BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J22

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006304215.1|  hypothetical protein CARUB_v10010325mg             200   3e-61   
ref|XP_009623992.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    195   8e-60   Nicotiana tomentosiformis
ref|XP_004232469.1|  PREDICTED: V-type proton ATPase subunit c2         194   2e-59   Solanum lycopersicum
emb|CDP07433.1|  unnamed protein product                                194   2e-59   Coffea canephora [robusta coffee]
ref|XP_011074644.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    193   5e-59   Sesamum indicum [beniseed]
ref|XP_002307699.1|  hypothetical protein POPTR_0005s25660g             193   5e-59   Populus trichocarpa [western balsam poplar]
ref|XP_011088499.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    193   5e-59   Sesamum indicum [beniseed]
gb|EYU36762.1|  hypothetical protein MIMGU_mgv1a015204mg                193   5e-59   Erythranthe guttata [common monkey flower]
ref|XP_008444773.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    193   5e-59   Cucumis melo [Oriental melon]
ref|XP_009335490.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    195   5e-59   Pyrus x bretschneideri [bai li]
ref|XP_002302232.1|  hypothetical protein POPTR_0002s08330g             193   5e-59   Populus trichocarpa [western balsam poplar]
ref|XP_009378455.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    193   6e-59   
ref|XP_009758914.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    193   7e-59   Nicotiana sylvestris
ref|XP_006409426.1|  hypothetical protein EUTSA_v10022840mg             194   1e-58   
gb|AAA82977.1|  vacuolar H+-ATPase proteolipid (16 kDa) subunit         192   1e-58   Gossypium hirsutum [American cotton]
ref|XP_007223415.1|  hypothetical protein PRUPE_ppa011277mg             194   1e-58   
ref|NP_564098.2|  VACUOLAR-TYPE H+ ATPASE C2                            192   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011092859.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    192   1e-58   Sesamum indicum [beniseed]
gb|EMS54266.1|  V-type proton ATPase 16 kDa proteolipid subunit         197   1e-58   Triticum urartu
ref|XP_006592081.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    193   1e-58   Glycine max [soybeans]
ref|XP_004152664.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    192   2e-58   
ref|XP_009625822.1|  PREDICTED: V-type proton ATPase subunit c1         191   2e-58   Nicotiana tomentosiformis
emb|CAA65063.1|  c subunit of V-type ATPase                             191   2e-58   Nicotiana tabacum [American tobacco]
ref|XP_004133996.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    191   3e-58   Cucumis sativus [cucumbers]
gb|KDP27632.1|  hypothetical protein JCGZ_19637                         191   3e-58   Jatropha curcas
ref|XP_009348673.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    191   3e-58   Pyrus x bretschneideri [bai li]
gb|AHC08714.1|  vacuolar H+-ATPase subunit c                            191   3e-58   Rosa rugosa [Japanese rose]
ref|XP_004152663.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    191   3e-58   Cucumis sativus [cucumbers]
ref|XP_007200387.1|  hypothetical protein PRUPE_ppa012519mg             191   3e-58   Prunus persica
ref|XP_007202676.1|  hypothetical protein PRUPE_ppa012515mg             191   3e-58   Prunus persica
ref|XP_002513751.1|  vacuolar ATP synthase proteolipid subunit 1,...    191   4e-58   Ricinus communis
gb|ABJ74162.1|  H+-ATPase proteolipid                                   191   4e-58   Acanthus ebracteatus
ref|XP_002310846.1|  hypothetical protein POPTR_0007s13890g             191   4e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010113377.1|  V-type proton ATPase 16 kDa proteolipid subunit    192   4e-58   
ref|XP_006423502.1|  hypothetical protein CICLE_v10029417mg             191   5e-58   Citrus clementina [clementine]
ref|XP_002890358.1|  vacuolar-H+-pumping ATPase 16 kDa proteolipi...    191   5e-58   
gb|AAK01292.1|  vacuolar ATPase subunit c                               191   5e-58   Avicennia marina
ref|XP_006284579.1|  hypothetical protein CARUB_v10005804mg             191   5e-58   
gb|ADQ53511.1|  VAH protein                                             191   5e-58   Phyllostachys edulis [kikko-chiku]
ref|XP_002513005.1|  vacuolar ATP synthase proteolipid subunit 1,...    190   6e-58   Ricinus communis
ref|XP_004287829.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    190   7e-58   Fragaria vesca subsp. vesca
ref|XP_009804090.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    190   7e-58   Nicotiana sylvestris
ref|XP_010523552.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    190   9e-58   Tarenaya hassleriana [spider flower]
ref|XP_010534694.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    190   9e-58   Tarenaya hassleriana [spider flower]
ref|XP_010432381.1|  PREDICTED: V-type proton ATPase subunit c1-like    189   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_004290874.1|  PREDICTED: V-type proton ATPase subunit c4         189   1e-57   Fragaria vesca subsp. vesca
ref|NP_179244.1|  ATPase, F0/V0 complex, subunit C protein              189   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416452.1|  PREDICTED: V-type proton ATPase subunit c4-like    189   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010530297.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    189   2e-57   Tarenaya hassleriana [spider flower]
gb|KDP38594.1|  hypothetical protein JCGZ_04519                         189   2e-57   Jatropha curcas
ref|XP_006416453.1|  hypothetical protein EUTSA_v10008949mg             189   2e-57   Eutrema salsugineum [saltwater cress]
ref|XP_010539643.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    189   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_006298701.1|  hypothetical protein CARUB_v10014796mg             189   2e-57   Capsella rubella
ref|XP_002441892.1|  hypothetical protein SORBIDRAFT_08g004380          189   2e-57   Sorghum bicolor [broomcorn]
ref|XP_008391887.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    189   2e-57   Malus domestica [apple tree]
ref|NP_001149195.1|  vacuolar ATP synthase 16 kDa proteolipid sub...    189   2e-57   
ref|NP_001290014.1|  V-type proton ATPase 16 kDa proteolipid subunit    189   2e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN25606.1|  unknown                                                 189   3e-57   Zea mays [maize]
emb|CAC80261.1|  V-ATPase subunit c                                     187   3e-57   Beta vulgaris [beet]
ref|NP_001065855.1|  Os11g0169900                                       189   3e-57   
ref|XP_009337683.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    189   3e-57   Pyrus x bretschneideri [bai li]
ref|NP_001066258.1|  Os12g0168900                                       189   3e-57   
ref|XP_006425529.1|  hypothetical protein CICLE_v10026647mg             189   3e-57   Citrus clementina [clementine]
ref|NP_001233967.1|  V-type proton ATPase 16 kDa proteolipid subunit    188   3e-57   Solanum lycopersicum
ref|NP_177693.1|  V-type proton ATPase proteolipid subunit c4           188   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435119.1|  hypothetical protein CICLE_v10002710mg             188   3e-57   Citrus clementina [clementine]
gb|ABK93797.1|  unknown                                                 188   4e-57   Populus trichocarpa [western balsam poplar]
gb|KJB77737.1|  hypothetical protein B456_012G154000                    188   4e-57   Gossypium raimondii
ref|XP_002279080.1|  PREDICTED: V-type proton ATPase subunit c1         188   4e-57   Vitis vinifera
gb|KDP46708.1|  hypothetical protein JCGZ_06496                         188   4e-57   Jatropha curcas
ref|XP_006411682.1|  hypothetical protein EUTSA_v10026433mg             188   5e-57   Eutrema salsugineum [saltwater cress]
ref|XP_011047217.1|  PREDICTED: V-type proton ATPase subunit c1         189   5e-57   Populus euphratica
ref|XP_010930879.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    188   5e-57   Elaeis guineensis
ref|XP_009149488.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    188   5e-57   Brassica rapa
ref|XP_004978799.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    188   5e-57   Setaria italica
ref|XP_008781499.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    188   5e-57   Phoenix dactylifera
ref|XP_002313006.1|  Vacuolar ATP synthase 16 kDa proteolipid sub...    189   6e-57   
gb|ABK93522.1|  unknown                                                 187   6e-57   Populus trichocarpa [western balsam poplar]
ref|XP_009109515.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    187   6e-57   Brassica rapa
sp|P23957.1|VATL_AVESA  RecName: Full=V-type proton ATPase 16 kDa...    187   6e-57   Avena sativa [cultivated oat]
ref|XP_009103374.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    187   6e-57   Brassica rapa
ref|XP_008793919.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    187   7e-57   Phoenix dactylifera
ref|XP_006653951.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    187   7e-57   Oryza brachyantha
ref|NP_001054416.1|  Os05g0106100                                       187   8e-57   
ref|XP_008377172.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    187   8e-57   
ref|XP_008785887.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    187   8e-57   Phoenix dactylifera
ref|XP_002510486.1|  vacuolar ATP synthase proteolipid subunit 1,...    187   9e-57   Ricinus communis
gb|ABK21313.1|  unknown                                                 187   1e-56   Picea sitchensis
ref|XP_010531483.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    187   1e-56   Tarenaya hassleriana [spider flower]
gb|AEB97956.1|  vacuolar H+-ATPase 16 kDa proteolipid subunit c         187   1e-56   Aeluropus littoralis
ref|XP_003569121.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    187   2e-56   Brachypodium distachyon [annual false brome]
ref|XP_007131746.1|  hypothetical protein PHAVU_011G038500g             187   2e-56   Phaseolus vulgaris [French bean]
ref|NP_001150274.1|  LOC100283904                                       187   2e-56   Zea mays [maize]
ref|XP_010912480.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    187   2e-56   Elaeis guineensis
gb|KHN41911.1|  V-type proton ATPase 16 kDa proteolipid subunit         188   2e-56   Glycine soja [wild soybean]
ref|XP_002972795.1|  hypothetical protein SELMODRAFT_228159             187   2e-56   Selaginella moellendorffii
ref|XP_011037226.1|  PREDICTED: V-type proton ATPase subunit c1         187   2e-56   Populus euphratica
ref|XP_006647358.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    187   2e-56   Oryza brachyantha
ref|NP_001047092.1|  Os02g0550100                                       187   2e-56   
ref|XP_010933937.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    186   2e-56   Elaeis guineensis
gb|ACX50967.1|  vacuolar membrane H+-ATPase c subunit                   186   2e-56   Tamarix hispida
gb|KGN62657.1|  hypothetical protein Csa_2G365640                       186   3e-56   Cucumis sativus [cucumbers]
ref|XP_003520270.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    186   3e-56   Glycine max [soybeans]
ref|XP_009414595.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    186   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003629349.1|  V-type proton ATPase 16 kDa proteolipid subu...    186   4e-56   Medicago truncatula
ref|XP_010912057.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    186   4e-56   
ref|XP_003543079.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    186   4e-56   Glycine max [soybeans]
gb|AFK34360.1|  unknown                                                 186   5e-56   Lotus japonicus
ref|XP_003517187.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    185   5e-56   Glycine max [soybeans]
ref|XP_003607079.1|  V-type proton ATPase 16 kDa proteolipid subu...    185   5e-56   Medicago truncatula
gb|AAF04597.1|AF193814_1  vacuolar H+-ATP synthase 16kDa proteoli...    185   6e-56   Dendrobium crumenatum
ref|XP_007157941.1|  hypothetical protein PHAVU_002G111000g             187   6e-56   Phaseolus vulgaris [French bean]
