P  +  YL   M QFS +   DW+F NT+ +LES++   +S  WP  ++GP
Sbjct  129  YDLPSFIAYPFEFSEYLGAIMDQFSTLEENDWVFINTFAQLESQIEKAMSGKWPLVMVGP  188

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            M+PS+YL+   E D+ YG SLW    E CL+WL +KP+ SV+YISFGSM  L
Sbjct  189  MLPSAYLNQPTE-DRDYGGSLWNQATENCLRWLDTKPSNSVIYISFGSMAEL  239



>ref|XP_003548080.2| PREDICTED: UDP-glycosyltransferase 74E2-like [Glycine max]
 gb|KHN32810.1| UDP-glycosyltransferase 74E2 [Glycine soja]
Length=478

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 108/172 (63%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA++ G+ GA FFT +     ++ H++   +ELP+      A  +LPG+P L  
Sbjct  135  MPWVLDVAKKFGLLGATFFTQTCTTNNIYFHVYKKLIELPL----TQAEYLLPGLPKLAA  190

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYP Y  + + QF N+  ADW+ AN++ ELE  VV  + K+WP K IGP
Sbjct  191  GDLPSFLNKYGSYPGYFDVVVNQFVNIDKADWVLANSFYELEQGVVDWLVKIWPLKPIGP  250

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R++ DK YG +++ P  E C+KWL  KP  SVVY+SFGSM  L
Sbjct  251  CLPSIYLDKRLQDDKDYGVNMYNPNSEACIKWLDEKPKGSVVYVSFGSMAGL  302



>gb|KDO43525.1| hypothetical protein CISIN_1g012194mg [Citrus sinensis]
Length=468

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 112/173 (65%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GAAF T S AV  ++ H++ G L+LP+      + L+LPG+PPL  
Sbjct  125  LPWALDVAKKFGLVGAAFLTQSCAVDCIYYHVNKGLLKLPLP----DSQLLLPGMPPLEP  180

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSF+    SYPA   M ++ QF N+  ADW+  NT+ ELE EV   + K+W  K IG
Sbjct  181  QDMPSFVYDLGSYPAVSDMVVKYQFDNIDKADWVLCNTFYELEEEVAEWLGKLWSLKTIG  240

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS YLD ++E DK YG S++KP  E C+KWL  +   SVVY+SFGS   L
Sbjct  241  PTVPSLYLDKQLEDDKDYGFSMFKPDNESCIKWLNDRAKGSVVYVSFGSYAPL  293



>gb|KCW48703.1| hypothetical protein EUGRSUZ_K02355 [Eucalyptus grandis]
Length=461

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 111/172 (65%), Gaps = 5/172 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR  G+  AAFFT S AV +VF H   G LE+PV+ +     ++LPG+PPL  
Sbjct  119  LPWALDVARNFGLVAAAFFTMSCAVNSVFYHCQKGWLEVPVKKQ-----VLLPGVPPLEP  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PS +    +YPA+  M + QFSN+   DW+  NT  EL+ EV     K+ P + IGP
Sbjct  174  QDMPSLVCDVGTYPAFTGMLVNQFSNLDKVDWVLCNTVYELDPEVADWFMKILPFRTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS+YLD R+E DK YG S+++P  +  ++WL +KP  SVVY+SFGSM  L
Sbjct  234  TVPSTYLDSRLEQDKEYGFSIFEPDHDTTMRWLSTKPKGSVVYVSFGSMAEL  285



>ref|XP_003632443.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Vitis vinifera]
Length=456

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 113/172 (66%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GA FFT S  V  ++ H+H G L+LP+   E    +V+PG+ PL  
Sbjct  117  LPWALDVAKQLGLVGAVFFTQSCTVNDIYYHVHQGMLKLPLSEPE----VVVPGLFPLQA  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYPA+  M + QFSN+   DW+F NT+ +LE +VV  ++K+ P + IGP
Sbjct  173  CDLPSFVYLYGSYPAFFDMVVNQFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+  DK YG ++ KP+   C++WL SKPN SVVY S+GS   L
Sbjct  233  TLPSVYLDKRLGDDKDYGLNMLKPVTGACMEWLDSKPNGSVVYASYGSFAVL  284



>ref|XP_010242476.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nelumbo nucifera]
Length=458

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 112/173 (65%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G+ GA FFT S AV  ++ H+H G L +P  + E  AA  LPG+PPL  
Sbjct  117  LPWALDVAKSFGLVGAPFFTQSCAVENIYYHVHQGLLTVP--MTETTAA-SLPGLPPLDI  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWP-AKLIG  359
             D+PSFI+   SYP+Y AM + QFSN+   DWI  NT+QELE E V  +++ WP  + IG
Sbjct  174  MDMPSFISVSGSYPSYFAMVVNQFSNLETTDWILVNTFQELEVEEVDWMTRRWPLLRTIG  233

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS Y+D R+  D  YG +L+K  G  CL WL  +   SVVY+SFGS+ +L
Sbjct  234  PTIPSMYMDKRVTYDMDYGLNLFKSDGSACLNWLNKRAAGSVVYVSFGSLAAL  286



>ref|XP_009783231.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana sylvestris]
Length=459

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 116/173 (67%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELP-VEIEENGAALVLPGIPPLY  179
             PWA++VA+++G+  AAFFT S AV  ++ H+H G L+LP  E++E    + +PG+  + 
Sbjct  112  LPWAVEVAKKYGLACAAFFTQSCAVDNIYYHVHKGVLKLPPTEVDEE---ISIPGLVTIE  168

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF++ P+S  A L M + QFSN+   DW+  N++ ELE EV   +SK++P K IG
Sbjct  169  SSDVPSFVSTPESARA-LEMLVNQFSNLEKIDWVLINSFYELEKEVTDWMSKLYPIKTIG  227

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SVVY+SFGS+  L
Sbjct  228  PTIPSVYLDKRLPDDKEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLTKL  280



>ref|XP_010069220.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW57496.1| hypothetical protein EUGRSUZ_H00261 [Eucalyptus grandis]
Length=475

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 112/174 (64%), Gaps = 2/174 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEE-NGAALVLPGIPPLY  179
             PWALD+A +HG+HGA+FFT S  V A++ H+H G+L+ P+E     G   V P I  L 
Sbjct  124  MPWALDIAIQHGMHGASFFTQSCTVGAIYHHVHRGTLKFPLEDSRGQGHDSVPPVISNLS  183

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF+   D+YPA + + + QFSNV  A+W   NT+ ELE EVV  +    P   +G
Sbjct  184  LNDLPSFVVDVDAYPALVKLVLGQFSNVMRANWRLFNTFAELEVEVVKWMGSQCPLLTVG  243

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPL-GEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS YLD RI+ DK YG SL+KP   E C++WL SK   SVVY+SFGS+ SL
Sbjct  244  PTVPSMYLDKRIQHDKDYGLSLFKPNDAETCIEWLDSKDADSVVYVSFGSLASL  297



>ref|XP_006469356.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
 gb|ACS87993.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis]
Length=468

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 111/173 (64%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GAAF T S AV  ++ H++ G L LP+      + L+LPG+PPL  
Sbjct  125  LPWALDVAKKFGLVGAAFLTQSCAVDCIYYHVNKGLLMLPLP----DSQLLLPGMPPLEP  180

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSF+    SYPA   M ++ QF N+  ADW+  NT+ ELE EV   + K+W  K IG
Sbjct  181  HDMPSFVYDLGSYPAVSDMVVKYQFDNIDKADWVLCNTFYELEEEVAEWLGKLWSLKTIG  240

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS YLD ++E DK YG S++KP  E C+KWL  +   SVVY+SFGS   L
Sbjct  241  PTVPSLYLDKQLEDDKDYGFSMFKPNNESCIKWLNDRAKGSVVYVSFGSYAQL  293



>ref|XP_010037081.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
 gb|KCW48705.1| hypothetical protein EUGRSUZ_K02356 [Eucalyptus grandis]
Length=468

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              WALDVA++ G  G AF+T + AV  V+ H + G L LP+    +G  + LPG+PPL  
Sbjct  127  LSWALDVAKQFGKSGVAFYTQACAVNNVYYHAYQGLLPLPL----SGTTISLPGLPPLEP  182

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             + PSF+    SYPA+  + + QFSN+  AD +  N++ ELE EVV  ++K+WP K +GP
Sbjct  183  AETPSFLYVLGSYPAFFNLIVNQFSNIDGADLVLYNSFYELEKEVVDYMAKLWPLKTVGP  242

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R++ DK YG +L++P  E CL WL  KP  SV+Y+SFGSM  L
Sbjct  243  AIPSIYLDKRLQDDKDYGINLFRPDTESCLSWLNDKPINSVIYVSFGSMAEL  294



>ref|XP_006447932.1| hypothetical protein CICLE_v10015140mg [Citrus clementina]
 gb|ESR61172.1| hypothetical protein CICLE_v10015140mg [Citrus clementina]
Length=468

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 111/173 (64%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GAAF T S AV  ++ H++ G L LP+      + L+LPG+PPL  
Sbjct  125  LPWALDVAKKFGLVGAAFLTQSCAVDCIYYHVNKGLLMLPLP----DSQLLLPGMPPLEP  180

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSF+    SYPA   M ++ QF N+  ADW+  NT+ ELE EV   + K+W  K IG
Sbjct  181  HDMPSFVYDLGSYPAVSDMVVKYQFDNIDKADWVLCNTFYELEEEVAEWLGKLWSLKTIG  240

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS YLD ++E DK YG S++KP  E C+KWL  +   SVVY+SFGS   L
Sbjct  241  PTVPSLYLDKQLEDDKDYGFSMFKPNNESCIKWLNDRAKGSVVYVSFGSYAQL  293



>gb|KCW49321.1| hypothetical protein EUGRSUZ_K02875, partial [Eucalyptus grandis]
Length=437

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 113/169 (67%), Gaps = 2/169 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G++ A   TNSA+VC+++ +I+ G L  P  +  +   +VLPG+P L  
Sbjct  87   LPWALDVAKNFGIYAAVLLTNSASVCSLYWYINQGRLTFP--LCPDALPIVLPGLPLLEF  144

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P F+   +S   YLA+ M +FS +   DW+F N+++ELE+E+V  +  VWP  ++GP
Sbjct  145  SDLPGFLADAESQSPYLALIMEKFSRLEENDWVFCNSFEELEAELVKALFGVWPLLMVGP  204

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            +VPS+Y+D +I+GD  YG SLW    ++C +WL  +P  SV+Y+SFGSM
Sbjct  205  LVPSAYVDRQIDGDTSYGGSLWNATSDQCSRWLDKRPLGSVIYVSFGSM  253



>ref|XP_002529823.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32572.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=467

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 106/171 (62%), Gaps = 4/171 (2%)
 Frame = +3

Query  6    PWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGP  185
            PW  DVARR G++GA+FFT S AV  ++ H   G+L +P+E     + + LP  P L   
Sbjct  120  PWLFDVARRSGIYGASFFTQSCAVTGLYYHKIQGALRVPLE----ESVVSLPSYPELESN  175

Query  186  DIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            D+PS++    SY A   M   QFSNV   DW+  NT+ ELE EVV  +   WP   IGP 
Sbjct  176  DLPSYVNGAGSYQAIYDMAFSQFSNVDEVDWLLWNTFNELEDEVVNWMKSKWPIMPIGPT  235

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS +LD R+E DK YG SL+KP  + C+KWL SK  +SVVY+SFGS  +L
Sbjct  236  IPSMFLDRRLEDDKDYGLSLFKPNSDACMKWLDSKEARSVVYVSFGSQAAL  286



>ref|XP_010039151.1| PREDICTED: UDP-glycosyltransferase 74F1-like, partial [Eucalyptus 
grandis]
Length=453

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 113/169 (67%), Gaps = 2/169 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G++ A   TNSA+VC+++ +I+ G L  P  +  +   +VLPG+P L  
Sbjct  103  LPWALDVAKNFGIYAAVLLTNSASVCSLYWYINQGRLTFP--LCPDALPIVLPGLPLLEF  160

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P F+   +S   YLA+ M +FS +   DW+F N+++ELE+E+V  +  VWP  ++GP
Sbjct  161  SDLPGFLADAESQSPYLALIMEKFSRLEENDWVFCNSFEELEAELVKALFGVWPLLMVGP  220

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            +VPS+Y+D +I+GD  YG SLW    ++C +WL  +P  SV+Y+SFGSM
Sbjct  221  LVPSAYVDRQIDGDTSYGGSLWNATSDQCSRWLDKRPLGSVIYVSFGSM  269



>gb|KJB10815.1| hypothetical protein B456_001G226500 [Gossypium raimondii]
Length=455

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 112/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+   AFFT S AV +V+ H++ G L+LP+     G+ + LP +PPL+ 
Sbjct  116  LPWALDVAKQFGISSVAFFTQSCAVNSVYYHVYKGHLQLPLR----GSHVSLPAMPPLHV  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             ++PSF+     Y A+  + + QFSN+  ADW+F N + ELE +VV  +SK W    +GP
Sbjct  172  SELPSFVAIYGLYRAWFDVLVDQFSNIDEADWVFFNHFYELEPQVVDWMSKFWNVITVGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E DK YG +++KP    C+ WL  KP  SVVY+SFGS+ SL
Sbjct  232  TIPSIYLDKRLENDKDYGMNMFKPNVTACMSWLSGKPKDSVVYVSFGSVASL  283



>ref|XP_002278455.1| PREDICTED: UDP-glycosyltransferase 74F2 [Vitis vinifera]
Length=457

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 111/173 (64%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G+ GAAFFT + AV  +F ++H G L LPV    +   + +PG+P L  
Sbjct  116  LPWALDVAKEFGLVGAAFFTQTCAVTYIFYYVHHGLLTLPV----SSPPVSIPGLPLLDL  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI+APDSYPAYL M + QF NV  AD I  N++ +LE  VV  +SKV     IGP
Sbjct  172  EDMPSFISAPDSYPAYLKMVLDQFCNVDKADCILVNSFYKLEDSVVDAMSKVCTLLTIGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKP-LGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS + D R+  D  YG + +K    E C++WL SKP  SVVY+SFGSM SL
Sbjct  232  TIPSFFSDKRVNDDMAYGLNFFKAHQSETCIEWLSSKPKGSVVYVSFGSMASL  284



>gb|KCW48704.1| hypothetical protein EUGRSUZ_K02355 [Eucalyptus grandis]
Length=436

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 111/172 (65%), Gaps = 5/172 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR+  + GAAFFT S AV +VF H   G LE+PV+ +     ++LPG+PPL  
Sbjct  94   LPWALDVARKFKLVGAAFFTMSCAVNSVFYHCQKGWLEVPVKKQ-----VLLPGMPPLEP  148

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PS +    +YP +  M + QFSN+   DW+  NT  EL+ EV     K+ P + IGP
Sbjct  149  QDMPSLVCDLGTYPGFTGMLVNQFSNLDKVDWMLCNTVYELDPEVADWFMKILPFRTIGP  208

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS+YLD R+E DK YG S+++P  +  ++WL +KP  SVVY+SFGSM  L
Sbjct  209  TVPSTYLDSRLEQDKEYGFSIFEPDHDTTMRWLSTKPKGSVVYVSFGSMAEL  260



>ref|XP_010095579.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
 gb|EXB61152.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
Length=456

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 106/169 (63%), Gaps = 4/169 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G+ GAAFFT S AV +++ H+  G L +PV   E    + +PG PP   
Sbjct  118  IPWALDVAKEFGLIGAAFFTQSCAVVSIYNHVQGGLLRVPVSESE----VSIPGCPPFRP  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYP    + + QFSNV  ADW+  NT  ELE EV   + K+ P K IGP
Sbjct  174  SDLPSFVYDTVSYPVITKVAVDQFSNVEKADWVLCNTCYELEEEVANWMMKILPLKTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
             +PS +LD R+EGDK YG SL+    E CLKWL S+P  SV Y+SFGS+
Sbjct  234  TIPSMFLDKRLEGDKLYGFSLFPSQSEACLKWLDSRPKGSVAYLSFGSL  282



>ref|XP_010025874.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=475

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 113/174 (65%), Gaps = 2/174 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEE-NGAALVLPGIPPLY  179
             PWALD+A +HG+HGA+FFT S AV A++ H+H G+L+ P+E     G   V P I  L 
Sbjct  124  MPWALDIAIQHGMHGASFFTQSCAVGAIYHHVHRGTLKFPLEDSRGQGQDSVPPVISNLS  183

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF+   D+YPA + + + QFSNV  A+W   +T+ ELE EVV  +    P   +G
Sbjct  184  LNDLPSFLVDVDAYPALVKLVLGQFSNVMRANWRLFSTFAELEVEVVKWMGSQCPLLTVG  243

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPL-GEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS YLD RI+ DK YG SL+KP   E C++WL SK   SVVY+SFGS+ SL
Sbjct  244  PTVPSMYLDKRIQHDKDYGLSLFKPNDAETCIEWLDSKDADSVVYVSFGSLASL  297



>gb|AFJ52953.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=471

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 115/173 (66%), Gaps = 6/173 (3%)
 Frame = +3

Query  6    PWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPV-EIEENGAALVLPGIPPLYG  182
            PW LDV++R G+ GAAFFT S AV AVF H+H G L+ PV E+EE    + +PG+PP   
Sbjct  127  PWCLDVSKRFGLIGAAFFTQSCAVDAVFYHVHRGLLKPPVTEVEET---VSIPGLPPFEP  183

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF+    SYPA+LA  + QFSN+ NADW+  N+  ELE +    +SK  P  K IG
Sbjct  184  HDLPSFV-HDGSYPAFLAALVGQFSNIQNADWVLCNSVHELEPKAADWLSKNLPNFKTIG  242

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD ++  DK YG S +KP  E C  WL+SKP +SVVY+SFGS+  L
Sbjct  243  PTLPSFYLDKQLPDDKDYGLSFFKPDNEACSNWLQSKPKRSVVYVSFGSIADL  295



>ref|XP_004287163.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 116/178 (65%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVE---IEENGAALVLPGIP-  170
             PW LDVAR+HG+ GA FFT SAAV A+F H + G L++P +      +   +++P +P 
Sbjct  154  MPWVLDVARQHGIDGAPFFTCSAAVTAIFHHFYEGVLKIPSKDSAARSSNTTMLIPSMPG  213