ref|XP_002962220.1|  hypothetical protein SELMODRAFT_77154              185   6e-56   
gb|AGV54613.1|  vacuolar H+-ATP synthase 16kDa proteolipid subunit      185   6e-56   Phaseolus vulgaris [French bean]
ref|NP_001276180.1|  uncharacterized protein LOC100815182               185   7e-56   Glycine max [soybeans]
gb|AFK44451.1|  unknown                                                 185   7e-56   Lotus japonicus
gb|AAP15165.1|  vacuolar H(+)-ATPase subunit c                          185   8e-56   Suaeda salsa
gb|ACJ86024.1|  unknown                                                 185   8e-56   Medicago truncatula
ref|XP_006590717.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    185   8e-56   Glycine max [soybeans]
gb|ACJ84165.1|  unknown                                                 185   9e-56   Medicago truncatula
ref|XP_004960548.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    185   9e-56   Setaria italica
ref|XP_003575109.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    185   9e-56   Brachypodium distachyon [annual false brome]
ref|XP_003612137.1|  V-type proton ATPase 16 kDa proteolipid subu...    185   9e-56   Medicago truncatula
ref|XP_011083597.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    185   1e-55   Sesamum indicum [beniseed]
gb|AHY99590.1|  vacuolar (H+)-ATPase c subunit                          184   2e-55   Annona cherimola [cherimoya]
gb|ABK24299.1|  unknown                                                 184   2e-55   Picea sitchensis
ref|XP_010927415.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    184   3e-55   Elaeis guineensis
gb|ACZ65572.1|  vacuolar H+-ATPase 16kDa subunit c                      183   3e-55   Iris lactea var. lactea
ref|XP_004977246.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    183   3e-55   Setaria italica
ref|XP_007135912.1|  hypothetical protein PHAVU_009G002400g             185   4e-55   Phaseolus vulgaris [French bean]
ref|XP_006854856.1|  hypothetical protein AMTR_s00182p00020350          183   4e-55   Amborella trichopoda
emb|CDY45329.1|  BnaA03g53020D                                          189   4e-55   Brassica napus [oilseed rape]
gb|ACZ65574.1|  vacuolar H+-ATPase 16kDa subunit c                      183   5e-55   Iris lactea var. lactea
ref|XP_006847027.1|  hypothetical protein AMTR_s00017p00172260          182   7e-55   Amborella trichopoda
ref|XP_001760844.1|  predicted protein                                  181   2e-54   
ref|XP_001751438.1|  predicted protein                                  181   3e-54   
gb|ACZ65575.1|  vacuolar H+-ATPase 16kDa subunit c                      181   3e-54   Iris lactea var. lactea
ref|XP_001751697.1|  predicted protein                                  180   6e-54   
gb|ACZ65576.1|  vacuolar H+-ATPase 16kDa subunit c                      178   3e-53   Iris lactea var. lactea
gb|AAA99934.1|  vacuolar H+-pumping ATPase 16 kDa proteolipid           177   9e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010091197.1|  V-type proton ATPase 16 kDa proteolipid subunit    176   4e-52   
gb|AAC12797.1|  adenosine triphosphatase                                173   1e-51   Vigna radiata [mung bean]
gb|AFK44243.1|  unknown                                                 173   3e-51   Medicago truncatula
gb|AAT08734.1|  vacuolar H+-ATPase proteolipid 16 kDa subunit           172   4e-51   Hyacinthus orientalis [common hyacinth]
gb|KJB43371.1|  hypothetical protein B456_007G196500                    174   5e-51   Gossypium raimondii
ref|NP_001045477.1|  Os01g0962300                                       172   1e-50   
ref|XP_004971351.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    171   3e-50   Setaria italica
gb|KJB14926.1|  hypothetical protein B456_002G149400                    169   6e-50   Gossypium raimondii
ref|NP_001185404.1|  V-type proton ATPase proteolipid subunit c4        171   7e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KJB77736.1|  hypothetical protein B456_012G154000                    168   1e-49   Gossypium raimondii
gb|EPS65806.1|  hypothetical protein M569_08973                         167   3e-49   Genlisea aurea
gb|KJB32611.1|  hypothetical protein B456_005G248800                    167   3e-49   Gossypium raimondii
ref|XP_010912058.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    167   3e-49   
ref|XP_008388136.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    166   4e-49   
gb|KJB77738.1|  hypothetical protein B456_012G154000                    167   4e-49   Gossypium raimondii
ref|XP_008467065.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    166   4e-49   Cucumis melo [Oriental melon]
gb|KJB17312.1|  hypothetical protein B456_003G010900                    167   6e-49   Gossypium raimondii
gb|KJB14925.1|  hypothetical protein B456_002G149400                    166   7e-49   Gossypium raimondii
gb|AAL09329.1|AF303372_1  vacuolar-type H(+)-ATPase subunit c           167   8e-49   Syntrichia ruralis
gb|KJB32612.1|  hypothetical protein B456_005G248800                    165   1e-48   Gossypium raimondii
ref|XP_006646714.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    166   1e-48   
gb|KDO41481.1|  hypothetical protein CISIN_1g031125mg                   165   2e-48   Citrus sinensis [apfelsine]
ref|XP_006423504.1|  hypothetical protein CICLE_v10029417mg             165   2e-48   
gb|KDO41482.1|  hypothetical protein CISIN_1g031125mg                   165   2e-48   Citrus sinensis [apfelsine]
gb|KDO41483.1|  hypothetical protein CISIN_1g031125mg                   165   2e-48   Citrus sinensis [apfelsine]
ref|XP_009109955.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    167   3e-48   
ref|XP_006423503.1|  hypothetical protein CICLE_v10029417mg             163   1e-47   
ref|XP_004977245.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    165   1e-47   
ref|XP_005848107.1|  hypothetical protein CHLNCDRAFT_30996              164   1e-47   Chlorella variabilis
gb|EAY82401.1|  hypothetical protein OsI_37615                          164   1e-47   Oryza sativa Indica Group [Indian rice]
gb|ABG22382.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit,...    162   2e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010451050.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    163   3e-47   Camelina sativa [gold-of-pleasure]
gb|EMS55033.1|  V-type proton ATPase 16 kDa proteolipid subunit         162   4e-47   Triticum urartu
ref|XP_006435120.1|  hypothetical protein CICLE_v10002710mg             162   5e-47   
gb|EYU38851.1|  hypothetical protein MIMGU_mgv1a026590mg                162   5e-47   Erythranthe guttata [common monkey flower]
ref|XP_006425528.1|  hypothetical protein CICLE_v10026647mg             162   6e-47   
ref|XP_004512226.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    162   7e-47   
dbj|BAJ90634.1|  predicted protein                                      161   7e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA23352.1|  vacuolar type H+-ATPase proteolipid subunit            162   1e-46   Acetabularia acetabulum
gb|ADH44696.1|  vacuolar H(+)-ATPase subunit c                          160   1e-46   Salvia miltiorrhiza [Chinese salvia]
ref|XP_001696361.1|  vacuolar H(+)-ATPase V0 sector, c/c' subunits      161   2e-46   Chlamydomonas reinhardtii
emb|CAA71930.1|  BV-16/1                                                159   2e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG30045.1|  hypothetical protein F383_01577                         169   2e-46   Gossypium arboreum [tree cotton]
gb|ADI46947.1|  ATPvL1m                                                 160   6e-46   Volvox carteri f. nagariensis
gb|KEH27580.1|  vacuolar H+-pumping ATPase 16 kDa proteolipid sub...    158   6e-46   Medicago truncatula
gb|ABN48303.1|  vacuolar ATPase subunit c                               157   6e-46   Cucumis sativus [cucumbers]
ref|XP_002887606.1|  hypothetical protein ARALYDRAFT_476712             160   1e-45   
ref|XP_002957938.1|  hypothetical protein VOLCADRAFT_107886             159   1e-45   Volvox carteri f. nagariensis
gb|KHN00493.1|  V-type proton ATPase 16 kDa proteolipid subunit         158   1e-45   Glycine soja [wild soybean]
ref|XP_005652095.1|  V-type ATPase                                      159   1e-45   Coccomyxa subellipsoidea C-169
emb|CEF98686.1|  V-ATPase proteolipid subunit                           158   2e-45   Ostreococcus tauri
ref|XP_004960547.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    158   3e-45   
ref|XP_011399797.1|  V-type proton ATPase 16 kDa proteolipid subunit    158   3e-45   Auxenochlorella protothecoides
gb|KDD76967.1|  hypothetical protein H632_c53p3                         157   6e-45   Helicosporidium sp. ATCC 50920
ref|XP_007017704.1|  Vacuolar H+-pumping ATPase 16 kDa proteolipi...    156   8e-45   
dbj|BAA23351.1|  vacuolar type H+-ATPase proteolipid subunit            155   3e-44   Acetabularia acetabulum
dbj|BAA21683.1|  vacuolar type H+-ATPase proteolipid subunit            155   4e-44   Acetabularia acetabulum
dbj|BAA23350.1|  vacuolar type H+-ATPase proteolipid subunit            155   5e-44   Acetabularia acetabulum
ref|XP_001418919.1|  F-ATPase family transporter: protons (vacuolar)    150   2e-42   Ostreococcus lucimarinus CCE9901
ref|XP_003080310.1|  vacuolar ATPase subunit c (ISS)                    152   3e-42   
gb|KIY99747.1|  hypothetical protein MNEG_8216                          147   1e-41   Monoraphidium neglectum
gb|EYU37872.1|  hypothetical protein MIMGU_mgv1a020126mg                145   1e-40   Erythranthe guttata [common monkey flower]
dbj|BAA21682.1|  vacuolar type H+-ATPase proteolipid subunit            145   3e-40   Acetabularia acetabulum
dbj|BAA23349.1|  vacuolar type H+-ATPase proteolipid subunit            145   3e-40   Acetabularia acetabulum
ref|XP_003058268.1|  H+-or Na+-translocating f-type, v-type and A...    144   4e-40   Micromonas pusilla CCMP1545
ref|XP_002499550.1|  H+-or Na+-translocating f-type, v-type and A...    144   8e-40   Micromonas commoda
ref|XP_008388137.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    140   3e-39   
ref|XP_007514510.1|  unknown                                            141   1e-38   Bathycoccus prasinos
ref|XP_009393807.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    139   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA95924.2|  expressed protein                                       138   4e-38   Oryza sativa Japonica Group [Japonica rice]
gb|AFW56182.1|  V-type proton ATPase proteolipid subunit                137   2e-37   
ref|XP_008368022.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    136   2e-37   Malus domestica [apple tree]
ref|XP_010089505.1|  V-type proton ATPase 16 kDa proteolipid subunit    135   3e-36   
gb|AIZ49544.1|  V-ATPase subunit c2                                     128   1e-34   Eriobotrya japonica [loquat]
ref|XP_004344009.1|  Vtype ATPase, C subunit                            129   3e-34   Acanthamoeba castellanii str. Neff
gb|AAW79383.1|  vacuolar ATP synthase                                   128   1e-33   Heterocapsa triquetra
ref|XP_005758268.1|  vacuolar H+-ATPase V0 sector, subunits c/c         127   3e-33   Emiliania huxleyi CCMP1516
ref|XP_009345640.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    126   1e-32   
ref|XP_002371832.1|  vacuolar ATP synthase 16 kDa proteolipid sub...    125   1e-32   
ref|XP_003884509.1|  hypothetical protein NCLIV_049080                  125   2e-32   Neospora caninum Liverpool
ref|XP_005703524.1|  V-type H+-transporting ATPase subunit c            124   3e-32   Galdieria sulphuraria
ref|XP_967959.1|  PREDICTED: V-type proton ATPase 16 kDa proteoli...    124   3e-32   Tribolium castaneum [rust-red flour beetle]
ref|XP_009692511.1|  vacuolar H+-ATPase subunit                         124   5e-32   Theileria orientalis strain Shintoku
ref|XP_002767877.1|  vacuolar ATP synthase 16 kDa proteolipid sub...    124   5e-32   Perkinsus marinus ATCC 50983
gb|KHJ49390.1|  AP-3 complex subunit beta-2                             132   8e-32   Trichuris suis
ref|XP_003661349.1|  hypothetical protein MYCTH_2314502                 122   1e-31   Thermothelomyces thermophila ATCC 42464
gb|KFM60257.1|  V-type proton ATPase proteolipid subunit                122   1e-31   Stegodyphus mimosarum
ref|XP_006873944.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    122   2e-31   Chrysochloris asiatica