Query  171  PLYGPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKV-WPA  347
            PL   D+PSF+   D+Y ++L   +  FSN+    WIF NTY++LE +V+   + + WP 
Sbjct  214  PLGFNDLPSFLCDVDAYSSFLNSTLNMFSNITQVKWIFYNTYEKLEEQVLKWTASLDWPV  273

Query  348  KLIGPMVPSSYLDGRIEGDKGYGASLWKP-LGEECLKWLKSKPNQSVVYISFGSMVSL  518
            K IGP +PSS+LD R+E +K Y  SL+KP   E C+KWL SK   SVVY+SFGS+ +L
Sbjct  274  KTIGPTIPSSFLDKRLEDEKDYSLSLFKPDRVETCMKWLDSKETGSVVYVSFGSLANL  331



>ref|XP_010037080.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Eucalyptus grandis]
Length=461

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 111/172 (65%), Gaps = 5/172 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR+  + GAAFFT S AV +VF H   G LE+PV+ +     ++LPG+PPL  
Sbjct  119  LPWALDVARKFKLVGAAFFTMSCAVNSVFYHCQKGWLEVPVKKQ-----VLLPGMPPLEP  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PS +    +YP +  M + QFSN+   DW+  NT  EL+ EV     K+ P + IGP
Sbjct  174  QDMPSLVCDLGTYPGFTGMLVNQFSNLDKVDWMLCNTVYELDPEVADWFMKILPFRTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS+YLD R+E DK YG S+++P  +  ++WL +KP  SVVY+SFGSM  L
Sbjct  234  TVPSTYLDSRLEQDKEYGFSIFEPDHDTTMRWLSTKPKGSVVYVSFGSMAEL  285



>ref|XP_010037079.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Eucalyptus grandis]
Length=462

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 111/172 (65%), Gaps = 5/172 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR  G+  AAFFT S AV +VF H   G LE+PV+ +     ++LPG+PPL  
Sbjct  119  LPWALDVARNFGLVAAAFFTMSCAVNSVFYHCQKGWLEVPVKKQ-----VLLPGVPPLEP  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PS +    +YPA+  M + QFSN+   DW+  NT  EL+ EV     K+ P + IGP
Sbjct  174  QDMPSLVCDVGTYPAFTGMLVNQFSNLDKVDWVLCNTVYELDPEVADWFMKILPFRTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS+YLD R+E D+ YG S+++P  +  ++WL +KP  SVVY+SFGSM  L
Sbjct  234  TVPSAYLDNRLEQDQEYGFSIFQPEHDTTMRWLGTKPKGSVVYVSFGSMAEL  285



>gb|AIE12489.1| UGT9 [Panax ginseng]
Length=439

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 112/172 (65%), Gaps = 8/172 (5%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LD+A+  G+  AAFFT S +VCA++ H+H G L++P+E    G    LP +P L  
Sbjct  106  MPWVLDIAKGLGLKAAAFFTQSCSVCAIYYHMHKGILKVPLE----GKNASLPAMPLLGI  161

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             ++P        Y   L++ + QFSN+  ADW+  N++ +LE+E+V  ++  WP K IGP
Sbjct  162  NELPDM----KLYQNLLSINISQFSNIEGADWLLFNSFDKLENELVKWMASKWPIKTIGP  217

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E DK YG SL+KP  + C+KWL +KPN SVVYISFGS+ +L
Sbjct  218  TIPSIYLDKRLEDDKDYGISLFKPNDDVCMKWLDTKPNNSVVYISFGSLANL  269



>ref|XP_010069222.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW57499.1| hypothetical protein EUGRSUZ_H00266 [Eucalyptus grandis]
Length=475

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 109/174 (63%), Gaps = 2/174 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEE-NGAALVLPGIPPLY  179
              WALD+A +HG+HGA+FFT S AV A++ H+H G+L+ P+E     G   V P I  L 
Sbjct  125  MSWALDIAIQHGMHGASFFTQSCAVSAIYRHVHTGTLKFPLEDSRGQGHVSVPPVISNLK  184

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF+   D+YPA   + + QFSNV  A+W   NT+ ELE EVV       P   +G
Sbjct  185  LNDLPSFVADADAYPALAKLVLDQFSNVMRANWRLFNTFAELEVEVVKWTGSQCPVLTVG  244

Query  360  PMVPSSYLDGRIEGDKGYGASLWK-PLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD RI+ DK YG SL+K    E C++WL SK   SVVYISFGS+ SL
Sbjct  245  PTIPSMYLDKRIQHDKDYGLSLFKLNDAETCIEWLDSKDADSVVYISFGSLASL  298



>ref|XP_002269003.2| PREDICTED: UDP-glycosyltransferase 74E2 [Vitis vinifera]
Length=456

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GA FFT S  V  ++ H+H G L LP+   E    +V+PG+ PL  
Sbjct  117  LPWALDVAKKFGLVGAVFFTQSCTVNNIYYHVHQGMLTLPLSEPE----VVVPGLFPLQA  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PS +    SYP +  M + QFSN+   DW+F NT+ +LE +VV  ++K+ P + IGP
Sbjct  173  CDLPSLVYLYGSYPDFFNMLVNQFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS+YLD R+  DK YG ++ KP+   C++WL SKPN SVVY S+GS   L
Sbjct  233  TLPSAYLDKRLGDDKDYGLNMLKPVTGACMEWLDSKPNGSVVYASYGSFAKL  284



>gb|AFJ52952.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=441

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 115/174 (66%), Gaps = 4/174 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PW LDVA+  G+  A FFT S AV A++ H++ GSL+LPV   +   +L++PG+P PL 
Sbjct  94   LPWCLDVAKELGLFAAPFFTQSCAVDAIYYHVYKGSLKLPVT--DQPQSLIIPGLPAPLE  151

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSFI+   SYPA   M + QFSN+  AD I  NT  +LE+E    +S +WP + +G
Sbjct  152  ADDMPSFISDYGSYPAAFDMIISQFSNIHKADCILCNTVYDLENETADWLSTIWPLRTVG  211

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWL-KSKPNQSVVYISFGSMVSL  518
            P +PS YLD +++ D+ YG S++KP  E C+ WL  +KP  SV+Y+SFGS+ SL
Sbjct  212  PTIPSMYLDKQLQDDRDYGFSIFKPNNEACINWLNNNKPKGSVIYVSFGSLASL  265



>emb|CDP16417.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   163 bits (413),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 114/172 (66%), Gaps = 3/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWA+DVA++  +      TNSA+VC+++  IH G L  PVE  ++   L +PG+PPL  
Sbjct  112  LPWAVDVAKKLDIFSVVLLTNSASVCSLYWQIHRGFLPFPVE--KDKVPLAIPGLPPLGF  169

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             ++PSF+  P    AYL   MR F+ +   DW+FAN++++LE+E+   ++ +WP +++GP
Sbjct  170  DELPSFLAFPSHNSAYLESIMRVFARLDENDWVFANSFEDLENELAKALTGLWPVQMVGP  229

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            MVPS+Y++G I GD  YG SLWKP  +  LKWL  K  +SVV++SFGSM  +
Sbjct  230  MVPSAYVEGPIAGDSDYGGSLWKP-SDHYLKWLDEKAPKSVVFVSFGSMADV  280



>emb|CDP21774.1| unnamed protein product, partial [Coffea canephora]
Length=376

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 110/173 (64%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA+  GV    FFT S AV  ++ H+H G L+LP  +EE+G  +  PG+PPL  
Sbjct  111  LPWCLDVAKDLGVRAGVFFTQSCAVNNIYNHVHKGLLKLP--LEESGVDI--PGLPPLLA  166

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSF++ P  YPA   + +  Q  N   ADWIF NT+  LE EV+  ++K+ P K IG
Sbjct  167  SDLPSFVSNPGLYPASSQLFVHDQMENFEEADWIFFNTFYGLEEEVIHWMAKILPVKTIG  226

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YL+ R+E DK YG +L+KP+   C+ WL  +  +SVVY+SFGS+  L
Sbjct  227  PTIPSMYLEKRLEDDKQYGVNLFKPMTNACMSWLNERSIRSVVYVSFGSLAEL  279



>ref|XP_009335348.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Pyrus x bretschneideri]
Length=460

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 114/172 (66%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA++ G+ GA FFT S AV  V+ H+H G L+LP  + +  + ++LPG+P L  
Sbjct  118  MPWPLDVAKKLGIAGAVFFTQSCAVDNVYYHVHRGLLKLP--LADGQSQILLPGLPALDP  175

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF++   SYPA   + + QFSNV  ADW+  NT+ +LE +VV  ++K+W  K +GP
Sbjct  176  LDLPSFVSDCGSYPAAYRVLVGQFSNVDKADWVLCNTFYDLEVQVVDWMAKLWRLKTVGP  235

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS+YL+ R++ DK Y  +L+K   + C+KWL  +P  SV Y+SFGS+  L
Sbjct  236  TIPSNYLNKRLKDDKEYSVNLFKSDNDACIKWLNERPKGSVAYVSFGSLAKL  287



>ref|XP_007033641.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 ref|XP_007033642.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 gb|EOY04567.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 gb|EOY04568.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
Length=442

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALD+A++ G+  AAFFT S AV  ++ ++H G ++LP+      ++L + G+P L G
Sbjct  103  FPWALDIAKKLGLPAAAFFTQSCAVDTIYYNVHEGLVKLPLA----ESSLSIDGLPLLQG  158

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYPA+L   + QFSN   ADW+F NT+  LE EV+  ++   P K IGP
Sbjct  159  CDLPSFVYDIGSYPAFLHTCVNQFSNFMEADWVFINTFTSLEEEVLNWMASQRPIKAIGP  218

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            ++PS YLD R+E D+ YG  L+KP  + C+ WL SK   SVVYISFGS+ +L
Sbjct  219  VIPSKYLDKRVEDDEEYGLHLFKPEIDICINWLNSKETGSVVYISFGSLAAL  270



>ref|XP_007033375.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
2 [Theobroma cacao]
 gb|EOY04301.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
2 [Theobroma cacao]
Length=425

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 105/173 (61%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWAL VA+  GV GA+FFT S AV A+F H+  G+  +P E       + LP +P L  
Sbjct  85   MPWALAVAKNFGVQGASFFTQSWAVNAIFYHLKQGTFRVPPE----EPVVSLPSMPELRL  140

Query  183  PDIPSFITAPD-SYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSF+     SYP    +   QFSN   A+W+F NTY ELE EV+  ++  WP K +G
Sbjct  141  SDLPSFVCDNSGSYPGLCKLVKNQFSNFEEANWVFCNTYDELEDEVINCMASKWPIKTVG  200

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD RI+ D  YG  L+KP  E C+KWL SK   SVVY+SFGS+  L
Sbjct  201  PTIPSMYLDKRIKDDNDYGLHLFKPDSELCIKWLDSKETDSVVYVSFGSLAGL  253



>ref|XP_010069226.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW57504.1| hypothetical protein EUGRSUZ_H00277 [Eucalyptus grandis]
Length=483

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 106/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVE-IEENGAALVLPGIPPLYG-  182
            WALDVA  HG+HGAAFFT S  V  ++  +H G ++LPVE ++  G  L  P    + G 
Sbjct  133  WALDVAIEHGMHGAAFFTQSCVVSCIYYLVHQGKVKLPVEAVDGQGRVLSDPPAMSVLGL  192

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D PSF+     YPA L M +RQFSN   A W+  NT+ ELE E+V  +   W    +GP
Sbjct  193  NDFPSFVVDVHKYPAILKMVLRQFSNFRKAKWLLFNTFTELEEEMVNWMGNQWLMLTVGP  252

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E D  YG SL+KP  E CL+WL SKP  S +YISFGS+ SL
Sbjct  253  TIPSLYLDKRLEDDTDYGLSLFKPEAEACLRWLDSKPPCSTLYISFGSLASL  304



>ref|XP_007045533.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007045534.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY01365.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY01366.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
Length=457

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVAR+ G+ GA FFT S AV ++  H+  G L+LP+E    G  + LPG+P    
Sbjct  118  LPWALDVARQLGLLGAVFFTQSCAVNSINYHVSEGLLKLPLE----GPNVSLPGLPLYKV  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             ++PS +    S+PA+  M + QFSN+  ADW+  NT+ ELE EVV  +S++W    +GP
Sbjct  174  SELPSVVYLYGSHPAWFDMIVNQFSNIDAADWVLVNTFYELEKEVVDWMSEIWKLGTVGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS +LD R+EG+K YG +L+ P    C+ WL  KPN SVVY+SFGS+  L
Sbjct  234  TIPSMHLDRRLEGNKDYGMNLFNPNTNTCMNWLNGKPNGSVVYVSFGSLADL  285



>ref|XP_002320558.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE98873.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=459

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA++ G+ GAAFFT S AV +++ H++ G ++LPV        +++PG+PPL  
Sbjct  116  MPWGLDVAKKFGLVGAAFFTQSCAVDSIYYHVYRGLIKLPV----TETQILVPGLPPLEP  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI    +YP +  M + QFSN+  ADW+F N++  LE EV    +K+WP + IGP
Sbjct  172  QDLPSFIYHLGTYPDFFDMLLDQFSNIDRADWVFCNSFYMLEREVADWFAKLWPFRSIGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD ++E D+ YG S +    + C+ WL  +   SVV++SFGS+V L
Sbjct  232  TIPSMYLDKQLENDRDYGFSFFMQNNDVCMNWLNDRAKGSVVHVSFGSLVDL  283



>emb|CAN69453.1| hypothetical protein VITISV_002845 [Vitis vinifera]
Length=433

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 111/172 (65%), Gaps = 5/172 (3%)
 Frame = +3

Query  6    PWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGP  185
            PWALDVA+  G+ GAAFFT + AV  +F ++H G L LPV    +   + +PG+P L   
Sbjct  5    PWALDVAKEFGLVGAAFFTQTCAVTYIFYYVHHGLLTLPV----SSPPVSIPGLPLLDLE  60

Query  186  DIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            D+PSFI+APDSYPAYL M + QF NV  AD I  N++ +LE  VV  +SKV     IGP 
Sbjct  61   DMPSFISAPDSYPAYLKMVLDQFCNVDKADCILVNSFYKLEDSVVDAMSKVCTLLTIGPT  120

Query  366  VPSSYLDGRIEGDKGYGASLWKP-LGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS + D R+  D  YG + +K    E C++WL SKP  SVVY+SFGSM SL
Sbjct  121  IPSFFSDKRVNDDMAYGLNFFKAHQSETCIEWLSSKPKGSVVYVSFGSMASL  172



>emb|CDP03926.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              WALDVA+R G+  AAFFT + AV +++ H++ G L +P+    + + + LPG+P L  
Sbjct  116  LTWALDVAKRFGLVTAAFFTQTCAVNSIYYHVYHGLLPVPL----SDSPISLPGLPLLQP  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             + PSFI  PDSYPA+  + + QFSNV  ADW+  + + +LE +V+  ++++W  K +GP
Sbjct  172  KETPSFIYLPDSYPAFRHILLNQFSNVDQADWVILSNFHKLEEDVLNWMARLWRVKTVGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS YLD R+E D GYG +L+KP    C+ WL ++P  SVVY++FGS + +
Sbjct  232  TVPSMYLDKRLEDDTGYGINLFKPDSSLCINWLDNQPKDSVVYVAFGSWIGI  283



>gb|KDP45201.1| hypothetical protein JCGZ_15066 [Jatropha curcas]
Length=457

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 109/172 (63%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ G  FF  S +V  ++ H+  G L LP+    +   + LPG+P L+ 
Sbjct  118  MPWALDVAKQFGLTGVTFFNQSCSVNNIYYHVQRGLLRLPL----SEPTVSLPGLPLLHA  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             + PSF++   SYP +  + M QF N+  ADW+  N++ +LE E+V  ++K W  + IGP
Sbjct  174  SETPSFVSDSVSYPGFHHLVMNQFCNIDEADWVLFNSFYKLEEEIVVWMAKRWRLRTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD RIE DK YG S +KP    C+KWL+ KP+ SVVY++FGS+  L
Sbjct  234  TLPSMYLDKRIEDDKDYGISTFKPDETNCIKWLQDKPSASVVYVAFGSVARL  285



>gb|EYU17621.1| hypothetical protein MIMGU_mgv1a006158mg [Erythranthe guttata]
Length=454

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 112/172 (65%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LD+A+ +G+ GA  FT    VC++F H+H G+LE+  +  E G  + LPG+P +  
Sbjct  116  IPWCLDIAKGNGLRGAVLFTQPCTVCSIFYHLHEGNLEISSD--EVGFEVSLPGMPVMGL  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+P+ +   +SYP+ L + + QFS   NADW   NT+ +LE E++  +S  +P + IGP
Sbjct  174  KDLPTLVYDMNSYPSLLRLLVEQFSTFENADWRLFNTFDKLEDEILKWMSNKYPIRTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS Y D R++G+  YG SL+KP  E C +WL++K ++SV+Y+SFGS+  L
Sbjct  234  TVPSMYADKRLKGNYDYGLSLFKPSTESCFQWLETKEDRSVIYVSFGSLADL  285



>ref|XP_011002911.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Populus 
euphratica]
Length=458

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 109/173 (63%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAH-IHCGSLELPVEIEENGAALVLPGIPPLY  179
             PW LDVA+  G+ G  FFT S AV  ++ H +  G+L++P+E     +++ LP +P L 
Sbjct  117  LPWVLDVAKSWGIEGGPFFTQSCAVTVLYYHTLQGGALKIPME---EKSSVSLPSLPQLE  173

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PS +  P SYP    +   QFSN+  A W+  NT+ ELE E+V  ++  WP K IG
Sbjct  174  FSDLPSLVHGPGSYPGIYDLLFSQFSNIDEASWLLWNTFNELEDEIVDWMASKWPIKPIG  233

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R+E DK YG SL+KP  E C+KWL SK   SVVY+SFGS+ +L
Sbjct  234  PTIPSMFLDKRLEDDKDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGSLATL  286



>ref|XP_011002910.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X1 [Populus 
euphratica]
Length=458

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 109/173 (63%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAH-IHCGSLELPVEIEENGAALVLPGIPPLY  179
             PW LDVA+  G+ G  FFT S AV  ++ H +  G+L++P+E     +++ LP +P L 
Sbjct  117  LPWVLDVAKSWGIEGGPFFTQSCAVTVLYYHTLQGGALKIPME---EKSSVSLPSLPQLE  173

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PS +  P SYP    +   QFSN+  A W+  NT+ ELE E+V  ++  WP K IG
Sbjct  174  FSDLPSLVHGPGSYPGIYDLLFSQFSNIDEASWLLWNTFNELEDEIVDWMASKWPIKPIG  233

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R+E DK YG SL+KP  E C+KWL SK   SVVY+SFGS+ +L
Sbjct  234  PTIPSMFLDKRLEDDKDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGSLATL  286



>emb|CBI33059.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 109/165 (66%), Gaps = 4/165 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GA FFT S  V  ++ H+H G L+LP+   E    +V+PG+ PL  
Sbjct  117  LPWALDVAKQLGLVGAVFFTQSCTVNDIYYHVHQGMLKLPLSEPE----VVVPGLFPLQA  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYPA+  M + QFSN+   DW+F NT+ +LE +VV  ++K+ P + IGP
Sbjct  173  CDLPSFVYLYGSYPAFFDMVVNQFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYIS  497
             +PS YLD R+  DK YG ++ KP+   C++WL SKPN SVVY S
Sbjct  233  TLPSVYLDKRLGDDKDYGLNMLKPVTGACMEWLDSKPNGSVVYAS  277



>emb|CDP03995.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WALDVA++ G+  AAFFT + AV +++ +++ G L +P+    + + + LPG+P L   +
Sbjct  118  WALDVAKQFGLVTAAFFTQTCAVNSIYYNVYHGLLPVPL----SDSPISLPGLPLLQPKE  173

Query  189  IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMV  368
             PSF+  PDSYPA+L M + QFSNV  ADW+  N + +LE + V  ++K+W    +GP V
Sbjct  174  TPSFVYLPDSYPAFLHMLVNQFSNVDQADWVILNNFHKLEEDAVNWIAKLWRVITVGPTV  233

Query  369  PSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGS  506
            PS YLD R+E D GYG +L+KP    C+ WL S+P  SVVY+SFGS
Sbjct  234  PSIYLDKRLEDDIGYGINLFKPDSSLCINWLNSQPKDSVVYVSFGS  279



>ref|XP_004292062.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
Length=463

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 110/169 (65%), Gaps = 3/169 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PW+LDVA++ G+ GA FFT S AV  ++ H H G ++LPV  ++    +++PG+  PL 
Sbjct  118  MPWSLDVAKKFGIFGAVFFTQSCAVGNIYYHAHKGLMKLPVSGDD--GEILIPGLQLPLE  175

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D PS +    S  A   M + QFSNV  ADW+  NT+ ELE EVV  +SK+WP K IG
Sbjct  176  AVDFPSSLCDLGSNHAVYDMVVGQFSNVDEADWVLCNTFYELEPEVVDWMSKLWPLKTIG  235

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGS  506
            P +PS YLD R++ DKGYG +L+K   + C+KWL  +P  SVVY+SFGS
Sbjct  236  PTIPSMYLDNRLKEDKGYGVNLFKQNHDACMKWLNEQPKDSVVYVSFGS  284



>ref|XP_002529822.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32571.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=453

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 106/172 (62%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LD+AR+ G+ GA+ FT S+AV  ++  +H G L +P E       + + G+PPL  
Sbjct  108  MPWVLDIARQLGLPGASLFTQSSAVNHIYYKLHEGKLNVPTE----QVLVSVEGMPPLEI  163

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF    + YP  L     QF N+  ADW+F NT+  LE EV+ G++  WP K IGP
Sbjct  164  YDLPSFFYELEKYPTCLTFMANQFLNIEEADWVFFNTFNSLEDEVLRGMTSQWPVKSIGP  223

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E ++ YG +L+KP  E C+KWL  +   SVVY+SFGS+  L
Sbjct  224  TIPSMYLDKRVEDNREYGINLFKPNVENCMKWLDLREASSVVYVSFGSITDL  275



>ref|XP_002532443.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29929.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=406

 Score =   160 bits (406),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 107/172 (62%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+++G+   AF T + AV   + H+    L +PV    +   + LPG+P L  
Sbjct  67   MPWALDVAKQYGILAVAFLTQACAVNNAYYHVQRSFLPVPV----SSPTVSLPGLPMLQV  122

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             ++PS I+   SYP +  + + QF N+  ADW+  NT+  LE EVV  ++K W    IGP
Sbjct  123  SELPSLISDCGSYPGFRYLLVDQFRNIDGADWVLCNTFYRLEEEVVDWMAKSWRLGTIGP  182

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS YLD R+E DK YG +L+KP    C+ WLK+KP+ SVVY+SFGSMV L
Sbjct  183  TVPSRYLDKRLEDDKDYGINLFKPDSSTCMNWLKTKPSSSVVYVSFGSMVEL  234



>emb|CDP13106.1| unnamed protein product [Coffea canephora]
Length=669

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 107/171 (63%), Gaps = 5/171 (3%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WALDVA+  G+  AAFFT S AV  ++ H++ G L+LP+E     + + +PG+PPL   D
Sbjct  472  WALDVAKSLGLRAAAFFTQSCAVYKIYYHVYAGLLKLPLE----ESKVEIPGLPPLLASD  527

Query  189  IPSFITAPDSYPAYLAM-KMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            +PSF +   SYP    M    Q  N+  ADWIF NT+ +LE EV+   SK+ P K IGP 
Sbjct  528  LPSFFSTYGSYPPIFQMVAYDQMKNIHEADWIFCNTFYKLEEEVIDCTSKILPIKTIGPS  587

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS YLD R++ DK YG S + P+  +C+ WL  +   SVVY+SFGS+  L
Sbjct  588  IPSMYLDKRLQDDKQYGLSRFMPMTNDCMPWLNERSTSSVVYVSFGSLAEL  638


 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 86/141 (61%), Gaps = 5/141 (4%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWAL VA+  G+  A FFT S AV  ++ H++ G L+LP+E     + + +PG+PPL  
Sbjct  111  LPWALRVAKSLGLRAAVFFTQSCAVNKIYYHVYTGLLKLPLE----ESKVEIPGLPPLSA  166

Query  183  PDIPSFITAPDSYP-AYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSFI++  SYP  +  +   Q  N+  AD I  NT+ ELE EV+   S++ P   IG
Sbjct  167  SDLPSFISSYGSYPPIFQLVTHDQMKNIHEADSIIYNTFYELEEEVIDWTSRILPIMTIG  226

Query  360  PMVPSSYLDGRIEGDKGYGAS  422
            P +PS YLD R++ DK YG +
Sbjct  227  PTIPSMYLDKRLQDDKQYGLT  247



>ref|XP_008235866.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=463

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+R G+ GAAFFT S AV  +++ +H G L+LP+  +   + ++LPG+PPL  
Sbjct  123  LPWALDVAKRVGIAGAAFFTVSCAVTNIYSLVHKGLLKLPLNPD---SEILLPGLPPLQP  179

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D PSFI AP+SYPA+  + +  FSN+  ADW+F +T+ ELE E V  ++K WP + IGP
Sbjct  180  SDTPSFIYAPESYPAFFKLCVEPFSNLDKADWVFYSTFYELEHETVDWMAKFWPLRTIGP  239

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R E DK YG +L  P  + C+KWL +KP  SV Y+SFGS+  L
Sbjct  240  TIPSMYLDKRHEEDKEYGLNLLNPNSDACMKWLNAKPKGSVAYVSFGSVAKL  291



>ref|XP_006447928.1| hypothetical protein CICLE_v10017682mg [Citrus clementina]
 gb|ESR61168.1| hypothetical protein CICLE_v10017682mg [Citrus clementina]
Length=466

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 111/173 (64%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GA F T S AV  ++ H++ G L+LP+     G  ++LPG+PPL  
Sbjct  123  LPWALDVAKKFGLLGATFLTQSCAVYCIYYHVNRGFLKLPL----TGNEILLPGMPPLEP  178

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PS +    SYPA   + ++ QF N   ADW+ +NT+ ELE EV   + + WP K IG
Sbjct  179  RDMPSLVYDSGSYPAISDLWLKSQFDNFDKADWVLSNTFYELEEEVAEWLGRHWPLKTIG  238

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS YLD ++E +K YG S++K   E C+KWL  +   SVVY+SFGS+ +L
Sbjct  239  PTVPSMYLDKQLEDNKDYGFSMFKQNNESCIKWLNDQAKGSVVYVSFGSVATL  291



>ref|XP_010908661.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Elaeis guineensis]
Length=461

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 108/169 (64%), Gaps = 4/169 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVAR  GV GAAF T    V AV+ H++ GSL +P+     G+   L G+P +  
Sbjct  112  LPWPLDVARELGVLGAAFLTQPCIVDAVYYHVYRGSLAVPLV----GSTFRLTGLPEIGA  167

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF++ P   P +L + + QFSN+  ADW+  NT+QELE+EV+  ++   P K IGP
Sbjct  168  SDMPSFVSVPGYSPTHLKILVNQFSNMETADWVLCNTFQELENEVINWMANYMPMKAIGP  227

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            MVPS+ ++  ++GDK YG  LWK  G  C+ WL  +  QSVVY+SFGS+
Sbjct  228  MVPSTCINEHLDGDKNYGVDLWKANGGVCMNWLDKREPQSVVYVSFGSI  276



>ref|XP_009783230.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Nicotiana sylvestris]
Length=458

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 117/173 (68%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELP-VEIEENGAALVLPGIPPLY  179
             PWA++VA+++G+  AAFFT S AV  ++ ++H G ++LP  E++E    +++PG+  + 
Sbjct  113  LPWAVEVAKKYGLACAAFFTQSCAVDNIYYYVHKGVIKLPPTEVDEQ---VLVPGLLTIE  169

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+P+F++ P+S    L M + QFSN+ N DW+  N++ ELE E++  +SK++P K IG
Sbjct  170  KSDVPTFVSNPES-AKILEMLVDQFSNLENVDWVLINSFYELEKEIIDWMSKLYPIKTIG  228

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SVVY+SFGS   L
Sbjct  229  PTIPSIYLDKRLPNDKEYGLSVFKPMTNECLNWLNHQPISSVVYVSFGSYAKL  281



>ref|XP_006357097.1| PREDICTED: UDP-glycosyltransferase 74F2-like, partial [Solanum 
tuberosum]
Length=345

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 111/173 (64%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PWA++VA+  G+  AAFFT + AV  ++ H+H G ++LP    +N   +++PG   P+ 
Sbjct  113  LPWAVEVAKNFGLISAAFFTQNCAVDNIYYHVHKGVIKLPPT--QNNEEILIPGFSSPIE  170

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D P+F+  P++    L M + QFSN+   DW+  N++ ELE EV+  +SK++P K IG
Sbjct  171  ASDAPTFVIDPEA-ERILEMLVNQFSNLDKVDWVLINSFYELEKEVIDWMSKMYPIKTIG  229

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SVVY+SFGS+  L
Sbjct  230  PTIPSMYLDKRLHDDKEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLAKL  282



>emb|CDP13108.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 107/173 (62%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA+  GV    FFT S  V  ++ H+H G L+LP+E  E    + +PG+PPL  
Sbjct  111  LPWCLDVAKDLGVRAGVFFTQSCVVNNIYYHVHKGLLKLPLEATE----VDIPGLPPLLA  166

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSF++ P  YPA   + +  Q   +  ADWIF NT+  LE +V+  ++K+ P K IG
Sbjct  167  SDLPSFVSNPGPYPATSQLVVHDQMEKIEEADWIFFNTFYRLEEKVIHWMAKILPVKTIG  226

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YL+ R+E DK YG +L+KP+   C+ WL  +   SVVY+SFGS+  L
Sbjct  227  PTIPSVYLEKRLEDDKQYGLNLFKPMTNACMSWLNERSISSVVYVSFGSLAKL  279



>emb|CDP08070.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 112/173 (65%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVAR-RHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLY  179
             PW L++ + + G+ GAAFFT + AVCA+F HIH G+L++P+E     + ++LP +P L 
Sbjct  117  MPWILEIVQGQLGLKGAAFFTQACAVCAIFNHIHRGTLKVPLET----STILLPSMPQLE  172

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF+  P  YP +L + + Q  N+  +DW+  N++ +LE+EVV  +++ +P K IG
Sbjct  173  SNDLPSFVYNPSPYPGHLDVVLSQNINLEKSDWLLFNSFDKLENEVVTWLTERYPIKTIG  232

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P  PS Y D R++ DK Y  + + P  E CLKWL +K   SVVY+SFGS+  L
Sbjct  233  PCTPSMYTDKRLKDDKDYTINFFAPDSEACLKWLDTKETGSVVYVSFGSVSDL  285



>emb|CDP13110.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 107/173 (62%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA+  GV    FFT S AV  ++ H+H G L+LP  +EE+G  +  PG+PPL  
Sbjct  111  LPWCLDVAKDLGVRAGVFFTQSCAVNNIYNHVHKGLLKLP--LEESGVDI--PGLPPLLA  166

Query  183  PDIPSFITAPDSYPAYLAM-KMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSF++ P  YPA   +    Q  N   ADWIF NT+  LE E +  ++K+ P K IG
Sbjct  167  SDLPSFVSNPGLYPASTQLFAHDQMENFEEADWIFFNTFYGLEEEAIHWMAKILPVKTIG  226

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YL+ R+E DK YG +L+KP+   C+ WL  +   SVVY+SFGS+  L
Sbjct  227  PTIPSMYLEKRLEDDKQYGLNLFKPMTNACMSWLNERSISSVVYVSFGSLAEL  279



>ref|XP_010069228.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
 gb|KCW57506.1| hypothetical protein EUGRSUZ_H00279 [Eucalyptus grandis]
Length=469

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 110/174 (63%), Gaps = 7/174 (4%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G+ GA FFT + AV  ++  +H G L +PVE       + +PG+PPL  
Sbjct  117  LPWALDVAKEFGLVGAPFFTQACAVNYIYYLVHHGHLRVPVE----SLPVCMPGLPPLEL  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI    SYPAY  M + QF N   ADW+  NT+ ELE+EVV  +SK+ P   IGP
Sbjct  173  RDMPSFIYVAGSYPAYFEMVLHQFLNTDKADWVLVNTFYELEAEVVDTMSKLCPVSTIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECL--KWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E D  YG +L+  L +  L   WL+SKP  SVVY+SFGS+ SL
Sbjct  233  TIPSMYLDKRVEDDIEYGLNLFT-LDKSTLITDWLRSKPPSSVVYVSFGSLSSL  285



>ref|XP_010069225.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=467

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 108/172 (63%), Gaps = 2/172 (1%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVE-IEENGAALVLPGIPPLYG-  182
            WALDVA +HG+HGA+FFT S  V  ++  +H G+++LP++ ++  G  L  P +  + G 
Sbjct  117  WALDVAIKHGMHGASFFTQSCVVSCIYYLVHQGTVKLPLDAVDGQGRVLCDPPVMSVLGL  176

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D PSF+     YP  L + + QFSN   A W+  NT+ ELE E+V  +   W    +GP
Sbjct  177  NDFPSFVADVHKYPGVLDIVLGQFSNFRKAKWLLFNTFTELEEELVNWMGNQWSMMTVGP  236

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS Y+D R+E D GYG SL+KP  E CL+WL SKP  S VY+SFGS+ SL
Sbjct  237  TIPSVYMDKRLEDDTGYGLSLFKPEAEACLRWLDSKPPCSTVYVSFGSLASL  288



>ref|XP_011082054.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=473

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 110/172 (64%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA+  G+  AAFFT S AV  ++ H+  G L++P+    +G  +++PG+PPL  
Sbjct  117  LPWCLDVAKEMGLAAAAFFTQSCAVDQIYYHVFKGELKVPL----SGEEILIPGLPPLKP  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYP    + + QFS +  ADW+F NT+ +LE EV+  ++K  P K IGP
Sbjct  173  EDMPSFMYVHGSYPPLFEVVLNQFSGLEKADWLFLNTFYQLEEEVIDNMAKFLPVKTIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS YLD R+  DK YG +++KP    C++WL  +  ++VVY+SFGS+  L
Sbjct  233  TVPSMYLDKRVPDDKEYGLNVYKPDTVACMEWLNQQQPETVVYVSFGSLAQL  284



>gb|KCW57503.1| hypothetical protein EUGRSUZ_H00275 [Eucalyptus grandis]
Length=483

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 108/172 (63%), Gaps = 2/172 (1%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVE-IEENGAALVLPGIPPLYG-  182
            WALDVA +HG+HGA+FFT S  V  ++  +H G+++LP++ ++  G  L  P +  + G 
Sbjct  133  WALDVAIKHGMHGASFFTQSCVVSCIYYLVHQGTVKLPLDAVDGQGRVLCDPPVMSVLGL  192

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D PSF+     YP  L + + QFSN   A W+  NT+ ELE E+V  +   W    +GP
Sbjct  193  NDFPSFVADVHKYPGVLDIVLGQFSNFRKAKWLLFNTFTELEEELVNWMGNQWSMMTVGP  252

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS Y+D R+E D GYG SL+KP  E CL+WL SKP  S VY+SFGS+ SL
Sbjct  253  TIPSVYMDKRLEDDTGYGLSLFKPEAEACLRWLDSKPPCSTVYVSFGSLASL  304



>ref|XP_011079130.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Sesamum indicum]
Length=462

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 108/172 (63%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G+  AAFFT S AV  ++ H++ G LELP+    +G  +V+PG+P +  
Sbjct  117  MPWALDVAKGLGLFAAAFFTQSCAVDNIYHHVYRGELELPL----SGGEVVVPGLPAMRP  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             ++PSFI    SYP    M + QF NV  ADWIF NT+ ELE EV+  +S+    K IGP
Sbjct  173  DEMPSFIYDHGSYPGTFQMVLNQFRNVDKADWIFINTFDELEEEVLEWMSRSLRVKAIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R++ D+ Y  +++KP    C  WL  +  +SV+Y+SFGS+  L
Sbjct  233  AIPSMYLDKRLQDDREYDFTIFKPDTNACKNWLNQRQPKSVIYVSFGSLAQL  284



>gb|AFJ52951.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=418

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 112/174 (64%), Gaps = 4/174 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA+R G+ GAAF T S AV A++ H+  G+++ PV  +     LV+ G+PPL  
Sbjct  66   MPWFLDVAKRFGIVGAAFLTQSCAVNAIYYHLREGTIKRPVVSDPAAGTLVIDGLPPLEV  125