gb|EPE05694.1|  vacuolar atp synthase 16 kda proteolipid subunit        122   2e-31   Ophiostoma piceae UAMH 11346
emb|CDY54164.1|  BnaC02g47230D                                          127   2e-31   Brassica napus [oilseed rape]
ref|XP_003709260.1|  V-type proton ATPase proteolipid subunit           122   2e-31   Magnaporthe oryzae 70-15
emb|CEP11926.1|  hypothetical protein                                   130   3e-31   Parasitella parasitica
ref|XP_002772137.1|  vacuolar ATP synthase 16 kDa proteolipid sub...    124   3e-31   Perkinsus marinus ATCC 50983
ref|XP_797801.1|  PREDICTED: V-type proton ATPase 16 kDa proteoli...    121   3e-31   Strongylocentrotus purpuratus [purple urchin]
gb|KIW63616.1|  V-type proton ATPase proteolipid subunit                123   4e-31   Phialophora americana
gb|ERT01764.1|  V-type proton ATPase proteolipid subunit                120   4e-31   Sporothrix schenckii ATCC 58251
ref|NP_001011570.1|  vacuolar H+ ATP synthase 16 kDa proteolipid ...    120   5e-31   Apis mellifera [bee]
ref|XP_007914202.1|  putative vacuolar atp synthase 16 kda proteo...    121   6e-31   Phaeoacremonium minimum UCRPA7
gb|EIE75365.1|  V-type proton ATPase proteolipid subunit                120   6e-31   Rhizopus delemar RA 99-880
sp|P55277.1|VATL_HELVI  RecName: Full=V-type proton ATPase 16 kDa...    120   7e-31   Heliothis virescens
ref|XP_003228377.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    120   8e-31   Anolis carolinensis [Carolina anole]
sp|P31403.1|VATL_MANSE  RecName: Full=V-type proton ATPase 16 kDa...    120   8e-31   Manduca sexta [Carolina sphinx]
ref|XP_004712996.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    120   9e-31   Echinops telfairi [lesser hedgehog tenrec]
tpg|DAA34683.1|  TPA: vacuolar H+-ATPase V0 sector subunits c/c'        120   9e-31   Amblyomma variegatum
gb|EPB83018.1|  V-type H+-transporting ATPase 16kDa proteolipid s...    120   1e-30   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_008815161.1|  V-type proton ATPase proteolipid subunit           120   1e-30   Plasmodium inui San Antonio 1
gb|KDR23608.1|  V-type proton ATPase 16 kDa proteolipid subunit         119   1e-30   Zootermopsis nevadensis
gb|KIH88046.1|  V-type H+-transporting ATPase 16kDa proteolipid s...    120   1e-30   Sporothrix brasiliensis 5110
gb|EHJ71500.1|  hypothetical protein KGM_13250                          120   1e-30   
ref|XP_001609797.1|  proteolipid subunit c                              120   1e-30   Babesia bovis T2Bo
ref|XP_002165747.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    120   1e-30   Hydra vulgaris
ref|XP_003396177.1|  PREDICTED: v-type proton ATPase 16 kDa prote...    120   1e-30   Bombus terrestris [large earth bumblebee]
ref|XP_001961321.1|  GF13808                                            120   2e-30   Drosophila ananassae
ref|XP_952989.1|  vacuolar H+-ATPase subunit                            120   2e-30   Theileria annulata
ref|XP_001613765.1|  vacuolar ATP synthetase                            120   2e-30   Plasmodium vivax
gb|EIE81432.1|  V-type proton ATPase proteolipid subunit                119   2e-30   Rhizopus delemar RA 99-880
ref|XP_003381793.1|  vacuolar ATP synthase proteolipid subunit          119   2e-30   Trichinella spiralis
dbj|BAN64843.1|  proteolipid subunit c, putative                        120   2e-30   Babesia bovis
gb|EPB91100.1|  V-type H+-transporting ATPase 16kDa proteolipid s...    119   2e-30   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002259621.1|  vacuolar ATP synthetase                            119   2e-30   Plasmodium knowlesi strain H
ref|XP_001229170.1|  vacuolar ATP synthase 16 kDa proteolipid sub...    119   2e-30   Chaetomium globosum CBS 148.51
gb|ACH56921.1|  vacuolar H+-ATPase V0 sector subunits c/c'              119   2e-30   Simulium vittatum
gb|EFX01295.1|  vacuolar ATP synthase proteolipid subunit               119   2e-30   Grosmannia clavigera kw1407
emb|CCF75916.1|  unnamed protein product                                119   2e-30   Babesia microti strain RI
ref|XP_006893921.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    119   3e-30   Elephantulus edwardii [Cape long-eared elephant shrew]
sp|Q43362.1|VATL_PLECA  RecName: Full=V-type proton ATPase 16 kDa...    119   3e-30   Chrysotila carterae
ref|XP_003703287.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    119   3e-30   Megachile rotundata
ref|XP_003417810.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    119   3e-30   Loxodonta africana [African bush elephant]
ref|XP_001361962.1|  GA16335                                            119   3e-30   Drosophila pseudoobscura pseudoobscura
ref|NP_001155531.1|  V-type proton ATPase 16 kDa proteolipid subunit    119   3e-30   Acyrthosiphon pisum
emb|CDS13504.1|  Putative V-type H-transporting ATPase 16kDaFT pr...    119   3e-30   Lichtheimia ramosa
ref|XP_004222823.1|  vacuolar ATP synthetase                            119   4e-30   Plasmodium cynomolgi strain B
ref|XP_011190581.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    119   4e-30   Zeugodacus cucurbitae [melon fruit fly]
gb|KFY08889.1|  hypothetical protein V492_05829                         119   4e-30   Pseudogymnoascus sp. VKM F-4246
ref|XP_001654757.1|  AAEL000291-PA                                      118   5e-30   Aedes aegypti
gb|KFP93001.1|  V-type proton ATPase 16 kDa proteolipid subunit         118   5e-30   Haliaeetus albicilla
gb|AAB71660.1|  V-ATPase C-subunit                                      118   5e-30   Aedes aegypti
gb|AHN55086.1|  vacuolar H-ATPase 16                                    118   5e-30   Schistocerca gregaria [desert locust]
ref|XP_004364210.1|  V-type ATPase                                      118   5e-30   Capsaspora owczarzaki ATCC 30864
ref|XP_008871715.1|  V-type proton ATPase proteolipid subunit           119   5e-30   
ref|XP_003124792.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    118   5e-30   
ref|XP_007833906.1|  V-type proton ATPase                               119   5e-30   
ref|XP_005054291.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    118   5e-30   
ref|XP_510748.3|  PREDICTED: V-type proton ATPase 16 kDa proteoli...    118   5e-30   
ref|XP_005150717.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    118   5e-30   
gb|KIW12158.1|  V-type proton ATPase proteolipid subunit                118   6e-30   
gb|ACH45347.1|  putative vacuolar H+ ATP synthase 16 kDa proteoli...    118   6e-30   
ref|XP_006913992.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    118   6e-30   
ref|XP_001013914.1|  V-type ATPase, C subunit family protein            118   6e-30   
ref|XP_009835201.1|  V-type proton ATPase proteolipid subunit           118   6e-30   
ref|XP_003916441.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    118   6e-30   
ref|XP_008621124.1|  V-type H+-transporting ATPase 16kDa proteoli...    118   6e-30   
gb|ESA03773.1|  hypothetical protein GLOINDRAFT_238678                  117   6e-30   
ref|XP_002062804.1|  GK19648                                            118   7e-30   
ref|XP_001911041.1|  hypothetical protein                               118   7e-30   
ref|XP_004999049.1|  vacuolar ATP synthase proteolipid subunit          119   7e-30   
gb|KFD57703.1|  hypothetical protein M513_01373                         118   7e-30   
ref|XP_007760266.1|  V-type proton ATPase proteolipid subunit           117   7e-30   
emb|CDJ91685.1|  ATPase domain containing protein                       118   7e-30   
gb|KIW03593.1|  V-type proton ATPase proteolipid subunit                118   7e-30   
ref|XP_002061756.1|  GK17170                                            118   7e-30   
ref|XP_005828493.1|  hypothetical protein GUITHDRAFT_96003              118   7e-30   
ref|XP_006696978.1|  hypothetical protein CTHT_0066820                  118   8e-30   
ref|NP_476801.1|  vacuolar H[+] ATPase 16kD subunit 1, isoform A        118   8e-30   
gb|AFM87499.1|  v-type proton ATPase proteolipid subunit-like pro...    117   8e-30   
ref|XP_011418206.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   9e-30   
gb|AFM87347.1|  v-type proton ATPase proteolipid subunit-like pro...    117   9e-30   
gb|EPT26846.1|  vacuolar ATP synthetase                                 117   9e-30   
ref|XP_005819759.1|  hypothetical protein GUITHDRAFT_156239             118   9e-30   
ref|XP_005025972.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    118   9e-30   
gb|EGT33594.1|  CBN-VHA-2 protein                                       117   1e-29   
gb|ETW45715.1|  V-type ATPase, C subunit                                117   1e-29   
ref|XP_001915231.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   1e-29   
ref|NP_001279870.1|  ATPase, H+ transporting, lysosomal 16kDa, V0...    117   1e-29   
ref|XP_005184512.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   1e-29   
dbj|BAN20571.1|  vacuolar H[+] ATPase subunit                           117   1e-29   
ref|XP_003438506.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   1e-29   
ref|XP_011059583.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   1e-29   
emb|CEG69140.1|  Putative V-type proton ATPase proteolipid subunit      117   1e-29   
emb|CEI94683.1|  Putative V-type proton ATPase proteolipid subunit      117   1e-29   
ref|XP_007937733.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   1e-29   
ref|XP_002112261.1|  conserved hypothetical protein                     117   1e-29   
ref|NP_001264953.1|  ATPase, H+ transporting, lysosomal 16kDa, V0...    117   1e-29   
ref|XP_005538224.1|  V-type ATPase V0 subunit c                         117   1e-29   
ref|XP_005935592.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   1e-29   
gb|AFK40303.1|  unknown                                                 117   1e-29   
gb|KEY73734.1|  hypothetical protein S7711_06310                        117   1e-29   
ref|XP_009222310.1|  V-type proton ATPase proteolipid subunit           117   1e-29   
ref|XP_004571403.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   1e-29   
ref|XP_005522837.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   1e-29   
ref|XP_004438215.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   1e-29   
gb|ELU01707.1|  hypothetical protein CAPTEDRAFT_19190                   117   1e-29   
gb|ABV60304.1|  putative V-ATPase C-subunit                             117   1e-29   
ref|XP_007423912.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   1e-29   
emb|CDW86375.1|  vacuolar atp synthase                                  125   1e-29   
ref|XP_001364794.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   1e-29   
gb|EXX50892.1|  Vma3p                                                   117   2e-29   
ref|XP_008599398.1|  vacuolar ATP synthase 16 kDa proteolipid sub...    117   2e-29   
emb|CDW57191.1|  ATP-synt C domain containing protein                   117   2e-29   
ref|XP_004704390.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   2e-29   
ref|XP_010784703.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   2e-29   
ref|XP_010386196.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   2e-29   
ref|NP_001185653.1|  TBC1 domain family, member 24                      117   2e-29   
gb|EMC86662.1|  V-type proton ATPase 16 kDa proteolipid subunit         116   2e-29   
ref|XP_003348177.1|  hypothetical protein SMAC_04022                    117   2e-29   
ref|NP_988893.1|  V-type proton ATPase 16 kDa proteolipid subunit       117   2e-29   
gb|KFP74912.1|  V-type proton ATPase 16 kDa proteolipid subunit         116   2e-29   
ref|XP_002926568.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   2e-29   
gb|ENN76641.1|  hypothetical protein YQE_06820                          117   2e-29   
ref|XP_001351750.1|  vacuolar ATP synthetase                            117   2e-29   
emb|CDO63070.1|  V-type proton ATPase 16 kDa proteolipid subunit,...    117   2e-29   
emb|CEJ92574.1|  Putative Vacuolar ATP synthase 16 kDa proteolipi...    117   2e-29   
ref|XP_009703293.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   2e-29   
gb|KFP07963.1|  V-type proton ATPase 16 kDa proteolipid subunit         116   2e-29   
ref|XP_010296907.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   2e-29   
ref|XP_011209070.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   2e-29   
ref|NP_001082675.1|  ATPase, H+ transporting, lysosomal 16kDa, V0...    117   2e-29   
sp|Q03105.1|VATL_TORMA  RecName: Full=V-type proton ATPase 16 kDa...    117   2e-29   
ref|XP_007800462.1|  V-type proton ATPase proteolipid subunit           116   2e-29   
ref|XP_003648856.1|  hypothetical protein THITE_57625                   117   2e-29   
ref|XP_010294763.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   2e-29   
gb|AFM86280.1|  v-type proton ATPase proteolipid subunit-like pro...    117   2e-29   
gb|EUT70588.1|  V-type proton ATPase proteolipid subunit                116   2e-29   
ref|XP_004373239.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   2e-29   
ref|XP_004534551.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   2e-29   
gb|KFO65676.1|  V-type proton ATPase 16 kDa proteolipid subunit         115   2e-29   
ref|XP_009814171.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   2e-29   
gb|EME49465.1|  hypothetical protein DOTSEDRAFT_40663                   117   2e-29   
gb|EMF17998.1|  vacuolar membrane ATPase C                              117   2e-29   
gb|KFP96368.1|  V-type proton ATPase 16 kDa proteolipid subunit         115   2e-29   
gb|AFM87725.1|  v-type proton ATPase proteolipid subunit-like pro...    116   2e-29   
ref|XP_961418.2|  vacuolar ATP synthase proteolipid subunit             117   2e-29   
ref|XP_010766304.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   2e-29   
gb|KFQ90630.1|  V-type proton ATPase 16 kDa proteolipid subunit         115   2e-29   
ref|XP_005442572.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    118   2e-29   
gb|ETN66257.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit        116   2e-29   
gb|KIV87022.1|  V-type proton ATPase proteolipid subunit, variant       116   2e-29   
ref|XP_007684629.1|  hypothetical protein COCMIDRAFT_33731              116   2e-29   
ref|XP_004622655.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   2e-29   
ref|XP_001637733.1|  predicted protein                                  116   3e-29   
ref|XP_008048077.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   3e-29   
ref|XP_001861266.1|  conserved hypothetical protein                     116   3e-29   
ref|XP_004474937.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   3e-29   
gb|KFP46779.1|  V-type proton ATPase 16 kDa proteolipid subunit         116   3e-29   
gb|KFV79775.1|  V-type proton ATPase 16 kDa proteolipid subunit         115   3e-29   
ref|XP_011500676.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   3e-29   
ref|XP_009937515.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   3e-29   
ref|XP_006002971.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   3e-29   
ref|XP_003998981.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   3e-29   
gb|AFM90381.1|  v-type proton ATPase proteolipid subunit-like pro...    116   3e-29   
gb|ETW38064.1|  V-type proton ATPase proteolipid subunit                116   3e-29   
ref|XP_010168905.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   3e-29   
ref|XP_007795242.1|  putative vacuolar atp synthase 16 kda proteo...    116   3e-29   
ref|XP_005493234.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   3e-29   
ref|XP_009491802.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   3e-29   
gb|KFZ47624.1|  V-type proton ATPase 16 kDa proteolipid subunit         116   3e-29   
gb|KFQ48976.1|  V-type proton ATPase 16 kDa proteolipid subunit         116   3e-29   
gb|AAH43805.1|  MGC64475 protein                                        117   3e-29   
ref|XP_007703845.1|  hypothetical protein COCSADRAFT_98697              116   3e-29   
gb|ETK87080.1|  V-type proton ATPase proteolipid subunit                116   3e-29   
ref|XP_010003360.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    117   3e-29   
gb|KEZ38785.1|  hypothetical protein SAPIO_CDS10822                     116   3e-29   
gb|KFV01697.1|  V-type proton ATPase 16 kDa proteolipid subunit         115   3e-29   
gb|KFU95240.1|  V-type proton ATPase 16 kDa proteolipid subunit         115   3e-29   
ref|XP_011148665.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   3e-29   
gb|KID80272.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit        116   3e-29   
gb|ACH45351.1|  putative vacuolar H+ ATP synthase 16 kDa proteoli...    115   3e-29   
ref|XP_010390380.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   3e-29   
ref|XP_009461707.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   4e-29   
ref|XP_006637438.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   4e-29   
ref|XP_002734832.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   4e-29   
gb|KGL85246.1|  V-type proton ATPase 16 kDa proteolipid subunit         115   4e-29   
dbj|BAM18985.1|  vacuolar H[+] ATPase subunit 16-1                      116   4e-29   
emb|CDQ68334.1|  unnamed protein product                                115   4e-29   
gb|KFW75226.1|  V-type proton ATPase 16 kDa proteolipid subunit         115   4e-29   
ref|XP_006808077.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   4e-29   
ref|XP_003137346.1|  vacuolar ATP synthase proteolipid subunit          116   4e-29   
ref|NP_001291535.1|  V-type proton ATPase 16 kDa proteolipid subunit    116   4e-29   
gb|ADI40537.1|  lysosomal H+-transporting ATPase V0 subunit C           115   4e-29   
gb|ELR09535.1|  V-type proton ATPase proteolipid subunit                116   4e-29   
ref|XP_004652254.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   4e-29   
gb|ACO09611.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit        116   4e-29   
ref|XP_009670391.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   4e-29   
emb|CBN81316.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit       115   4e-29   
ref|XP_009647925.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   4e-29   
ref|XP_009090445.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   4e-29   
gb|KFX96105.1|  hypothetical protein V490_03502                         116   4e-29   
ref|XP_005505717.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   4e-29   
ref|XP_003856781.1|  hypothetical protein MYCGRDRAFT_54447              116   4e-29   
gb|KFX89253.1|  hypothetical protein O988_08699                         116   4e-29   
ref|XP_003008951.1|  vacuolar ATP synthase 16 kDa proteolipid sub...    116   4e-29   
dbj|BAM17838.1|  vacuolar H[+] ATPase subunit 16-1                      116   4e-29   
ref|NP_001154112.1|  Vacuolar ATP synthase 16 kDa proteolipid sub...    115   4e-29   
ref|XP_008501323.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   4e-29   
ref|XP_011259751.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   4e-29   
ref|XP_001600237.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    116   4e-29   
ref|NP_001685.1|  V-type proton ATPase 16 kDa proteolipid subunit       115   5e-29   
ref|XP_002137844.1|  GA26304                                            116   5e-29   
gb|KEF54155.1|  V-type proton ATPase proteolipid subunit                115   5e-29   
gb|KFV02755.1|  V-type proton ATPase 16 kDa proteolipid subunit         115   5e-29   
ref|XP_001553113.1|  hypothetical protein BC1G_08480                    115   5e-29   
ref|XP_004403236.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   5e-29   
ref|XP_007747272.1|  V-type proton ATPase proteolipid subunit           115   5e-29   
gb|AAP36127.1|  Homo sapiens ATPase, H+ transporting, lysosomal 1...    115   5e-29   
gb|KIV87021.1|  V-type proton ATPase proteolipid subunit                116   5e-29   
ref|XP_007821775.1|  vacuolar ATP synthase subunit C                    116   5e-29   
ref|XP_002433961.1|  vacuolar H+ ATPase                                 115   5e-29   
gb|ETN76971.1|  V-type ATPase, C subunit                                116   5e-29   
gb|KIW99775.1|  V-type proton ATPase proteolipid subunit                115   5e-29   
ref|XP_008905373.1|  V-type proton ATPase proteolipid subunit           116   5e-29   
ref|XP_007713604.1|  hypothetical protein COCCADRAFT_27319              116   5e-29   
ref|XP_008312841.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   5e-29   
gb|AFM87009.1|  v-type proton ATPase proteolipid subunit-like pro...    115   5e-29   
ref|NP_001009195.1|  V-type proton ATPase 16 kDa proteolipid subunit    115   5e-29   
ref|XP_001800953.1|  hypothetical protein SNOG_10691                    115   5e-29   
gb|EYB91426.1|  hypothetical protein Y032_0206g1987                     115   5e-29   
ref|XP_007256360.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   5e-29   
gb|EMD90324.1|  hypothetical protein COCHEDRAFT_1022292                 115   5e-29   
ref|XP_009017285.1|  hypothetical protein HELRODRAFT_185574             116   5e-29   
emb|CCE29484.1|  probable H+-transporting ATPase lipid-binding pr...    116   5e-29   
gb|KFO71278.1|  V-type proton ATPase 16 kDa proteolipid subunit         115   5e-29   
ref|XP_004750723.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   5e-29   
ref|XP_003478538.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   5e-29   
ref|XP_002017466.1|  GL21511                                            115   5e-29   
emb|CCI11782.1|  Ev2180                                                 115   5e-29   
gb|AFM87384.1|  v-type proton ATPase proteolipid subunit-like pro...    115   6e-29   
ref|XP_010718222.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    115   6e-29   
ref|XP_009987046.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   6e-29   
gb|KFB53828.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit        115   6e-29   
gb|EYC06041.1|  hypothetical protein Y032_0078g1162                     115   6e-29   
ref|XP_007292593.1|  vacuolar ATP synthase 16 kDa proteolipid sub...    115   6e-29   
gb|EPQ66305.1|  Proteolipid subunit of the vacuolar H(+)-ATPase V...    115   6e-29   
ref|XP_003454063.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   6e-29   
gb|KFZ10098.1|  hypothetical protein V502_08315                         116   6e-29   
emb|CDJ96415.1|  ATPase domain containing protein                       115   6e-29   
gb|KFY96353.1|  hypothetical protein V500_02492                         116   6e-29   
ref|XP_537002.1|  PREDICTED: V-type proton ATPase 16 kDa proteoli...    115   7e-29   
gb|EFX70021.1|  hypothetical protein DAPPUDRAFT_231646                  115   7e-29   
gb|AAV84268.1|  vacuolar atpase 16kDa subunit                           115   7e-29   
ref|XP_001940404.1|  vacuolar ATP synthase 16 kDa proteolipid sub...    115   7e-29   
gb|EDM03809.1|  ATPase, H transporting, lysosomal V0 subunit c, i...    115   7e-29   
ref|XP_002048557.1|  GJ11291                                            115   7e-29   
ref|XP_005313177.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   7e-29   
ref|XP_008296032.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   7e-29   
ref|XP_003094813.1|  CRE-VHA-3 protein                                  115   8e-29   
gb|ESZ91115.1|  vacuolar ATP synthase 16 kDa proteolipid subunit        115   8e-29   
gb|EHK98320.1|  putative V-type proton ATPase 16 kDa proteolipid ...    115   8e-29   
ref|XP_006966298.1|  predicted protein                                  115   8e-29   
ref|XP_007920310.1|  hypothetical protein MYCFIDRAFT_71197              115   8e-29   
ref|XP_007054598.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   8e-29   
gb|EHK45191.1|  vacuolar ATP synthase subunit C                         115   8e-29   
ref|XP_008303561.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   8e-29   
ref|XP_005748516.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   8e-29   
gb|EHK26335.1|  hypothetical protein TRIVIDRAFT_82305                   115   8e-29   
ref|XP_003842370.1|  similar to vacuolar H+ ATP synthase 16 kDa p...    115   8e-29   
gb|EMT63564.1|  V-type proton ATPase 16 kDa proteolipid subunit         115   9e-29   
ref|XP_001588693.1|  vacuolar ATP synthase 16 kDa proteolipid sub...    115   9e-29   
ref|XP_005337843.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   9e-29   
ref|XP_005814433.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    115   9e-29   
emb|CDH50667.1|  ubiquitin-60s ribosomal protein l40 fusionprotein      118   9e-29   