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVW--PAKLI  356
             D+PSFI   D +  +LA  +RQFSN G ADW+F NT  +LE E V  ++K W    + I
Sbjct  126  SDLPSFI-WDDLHTEFLAAHLRQFSNDG-ADWVFCNTVYQLELEAVDWLTKQWLINFRTI  183

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            GP +PS YLD +I  DK Y  S++ P  + C+ WL+SKP+ SVVY+SFGS+  L
Sbjct  184  GPTIPSFYLDKQIPDDKDYDISIFNPQNQTCMNWLQSKPDGSVVYVSFGSLARL  237



>emb|CDP03994.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 112/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              WALDVA+R G+  AAFFT + AV +++ H++ G L +P+    + + + LPG+P L  
Sbjct  116  LTWALDVAKRFGLVTAAFFTQTCAVNSIYYHVYHGLLPVPL----SDSPISLPGLPLLQP  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             + PSFI  PDSYP +  + + QFSNV  ADW+  + + +LE + V  ++++W  K +GP
Sbjct  172  KETPSFIYLPDSYPDFRHILVNQFSNVDQADWVILSNFHKLEEDAVNWMARLWRVKTVGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS YLD R+E D GYG +L+KP    C+ WL ++P  SVVY++FGS + +
Sbjct  232  TVPSMYLDKRLEDDTGYGINLFKPDSSLCINWLDNQPKDSVVYVAFGSWIGI  283



>ref|XP_010069229.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74F2-like 
[Eucalyptus grandis]
Length=469

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 110/174 (63%), Gaps = 7/174 (4%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+  G+ GA FFT   AV  ++  +H G L++PVE       + +PG+PPL  
Sbjct  117  LPWALDVAKGFGLIGAPFFTQXCAVNYIYYLVHHGHLKVPVE----SFPVCVPGLPPLEL  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI    SYPAY  M + QF N   ADW+  NT+ ELE+EVV  +SK+ P   IGP
Sbjct  173  RDMPSFIYVAGSYPAYFEMVLHQFLNTDKADWVLVNTFYELEAEVVDTMSKLCPVTTIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECL--KWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E D  YG +L+  L +  L   WL+SKP  SVVY+SFGSM SL
Sbjct  233  TIPSMYLDKRVENDIEYGLNLFT-LDKSTLITDWLRSKPPSSVVYVSFGSMSSL  285



>ref|XP_006447926.1| hypothetical protein CICLE_v10015147mg [Citrus clementina]
 gb|ESR61166.1| hypothetical protein CICLE_v10015147mg [Citrus clementina]
Length=466

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 107/173 (62%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GA F T S AV  ++ H + G L+LP+     G  + LPG+PPL  
Sbjct  123  LPWALDVAKKFGLLGATFLTQSCAVYCIYYHANMGFLKLPL----TGNEISLPGMPPLEP  178

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PS +    SYPA   + ++ QF N+   DW+  NT+ ELE EV   + + WP + IG
Sbjct  179  QDMPSIVYDLGSYPAISDLVLKNQFDNIDKVDWVLCNTFYELEEEVAEWLGRHWPLRAIG  238

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS YLD ++E DK YG S++    E C+KWL  +   SVVY+SFGSM +L
Sbjct  239  PTVPSKYLDKQLEDDKDYGFSMFMQSNESCIKWLNDQAKGSVVYVSFGSMATL  291



>ref|XP_010069224.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=467

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 107/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVE-IEENGAALVLPGIPPLYG-  182
            WALDVA  HG+HGA+FFT S  V  ++  +H G+++LP++ ++  G  L  P +  + G 
Sbjct  117  WALDVAIEHGMHGASFFTQSCVVSCIYYLVHQGTVKLPLDAVDGQGRVLCDPPVMSVLGM  176

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D PSF+     YP  L + + QFSN   A W+  NT+ ELE E+V  +   W    +GP
Sbjct  177  NDFPSFVADVHKYPGVLDIVLGQFSNFRKAKWLLFNTFTELEEELVNWMGNQWSMMTVGP  236

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS Y+D R+E D GYG SL+KP  E CL+WL SKP  S VY+SFGS+ SL
Sbjct  237  TIPSVYMDKRLEDDTGYGLSLFKPEAEACLRWLDSKPPCSTVYVSFGSLASL  288



>ref|XP_011082052.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Sesamum indicum]
Length=457

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 114/172 (66%), Gaps = 5/172 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWA+ VA++HG+ GAAFFT S++V +++ +++ G L++P+  +E   A    G+P L  
Sbjct  116  LPWAVVVAKKHGLVGAAFFTQSSSVNSIYYNVYKGQLKVPLLDKEIAVA----GLPLLEI  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+   DS+P    + + QF NV  AD++F N++ ELE EV   ++K+ P K IGP
Sbjct  172  SDVPSFVRDQDSHPGSFELVLNQFRNVEEADFVFVNSFYELEEEVTDLMAKILPVKTIGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
              PS YLD R+  DK Y  S++KP+   C+KWL+ + N+SV+Y+SFGSM  L
Sbjct  232  TTPSMYLDKRLTEDKDYDLSIFKPVN-SCMKWLEERTNKSVIYVSFGSMAKL  282



>ref|XP_002529825.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32574.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=467

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 105/171 (61%), Gaps = 4/171 (2%)
 Frame = +3

Query  6    PWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGP  185
            PW  DVAR  GV+GA+FFT S A   ++ H   G+L++P+E      A+ LP  P L   
Sbjct  120  PWIFDVARSSGVYGASFFTQSCAATGLYYHKIQGALKVPLE----EPAVSLPAYPELEAN  175

Query  186  DIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            D+PSF+  P SY A   M   Q SNV   DW+  NT+ ELE E+V  ++  W    IGP 
Sbjct  176  DLPSFVNGPGSYQAVYDMAFSQLSNVDEVDWLLWNTFTELEDEIVNWMASKWTIMPIGPA  235

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS +LD R+E DK YG +L+KP  + C+KWL SK   SV+Y+SFGS+ +L
Sbjct  236  IPSMFLDNRLEDDKDYGVNLFKPNSDACMKWLDSKEPSSVIYVSFGSLAAL  286



>ref|XP_006447930.1| hypothetical protein CICLE_v10015149mg [Citrus clementina]
 gb|ESR61170.1| hypothetical protein CICLE_v10015149mg [Citrus clementina]
Length=465

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 117/174 (67%), Gaps = 6/174 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GAAF T S AV +++ H++ G ++LP+     G  ++LPG+PPL  
Sbjct  121  LPWALDVAKKFGLTGAAFLTQSCAVASIYHHVNKGLIKLPL----TGDQVLLPGLPPLDP  176

Query  183  PDIPSFITAPDSYPAYLAMKM-RQFSNVGNADWIFANTYQELESEVVAGVSKV-WPAKLI  356
             D PSFI AP SYPA+  M + RQ SN+  ADWI  NT+ ELE EV   + K  W  + I
Sbjct  177  QDTPSFINAPASYPAFFDMIVTRQVSNIDKADWILCNTFYELEKEVTEWLGKQHWLLRTI  236

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            GP +PS YLD +IE DK YG S+++P  E C+KWL  + N SVVY+SFGSM +L
Sbjct  237  GPTLPSIYLDKQIEDDKEYGFSIFEPNIESCMKWLNDRANGSVVYLSFGSMATL  290



>gb|KCW57502.1| hypothetical protein EUGRSUZ_H00273 [Eucalyptus grandis]
Length=483

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 107/172 (62%), Gaps = 2/172 (1%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVE-IEENGAALVLPGIPPLYG-  182
            WALDVA  HG+HGA+FFT S  V  ++  +H G+++LP++ ++  G  L  P +  + G 
Sbjct  133  WALDVAIEHGMHGASFFTQSCVVSCIYYLVHQGTVKLPLDAVDGQGRVLCDPPVMSVLGM  192

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D PSF+     YP  L + + QFSN   A W+  NT+ ELE E+V  +   W    +GP
Sbjct  193  NDFPSFVADVHKYPGVLDIVLGQFSNFRKAKWLLFNTFTELEEELVNWMGNQWSMMTVGP  252

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS Y+D R+E D GYG SL+KP  E CL+WL SKP  S VY+SFGS+ SL
Sbjct  253  TIPSVYMDKRLEDDTGYGLSLFKPEAEACLRWLDSKPPCSTVYVSFGSLASL  304



>gb|AGD95005.1| lignan glucosyltransferase [Linum usitatissimum]
Length=468

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 112/174 (64%), Gaps = 4/174 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA+R G+ GAAF T S AV A++ H+  G+++ PV  +     LV+ G+PPL  
Sbjct  116  MPWFLDVAKRFGIVGAAFLTQSCAVNAIYYHLREGTIKRPVVSDPAAGTLVIDGLPPLEV  175

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVW--PAKLI  356
             D+PSFI   D +  +LA  +RQFSN G ADW+F NT  +LE E V  ++K W    + I
Sbjct  176  SDLPSFI-WDDLHTEFLAAHLRQFSNDG-ADWVFCNTVYQLELEAVDWLTKQWLINFRTI  233

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            GP +PS YLD +I  DK Y  S++ P  + C+ WL+SKP+ SVVY+SFGS+  L
Sbjct  234  GPTIPSFYLDKQIPDDKDYDISIFNPQNQTCMNWLQSKPDGSVVYVSFGSLARL  287



>ref|XP_007201501.1| hypothetical protein PRUPE_ppa016883mg [Prunus persica]
 gb|EMJ02700.1| hypothetical protein PRUPE_ppa016883mg [Prunus persica]
Length=466

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 115/173 (66%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA++ G+ GA FFT S +V  +F H+H G L+LP+  +   + ++LPG+PPL  
Sbjct  124  MPWPLDVAKKFGIVGAVFFTQSCSVDNIFYHVHQGLLKLPLPPD---SEILLPGLPPLQP  180

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSFI    SYPA+  M +  QF NV  ADW+F NT+ ELE EVV  ++K+WP + IG
Sbjct  181  SDMPSFIYVYGSYPAFFTMVVDGQFYNVDKADWVFCNTFYELEEEVVDCMAKLWPLRTIG  240

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R E D+ YG SL+ P  + CL WL +KP  SV Y+SFGS+  L
Sbjct  241  PTIPSMYLDKRREDDREYGFSLFNPNSDACLTWLNAKPKGSVAYVSFGSLAEL  293



>gb|AFJ52958.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=457

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+ HG++ A+FFT   AV  ++ +I  G L+LPV+       + + G+P L  
Sbjct  115  LPWALDVAKEHGLYAASFFTQPCAVDFIYYNIRHGLLKLPVDT----WPVRILGLPELEP  170

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+ AP++YPAY AM + QFSN   AD++  NT+ ELE E +  +SKV P   IGP
Sbjct  171  RDMPSFVNAPEAYPAYFAMVVNQFSNTEKADYVLINTFYELEKEALHTMSKVCPVLAIGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS+YLDGRI+ D  YG  L+         W+ +KP +SV+Y++FGSMV+ 
Sbjct  231  TVPSTYLDGRIDDDAEYGVDLFSLERSISTAWIATKPPKSVIYVAFGSMVTF  282



>gb|EYU17634.1| hypothetical protein MIMGU_mgv1a006216mg [Erythranthe guttata]
Length=452

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 110/173 (64%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVARR G+ GA FFT + AV  V+ ++H G L++PV        + +PG+P L  
Sbjct  117  LPWVLDVARRFGIAGACFFTQACAVNYVYYYVHRGLLDIPVA---TPPPVEIPGLPALEL  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
            PD+PSF     SYPAY  M + QFSNV  AD++  NT+ +LE +VV  ++KV P   IGP
Sbjct  174  PDLPSFTHVSGSYPAYFEMVLNQFSNVDKADFVLVNTFYKLEEKVVDSMTKVCPMLTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPL-GEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD RIE D  Y  +L++    +  L WL +KP +SVVYI+FGSM +L
Sbjct  234  TLPSFYLDNRIENDDKYDVNLFQSDPSQPILDWLNTKPPKSVVYIAFGSMDNL  286



>ref|XP_006469357.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
Length=464

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 108/173 (62%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GA F T S AV  ++ H + G L+LP+     G  + LPG+PPL  
Sbjct  121  LPWALDVAKKFGLLGATFLTQSCAVYCIYYHANRGFLKLPL----TGNEISLPGMPPLEP  176

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSF+    SYPA   + ++ QF N+   DW+  NT+ ELE EV   + + WP + IG
Sbjct  177  QDMPSFVYDLGSYPAISDLVLKNQFDNIDKVDWVLCNTFYELEEEVAEWLGRHWPLRAIG  236

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS YLD ++E +K YG S++K   E C+KWL  +   SVVY+SFGS  +L
Sbjct  237  PTVPSMYLDKQLEDEKDYGFSIFKQSNESCIKWLNDQAKGSVVYVSFGSAATL  289



>ref|XP_006370131.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|ERP66700.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=471

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 106/173 (61%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGS-LELPVEIEENGAALVLPGIPPLY  179
             PW LDVA+  G+ G  FFT S AV  ++ H   GS L++P+E     + + LP +P L 
Sbjct  117  LPWVLDVAKSWGIEGGPFFTQSCAVTVLYYHTLQGSALKIPME---EKSPVSLPSLPQLE  173

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PS +  P SYP    +   QFSN+  A W+  NT+ ELE E+V  ++  WP K IG
Sbjct  174  FSDLPSLVHGPGSYPGIYDLLFSQFSNIDEASWLLWNTFNELEDEIVDWMASKWPIKPIG  233

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R+E DK YG SL+KP  E C+KWL SK   SVVY+SFGS+  L
Sbjct  234  PTIPSMFLDKRLEDDKDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGSLAVL  286



>ref|XP_011082053.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=458

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 110/169 (65%), Gaps = 5/169 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPG-IPPLY  179
            +PWALDVA++ G+  A FFT S +V +++ H H G L+LP+    + A + +PG +P L 
Sbjct  118  YPWALDVAKKFGLTAAMFFTQSNSVNSIYFHAHKGELKLPL----SEAEVRIPGGLPALK  173

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D PSFI   +S P    +  +QF NV   DWIF NT+ ELE EV   ++K  P + IG
Sbjct  174  PEDTPSFIRDYESDPVRSELMTQQFRNVEIVDWIFVNTFHELEQEVCDWMAKFLPVRAIG  233

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGS  506
            P +PS Y+D R+  D+ YG S +KP+ + C+KWLK++PN+SV+Y SFGS
Sbjct  234  PTIPSMYIDKRLPDDREYGISAFKPVTDPCMKWLKNQPNRSVIYASFGS  282



>ref|XP_006351615.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Solanum tuberosum]
Length=461

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 108/171 (63%), Gaps = 4/171 (2%)
 Frame = +3

Query  6    PWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGP  185
            PWALDVA++HG+ GA FFT + AV  ++ ++H G L LP+    +   + + G+P L   
Sbjct  119  PWALDVAKKHGLIGACFFTQACAVNYIYYYVHHGKLTLPI----SSTPVKISGLPELELQ  174

Query  186  DIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            D+PSF     +YPAY  M + QF+NV  AD++F N++ +LE+EV   +SK+ P   IGP 
Sbjct  175  DMPSFFYVHGTYPAYFEMVLNQFTNVDKADYVFVNSFYKLEAEVADTMSKISPLSTIGPT  234

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS Y+D R+E D  YG +L+      C+ WL +KP  SVVY +FGSM + 
Sbjct  235  LPSFYMDNRVENDIEYGLNLFHVDSSTCINWLNTKPEGSVVYAAFGSMSTF  285



>ref|XP_004244486.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Solanum lycopersicum]
Length=456

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 111/173 (64%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PWA++VA++ G+  AAFFT +  V  ++ H+H G ++LP    +N   +++PG   P+ 
Sbjct  113  LPWAVEVAKQFGLISAAFFTQNCVVDNIYYHVHKGVIKLPPT--QNDEKIIIPGFSSPIK  170

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+P+F+  P+     L M + QFSN+   DW+  N++ ELE EV+  +SK++P K IG
Sbjct  171  ASDVPNFVINPEG-ERILEMLVNQFSNLDKVDWVLINSFYELEKEVIDWMSKIYPIKTIG  229

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SV+Y+SFGS+  L
Sbjct  230  PTIPSMYLDKRLHDDKEYGLSMFKPMTNECLNWLNHQPISSVLYVSFGSLAKL  282



>gb|KCW57495.1| hypothetical protein EUGRSUZ_H00261 [Eucalyptus grandis]
Length=472

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 110/174 (63%), Gaps = 5/174 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEE-NGAALVLPGIPPLY  179
             PWALD+A +HG+HGA+FFT S  V A++ H+H G+L+ P+E     G   V P I  L 
Sbjct  124  MPWALDIAIQHGMHGASFFTQSCTVGAIYHHVHRGTLKFPLEDSRGQGHDSVPPVISNLS  183

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF+   D+YPA + + + QFSNV  A+W   NT+ ELE E +       P   +G
Sbjct  184  LNDLPSFVVDVDAYPALVKLVLGQFSNVMRANWRLFNTFAELEVEWMGSQC---PLLTVG  240

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPL-GEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS YLD RI+ DK YG SL+KP   E C++WL SK   SVVY+SFGS+ SL
Sbjct  241  PTVPSMYLDKRIQHDKDYGLSLFKPNDAETCIEWLDSKDADSVVYVSFGSLASL  294



>gb|KFK44472.1| hypothetical protein AALP_AA1G260900 [Arabis alpina]
Length=463

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 110/170 (65%), Gaps = 4/170 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW L+VAR + +  A FFTN+  VC++      G+  LP +   N    ++PG+P L  
Sbjct  117  IPWGLEVARSNSISAAVFFTNNLTVCSMLLKFSNGAFSLPAD--PNSGTYLVPGLPALRY  174

Query  183  PDIPSFITAP-DSYPAYLAMKMRQFSNVGNADWIFANTYQELES-EVVAGVSKVWPAKLI  356
             ++PSF      S+  +  M ++QFSN  NADWIF N +  LE+ E   G S+   A LI
Sbjct  175  DELPSFTGRHWLSHAGHGRMLLKQFSNHENADWIFVNGFDGLETQECEIGESEAMKATLI  234

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGS  506
            GPM+PS+YLD RI+GDKGYGASL KP+ EEC++WL +KP +SV+++SFGS
Sbjct  235  GPMIPSAYLDDRIKGDKGYGASLLKPVSEECMEWLGTKPTKSVIFVSFGS  284



>ref|XP_009630995.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Nicotiana tomentosiformis]
 gb|AAF61647.1|AF190634_1 UDP-glucose:salicylic acid glucosyltransferase [Nicotiana tabacum]
Length=459

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 112/173 (65%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELP-VEIEENGAALVLPGIPPLY  179
             PWA++V    GV  AAFFT S AV  ++ H+H G L+LP  ++++    + +PG+  + 
Sbjct  113  LPWAVEVGNNFGVATAAFFTQSCAVDNIYYHVHKGVLKLPPTDVDKE---ISIPGLLTIE  169

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF++ P+S    L M + QFSN+ N DW+  N++ ELE EV+  ++K++P K IG
Sbjct  170  ASDVPSFVSNPES-SRILEMLVNQFSNLENTDWVLINSFYELEKEVIDWMAKIYPIKTIG  228

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+   CL WL  +P  SVVY+SFGS+  L
Sbjct  229  PTIPSMYLDKRLPDDKEYGLSVFKPMTNACLNWLNHQPVSSVVYVSFGSLAKL  281



>ref|XP_002532442.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29928.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=457

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 108/172 (63%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+   AF T + AV   + H+  G L +P     +   + LPG+P L  
Sbjct  118  LPWALDVAKQFGILAVAFLTQACAVNNAYYHVQRGLLRVP----GSSPTVSLPGLPLLQV  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             ++PSFI+   SYP +  + + QF N+  ADW+  NT+  LE EVV  ++K W  + +GP
Sbjct  174  SELPSFISDYVSYPGFRNLLVDQFRNIDGADWVLCNTFYRLEEEVVDWMAKKWRLRTVGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E DK YG +L+KP    CL WLK+KP++SVVY+SFGS+  L
Sbjct  234  TLPSKYLDKRLEYDKDYGINLFKPDSGTCLNWLKTKPSRSVVYVSFGSVAEL  285



>ref|XP_010042371.1| PREDICTED: UDP-glycosyltransferase 74E2-like, partial [Eucalyptus 
grandis]
Length=346

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 105/172 (61%), Gaps = 2/172 (1%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVE-IEENGAALVLPGIPPLYG-  182
            WALDVA  HG+HGA+FFT S  V  ++  +H G+++LP+E ++  G  L  P +  + G 
Sbjct  88   WALDVAIEHGMHGASFFTQSCVVSCIYYLVHQGTVKLPLEAVDGQGRVLCDPPVMSVLGL  147

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D PSF+     YPA L + + QFSN   A W+  NT+ ELE E+V  +   W    +GP
Sbjct  148  NDFPSFVADVHKYPAVLDIVLGQFSNFRKAKWLLFNTFSELEEELVNWMGNQWSMMTVGP  207

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS Y D R+E D GYG SL+KP  E CL+WL SK   S +Y+SFG + SL
Sbjct  208  TIPSVYKDKRLEDDTGYGLSLFKPEAEACLRWLDSKLPCSTIYVSFGCLASL  259



>ref|XP_006357048.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=460

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 111/173 (64%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PWA++VA+  G+  AAFFT + AV  ++ H+H G ++LP    +N   +++PG    + 
Sbjct  113  LPWAVEVAKNFGLISAAFFTQNCAVDNIYYHVHKGVIKLPPT--QNDEEILIPGFSSTIE  170

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+P+F+  P+     L M + QFSN+   DW+  N++ ELE EV+  +SK++P K IG
Sbjct  171  ASDVPTFVINPEG-ERILEMLVNQFSNLDKVDWVLINSFYELEKEVIDYMSKIYPIKTIG  229

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SVVY+SFGS+ +L
Sbjct  230  PTIPSMYLDKRLHDDKEYGLSVFKPMTNECLNWLNHQPINSVVYVSFGSITNL  282



>ref|XP_006469355.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Citrus sinensis]
Length=464

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 111/171 (65%), Gaps = 5/171 (3%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WALDVA++ G+ GA F T S AV  ++ H+  GSLELP+     G  ++LPG+PPL   D
Sbjct  125  WALDVAKKFGLLGAPFLTQSCAVDYIYYHVKKGSLELPL----TGNEILLPGMPPLEPQD  180

Query  189  IPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            +PSFI    SYPA   M M+ QF N+  ADW+  NT+ ELE EVV  + K W  + IGP 
Sbjct  181  MPSFIHDLGSYPAVSYMMMKFQFENIDKADWVLCNTFYELEEEVVEWLRKTWSLRTIGPT  240

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS YLD +IE DK YG S++K   E C+KWL  +  +SVVY+S+GS V L
Sbjct  241  IPSFYLDKQIEDDKDYGFSMFKSSTEACMKWLNDRAKESVVYVSYGSFVEL  291



>ref|XP_011002951.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74E2-like 
[Populus euphratica]
Length=493

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 106/173 (61%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAH-IHCGSLELPVEIEENGAALVLPGIPPLY  179
             PW LDVA+  G+ G  FFT S AV  ++ H +  G+L++P+E     +++ LP +P L 
Sbjct  119  LPWVLDVAKSWGIEGGPFFTQSCAVTVLYYHTLQGGALKIPME---EKSSVSLPSLPQLE  175

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PS +  P SYP    +   QFSN+  A W+  NT+ ELE E+V  ++  WP K  G
Sbjct  176  FSDLPSLVHGPGSYPGVYDLLFSQFSNIDEASWLLGNTFNELEDEIVDWMASKWPIKPTG  235

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R+E DK YG SL+KP  E C+KWL SK   SVVY+SFG   +L
Sbjct  236  PTIPSMFLDKRLEDDKDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGGFAAL  288



>gb|KDO43523.1| hypothetical protein CISIN_1g012277mg [Citrus sinensis]
Length=464

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 111/171 (65%), Gaps = 5/171 (3%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WALDVA++ G+ GA F T S AV  ++ H+  GSLELP+     G  ++LPG+PPL   D
Sbjct  125  WALDVAKKFGLLGAPFLTQSCAVDYIYYHVKKGSLELPL----TGNEILLPGMPPLEPQD  180

Query  189  IPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            +PSFI    SYPA   M M+ QF N+  ADW+  NT+ ELE EVV  + K W  + IGP 
Sbjct  181  MPSFIHDLGSYPAVSYMMMKFQFENIDKADWVLCNTFYELEEEVVEWLRKTWSLRTIGPT  240

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS YLD +IE DK YG S++K   E C+KWL  +  +SVVY+S+GS V L
Sbjct  241  IPSFYLDKQIEDDKDYGFSMFKSSTEACMKWLNDRAKESVVYVSYGSFVEL  291



>gb|KHN13207.1| UDP-glycosyltransferase 74E1 [Glycine soja]
Length=452

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 108/173 (62%), Gaps = 7/173 (4%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDVA+  G+ GA F T +  V +++ H+H G L++P+   E      LP +P L  
Sbjct  112  FPWALDVAKSFGIMGAVFLTQNMTVNSIYYHVHLGKLQVPLTEHE----FSLPSLPKLQL  167

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF+     +P YL   + QFSN+  ADW+  NT+ EL+ EV   ++K+WP  + IG
Sbjct  168  EDMPSFLLTYVEHPYYLDFFVDQFSNIDKADWVLCNTFYELDKEVANWITKIWPKFRNIG  227

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R E DK YG + ++   EEC++WL  KP  SVVY+SFGS+  L
Sbjct  228  PNIPSMFLDKRHEDDKDYGVAQFE--SEECIEWLNDKPKGSVVYVSFGSIAML  278



>ref|XP_003543857.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Glycine max]
Length=457

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 108/173 (62%), Gaps = 7/173 (4%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDVA+  G+ GA F T +  V +++ H+H G L++P+   E      LP +P L  
Sbjct  117  FPWALDVAKSFGIMGAVFLTQNMTVNSIYYHVHLGKLQVPLTEHE----FSLPSLPKLQL  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF+     +P YL   + QFSN+  ADW+  NT+ EL+ EV   ++K+WP  + IG
Sbjct  173  EDMPSFLLTYVEHPYYLDFFVDQFSNIDKADWVLCNTFYELDKEVANWITKIWPKFRNIG  232

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R E DK YG + ++   EEC++WL  KP  SVVY+SFGS+  L
Sbjct  233  PNIPSMFLDKRHEDDKDYGVAQFE--SEECIEWLNDKPKGSVVYVSFGSIAML  283



>ref|XP_007049526.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
 gb|EOX93683.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
Length=459

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 108/171 (63%), Gaps = 5/171 (3%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            +ALDVA++ G+  AAFFT + AV +V+ H+  G L+LP+        + LPG+PPL   +
Sbjct  120  FALDVAKQFGIRTAAFFTQACAVNSVYYHVSRGLLQLPLP----EPKVSLPGLPPLEVSE  175

Query  189  IPSFITAPDSYPAYLAMKM-RQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            +PSF+    SYPA+  + +  QFSN+  ADW+F N + +LE E V  +S+ W    IGP 
Sbjct  176  LPSFVCHHGSYPAWFDVVVNHQFSNINEADWVFLNIFYDLEKEAVDWMSQFWNVMTIGPT  235

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS YLD R+E DK YG  L+KP    C+ WL  KP  SVVY+SFGSM  L
Sbjct  236  IPSMYLDKRLENDKHYGMHLFKPKTSTCMSWLSGKPKSSVVYVSFGSMAEL  286



>ref|XP_010101352.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
 gb|EXB88299.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
Length=649

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 112/171 (65%), Gaps = 2/171 (1%)
 Frame = +3

Query  6    PWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGP  185
            P ALD+A++ G+ GA FFT S AV  +F ++  G L +PVE +E    + + G+P L   
Sbjct  309  PQALDIAKQLGLPGAPFFTQSCAVNVLFYNMPQGLLRVPVEDKE--PPMSMTGLPQLELF  366

Query  186  DIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            D+PSF+    SYP+ LA    QFSN   AD IF NT++ LE EVV+  +  WP K IGP 
Sbjct  367  DLPSFVYDMVSYPSLLANLANQFSNFREADCIFFNTFESLEEEVVSWAASQWPVKNIGPT  426

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS YLD R++ DK YG SL+KP  E C KWL SK ++SVVY++FGS+ +L
Sbjct  427  IPSMYLDKRLQDDKDYGLSLFKPEAETCRKWLDSKDDKSVVYVAFGSLAAL  477


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 65/129 (50%), Gaps = 5/129 (4%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WALDVAR   +  A FFT S +  A++ H++  ++ +P+ +E    A+ LP +P     D
Sbjct  124  WALDVAREFDLQAAPFFTQSCSNLAIYYHLYQATISIPL-LE---PAVSLPSLPRFQIND  179

Query  189  IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAG-VSKVWPAKLIGPM  365
            +PSFI+ P SYP  L      F +     WIF NT+  LE E     VSK     L+   
Sbjct  180  MPSFISVPGSYPDILKTIFDGFPHFHQVKWIFCNTFDMLEEEFAKRLVSKGLKITLVTAF  239

Query  366  VPSSYLDGR  392
            + +  +  R
Sbjct  240  INAESIQAR  248



>ref|XP_006357100.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Solanum tuberosum]
Length=457

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 110/171 (64%), Gaps = 4/171 (2%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLYGP  185
            WA++VA + G+  AAFFT + AV  ++ H+H G ++ P    +N   +++PG   P+   
Sbjct  116  WAVEVATKFGLVSAAFFTQNCAVDNIYYHVHKGVIKFPPT--QNDKEIIIPGFSCPIEAS  173

Query  186  DIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            D+PSF+  P++    + M + QFSN+   DW+  N++ ELE EV+  +SK++P K IGP 
Sbjct  174  DVPSFVFRPEA-ERIIEMMVNQFSNLDKVDWVLINSFYELEKEVIDWMSKIYPIKTIGPT  232

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS YLD R+  DK YG S++KP+  ECL WL  +P  SVVY+SFGS+  L
Sbjct  233  IPSMYLDKRLHDDKEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLAKL  283



>ref|XP_006357098.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=457

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 110/173 (64%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PW ++VA++ G+  AAFFT +  V  ++ H+H G ++LP    +N   +++PG   P+ 
Sbjct  114  LPWVVEVAKKFGLISAAFFTQNCTVDNIYYHVHKGVIKLPPT--QNDEKILIPGFSCPIE  171

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+P+F+  P+     L + + QFSN+   DWI  N++ ELE EV+  +SK++P K IG
Sbjct  172  ASDVPTFVIYPEG-ERILQVLVNQFSNLDKVDWILINSFYELEKEVIDWMSKIYPIKTIG  230

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SVVY+SFGS+  L
Sbjct  231  PTIPSMYLDKRLHDDKEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLAKL  283



>gb|KDO37942.1| hypothetical protein CISIN_1g048393mg, partial [Citrus sinensis]
Length=369

 Score =   155 bits (391),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GAAF T S AV +++ H++ G ++LP+     G  ++LPG+PPL  
Sbjct  44   LPWALDVAKKFGLTGAAFLTQSCAVASIYHHVNKGLIKLPL----TGDEVLLPGLPPLDP  99

Query  183  PDIPSFITAPDSYPAYLAMKM-RQFSNVGNADWIFANTYQELESEVVAGVSKV-WPAKLI  356
             D PSFI  P SYPA+  M + RQF N+  ADWI  NT+ ELE EV   + K  W  + I
Sbjct  100  QDTPSFINDPASYPAFFDMIVTRQFYNIDKADWILCNTFYELEKEVTEWLGKQHWLLRTI  159

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            GP +PS YLD +IE DK YG S+++   E C+KWL  + N SVVY+SFGSM +L
Sbjct  160  GPTLPSIYLDKQIEDDKEYGFSIFETNIESCMKWLNDRANGSVVYVSFGSMATL  213



>gb|KJB60859.1| hypothetical protein B456_009G328300 [Gossypium raimondii]
Length=391

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 107/170 (63%), Gaps = 4/170 (2%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WALDVA++ G+  A F T S AV ++  H+  G L++P E    G+++ L G+P L   +
Sbjct  54   WALDVAKQWGIRAAVFLTQSCAVNSIHYHVSRGLLKVPAE----GSSVWLSGLPELKVWE  109

Query  189  IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMV  368
            +PS I    SYPA+    + QFSN+  ADW+  NT+ ELE EVV  +SK+W    IGP +
Sbjct  110  LPSLIYHHGSYPAWFDTIVNQFSNIDEADWVLVNTFYELEKEVVDWMSKIWKLGTIGPTI  169

Query  369  PSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            PS YLD R++ +K YG  L  P    C++WL +KPN SVVY+SFGS+  +
Sbjct  170  PSMYLDKRLKHNKDYGLQLLHPNTSACMRWLNTKPNGSVVYVSFGSLAEV  219



>ref|XP_003624251.1| UDP-glucose glucosyltransferase [Medicago truncatula]
 gb|AES80469.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=457

 Score =   156 bits (394),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 113/173 (65%), Gaps = 6/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDVA+R G+ G ++ T +  V +++ H+H G+L++P+  +E    + LP +P +  
Sbjct  117  FPWALDVAKRFGIVGVSYLTQNMLVNSIYYHVHQGTLKVPLMEDE----ISLPLLPRIEL  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKL-IG  359
             D+PSF +        L + + QFSN+  ADWI  NT+ E+E EVV    K+WP  + IG
Sbjct  173  GDMPSFFSTKGENQVLLDLLVGQFSNIDKADWILCNTFYEMEKEVVDWTIKIWPKFMTIG  232

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R++ D+ YGA+ +K   E+C++WL  KP  SVVY+SFGSMVSL
Sbjct  233  PSIPSKFLDKRLKDDEDYGAAQFKT-NEKCMEWLNDKPKGSVVYVSFGSMVSL  284



>gb|KGN58388.1| hypothetical protein Csa_3G636370 [Cucumis sativus]
Length=430

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 108/170 (64%), Gaps = 5/170 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA    +  A FFT S AV  ++ H+H G ++LP+   E    + +PG+P +  
Sbjct  91   LPWVLDVANELQIATAVFFTQSCAVANIYYHVHKGLIDLPLPNRE----IEIPGLPLMKP  146

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             + PSFI    +YPAY  + + Q++NV  ADWI  NT++ELE EV+  + K+WP+ + IG
Sbjct  147  AEFPSFIYQLGTYPAYYDLLVNQYANVDKADWILCNTFEELEREVLEYLKKIWPSIRAIG  206

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            P +PS YLDGRIEGD+ YG S+    G+   KWL+ +   SVVY+SFGS+
Sbjct  207  PSIPSGYLDGRIEGDREYGMSILDLDGDVSRKWLEGRRKGSVVYVSFGSI  256



>ref|XP_006469358.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006469359.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006469360.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X3 [Citrus 
sinensis]
Length=466

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 107/173 (62%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GA F T S AV  ++ H + G L+LP+     G  + LPG+PPL  
Sbjct  123  LPWALDVAKKFGLLGATFLTQSCAVYCIYYHANRGFLKLPL----TGNEISLPGMPPLEP  178

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PS +    SYPA   + ++ QF N+   DW+  NT+ ELE EV   + + WP + IG
Sbjct  179  QDMPSIVYDLGSYPAISDLVLKNQFDNIDKVDWVLCNTFYELEEEVAEWLGRHWPLRAIG  238

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS YLD ++E +K YG S++K   E C+KWL  +   SVVY+SFGS  +L
Sbjct  239  PTVPSMYLDKQLEDEKDYGFSIFKQSNESCIKWLNDQAKGSVVYVSFGSAATL  291



>ref|XP_004245060.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Solanum lycopersicum]
Length=460

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 108/172 (63%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+++G+ GA FFT + AV  ++ +IH G L LP+    +   + + G+  L  
Sbjct  118  MPWALDVAKKYGLIGACFFTQACAVNYIYYYIHHGKLTLPI----SSTNVKISGLSELEL  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI    +YPAY  M + QF+NV  AD++F N++ +LE+EV   +SK+ P   IGP
Sbjct  174  RDMPSFIYVHGTYPAYFEMVLNQFTNVDKADYVFVNSFYKLEAEVADTMSKISPLSTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS Y+D R+E D  YG +L+      C+ WL +KP  SVVY +FGSM + 
Sbjct  234  TLPSFYMDNRVENDIEYGLNLFHVDSSTCINWLNTKPEGSVVYAAFGSMSTF  285



>ref|XP_008460408.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Cucumis melo]
Length=460