>ref|XP_006304215.1| hypothetical protein CARUB_v10010325mg [Capsella rubella]
 gb|EOA37113.1| hypothetical protein CARUB_v10010325mg [Capsella rubella]
Length=203

 Score =   200 bits (509),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 156/169 (92%), Gaps = 1/169 (1%)
 Frame = +2

Query  26   KS*KRDFQIRSNPRSTK-AEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGV  202
            KS K +F   S PRS      M+S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGV
Sbjct  18   KSSKHNFFFVSFPRSDLIGRAMASSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGV  77

Query  203  GVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssg  382
            GVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSG
Sbjct  78   GVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSG  137

Query  383  lacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            LACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  138  LACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  186



>ref|XP_009623992.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
tomentosiformis]
 ref|XP_009606165.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
tomentosiformis]
 ref|XP_009617684.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
tomentosiformis]
 ref|XP_009804961.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
sylvestris]
 ref|XP_009757474.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
sylvestris]
Length=165

 Score =   195 bits (496),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_004232469.1| PREDICTED: V-type proton ATPase subunit c2 [Solanum lycopersicum]
 ref|XP_004238323.1| PREDICTED: V-type proton ATPase subunit c2 [Solanum lycopersicum]
 ref|XP_006340710.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c2-like 
[Solanum tuberosum]
 ref|XP_006342012.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c2-like 
[Solanum tuberosum]
 ref|XP_009625408.1| PREDICTED: V-type proton ATPase subunit c2 [Nicotiana tomentosiformis]
 ref|XP_009603555.1| PREDICTED: V-type proton ATPase subunit c2 [Nicotiana tomentosiformis]
 ref|XP_009791892.1| PREDICTED: V-type proton ATPase subunit c2 [Nicotiana sylvestris]
 ref|XP_009770493.1| PREDICTED: V-type proton ATPase subunit c2 [Nicotiana sylvestris]
Length=165

 Score =   194 bits (493),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>emb|CDP07433.1| unnamed protein product [Coffea canephora]
 emb|CDP07434.1| unnamed protein product [Coffea canephora]
 emb|CDP01923.1| unnamed protein product [Coffea canephora]
Length=165

 Score =   194 bits (493),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 148/148 (100%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPKTK+YYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKTKAYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_011074644.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Sesamum 
indicum]
 ref|XP_011083595.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit isoform 
X1 [Sesamum indicum]
 ref|XP_011083596.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit isoform 
X2 [Sesamum indicum]
 emb|CAH58637.1| vacuolar H+-ATPase C subunit [Plantago major]
 emb|CAJ38382.1| vacuolar H+-ATPase, subunit C 2 [Plantago major]
 gb|EPS58502.1| hypothetical protein M569_16311 [Genlisea aurea]
 gb|EPS66400.1| hypothetical protein M569_08374 [Genlisea aurea]
Length=165

 Score =   193 bits (491),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_002307699.1| hypothetical protein POPTR_0005s25660g [Populus trichocarpa]
 ref|XP_006434205.1| hypothetical protein CICLE_v10002719mg [Citrus clementina]
 ref|XP_006434206.1| hypothetical protein CICLE_v10002719mg [Citrus clementina]
 ref|XP_006472789.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Citrus sinensis]
 ref|XP_007017703.1| ATPase, F0/V0 complex, subunit C protein isoform 1 [Theobroma 
cacao]
 ref|XP_007019085.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 ref|XP_007042016.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 ref|XP_007046739.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 ref|XP_010109123.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 ref|XP_011027515.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Populus 
euphratica]
 ref|XP_011045145.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Populus 
euphratica]
 sp|Q43434.1|VATL_GOSHI RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Gossypium hirsutum]
 gb|AAA82976.1| vacuolar H+-ATPase proteolipid (16 kDa) subunit [Gossypium hirsutum]
 dbj|BAA75542.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 dbj|BAA89595.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 gb|ABK95764.1| unknown [Populus trichocarpa]
 gb|EEE94695.1| hypothetical protein POPTR_0005s25660g [Populus trichocarpa]
 gb|EOX90896.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 gb|EOX97847.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 gb|EOY14928.1| ATPase, F0/V0 complex, subunit C protein isoform 1 [Theobroma 
cacao]
 gb|EOY16310.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 gb|ESR47445.1| hypothetical protein CICLE_v10002719mg [Citrus clementina]
 gb|ESR47446.1| hypothetical protein CICLE_v10002719mg [Citrus clementina]
 gb|EXC55711.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 gb|KDO80622.1| hypothetical protein CISIN_1g031149mg [Citrus sinensis]
 gb|KDO80623.1| hypothetical protein CISIN_1g031149mg [Citrus sinensis]
 gb|KDO80624.1| hypothetical protein CISIN_1g031149mg [Citrus sinensis]
 gb|KDO80625.1| hypothetical protein CISIN_1g031149mg [Citrus sinensis]
 gb|KHG23863.1| V-type proton ATPase 16 kDa proteolipid subunit [Gossypium arboreum]
 gb|KHG30047.1| CVA16-2: V-type proton ATPase 16 kDa proteolipid subunit [Gossypium 
arboreum]
 gb|KJB14924.1| hypothetical protein B456_002G149400 [Gossypium raimondii]
 gb|KJB17311.1| hypothetical protein B456_003G010900 [Gossypium raimondii]
 gb|KJB77739.1| hypothetical protein B456_012G154000 [Gossypium raimondii]
Length=165

 Score =   193 bits (491),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_011088499.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Sesamum indicum]
Length=165

 Score =   193 bits (490),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGL+GL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLSGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>gb|EYU36762.1| hypothetical protein MIMGU_mgv1a015204mg [Erythranthe guttata]
 gb|EYU40398.1| hypothetical protein MIMGU_mgv1a015188mg [Erythranthe guttata]
Length=165

 Score =   193 bits (490),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGL+CGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLSCGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_008444773.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Cucumis 
melo]
 ref|XP_008444777.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Cucumis 
melo]
 ref|XP_010066228.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Eucalyptus 
grandis]
 ref|XP_010028655.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Eucalyptus 
grandis]
 ref|XP_010104504.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 ref|XP_010263904.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nelumbo 
nucifera]
 ref|XP_010271457.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nelumbo 
nucifera]
 ref|XP_010242823.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nelumbo 
nucifera]
 ref|XP_010247680.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nelumbo 
nucifera]
 sp|Q96473.1|VATL_KALDA RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=V-type 
H(+)-ATPase 16 kDa subunit; AltName: Full=Vacuolar proton 
pump 16 kDa proteolipid subunit [Kalanchoe daigremontiana]
 gb|AAC49473.1| V-type H+-ATPase 16 kDa subunit [Kalanchoe daigremontiana]
 gb|ACU87545.1| V-H+-ATPase subunit c protein [Limonium bicolor]
 gb|EXC01105.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
Length=165

 Score =   193 bits (490),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_009335490.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Pyrus x bretschneideri]
Length=218

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 154/165 (93%), Gaps = 7/165 (4%)
 Frame = +2

Query  56   SNPRST------KAEKMSS-TFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVAS  214
            S PRS       K+ +MSS TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVAS
Sbjct  37   SKPRSDQRISVRKSRRMSSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVAS  96

Query  215  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacg  394
            MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACG
Sbjct  97   MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACG  156

Query  395  laglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            LAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  157  LAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  201



>ref|XP_002302232.1| hypothetical protein POPTR_0002s08330g [Populus trichocarpa]
 gb|ABK93712.1| unknown [Populus trichocarpa]
 gb|EEE81505.1| hypothetical protein POPTR_0002s08330g [Populus trichocarpa]
Length=165

 Score =   193 bits (490),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGL+CGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLSCGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_009378455.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Pyrus 
x bretschneideri]
 ref|XP_009379559.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Pyrus 
x bretschneideri]
 gb|AIY85416.1| V-ATPase subunit C2 [Eriobotrya japonica]
Length=165

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_009758914.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
sylvestris]
 sp|Q40585.1|VATL_TOBAC RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Nicotiana tabacum]
 emb|CAA65062.1| c subunit of V-type ATPase [Nicotiana tabacum]
Length=165

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 147/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MPSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_006409426.1| hypothetical protein EUTSA_v10022840mg [Eutrema salsugineum]
 gb|ESQ50879.1| hypothetical protein EUTSA_v10022840mg [Eutrema salsugineum]
Length=224

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 151/159 (95%), Gaps = 1/159 (1%)
 Frame = +2

Query  53   RSNPRSTKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRP  232
            R      ++EKMS TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRP
Sbjct  50   RFERSGLRSEKMS-TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRP  108

Query  233  ELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsa  412
            ELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSA
Sbjct  109  ELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSA  168

Query  413  gMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            GMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  169  GMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  207



>gb|AAA82977.1| vacuolar H+-ATPase proteolipid (16 kDa) subunit [Gossypium hirsutum]
 gb|KHF97295.1| V-type proton ATPase 16 kDa proteolipid subunit [Gossypium arboreum]
Length=165

 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MS+TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSTTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_007223415.1| hypothetical protein PRUPE_ppa011277mg [Prunus persica]
 gb|EMJ24614.1| hypothetical protein PRUPE_ppa011277mg [Prunus persica]
Length=216

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 155/164 (95%), Gaps = 3/164 (2%)
 Frame = +2

Query  47   QIRSNPR--STKAEKMSS-TFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASM  217
            ++RS+      K+ +MSS TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASM
Sbjct  36   EVRSDQEYLVRKSRRMSSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASM  95

Query  218  GVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacgl  397
            GVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGL
Sbjct  96   GVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGL  155

Query  398  aglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            AGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  156  AGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  199



>ref|NP_564098.2| VACUOLAR-TYPE H+ ATPASE C2 [Arabidopsis thaliana]
 ref|XP_002300729.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 4 family protein 
[Populus trichocarpa]
 ref|XP_006386190.1| hypothetical protein POPTR_0002s02870g [Populus trichocarpa]
 ref|XP_011028959.1| PREDICTED: V-type proton ATPase subunit c2 [Populus euphratica]
 ref|XP_011028960.1| PREDICTED: V-type proton ATPase subunit c2 [Populus euphratica]
 sp|P59228.1|VATL2_ARATH RecName: Full=V-type proton ATPase subunit c2; Short=V-ATPase 
subunit c2; AltName: Full=V-type proton ATPase 16 kDa proteolipid 
subunit c2; Short=V-ATPase 16 kDa proteolipid subunit 
c2; AltName: Full=Vacuolar H(+)-ATPase subunit c isoform 2; 
AltName: Full=Vacuolar proton pump 16 kDa proteolipid subunit 
c2; AltName: Full=Vacuolar proton pump subunit c2 [Arabidopsis 
thaliana]
 gb|AAG12542.1|AC007797_2 vacuolar H+-pumping ATPase [Arabidopsis thaliana]
 gb|AAA99937.1| vacuolar H+-pumping ATPase 16 kDa proteolipid [Arabidopsis thaliana]
 gb|ABD65598.1| At1g19910 [Arabidopsis thaliana]
 gb|ABK93405.1| unknown [Populus trichocarpa]
 gb|EEE80002.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 4 family protein 
[Populus trichocarpa]
 gb|AEE29912.1| VACUOLAR-TYPE H+ ATPASE C2 [Arabidopsis thaliana]
 gb|ERP63987.1| hypothetical protein POPTR_0002s02870g [Populus trichocarpa]
 gb|KFK44115.1| hypothetical protein AALP_AA1G217500 [Arabis alpina]
 gb|KHG04199.1| V-type proton ATPase 16 kDa proteolipid subunit c2 -like protein 
[Gossypium arboreum]
 gb|KHG08825.1| V-type proton ATPase 16 kDa proteolipid subunit c2 -like protein 
[Gossypium arboreum]
 gb|KHG19338.1| V-type proton ATPase 16 kDa proteolipid subunit c2 -like protein 
[Gossypium arboreum]
 gb|KHG25128.1| V-type proton ATPase 16 kDa proteolipid subunit c2 -like protein 
[Gossypium arboreum]
 gb|KJB32610.1| hypothetical protein B456_005G248800 [Gossypium raimondii]
 gb|KJB40127.1| hypothetical protein B456_007G047900 [Gossypium raimondii]
 gb|KJB43370.1| hypothetical protein B456_007G196500 [Gossypium raimondii]
 gb|KJB63564.1| hypothetical protein B456_010G006100 [Gossypium raimondii]
 gb|KJB63565.1| hypothetical protein B456_010G006100 [Gossypium raimondii]
Length=165

 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_011092859.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Sesamum 
indicum]
Length=165

 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>gb|EMS54266.1| V-type proton ATPase 16 kDa proteolipid subunit [Triticum urartu]
Length=313

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 139/148 (94%), Gaps = 3/148 (2%)
 Frame = +2

Query  53   RSNP---RSTKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGV  223
            R++P    ST+  KMSS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGV
Sbjct  135  RADPDPSSSTRRRKMSSVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGV  194

Query  224  MRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglag  403
            MRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAG
Sbjct  195  MRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAG  254

Query  404  lsagMAIGIVGDAGVRANAQQPKLFVGM  487
            L+AGMAIGIVGDAGVRANAQQPKLFVGM
Sbjct  255  LAAGMAIGIVGDAGVRANAQQPKLFVGM  282



>ref|XP_006592081.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
Length=203

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +2

Query  23   WKS*KRDFQIRSNPRSTKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGV  202
            W    R+  +  + +S     + + FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGV
Sbjct  18   WNCGNRNISLLRSDQSDVVAVIMAPFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGV  77

Query  203  GVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssg  382
            GVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSG
Sbjct  78   GVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSG  137

Query  383  lacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            LACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  138  LACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  186



>ref|XP_004152664.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 ref|XP_004164437.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 ref|XP_006487263.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Citrus sinensis]
 gb|KDO41480.1| hypothetical protein CISIN_1g031125mg [Citrus sinensis]
Length=165

 Score =   192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_009625822.1| PREDICTED: V-type proton ATPase subunit c1 [Nicotiana tomentosiformis]
Length=164

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 146/146 (100%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>emb|CAA65063.1| c subunit of V-type ATPase [Nicotiana tabacum]
Length=165

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVA MGVMRPELVMKSIVPVV
Sbjct  1    MASTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVACMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIA+IISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIALIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_004133996.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 ref|XP_004169510.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 gb|KGN56739.1| Vacuolar H+-ATPase c subunit [Cucumis sativus]
Length=165

 Score =   191 bits (486),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>gb|KDP27632.1| hypothetical protein JCGZ_19637 [Jatropha curcas]
 gb|KDP32809.1| hypothetical protein JCGZ_12101 [Jatropha curcas]
Length=165

 Score =   191 bits (485),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_009348673.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Pyrus x bretschneideri]
Length=166

 Score =   191 bits (486),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 145/147 (99%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            SSTFSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    SSTFSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>gb|AHC08714.1| vacuolar H+-ATPase subunit c [Rosa rugosa]
Length=166

 Score =   191 bits (486),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 146/147 (99%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            SSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    SSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>ref|XP_004152663.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 ref|XP_004164438.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 ref|XP_006466918.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Citrus sinensis]
 dbj|BAA75515.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 dbj|BAA89594.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 gb|KDO71128.1| hypothetical protein CISIN_1g031129mg [Citrus sinensis]
 gb|KGN62658.1| hypothetical protein Csa_2G365650 [Cucumis sativus]
Length=165

 Score =   191 bits (485),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_007200387.1| hypothetical protein PRUPE_ppa012519mg [Prunus persica]
 ref|XP_008221315.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Prunus 
mume]
 ref|XP_008236829.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Prunus 
mume]
 ref|XP_008387974.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Malus 
domestica]
 gb|EMJ01586.1| hypothetical protein PRUPE_ppa012519mg [Prunus persica]
 gb|AIY85418.1| V-ATPase subunit C3 [Eriobotrya japonica]
Length=166

 Score =   191 bits (485),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 146/147 (99%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            SSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    SSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>ref|XP_007202676.1| hypothetical protein PRUPE_ppa012515mg [Prunus persica]
 ref|XP_007227535.1| hypothetical protein PRUPE_ppa012508mg [Prunus persica]
 ref|XP_008219630.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Prunus 
mume]
 ref|XP_008241801.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Prunus 
mume]
 ref|XP_008372768.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Malus 
domestica]
 ref|XP_008378478.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Malus 
domestica]
 ref|XP_008338772.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Malus 
domestica]
 ref|XP_009378196.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Pyrus x bretschneideri]
 ref|XP_009338639.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Pyrus x bretschneideri]
 gb|EMJ03875.1| hypothetical protein PRUPE_ppa012515mg [Prunus persica]
 gb|EMJ28734.1| hypothetical protein PRUPE_ppa012508mg [Prunus persica]
Length=166