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 107/170 (63%), Gaps = 5/170 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+   +  A FFT S AV  ++ H+H G ++LP+   E+     +PG+P +  
Sbjct  118  LPWALDVAKEFQIATAVFFTQSCAVANIYYHVHKGLIDLPLPNRESE----IPGLPLMKP  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             + PSFI    SYPAY  + + Q++NV  ADWIF NT+ ELE EV+  + K WP+ + IG
Sbjct  174  AEFPSFIYQLGSYPAYYDLLVNQYANVDKADWIFCNTFDELEREVLEYLKKTWPSIRAIG  233

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            P +PS YLDG IEGD+ YG S+    G+   KWL  +   SVVY+SFGS+
Sbjct  234  PSIPSGYLDGGIEGDREYGLSILDLDGDVSRKWLDGRRKGSVVYVSFGSI  283



>emb|CAN67249.1| hypothetical protein VITISV_008684 [Vitis vinifera]
Length=419

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WA D+  R  V GA FFT S AV  ++ H++ G+ ++P+E    G  + +P +P L   D
Sbjct  82   WAQDIVERLSVDGAPFFTQSCAVSTIYYHVNQGAFKIPLE----GPTVSIPSMPILGVND  137

Query  189  IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMV  368
            +PSFI    SYP   ++   QFSN    +W+F NT+ ELE EVV  ++   P K IGP +
Sbjct  138  LPSFINDTSSYPTLWSLVKTQFSNFEKVNWVFFNTFCELEDEVVKWLASKRPIKTIGPTI  197

Query  369  PSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            PS YLD RI+ D+ YG SL+KP  + C+ WL +K   SVVY+SFGS+ SL
Sbjct  198  PSMYLDRRIDDDEDYGLSLFKPNADACITWLDTKDTVSVVYVSFGSLASL  247



>ref|XP_006307446.1| hypothetical protein CARUB_v10009070mg [Capsella rubella]
 gb|EOA40344.1| hypothetical protein CARUB_v10009070mg [Capsella rubella]
Length=462

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 109/171 (64%), Gaps = 4/171 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVAR  GV  AAFFTN+  VC+V      G   LP +   N A   + G+P L  
Sbjct  117  LPWGLDVARSMGVSAAAFFTNNLTVCSVMRKFSNGEFTLPAD--PNWALFRVRGLPSLSY  174

Query  183  PDIPSFITAP-DSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVA-GVSKVWPAKLI  356
             ++PSF+     ++P +  + + QF N  NADW+F N ++ LE++    G S+   A LI
Sbjct  175  HELPSFVGRHWSTHPEHGRVLLNQFPNHENADWLFVNGFEGLETQDCEDGESEAMRATLI  234

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            GPM+PS+YLD RI+GD+ YGASL KP+ EEC++WL +KP QSVV+ISFGS 
Sbjct  235  GPMIPSAYLDDRIKGDRDYGASLLKPISEECMEWLGTKPAQSVVFISFGSF  285



>gb|KDP45197.1| hypothetical protein JCGZ_15062 [Jatropha curcas]
Length=463

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 109/172 (63%), Gaps = 3/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW L+VA+++G+ GA FFT S AV  ++ +++ G ++ P++ E     ++ PG+ PL  
Sbjct  118  MPWCLEVAKKNGLVGAVFFTQSCAVDIIYYNVYKGLIKPPLDRE---TQVLAPGLTPLEV  174

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    S PA   M + QFSN+   DW+  NT+ ELE E    ++K+WP + IGP
Sbjct  175  EDLPSFVHHFGSDPAVFDMLVDQFSNIDEVDWVLCNTFYELEQEAADWLAKLWPLRTIGP  234

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD +++ DK YG  ++KP  E C  WL  KP  SVVY+SFGS+ +L
Sbjct  235  TIPSMYLDKQLQDDKDYGFYIYKPNNEACKNWLNGKPKGSVVYVSFGSLATL  286



>ref|XP_007201692.1| hypothetical protein PRUPE_ppa016444mg [Prunus persica]
 gb|EMJ02891.1| hypothetical protein PRUPE_ppa016444mg [Prunus persica]
Length=464

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 114/170 (67%), Gaps = 4/170 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDVA+R G+  AAFFT S AV  +++ +H G L+LP+  +   + ++LPG+PPL  
Sbjct  123  FPWALDVAKRVGIAAAAFFTVSCAVTNIYSLVHNGLLKLPLNPD---SEILLPGLPPLQP  179

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAG-VSKVWPAKLIG  359
             D PSFI  P+SYP +L + +  FSN+  ADW+F NT+ ELE EV+    +K W  + IG
Sbjct  180  SDTPSFIYVPESYPDFLKLSVDLFSNLCKADWVFCNTFYELEQEVIEYWTTKFWTFRTIG  239

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            P +PS YLD R E +K YG SL K   + C+KWL +KP  SV Y+SFGSM
Sbjct  240  PTIPSMYLDKRHEDNKEYGLSLLKLKSDACMKWLNAKPKGSVAYMSFGSM  289



>ref|XP_004162644.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Cucumis sativus]
Length=457

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 108/170 (64%), Gaps = 5/170 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA    +  A FFT S AV  ++ H+H G ++LP+   E    + +PG+P +  
Sbjct  118  LPWVLDVANELQIATAVFFTQSCAVANIYYHVHKGLIDLPLPNRE----IEIPGLPLMKP  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             + PSFI    +YPAY  + + Q++NV  ADWI  NT++ELE EV+  + K+WP+ + IG
Sbjct  174  AEFPSFIYQLGTYPAYYDLLVNQYANVDKADWILCNTFEELEREVLEYLKKIWPSIRAIG  233

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            P +PS YLDGRIEGD+ YG S+    G+   KWL+ +   SVVY+SFGS+
Sbjct  234  PSIPSGYLDGRIEGDREYGMSILDLDGDVSRKWLEGRRKGSVVYVSFGSI  283



>ref|XP_003632087.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Vitis vinifera]
Length=452

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WA D+  R  V GA FFT S AV  ++ H++ G+ ++P+E    G  + +P +P L   D
Sbjct  115  WAQDIVERLSVDGAPFFTQSCAVSTIYYHVNQGAFKIPLE----GPTVSIPSMPILGVND  170

Query  189  IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMV  368
            +PSFI    SYP   ++   QFSN    +W+F NT+ ELE EVV  ++   P K IGP +
Sbjct  171  LPSFINDTSSYPTLWSLVKTQFSNFEKVNWVFFNTFCELEDEVVKWLASKRPIKTIGPTI  230

Query  369  PSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            PS YLD RI+ D+ YG SL+KP  + C+ WL +K   SVVY+SFGS+ SL
Sbjct  231  PSMYLDRRIDDDEDYGLSLFKPNADACITWLDTKDTVSVVYVSFGSLASL  280



>ref|XP_008233915.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=447

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 118/172 (69%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              WALD+A+  G+ GA+FFT+S AV  V+ ++H G L +P++       ++LPG+P L  
Sbjct  108  MTWALDMAKGLGIAGASFFTHSCAVGTVYCNVHQGVLSVPLK----EGPILLPGLPLLEP  163

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI  P SYP++L + + +FSN+ +ADWIF N++  LE EVV+ +   WP K IGP
Sbjct  164  HDLPSFIYDPGSYPSFLKLVVGRFSNITDADWIFWNSFDCLEQEVVSWMRTRWPIKTIGP  223

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E D+ YG +L+ P  + C+KWL+SK   +VVY+SFGSM +L
Sbjct  224  TLPSMYLDKRLEDDRDYGFNLFTPNTDTCIKWLESKDTGTVVYVSFGSMANL  275



>ref|XP_004144461.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Cucumis sativus]
Length=490

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 108/170 (64%), Gaps = 5/170 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA    +  A FFT S AV  ++ H+H G ++LP+   E    + +PG+P +  
Sbjct  151  LPWVLDVANELQIATAVFFTQSCAVANIYYHVHKGLIDLPLPNRE----IEIPGLPLMKP  206

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             + PSFI    +YPAY  + + Q++NV  ADWI  NT++ELE EV+  + K+WP+ + IG
Sbjct  207  AEFPSFIYQLGTYPAYYDLLVNQYANVDKADWILCNTFEELEREVLEYLKKIWPSIRAIG  266

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            P +PS YLDGRIEGD+ YG S+    G+   KWL+ +   SVVY+SFGS+
Sbjct  267  PSIPSGYLDGRIEGDREYGMSILDLDGDVSRKWLEGRRKGSVVYVSFGSI  316



>ref|NP_001274852.1| UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
 gb|AFX67035.1| UDP-glucose:glucosyltransferase [Solanum tuberosum]
Length=462

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 114/170 (67%), Gaps = 4/170 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PWA++VA++ G+  AAFFT + AV  ++ H+H G ++LP    ++ A +++PG+   + 
Sbjct  113  LPWAVEVAKKFGLVSAAFFTQNCAVDNIYYHVHKGVIKLPPT--QHDAKILIPGLSCTIE  170

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF ++P+S    + + + QFSN+   DW+  N++ ELE EV+  +SK++P K IG
Sbjct  171  SSDVPSFESSPES-DKLVELLVNQFSNLEKTDWVLINSFYELEKEVIDWMSKIYPIKTIG  229

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSM  509
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SV+Y+SFGS+
Sbjct  230  PTIPSMYLDKRLHDDKEYGLSIFKPMTNECLNWLNHQPISSVLYVSFGSL  279



>ref|XP_010679010.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=464

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 106/171 (62%), Gaps = 1/171 (1%)
 Frame = +3

Query  6    PWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGP  185
            PWALDVA++ G+ G  FFT S +V +++ H+  G +ELP+ +      + +PG+P L   
Sbjct  124  PWALDVAKKFGLVGVLFFTQSCSVNSIYYHVQRGLIELPL-LGPGPNTVSVPGVPELQPW  182

Query  186  DIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            ++PSF+    SYP +    M QFS++   DW+  N + ++E EVV  +SK+W  K IGP 
Sbjct  183  EVPSFVENYGSYPFWFDAVMEQFSSIDQVDWVLCNIFYDMEIEVVDWMSKMWKVKTIGPT  242

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            VPS YLD R+E DK Y   L+KP    C  WL SKP +SV+YISFGS   L
Sbjct  243  VPSYYLDKRLEDDKDYSLQLFKPNTVLCKNWLDSKPKESVIYISFGSAAEL  293



>ref|XP_009599369.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74F2-like 
[Nicotiana tomentosiformis]
Length=456

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 107/172 (62%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+ HG+ GA FFT + AV  ++ ++H G L LP+    +   + + G+P L  
Sbjct  118  MPWALDVAKDHGLIGACFFTQACAVNYIYYYVHHGKLTLPI----SSPPVRILGLPELEL  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI    +YPAY  + + QF N   AD++F N++ +LE+EVV  +SKV P   IGP
Sbjct  174  RDMPSFIYVHGTYPAYFELVLNQFINGDKADYVFVNSFYKLEAEVVDTMSKVTPLSTIGP  233

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS YLD R E D  YG  L++     C+ WL +K   SVVY++FGSM +L
Sbjct  234  TVPSLYLDNRAENDIEYGLXLYQVDASTCINWLNTKAEGSVVYVAFGSMSTL  285



>ref|XP_003624252.1| UDP-glucosyltransferase, putative [Medicago truncatula]
 gb|AES80470.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=459

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 110/173 (64%), Gaps = 6/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPW LDVA+R G+ G +F T + +V +++ H+  G L +P++++E    + LP +P L  
Sbjct  112  FPWTLDVAKRLGIFGVSFLTQNVSVNSIYYHVLVGKLRVPLDVQE----ISLPVLPQLQH  167

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF+   +  P +L + + QFSN+  ADWI  N++ EL  E      K+WP  + IG
Sbjct  168  RDMPSFVLTYEKDPTFLELAVGQFSNICKADWILCNSFHELHQEGADWSMKIWPNFRTIG  227

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD RI+ D+ YGA+ ++   EEC++WL  KP  SVVY SFGS+ SL
Sbjct  228  PSIPSKFLDKRIKNDEDYGATQFQS-EEECMEWLNDKPKGSVVYASFGSLASL  279



>ref|XP_006357101.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Solanum tuberosum]
Length=558

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 110/173 (64%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PWA++VA+   +  AAFFT + AV  ++ H+H G ++LP    +N   +++PG    + 
Sbjct  113  LPWAVEVAKNFRLVSAAFFTQNCAVDNIYYHVHKGVIKLPPT--QNDEEILIPGFSSTIE  170

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF+ +P++    L M   QFSN+   DW+  N++ ELE EV+  +SK++P K IG
Sbjct  171  ASDVPSFVISPEAE-RILEMLANQFSNLDKVDWVLINSFHELEKEVIDWMSKIYPIKTIG  229

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SVVY+SFGS+  L
Sbjct  230  PTIPSIYLDKRLHDDKEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLAKL  282



>dbj|BAG80541.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=463

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 112/173 (65%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PWA++VA+  G+  AAFFT + AV  ++ H+H G L+LP    ++   +++PG   P+ 
Sbjct  113  LPWAVEVAKDFGLVSAAFFTQNCAVDNIYYHVHKGVLKLPPT--QDDEEILIPGFSCPIE  170

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF+ +P++    L M + QFSN+   DW+  N++ ELE EV+  +SK++P K IG
Sbjct  171  SSDVPSFVISPEA-ARILDMLVNQFSNLDKVDWVLINSFYELEKEVIDWMSKIYPIKTIG  229

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+  ECL WL  +   SVVY+SFGS+  +
Sbjct  230  PTIPSMYLDNRLPDDKEYGLSVFKPMTNECLNWLNHQLISSVVYVSFGSLAKV  282



>ref|XP_009783229.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Nicotiana sylvestris]
Length=462

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 113/173 (65%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELP-VEIEENGAALVLPGIPPLY  179
             PWA++VA++ G+  AAFFT S  V  ++ H+H G L+LP  +I+E    + +PG+  + 
Sbjct  113  LPWAVEVAKKFGLATAAFFTQSCTVDNIYYHVHKGVLKLPPTDIDEE---ISIPGLLTVE  169

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+P+F  +P+S    L M + QFSN+   DW+  N++ ELE EV+  +S+V+P K IG
Sbjct  170  TSDVPTFEISPES-ARVLEMLVNQFSNLEKVDWVLINSFYELEKEVIDWMSEVYPIKTIG  228

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+ + CL WL  +P  SVVY+SFGS+  +
Sbjct  229  PAIPSMYLDKRLPDDKEYGLSVFKPMTDACLNWLNHQPVSSVVYVSFGSLAKV  281



>gb|KHN45525.1| UDP-glycosyltransferase 74E2 [Glycine soja]
Length=429

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 109/173 (63%), Gaps = 7/173 (4%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDV +R G+ GA++ T +  V  ++ H+H G+L+ P++  E    + LP +P L  
Sbjct  92   FPWALDVTKRFGILGASYLTQNMTVNNIYYHVHLGTLQAPLKEHE----ISLPKLPKLQH  147

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF    +  P+ L   + QFSN+  ADWI  NTY EL+ E+V  + ++WP  + IG
Sbjct  148  EDMPSFFFTYEEDPSMLDFFVVQFSNIDKADWILCNTYYELDKEIVDWIMEIWPKFRSIG  207

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R E D+ YG + +K   +EC++WL  KP  SVVY+SFGS+ + 
Sbjct  208  PNIPSLFLDKRYENDQDYGVTEFK--RDECIEWLDDKPKGSVVYVSFGSIATF  258



>ref|XP_009630994.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana tomentosiformis]
Length=456

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 113/169 (67%), Gaps = 5/169 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELP-VEIEENGAALVLPGIPPLY  179
             PWA++V  + G+  AAFFT S AV  ++ H+  G ++LP +E+++    +++PG+  + 
Sbjct  114  LPWAVEVGNKFGLVTAAFFTQSCAVDNIYYHVLKGVIKLPPIEVDKE---IIVPGLVTIE  170

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+P+F++ P+S    L M + QFSN+ N DW+  N++ ELE+EV+  +SK++P   IG
Sbjct  171  SSDVPTFVSNPES-AKILEMLVDQFSNLENVDWVLINSFYELENEVIDWMSKLYPISTIG  229

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGS  506
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SVVY+SFGS
Sbjct  230  PTIPSVYLDKRLPNDKEYGLSVFKPMTNECLNWLNHQPISSVVYVSFGS  278



>gb|KDP45202.1| hypothetical protein JCGZ_15067 [Jatropha curcas]
Length=454

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 108/172 (63%), Gaps = 5/172 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              WALDVA++ G+    FFT S AV  ++ H+  G L LP++     +++ +PG+P L  
Sbjct  118  LTWALDVAKQFGLFAVVFFTQSCAVNNIYYHVQRGLLPLPLK-----SSVSVPGLPLLQV  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             + PSFI+   SYP +  + + QFSN   ADWI  N++ +LE E V  ++K W  + IGP
Sbjct  173  SETPSFISIWGSYPGFSHLLVNQFSNFDEADWILYNSFYKLEEEAVDWMAKRWRLRTIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E DK YG +L++P    CL WL+ KP+ SVVY+SFGSM  L
Sbjct  233  TLPSMYLDKRLEDDKHYGINLFEPDTTACLNWLQDKPSGSVVYVSFGSMAQL  284



>ref|XP_010321783.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Solanum lycopersicum]
Length=460

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 104/173 (60%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGI-PPLY  179
             PW LDVA+  G+    FFT S AV  +F HI    L+LPVE  +    ++LPG+  PL 
Sbjct  117  MPWILDVAKMFGLVSGVFFTMSCAVENIFYHIQLKELKLPVEGHDQ---VLLPGLLQPLV  173

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF+    SYP +L M + QFSN+  ADWI  NT  ELE   V  ++K    + IG
Sbjct  174  PSDLPSFVNDMGSYPPFLKMLVDQFSNIQEADWILCNTIYELEKHEVDWITKRLRLRTIG  233

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS Y+D R+E D  YG S++KP  + C+KWL    + SVVY+SFGSM  L
Sbjct  234  PTIPSMYVDKRLENDNSYGLSIYKPKSDVCMKWLSDCDDGSVVYVSFGSMAEL  286



>ref|XP_007033644.1| Uridine diphosphate glycosyltransferase 74E2 [Theobroma cacao]
 gb|EOY04570.1| Uridine diphosphate glycosyltransferase 74E2 [Theobroma cacao]
Length=525

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 109/172 (63%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALD+A+  G+  AAFFT S AV  ++ ++H G ++LP+      ++L + G+P L  
Sbjct  186  IPWALDIAKHLGLPAAAFFTQSCAVDTIYYNVHEGLVKLPLA----ESSLSIDGLPLLQE  241

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYPA L   + QFSN   ADW+F NT+  LE EV+  ++   P K IGP
Sbjct  242  CDLPSFVYDIGSYPALLHTCVNQFSNFMEADWVFINTFTSLEDEVLNWMASQRPIKAIGP  301

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E D+ YG  L+KP  + C+ WL SK   SVVYISFGS+ +L
Sbjct  302  AIPSKYLDKRVEDDEEYGLHLFKPEIDICINWLNSKETGSVVYISFGSLAAL  353



>ref|XP_006388126.1| hypothetical protein POPTR_0322s00200g [Populus trichocarpa]
 gb|ERP47040.1| hypothetical protein POPTR_0322s00200g [Populus trichocarpa]
Length=461

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 113/173 (65%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW L++AR+ G+ GA+FFT S AV +V+  IH G L++P+E       + +PG+PPL  
Sbjct  112  MPWVLEIARQLGLIGASFFTQSCAVSSVYYQIHEGQLKIPLE----KFPVSVPGLPPLDV  167

Query  183  PDIPSFITAPDS-YPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             ++PSF+   +S Y + L + + QF N   ADW+F N++  LE EVV G++     K IG
Sbjct  168  DELPSFVHDMESEYSSILTLVVNQFLNFRGADWVFVNSFNTLEEEVVNGLASQRSIKPIG  227

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            PM+PS YLD ++E D  YG SL+KP  + C++WL SK   SVVY+SFG++ +L
Sbjct  228  PMIPSVYLDRQLEDDTEYGLSLFKPALDGCMEWLDSKETGSVVYVSFGTLAAL  280



>gb|KDO41311.1| hypothetical protein CISIN_1g038830mg, partial [Citrus sinensis]
Length=335

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 105/164 (64%), Gaps = 5/164 (3%)
 Frame = +3

Query  30   RHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPDIPSFITA  209
            + G+ GAAF T S AV  ++ H++ G ++LP+     G  +++PG+ PL   D PSFI  
Sbjct  1    KFGLIGAAFLTQSCAVAGIYHHMNKGLIKLPL----TGDQVLVPGLRPLDPQDTPSFIND  56

Query  210  PDSYPAYLAMKM-RQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMVPSSYLD  386
              SYPA+  M + RQFSN+  ADWI  NT+ ELE EV   + K W  + IGP +PS YLD
Sbjct  57   SASYPAFFDMIITRQFSNIDKADWILCNTFYELEKEVTEWLGKHWLLRTIGPTLPSIYLD  116

Query  387  GRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +IE DK YG S+++P  E  +KWL  + N SVVY+SFGSM +L
Sbjct  117  KQIEDDKEYGFSIFEPDIESSMKWLNDRANGSVVYVSFGSMATL  160



>ref|XP_003554595.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Glycine max]
Length=454

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 109/173 (63%), Gaps = 7/173 (4%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDV +R G+ GA++ T +  V  ++ H+H G+L+ P++  E    + LP +P L  
Sbjct  117  FPWALDVTKRFGILGASYLTQNMTVNNIYYHVHLGTLQAPLKEHE----ISLPKLPKLQH  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF    +  P+ L   + QFSN+  ADWI  NTY EL+ E+V  + ++WP  + IG
Sbjct  173  EDMPSFFFTYEEDPSMLDFFVVQFSNIDKADWILCNTYYELDKEIVDWIMEIWPKFRSIG  232

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R E D+ YG + +K   +EC++WL  KP  SVVY+SFGS+ + 
Sbjct  233  PNIPSLFLDKRYENDQDYGVTEFK--RDECIEWLDDKPKGSVVYVSFGSIATF  283



>ref|XP_009776061.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana sylvestris]
Length=459

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 112/173 (65%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PWA++VA+  G+  AAFFT +  V  ++ H+H G L+LP   + +G  L+ PG+   + 
Sbjct  113  LPWAVEVAKDFGLVSAAFFTQNCVVDNIYYHVHKGVLKLP-PTQVDGEILI-PGLSSTIE  170

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF ++P S    + M + QFSN+   DW+  N++ ELE EV+  ++K++P K IG
Sbjct  171  SSDVPSFESSPQS-EKLVEMLVNQFSNLEKVDWVLINSFYELEKEVIDWMAKLYPIKTIG  229

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG SL+KP+ +ECL WL  +P  SVVY+SFGSM  L
Sbjct  230  PTIPSMYLDKRLPNDKEYGLSLFKPMAKECLNWLNHQPISSVVYVSFGSMAKL  282



>ref|XP_008235865.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=464

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 114/173 (66%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDVA+R G+  AAF T S AV  +F+ +H G L+LP+      + ++LPG+PPL  
Sbjct  123  FPWALDVAKRVGIAAAAFVTVSCAVTNIFSLVHNGLLKLPLN---PNSQILLPGLPPLQP  179

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAG-VSKVWPAKLIG  359
             D PSFI  P+SYPA+L + +  FSN+  ADW+F NT+ ELE EV+   ++K W  + IG
Sbjct  180  SDTPSFIHVPESYPAFLKLSVDLFSNLCKADWVFCNTFYELEQEVIEYWMTKFWTLRTIG  239

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R E +  YG SL K   + C+KWL +KP  SV Y+SFGS+  L
Sbjct  240  PTIPSMYLDKRHEDNNEYGLSLLKLNSDPCMKWLNAKPKGSVAYMSFGSLAEL  292



>emb|CAN70002.1| hypothetical protein VITISV_033171 [Vitis vinifera]
Length=459

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 110/173 (64%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GA FFT S  V  ++ H+H G L+LP    E    +V+PG+ PL  
Sbjct  119  LPWALDVAKKLGLVGAVFFTQSCTVNNIYYHVHQGMLKLPHSEPE----VVVPGLFPLQA  174

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAG-VSKVWPAKLIG  359
             D+PS +    SYP +  M + QFSN+   DW+F NT+ +LE +VV   ++K+ P + IG
Sbjct  175  CDLPSLVYLYGSYPDFFNMLVNQFSNIEKVDWVFYNTFYKLEEKVVEYWMAKICPLRTIG  234

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS+YL+ R+  DK YG ++ KP+   C++WL  KPN SVVY S+GS   L
Sbjct  235  PTLPSAYLNKRLGDDKDYGLNMLKPVTGACMEWLDGKPNGSVVYASYGSFAVL  287



>gb|ACU19612.1| unknown [Glycine max]
Length=454

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 109/173 (63%), Gaps = 7/173 (4%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDV +R G+ GA++ T +  V  ++ H+H G+L+ P++  E    + LP +P L  
Sbjct  117  FPWALDVTKRFGILGASYLTQNMTVNNIYYHVHLGTLQAPLKEHE----ISLPKLPKLQH  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF    +  P+ L   + QFSN+  ADWI  NTY EL+ E+V  + ++WP  + IG
Sbjct  173  EDMPSFFFTYEEDPSMLDFFVVQFSNIDKADWILCNTYYELDKEIVDWIMEIWPKFRSIG  232

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R E D+ YG + +K   +EC++WL  KP  SVVY+SFGS+ + 
Sbjct  233  PNIPSLFLDKRYENDQDYGVTEFK--RDECIEWLDDKPKGSVVYVSFGSIATF  283



>ref|XP_006372895.1| hypothetical protein POPTR_0017s06080g [Populus trichocarpa]
 gb|ERP50692.1| hypothetical protein POPTR_0017s06080g [Populus trichocarpa]
Length=350

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 112/173 (65%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW L++AR+ G+ GA+FFT S AV +V+  IH G L++P+E       + + G+PPL  
Sbjct  1    MPWVLEIARQLGLIGASFFTQSCAVNSVYYQIHEGQLKIPLE----KFPVSVQGLPPLDV  56

Query  183  PDIPSFITAPDS-YPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             ++PSF+   +S Y + L + + QFSN   ADWIF N++  LE EVV  ++     K IG
Sbjct  57   DELPSFVHDMESEYSSILTLVVNQFSNFRGADWIFVNSFNTLEEEVVNCLASQRSIKPIG  116

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            PM+PS YLD ++E D  YG SL+KP  + C++WL SK   SVVY+SFGS+ +L
Sbjct  117  PMIPSVYLDRQLEDDTEYGLSLFKPAVDGCMEWLDSKETGSVVYVSFGSLAAL  169



>ref|XP_007151254.1| hypothetical protein PHAVU_004G031100g [Phaseolus vulgaris]
 gb|ESW23248.1| hypothetical protein PHAVU_004G031100g [Phaseolus vulgaris]
Length=458

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 108/173 (62%), Gaps = 9/173 (5%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            F WALDVA+R GV GAA+ T +  V +++ H+H G+L+ P+  +E    +  P +P L+ 
Sbjct  118  FSWALDVAKRFGVVGAAYLTQNMTVNSIYYHVHLGNLQSPLTQDE----ISFPALPTLHL  173

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF    D    +L   + QFSN+  ADWI  NT+ EL+ E+   + KVWP  K IG
Sbjct  174  QDMPSFFFNED--LGFLDFVVSQFSNIDKADWILCNTFYELDKEIADWIVKVWPKFKTIG  231

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD + E D+ YG + +K   EEC++WL  KP  SVVY+SFGSM S 
Sbjct  232  PNIPSFFLDKQYEDDQDYGVTQFK--SEECMEWLDDKPKGSVVYVSFGSMASF  282



>ref|XP_011082055.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=476

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 116/172 (67%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA+  G+  AAFFT+S AV  ++ H+  G L++P+    +G  ++LPG+PPL  
Sbjct  129  LPWGLDVAKEFGMAAAAFFTHSCAVDQIYYHVFKGELKVPL----SGEEILLPGLPPLMP  184

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    +YP +L M + +FS + NADW+F NT+ +LE EV+  ++K +P K +GP
Sbjct  185  DDMPSFVHVHGAYPPFLEMTVNRFSGLENADWLFFNTFYKLEEEVIDNMAKFFPVKTVGP  244

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+  D+ YG S++ P  E C++WLK +  +SVVY+SFGS+  L
Sbjct  245  TIPSMYLDKRLSDDREYGLSIYNPDTEACMEWLKQRQPESVVYVSFGSLAKL  296



>emb|CBI24721.3| unnamed protein product [Vitis vinifera]
Length=717

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WA D+  R  V GA FFT S AV  ++ H++ G+ ++P+E    G  + +P +P L   D
Sbjct  112  WAQDIVERLSVDGAPFFTQSCAVSTIYYHVNQGAFKIPLE----GPTVSIPSMPILGVND  167

Query  189  IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMV  368
            +PSFI    SYP   ++   QFSN    +W+F NT+ ELE EVV  ++   P K IGP +
Sbjct  168  LPSFINDTSSYPTLWSLVKTQFSNFEKVNWVFFNTFCELEDEVVKWLASKRPIKTIGPTI  227

Query  369  PSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            PS YLD RI+ D+ YG SL+KP  + C+ WL +K   SVVY+SFGS+ SL
Sbjct  228  PSMYLDRRIDDDEDYGLSLFKPNADACITWLDTKDTVSVVYVSFGSLASL  277


 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 97/172 (56%), Gaps = 8/172 (5%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWA DVA   G+ G  FFT S AV  ++ H + G L+ P+E    G  + +P +P L  
Sbjct  455  MPWAQDVAEPLGLDGVPFFTQSCAVSTIYYHFNQGKLKTPLE----GYTVSIPSMPLLCI  510

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI         L   ++QFSN     WI  NT+ +LE EV+  ++ + P K IGP
Sbjct  511  NDLPSFINDK----TILGFLLKQFSNFQKVKWILFNTFDKLEEEVMKWMASLRPIKTIGP  566

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS YLD R+E DK YG SL+K   +  + WL  K   SVVY SFGSM SL
Sbjct  567  TVPSMYLDKRLEEDKEYGLSLFKQNVDAYIAWLDLKGIGSVVYASFGSMASL  618



>gb|KEH25946.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=461

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 104/172 (60%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW +DVA+   ++ A F T +  V ++  H   G L+LP+  +E    +VLPG+P L  
Sbjct  119  LPWVVDVAKEFELYVAVFLTQACCVNSINFHAFKGWLDLPLLEKE----IVLPGLPKLEA  174

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    ++P Y  +   QFS +   DW+ ANT+ ELE EVV  + K+W  K IGP
Sbjct  175  ADLPSFLYKYGTHPGYFDILTNQFSMIDQVDWVLANTFYELEPEVVDWLKKIWSLKTIGP  234

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS +LD RI+ D  YG +++ P  E C+KWL  KP  SVVY+SFGS  SL
Sbjct  235  CVPSMFLDRRIQDDNDYGINIFNPNSESCIKWLDDKPKGSVVYVSFGSRSSL  286



>ref|XP_011085046.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Sesamum indicum]
Length=465

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA+++ + GAAFFT S AV  V+ + H G L LP+        + LPG+PPL  
Sbjct  118  LPWVLDVAKKYAIKGAAFFTQSCAVNYVYYYAHHGLLTLPLSTP---PPVELPGLPPLDL  174

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI    SYPAY  M + QFSNV  AD++  NT+ +LE  V+  ++KV P   IGP
Sbjct  175  SDMPSFIYVHGSYPAYFQMVLSQFSNVEKADFVLVNTFYKLEETVIDSMTKVCPLITIGP  234

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGE--ECLKWLKSKPNQSVVYISFGSMVSL  518
             VPS YLD R+E D  Y  +L++   +    + WL +KP  S+VYI+FGSM +L
Sbjct  235  TVPSVYLDKRVENDHNYDLNLFQSDTQLSSIINWLDTKPPASIVYIAFGSMSNL  288



>ref|XP_006447933.1| hypothetical protein CICLE_v10015155mg [Citrus clementina]
 gb|ESR61173.1| hypothetical protein CICLE_v10015155mg [Citrus clementina]
Length=464

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 110/171 (64%), Gaps = 5/171 (3%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WALDVA++ G+ GA F + S AV  ++ H+  GSLELP+     G  ++LPG+P L   D
Sbjct  125  WALDVAKKFGLLGAPFLSQSCAVDYIYYHVKKGSLELPL----TGNEILLPGMPSLEPQD  180

Query  189  IPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            +PSFI    SYPA   M M+ QF N+  ADW+  NT+ ELE EVV  + K W  + IGP 
Sbjct  181  MPSFIHDLGSYPAVSYMMMKFQFENIDKADWVLCNTFYELEEEVVEWLRKTWSLRTIGPT  240

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS YLD +IE DK YG S++K   E C+KWL  +  +SVVY+S+GS V L
Sbjct  241  IPSFYLDKQIEDDKDYGFSMFKSSTEACMKWLNDRAEESVVYVSYGSFVEL  291



>emb|CDP06918.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 110/168 (65%), Gaps = 4/168 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              WALDVA++ G+  A+FFT + AV +++ +++ G L +P+    + + + LPG+P L  
Sbjct  115  LTWALDVAKQFGLVTASFFTQTCAVNSIYYNVYHGLLPVPL----SDSPISLPGLPLLQP  170

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             + PSF+  PDS PA+L + + QFSN+  ADW+  N + +LE + +  ++K+W    +GP
Sbjct  171  KETPSFVYLPDSSPAFLHLLVNQFSNIDQADWVILNNFHKLEEDALNWMAKLWRVITVGP  230

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGS  506
             VPS YLD R+E D GYG +L+KP    C+ WL S+P  SVVY++FGS
Sbjct  231  TVPSIYLDKRLEDDIGYGINLFKPESSLCINWLNSQPKDSVVYVAFGS  278



>ref|XP_004244485.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum lycopersicum]
Length=456

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 111/173 (64%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PWA++VA++ G+  AAFFT +  V  ++ H+H G ++LP    +N   +++PG P  + 
Sbjct  113  IPWAVEVAKQFGLISAAFFTQNCVVDNLYYHVHKGVIKLPPT--QNDEEILIPGFPNSID  170

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF+ +P++    + M   QFSN+   D +  N++ ELE EV+  +SK++P K IG
Sbjct  171  ASDVPSFVISPEA-ERIVEMLANQFSNLDKVDCVLINSFYELEKEVIEWMSKIYPIKTIG  229

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SVVY+SFGS+  L
Sbjct  230  PTIPSMYLDKRLHDDKEYGLSVFKPMTNECLNWLNHQPISSVVYVSFGSITKL  282



>gb|AGZ84547.1| glycosyltransferase KGT18 [Pueraria montana var. lobata]
Length=454

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 106/173 (61%), Gaps = 7/173 (4%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDV +R G+ GA + T +  V  ++ H+H G L+ P++  E    + LP +P L  
Sbjct  117  FPWALDVTKRFGIVGAVYLTQNMTVNNIYYHVHLGRLQAPLKDHE----ISLPKLPKLQH  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF    +  P  L   + QFSN+  ADWI  NTY EL+ E++  + ++WP  + IG
Sbjct  173  EDMPSFFFTYEQDPTLLDFVVAQFSNIDKADWILCNTYYELDKEIIDWIMEIWPKFRSIG  232

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R E D+ YG + +K   ++C+KWL  KP  SVVY+SFGS+ + 
Sbjct  233  PNIPSLFLDKRYEDDQDYGITEFK--SDDCMKWLDDKPKGSVVYVSFGSIATF  283



>gb|KDO43524.1| hypothetical protein CISIN_1g012277mg [Citrus sinensis]
Length=467

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 110/174 (63%), Gaps = 8/174 (5%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WALDVA++ G+ GA F T S AV  ++ H+  GSLELP+     G  ++LPG+PPL   D
Sbjct  125  WALDVAKKFGLLGAPFLTQSCAVDYIYYHVKKGSLELPL----TGNEILLPGMPPLEPQD  180

Query  189  IPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAG---VSKVWPAKLI  356
            +PSFI    SYPA   M M+ QF N+  ADW+  NT+ ELE EV      + K W  + I
Sbjct  181  MPSFIHDLGSYPAVSYMMMKFQFENIDKADWVLCNTFYELEEEVAVVVEWLRKTWSLRTI  240

Query  357  GPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            GP +PS YLD +IE DK YG S++K   E C+KWL  +  +SVVY+S+GS V L
Sbjct  241  GPTIPSFYLDKQIEDDKDYGFSMFKSSTEACMKWLNDRAKESVVYVSYGSFVEL  294