 Score =   191 bits (485),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 146/147 (99%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            SSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    SSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>ref|XP_002513751.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
 gb|EEF48334.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
Length=169

 Score =   191 bits (485),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 146/150 (97%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +2

Query  80   EKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVP  259
              MSS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVP
Sbjct  3    RNMSSGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVP  62

Query  260  VVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGD  439
            VVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGD
Sbjct  63   VVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGD  122

Query  440  AGVRANAQQPKLFVGMililifaealalYG  529
            AGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  AGVRANAQQPKLFVGMILILIFAEALALYG  152



>gb|ABJ74162.1| H+-ATPase proteolipid [Acanthus ebracteatus]
Length=165

 Score =   191 bits (485),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MS TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSLTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALA YG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALAWYG  148



>ref|XP_002310846.1| hypothetical protein POPTR_0007s13890g [Populus trichocarpa]
 ref|XP_011025922.1| PREDICTED: V-type proton ATPase subunit c2-like [Populus euphratica]
 gb|EEE91296.1| hypothetical protein POPTR_0007s13890g [Populus trichocarpa]
Length=165

 Score =   191 bits (484),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MVSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_010113377.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 gb|EXC35384.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
Length=188

 Score =   192 bits (487),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 133/134 (99%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGM  487
            VRANAQQPKLFVGM
Sbjct  121  VRANAQQPKLFVGM  134



>ref|XP_006423502.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
 gb|ESR36742.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
Length=165

 Score =   191 bits (484),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MPSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_002890358.1| vacuolar-H+-pumping ATPase 16 kDa proteolipid subunit 2 [Arabidopsis 
lyrata subsp. lyrata]
 ref|XP_006302919.1| hypothetical protein CARUB_v10021055mg [Capsella rubella]
 ref|XP_010498416.1| PREDICTED: V-type proton ATPase subunit c2 [Camelina sativa]
 ref|XP_010459670.1| PREDICTED: V-type proton ATPase subunit c2 [Camelina sativa]
 ref|XP_010477217.1| PREDICTED: V-type proton ATPase subunit c2 [Camelina sativa]
 gb|EFH66617.1| vacuolar-H+-pumping ATPase 16 kDa proteolipid subunit 2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EOA35817.1| hypothetical protein CARUB_v10021055mg [Capsella rubella]
 gb|KFK41996.1| hypothetical protein AALP_AA2G198800 [Arabis alpina]
Length=165

 Score =   191 bits (484),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>gb|AAK01292.1| vacuolar ATPase subunit c [Avicennia marina]
Length=165

 Score =   191 bits (484),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M STFSGDETAPFFGFLGAA+ALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MVSTFSGDETAPFFGFLGAASALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_006284579.1| hypothetical protein CARUB_v10005804mg, partial [Capsella rubella]
 gb|EOA17477.1| hypothetical protein CARUB_v10005804mg, partial [Capsella rubella]
Length=192

 Score =   191 bits (486),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 155/162 (96%), Gaps = 3/162 (2%)
 Frame = +2

Query  44   FQIRSNPRSTKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGV  223
            FQI S+P+  +  KMS TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGV
Sbjct  17   FQI-SDPK-IQNLKMS-TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGV  73

Query  224  MRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglag  403
            MRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAG
Sbjct  74   MRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAG  133

Query  404  lsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            LSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  134  LSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  175



>gb|ADQ53511.1| VAH protein [Phyllostachys edulis]
Length=165

 Score =   191 bits (484),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGL+CGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLSCGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_002513005.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
 ref|XP_002531515.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
 gb|EEF30869.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
 gb|EEF49508.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
Length=165

 Score =   190 bits (483),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 146/148 (99%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_004287829.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Fragaria 
vesca subsp. vesca]
 ref|XP_004291823.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Fragaria 
vesca subsp. vesca]
Length=166

 Score =   190 bits (483),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 145/147 (99%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            S+TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    STTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>ref|XP_009804090.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
sylvestris]
Length=164

 Score =   190 bits (483),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STF+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    STFAGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_010523552.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tarenaya 
hassleriana]
Length=165

 Score =   190 bits (482),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_010534694.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Tarenaya hassleriana]
Length=165

 Score =   190 bits (482),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_010432381.1| PREDICTED: V-type proton ATPase subunit c1-like [Camelina sativa]
Length=164

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_004290874.1| PREDICTED: V-type proton ATPase subunit c4 [Fragaria vesca subsp. 
vesca]
Length=166

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 145/147 (99%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            SS+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    SSSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>ref|NP_179244.1| ATPase, F0/V0 complex, subunit C protein [Arabidopsis thaliana]
 ref|NP_195603.1| vacuolar-type H(+)-ATPase C3 [Arabidopsis thaliana]
 ref|NP_195198.1| vacuolar H+-pumping ATPase C1 [Arabidopsis thaliana]
 ref|XP_002306142.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 family 
protein [Populus trichocarpa]
 ref|XP_002285861.1| PREDICTED: V-type proton ATPase subunit c1 [Vitis vinifera]
 ref|XP_002866823.1| vacuolar ATP synthase 16 kDa proteolipid subunit 5 [Arabidopsis 
lyrata subsp. lyrata]
 ref|XP_002867106.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002886055.1| vacuolar ATP synthase 16 kDa proteolipid subunit 5 [Arabidopsis 
lyrata subsp. lyrata]
 ref|XP_006412191.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 ref|XP_006412192.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 ref|XP_006412193.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 ref|XP_009109559.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
 ref|XP_009136312.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
 ref|XP_009138323.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
 ref|XP_009101920.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
 ref|XP_009108707.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
 ref|XP_009401127.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009404986.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009410658.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009414856.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Musa acuminata subsp. malaccensis]
 ref|XP_010516605.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010431841.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010436985.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010446405.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010467382.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010489224.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010489226.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010647579.1| PREDICTED: V-type proton ATPase subunit c1 [Vitis vinifera]
 sp|P0DH92.1|VATL1_ARATH RecName: Full=V-type proton ATPase subunit c1; Short=V-ATPase 
subunit c1; AltName: Full=V-type proton ATPase 16 kDa proteolipid 
subunit c1; Short=V-ATPase 16 kDa proteolipid subunit 
c1; AltName: Full=Vacuolar H(+)-ATPase subunit c isoform 1; 
AltName: Full=Vacuolar proton pump 16 kDa proteolipid subunit 
c1; AltName: Full=Vacuolar proton pump subunit c1 [Arabidopsis 
thaliana]
 sp|P0DH93.1|VATL3_ARATH RecName: Full=V-type proton ATPase subunit c3; Short=V-ATPase 
subunit c3; AltName: Full=V-type proton ATPase 16 kDa proteolipid 
subunit c3; Short=V-ATPase 16 kDa proteolipid subunit 
c3; AltName: Full=Vacuolar H(+)-ATPase subunit c isoform 3; 
AltName: Full=Vacuolar proton pump 16 kDa proteolipid subunit 
c3; AltName: Full=Vacuolar proton pump subunit c3 [Arabidopsis 
thaliana]
 sp|P0DH94.1|VATL5_ARATH RecName: Full=V-type proton ATPase subunit c5; Short=V-ATPase 
subunit c5; AltName: Full=V-type proton ATPase 16 kDa proteolipid 
subunit c5; Short=V-ATPase 16 kDa proteolipid subunit 
c5; AltName: Full=Vacuolar H(+)-ATPase subunit c isoform 5; 
AltName: Full=Vacuolar proton pump 16 kDa proteolipid subunit 
c5; AltName: Full=Vacuolar proton pump subunit c5 [Arabidopsis 
thaliana]
 gb|AAK49588.1|AF372872_1 AT4g34720/T4L20_300 [Arabidopsis thaliana]
 gb|AAL06550.1|AF412097_1 AT4g38920/F19H22_20 [Arabidopsis thaliana]
 gb|AAA99933.1| vacuolar H+-pumping ATPase 16 kDa proteolipid [Arabidopsis thaliana]
 gb|AAA99935.1| vacuolar H+-pumping ATPase 16 kDa proteolipid [Arabidopsis thaliana]
 emb|CAA18851.1| vacuolar H+-transporting ATPase 16K chain [Arabidopsis thaliana]
 emb|CAB38812.1| H+-transporting ATPase 16K chain P2, vacuolar [Arabidopsis thaliana]
 gb|AAD26493.1| putative vacuolar proton-ATPase 16 kDa proteolipid [Arabidopsis 
thaliana]
 emb|CAB80189.1| vacuolar H+-transporting ATPase 16K chain [Arabidopsis thaliana]
 emb|CAB80555.1| H+-transporting ATPase 16K chain P2, vacuolar [Arabidopsis thaliana]
 gb|AAK83591.1| AT4g38920/F19H22_20 [Arabidopsis thaliana]
 gb|AAL24318.1| H+-transporting ATPase 16K chain P2, vacuolar [Arabidopsis thaliana]
 gb|AAL90932.1| AT4g38920/F19H22_20 [Arabidopsis thaliana]
 gb|AAM13248.1| H+-transporting ATPase 16K chain P2, vacuolar [Arabidopsis thaliana]
 gb|AAM63410.1| vacuolar H+-transporting ATPase 16K chain [Arabidopsis thaliana]
 gb|AAM64670.1| vacuolar H+-transporting ATPase 16K chain [Arabidopsis thaliana]
 gb|AAM91049.1| AT4g34720/T4L20_300 [Arabidopsis thaliana]
 gb|AAT41752.1| At2g16510 [Arabidopsis thaliana]
 gb|AAT70456.1| At2g16510 [Arabidopsis thaliana]
 gb|ABK93045.1| unknown [Populus trichocarpa]
 gb|ABK94186.1| unknown [Populus trichocarpa]
 emb|CAN62098.1| hypothetical protein VITISV_006218 [Vitis vinifera]
 gb|EEE86653.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 family 
protein [Populus trichocarpa]
 gb|EFH43082.1| vacuolar ATP synthase 16 kDa proteolipid subunit 5 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH43365.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62314.1| vacuolar ATP synthase 16 kDa proteolipid subunit 5 [Arabidopsis 
lyrata subsp. lyrata]
 emb|CBI37981.3| unnamed protein product [Vitis vinifera]
 emb|CBI19010.3| unnamed protein product [Vitis vinifera]
 gb|AEC06505.1| ATPase, F0/V0 complex, subunit C protein [Arabidopsis thaliana]
 gb|AEE86415.1| vacuolar H+-pumping ATPase C1 [Arabidopsis thaliana]
 gb|AEE86993.1| vacuolar-type H(+)-ATPase C3 [Arabidopsis thaliana]
 gb|AEQ39042.1| putative proton-transporting ATPase [Wolffia arrhiza]
 gb|ESQ53644.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 gb|ESQ53645.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 gb|ESQ53646.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 gb|KFK30108.1| hypothetical protein AALP_AA7G217800 [Arabis alpina]
 gb|KFK30483.1| hypothetical protein AALP_AA7G266800 [Arabis alpina]
 gb|KFK40060.1| hypothetical protein AALP_AA3G325100 [Arabis alpina]
Length=164