>gb|AGU14135.1| UDP-glycosyltransferase [Cicer arietinum]
Length=436

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 109/173 (63%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            +PWALDVA+R G+ G AF T +  + +++ H + G L +P++++EN   + LP +P L  
Sbjct  92   YPWALDVAKRFGIVGVAFLTQNIGIHSIYYHAYMGKLRVPLDVKEN---ISLPMLPQLQY  148

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF    +  P +L + + QFSN+  ADWI  N++ EL  EV      +WP  + IG
Sbjct  149  RDMPSFFHTYEKDPTFLHLCLDQFSNMDKADWILCNSFYELHQEVADWTMNIWPNFRTIG  208

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD RI+ D+ YGA  +K   E C++WL  KP  SVVY+SFGS+ SL
Sbjct  209  PSIPSMFLDKRIKYDEDYGAPQFKS-EEYCMEWLNDKPKGSVVYVSFGSLASL  260



>ref|XP_006447240.1| hypothetical protein CICLE_v10015138mg [Citrus clementina]
 ref|XP_006469903.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
 gb|ESR60480.1| hypothetical protein CICLE_v10015138mg [Citrus clementina]
Length=468

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 110/173 (64%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GAAF T S  V  ++ H++ G L+LP+      + L+LPG+PPL  
Sbjct  125  LPWALDVAKKFGLVGAAFLTQSCVVDCIYYHVNKGLLKLPLLD----SQLLLPGMPPLEP  180

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSF+    SYPA   M ++ QF N+  ADW+  NT+ ELE EV   + K W  K IG
Sbjct  181  QDMPSFVYDLGSYPAVSDMVVKYQFDNIDKADWVLCNTFYELEKEVAQWLGKHWSLKTIG  240

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P  PS YL  +IE DK YG S++KP  E C+KWL  + N  VVY+SFGSM +L
Sbjct  241  PTKPSMYLGKQIEEDKDYGFSIFKPNNESCIKWLNDRANGCVVYVSFGSMATL  293



>ref|XP_003554601.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Glycine max]
 gb|KHN45526.1| UDP-glycosyltransferase 74F1 [Glycine soja]
Length=449

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 110/173 (64%), Gaps = 9/173 (5%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+R G+ GAA+ T +  V +++ H+  G L+ P+ IE +   + LP +P L+ 
Sbjct  117  LPWALDVAKRFGIVGAAYLTQNMTVNSIYYHVQLGKLQAPL-IEHD---ISLPALPKLHL  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+P+F    D  P+ L   + QFSN+  ADWI  NT+ EL+ E+V    K+WP  K IG
Sbjct  173  KDMPTFFFDED--PSLLDFVVAQFSNIDKADWILCNTFNELDKEIVDWFVKIWPKFKTIG  230

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P VPS +LD + E D+ YG + +K   EEC++WL  KP  SVVY+SFGSM ++
Sbjct  231  PNVPSFFLDKQCEDDQDYGVTQFK--SEECVEWLDDKPKGSVVYVSFGSMATM  281



>ref|XP_004493042.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Cicer arietinum]
Length=464

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 109/173 (63%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            +PWALDVA+R G+ G AF T +  + +++ H + G L +P++++EN   + LP +P L  
Sbjct  120  YPWALDVAKRFGIVGVAFLTQNIGIHSIYYHAYMGKLRVPLDVKEN---ISLPMLPQLQY  176

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF    +  P +L + + QFSN+  ADWI  N++ EL  EV      +WP  + IG
Sbjct  177  RDMPSFFHTYEKDPTFLHLCLDQFSNMDKADWILCNSFYELHQEVADWTMNIWPNFRTIG  236

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD RI+ D+ YGA  +K   E C++WL  KP  SVVY+SFGS+ SL
Sbjct  237  PSIPSMFLDKRIKYDEDYGAPQFKS-EEYCMEWLNDKPKGSVVYVSFGSLASL  288



>ref|XP_007133505.1| hypothetical protein PHAVU_011G184600g [Phaseolus vulgaris]
 gb|ESW05499.1| hypothetical protein PHAVU_011G184600g [Phaseolus vulgaris]
Length=457

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 107/173 (62%), Gaps = 6/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LD+A++HG+  A F T    V  V+ H+  G+L++P+E   N   + LPG+P L  
Sbjct  119  LPWTLDIAKKHGLTCAVFLTQPLFVNCVYHHVQKGNLKVPLE---NSNVISLPGLPLLQP  175

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSFI +  +Y A   + + QFSN+  A W+  NT+ +LE EV   + K+WP  K IG
Sbjct  176  FDLPSFIYSYGTYSASFELVLNQFSNIKEAHWVLCNTFYDLEKEVADWLMKIWPKLKTIG  235

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R + D  YG SL+K   EEC+KW+  KP  S+VY+SFGS  +L
Sbjct  236  PTIPSMFLDKRDKDDDEYGFSLFK--SEECVKWMDEKPKGSIVYVSFGSFSTL  286



>gb|KDP35132.1| hypothetical protein JCGZ_10666 [Jatropha curcas]
Length=457

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 108/172 (63%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+   +  AAFFT  AAV  ++ +I C SL +PV    +   + +P +P L  
Sbjct  116  LPWALDVAKDFRLFAAAFFTQPAAVDFIYYNIQCKSLSVPV----SSTPVSIPSLPLLEI  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PS ++ P++YPAY AM   Q+SN+  AD++  NT+ +LE EVV  +SKV P   IGP
Sbjct  172  GDMPSAVSGPEAYPAYTAMLFNQWSNIEKADYVLINTFYKLEKEVVDEMSKVCPVLTIGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD RIE D  YG  L+       L W+ +KP +SVVY++FGS+ +L
Sbjct  232  TIPSKYLDKRIENDDDYGLDLFALEASFSLNWISNKPARSVVYVAFGSLSNL  283



>ref|NP_001234680.1| UDP-xylose phenolic glycosyltransferase [Solanum lycopersicum]
 emb|CAI62049.1| UDP-xylose phenolic glycosyltransferase [Solanum lycopersicum]
Length=456

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 111/173 (64%), Gaps = 4/173 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIP-PLY  179
             PWA++VA++ G+  AAFFT +  V  ++ H+H G ++LP    +N   +++PG P  + 
Sbjct  113  LPWAVEVAKQFGLISAAFFTQNCVVDNLYYHVHKGVIKLPPT--QNDEEILIPGFPNSID  170

Query  180  GPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
              D+PSF+ +P++    + M   QFSN+   D +  N++ ELE EV+  +SK++P K IG
Sbjct  171  ASDVPSFVISPEA-ERIVEMLANQFSNLDKVDCVLINSFYELEKEVIDWMSKIYPIKTIG  229

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  DK YG S++KP+  ECL WL  +P  SV+Y+SFGS+  L
Sbjct  230  PTIPSMYLDKRLHDDKEYGLSMFKPMTNECLNWLNHQPISSVLYVSFGSLAKL  282



>ref|XP_004493041.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Cicer arietinum]
 gb|AGU14133.1| UDP-glycosyltransferase [Cicer arietinum]
Length=459

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 111/173 (64%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
            FPWALDVA+R G+ G  F T + +V ++F ++H G L++P+ IE+N   + LP +P L  
Sbjct  114  FPWALDVAKRFGIIGVCFLTQNMSVNSIFYNVHIGKLKVPI-IEQN--EISLPLLPTLEI  170

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPA-KLIG  359
             D+PSF          L + + QFSN+  ADWI  N+  ++E +VV    K+WP  + IG
Sbjct  171  GDMPSFFLPKGQNQVLLDLMVGQFSNIDKADWILCNSLYDIEKKVVDWTMKIWPKFRSIG  230

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            P +PS +LD R++ D+ YGA+ +K   EEC++WL  KP  SVVY+SFGSM +L
Sbjct  231  PSIPSMFLDKRLKDDEAYGATQFKS-NEECMEWLNDKPKGSVVYVSFGSMGTL  282



>ref|XP_008236255.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Prunus mume]
Length=459

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 113/172 (66%), Gaps = 2/172 (1%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
              W LD+AR+ G+ GA FFT S AV  ++ HIH G L+LP  + ++ + +  PG+PPL  
Sbjct  119  MTWPLDIARKFGISGAVFFTQSCAVENIYYHIHEGLLKLP--LADDQSQISFPGLPPLEP  176

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSF+    SYPA+  + + QFSNV  ADWI +NT+ ELE +VV  ++K WP + +GP
Sbjct  177  LDLPSFLYDFGSYPAFYEVLVGQFSNVDKADWILSNTFYELEEQVVDWLAKFWPLRTVGP  236

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E DK YG +L+K   + C+KWL  +P  SV Y+SFGS   L
Sbjct  237  TIPSKYLDERLEDDKEYGVNLFKSDNDACIKWLNERPKGSVAYVSFGSAARL  288



>gb|KDO43526.1| hypothetical protein CISIN_1g0406122mg, partial [Citrus sinensis]
Length=224

 Score =   146 bits (369),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 103/164 (63%), Gaps = 5/164 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GA F T S AV  ++ H + G L+LP+     G  ++LPG+PPL  
Sbjct  65   LPWALDVAKKFGLLGATFLTQSCAVYCIYYHANRGFLKLPL----TGNEILLPGMPPLEP  120

Query  183  PDIPSFITAPDSYPAYLAMKMR-QFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIG  359
             D+PSF+     YPA   + ++ QF N+  ADW+ +NT+ +LE  VV  + + W  + IG
Sbjct  121  QDMPSFVYDLGLYPAISDLVLKNQFDNIDKADWVLSNTFYDLEEGVVEWLGRHWSLRTIG  180

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVY  491
            P VPS+YLD ++E DK YG S++K   E C+KWL  +   SVVY
Sbjct  181  PTVPSTYLDKQLEDDKDYGFSMFKQNNESCIKWLNDQAKGSVVY  224



>ref|XP_007033645.1| UDP-glucosyltransferase 74F2, putative [Theobroma cacao]
 gb|EOY04571.1| UDP-glucosyltransferase 74F2, putative [Theobroma cacao]
Length=455

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 107/172 (62%), Gaps = 4/172 (2%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA++ G+ GAAFFT + AV  ++ + H G L LPV  E     + +PG+P L  
Sbjct  116  LPWALDVAKQFGLVGAAFFTQACAVNYIYYYAHHGLLSLPVSSE----PVSIPGLPLLQL  171

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI    SYP Y  + + QFSN   AD++  NT+ +LE E V  +SKV P   IGP
Sbjct  172  RDMPSFIYVAGSYPFYFELVLSQFSNSDKADFVLVNTFYKLEHEAVESMSKVSPLLTIGP  231

Query  363  MVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E D+ Y  +L+K       +WL +KP  SVV++SFGSM +L
Sbjct  232  TIPSMYLDQRVETDEDYDLNLFKLDSSSSTEWLSTKPPGSVVFVSFGSMANL  283



>ref|XP_008235864.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=461

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 111/170 (65%), Gaps = 3/170 (2%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WALDVA+R G+ GAAFFT S AV  +++ +  G L++P+     G+ ++LPG+PPL   D
Sbjct  123  WALDVAKRAGIAGAAFFTFSCAVTNIYSLVQNGLLKVPLN---PGSEILLPGLPPLQPSD  179

Query  189  IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMV  368
             PSF+    SYPA+  + + QFSN+  ADW+  NT+ ELE E V  ++K WP + IGP +
Sbjct  180  TPSFVYDSGSYPAFFKLILDQFSNLDKADWVLCNTFHELEQEAVDRMAKFWPLRTIGPTI  239

Query  369  PSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            PS Y+D R E +  YG SL KP  + C+KWL  KP  SV Y+SFGS+  +
Sbjct  240  PSMYMDKRHEDNWEYGLSLLKPNSDACMKWLNVKPKGSVAYVSFGSVAEI  289



>dbj|BAG80538.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=461

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 114/175 (65%), Gaps = 7/175 (4%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELP-VEIEENGAALVLPGI--PP  173
             PWA++VA+  G+  AAFFT +  V  ++ H+H G ++LP  E++E    +++PG+    
Sbjct  113  LPWAVEVAKNFGLVSAAFFTQNCTVDNIYYHVHKGVIKLPPTEVDEQ---ILIPGLSSTT  169

Query  174  LYGPDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKL  353
            +   D+PSF ++P S    + + + QFSN+   DW+  N++ +LE EV+  ++K++P K 
Sbjct  170  VESSDVPSFESSPQS-DKLVELLVNQFSNLEKVDWVLINSFYKLEKEVIDWMAKLYPIKT  228

Query  354  IGPMVPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            IGP +PS YLD R+  DK YG SL+KP+  ECL WL ++P  SVVY+SFGSM  +
Sbjct  229  IGPTIPSMYLDRRLPNDKEYGLSLFKPMANECLNWLNNQPISSVVYVSFGSMAKV  283



>ref|XP_006342416.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=448

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WA+D+A + G+ GAAFFT S ++ A++ H+   + ++ +    +G+ + LP +P L   D
Sbjct  114  WAIDLAHQLGLKGAAFFTQSCSLSAIYYHMDLETTKVSL----DGSDVSLPSLPLLAKED  169

Query  189  IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMV  368
            +PS I   D YP    +   Q  N   ADW+F NT+  LE EVV  +   +P K IGP +
Sbjct  170  LPSIIYDTDLYPTLRGLIFSQNINFKKADWLFFNTFNALEKEVVDWIRPRYPIKTIGPTI  229

Query  369  PSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            PS YLD R++ DK YG SL+KP  E C+KWL SK   SVVY+SFGS+ SL
Sbjct  230  PSMYLDKRLKDDKEYGLSLFKPNSETCMKWLDSKEIGSVVYVSFGSLASL  279



>gb|ABK96547.1| unknown [Populus trichocarpa x Populus deltoides]
Length=457

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 102/170 (60%), Gaps = 4/170 (2%)
 Frame = +3

Query  9    WALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGPD  188
            WALDVA+  GV GAAFFT    V  ++ +I  G L LP+      A + +PG+P L   D
Sbjct  118  WALDVAKDFGVMGAAFFTQPCVVDYIYYNIQHGLLSLPI----TSATVSIPGLPLLESRD  173

Query  189  IPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPMV  368
            +PSFI  P SYPAY  M + QFSN    D+I  NT+ +LE+E V  +SKV P   IGP V
Sbjct  174  MPSFINVPGSYPAYFKMLLDQFSNTEKVDYILINTFYKLEAEAVDTISKVCPTLTIGPTV  233

Query  369  PSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            PS YLD RIE D  Y   L+         W+ +KP +SVVY++FGS+ +L
Sbjct  234  PSRYLDKRIEDDDYYNLDLFTLHASISTNWISNKPPRSVVYVAFGSISNL  283



>gb|KCW57957.1| hypothetical protein EUGRSUZ_H00691 [Eucalyptus grandis]
Length=443

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PWALDVA+R    G AFFT + AV  ++ H+  G LELP+     G ++ +PG+PPL  
Sbjct  95   MPWALDVAKRCKKLGVAFFTQTCAVNNIYYHVQRGLLELPLS---GGGSVEVPGLPPLEP  151

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVS-KVWPAKLIG  359
             ++PSF+    SYP    + M+QFSNVG+AD +  N + ELE EVV  +S  +WP K IG
Sbjct  152  SELPSFLYKLGSYPGSYDLVMKQFSNVGDADLVLFNNFYELEEEVVDWMSTNLWPLKTIG  211

Query  360  PMVPSSYLDGRIEGDKGYGASLWKPLGEECLK-WLKSKPNQSVVYISFGSMVSL  518
            P +PS YLD R+  D  YG +L+ P     +  WL S P +SVVY+SFGSM  L
Sbjct  212  PTLPSLYLDKRLPDDTAYGINLFTPTTTSTVSAWLCSHPPRSVVYVSFGSMADL  265



>emb|CAN68287.1| hypothetical protein VITISV_017016 [Vitis vinifera]
Length=458

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 106/173 (61%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    FPWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYG  182
             PW LDVA++ G+ GAAFFT + AV  ++ H + G L LPV+       + +PG+P L  
Sbjct  117  LPWVLDVAKQFGLVGAAFFTQTCAVNYIYYHAYHGLLPLPVK----STPVSIPGLPLLEL  172

Query  183  PDIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGP  362
             D+PSFI    SYPAY  + + QF NV  ADW+  NT+ +LE EVV  ++K+ P   IGP
Sbjct  173  RDMPSFIYVAGSYPAYFQLVLNQFCNVHKADWVLVNTFYKLEEEVVDAMAKLSPLITIGP  232

Query  363  MVPSSYLDGRIEGDKGYGASLWKPL-GEECLKWLKSKPNQSVVYISFGSMVSL  518
             +PS YLD R+E +  YG  L+        + WL +KP +SV+Y+SFGSM  L
Sbjct  233  TIPSKYLDNRLENEAEYGFDLFSSEPSAHTINWLDNKPTRSVIYVSFGSMACL  285



>ref|XP_002529824.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32573.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=467

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 108/171 (63%), Gaps = 4/171 (2%)
 Frame = +3

Query  6    PWALDVARRHGVHGAAFFTNSAAVCAVFAHIHCGSLELPVEIEENGAALVLPGIPPLYGP  185
            PW  D+AR  GV+GA+FFT S AV  ++ H   G+L++P+      +A+ LP  P L   
Sbjct  120  PWIFDIARSSGVYGASFFTQSCAVTGLYYHKIQGALKVPL----GESAVSLPAYPELEAN  175

Query  186  DIPSFITAPDSYPAYLAMKMRQFSNVGNADWIFANTYQELESEVVAGVSKVWPAKLIGPM  365
            D+PS++  P SY A   M   QFSNV   DW+  NT+ ELE EVV  ++  WP   IGP 
Sbjct  176  DMPSYVNGPGSYQAIYDMAFSQFSNVDEVDWVLWNTFNELEDEVVKWMASKWPIIPIGPT  235

Query  366  VPSSYLDGRIEGDKGYGASLWKPLGEECLKWLKSKPNQSVVYISFGSMVSL  518
            +PS +LD R++ DK YG SL+KP  + C+KWL SK   SVVY+SFGS+ +L
Sbjct  236  IPSMFLDKRLKDDKDYGVSLFKPNSDTCMKWLDSKEPSSVVYVSFGSLAAL  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000