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_010416452.1| PREDICTED: V-type proton ATPase subunit c4-like [Camelina sativa]
Length=165

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MTSGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_010530297.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Tarenaya hassleriana]
Length=165

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MTSGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>gb|KDP38594.1| hypothetical protein JCGZ_04519 [Jatropha curcas]
Length=167

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  5    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  64

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  65   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  124

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  125  ANAQQPKLFVGMILILIFAEALALYG  150



>ref|XP_006416453.1| hypothetical protein EUTSA_v10008949mg [Eutrema salsugineum]
 ref|XP_009110251.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c2-like 
[Brassica rapa]
 ref|XP_010428588.1| PREDICTED: V-type proton ATPase subunit c2-like [Camelina sativa]
 ref|XP_010471677.1| PREDICTED: V-type proton ATPase subunit c2-like [Camelina sativa]
 gb|ESQ34806.1| hypothetical protein EUTSA_v10008949mg [Eutrema salsugineum]
Length=165

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_010539643.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Tarenaya hassleriana]
 ref|XP_010539854.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tarenaya 
hassleriana]
Length=165

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_006298701.1| hypothetical protein CARUB_v10014796mg [Capsella rubella]
 ref|XP_009393424.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009399178.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009411919.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_010061023.1| PREDICTED: V-type proton ATPase subunit c1 [Eucalyptus grandis]
 gb|EOA31599.1| hypothetical protein CARUB_v10014796mg [Capsella rubella]
 gb|KCW67923.1| hypothetical protein EUGRSUZ_F01624 [Eucalyptus grandis]
Length=164

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_002441892.1| hypothetical protein SORBIDRAFT_08g004380 [Sorghum bicolor]
 ref|XP_002442886.1| hypothetical protein SORBIDRAFT_08g004390 [Sorghum bicolor]
 gb|EES15730.1| hypothetical protein SORBIDRAFT_08g004380 [Sorghum bicolor]
 gb|EES16724.1| hypothetical protein SORBIDRAFT_08g004390 [Sorghum bicolor]
Length=165

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_008391887.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Malus domestica]
 ref|XP_008358082.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Malus domestica]
 ref|XP_008365697.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Malus domestica]
Length=166

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  123

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  124  ANAQQPKLFVGMILILIFAEALALYG  149



>ref|NP_001149195.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 ref|NP_001147046.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 ref|NP_001148417.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 ref|XP_002450376.1| hypothetical protein SORBIDRAFT_05g004510 [Sorghum bicolor]
 ref|XP_003577806.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Brachypodium distachyon]
 ref|XP_003578850.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Brachypodium distachyon]
 ref|XP_008679623.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Zea 
mays]
 gb|AAL08022.1|AF416606_1 vacuolar H+-ATPase 16 kDa proteolipid subunit c [Cenchrus americanus]
 gb|AAV36518.1| vacuolar ATPase subunit c isoform [Cenchrus americanus]
 gb|ACG25259.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|ACG31406.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|ACG32031.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|ACG34512.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|ACL52430.1| unknown [Zea mays]
 gb|ACN25454.1| unknown [Zea mays]
 gb|ACN35717.1| unknown [Zea mays]
 gb|EES09364.1| hypothetical protein SORBIDRAFT_05g004510 [Sorghum bicolor]
 dbj|BAJ84818.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86865.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89097.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFW65377.1| hypothetical protein ZEAMMB73_020019 [Zea mays]
 tpg|DAA39043.1| TPA: V-type proton ATPase proteolipid subunit [Zea mays]
Length=165

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|NP_001290014.1| V-type proton ATPase 16 kDa proteolipid subunit [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010667733.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Beta 
vulgaris subsp. vulgaris]
 sp|P68161.1|VATL_MESCR RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Mesembryanthemum 
crystallinum]
 sp|P68162.1|VATL_BETVU RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Beta vulgaris]
 emb|CAA67356.1| subunit c of V-type ATPase [Beta vulgaris subsp. vulgaris]
 emb|CAA64455.1| V-type ATPase c subunit [Mesembryanthemum crystallinum]
 emb|CAC79689.1| subunit c of V-type ATPase [Beta vulgaris]
Length=165

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MS+ F+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSTVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>gb|ACN25606.1| unknown [Zea mays]
 tpg|DAA55568.1| TPA: ATPase1 [Zea mays]
Length=165

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGA+AALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSAFSGDETAPFFGFLGASAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>emb|CAC80261.1| V-ATPase subunit c [Beta vulgaris]
Length=135

 Score =   187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 130/134 (97%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MS+ F+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSTVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGM  487
            VRANAQQPKLFVGM
Sbjct  121  VRANAQQPKLFVGM  134



>ref|NP_001065855.1| Os11g0169900 [Oryza sativa Japonica Group]
 sp|Q0IUB5.1|VATL_ORYSJ RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Oryza sativa 
Japonica Group]
 sp|A2ZBW5.1|VATL_ORYSI RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Oryza sativa 
Indica Group]
 gb|AAA68175.1| H+-ATPase [Oryza sativa]
 gb|AAX93004.1| V-type ATPase, C subunit, putative [Oryza sativa Japonica Group]
 gb|ABA91617.1| Vacuolar ATP synthase 16 kDa proteolipid subunit, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27700.1| Os11g0169900 [Oryza sativa Japonica Group]
 gb|EAY80099.1| hypothetical protein OsI_35271 [Oryza sativa Indica Group]
 gb|EAZ17575.1| hypothetical protein OsJ_33113 [Oryza sativa Japonica Group]
 dbj|BAG97078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00387.1| unnamed protein product [Oryza sativa Japonica Group]
Length=165

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAA+AL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSVFSGDETAPFFGFLGAASALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_009337683.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Pyrus x bretschneideri]
Length=166

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 145/147 (99%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            SSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    SSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>ref|NP_001066258.1| Os12g0168900 [Oryza sativa Japonica Group]
 ref|XP_006663858.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Oryza brachyantha]
 gb|AAK91135.1|AF286464_1 V-ATPase subunit c [Oryza coarctata]
 dbj|BAF29277.1| Os12g0168900 [Oryza sativa Japonica Group]
 gb|EAZ19781.1| hypothetical protein OsJ_35361 [Oryza sativa Japonica Group]
Length=165

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAA+ALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSVFSGDETAPFFGFLGAASALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_006425529.1| hypothetical protein CICLE_v10026647mg [Citrus clementina]
 gb|ESR38769.1| hypothetical protein CICLE_v10026647mg [Citrus clementina]
Length=165

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS F GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSAFIGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|NP_001233967.1| V-type proton ATPase 16 kDa proteolipid subunit [Solanum lycopersicum]
 ref|NP_001275382.1| vacuolar proton ATPase proteolipid subunit-like protein [Solanum 
tuberosum]
 ref|XP_004248676.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Solanum 
lycopersicum]
 ref|XP_004248677.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Solanum 
lycopersicum]
 ref|XP_006365928.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Solanum tuberosum]
 ref|XP_006365929.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Solanum tuberosum]
 sp|O24011.1|VATL_SOLLC RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Solanum lycopersicum]
 gb|AAB64199.1| vacuolar proton ATPase proteolipid subunit [Solanum lycopersicum]
 gb|ABA40433.1| vacuolar proton ATPase proteolipid subunit-like protein [Solanum 
tuberosum]
 gb|ABB29937.1| vacuolar proton ATPase proteolipid subunit-like protein [Solanum 
tuberosum]
Length=164

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            S F+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    SNFAGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|NP_177693.1| V-type proton ATPase proteolipid subunit c4 [Arabidopsis thaliana]
 sp|P59229.1|VATL4_ARATH RecName: Full=V-type proton ATPase subunit c4; Short=V-ATPase 
subunit c4; AltName: Full=V-type proton ATPase 16 kDa proteolipid 
subunit c4; Short=V-ATPase 16 kDa proteolipid subunit 
c4; AltName: Full=Vacuolar H(+)-ATPase subunit c isoform 4; 
AltName: Full=Vacuolar proton pump 16 kDa proteolipid subunit 
c4; AltName: Full=Vacuolar proton pump subunit c4 [Arabidopsis 
thaliana]
 gb|AAD38803.1|AF153677_1 vacuolar H+-pumping ATPase 16 kDa subunit c isoform 4 [Arabidopsis 
thaliana]
 gb|AAF87129.1|AC006434_25 F10A5.17 [Arabidopsis thaliana]
 gb|AAL11568.1|AF424574_1 At1g75630/F10A5_17 [Arabidopsis thaliana]
 gb|AAA99936.1| vacuolar H+-pumping ATPase 16 kDa proteolipid [Arabidopsis thaliana]
 gb|AAM19995.1| At1g75630/F10A5_17 [Arabidopsis thaliana]
 gb|AEE35739.1| V-type proton ATPase proteolipid subunit c4 [Arabidopsis thaliana]
Length=166

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 145/147 (99%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            SS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    SSGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>ref|XP_006435119.1| hypothetical protein CICLE_v10002710mg [Citrus clementina]
 ref|XP_006473604.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Citrus sinensis]
 dbj|BAA75516.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 dbj|BAA89596.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 gb|ESR48359.1| hypothetical protein CICLE_v10002710mg [Citrus clementina]
 gb|KDO84764.1| hypothetical protein CISIN_1g031073mg [Citrus sinensis]
Length=166

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 147/149 (99%), Gaps = 1/149 (1%)
 Frame = +2

Query  86   MSST-FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV  262
            MSST FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV
Sbjct  1    MSSTLFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV  60

Query  263  VMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDA  442
            VMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDA
Sbjct  61   VMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDA  120

Query  443  GVRANAQQPKLFVGMililifaealalYG  529
            GVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  GVRANAQQPKLFVGMILILIFAEALALYG  149



>gb|ABK93797.1| unknown [Populus trichocarpa]
Length=165

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MVSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFV MILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVRMILILIFAEALALYG  148



>gb|KJB77737.1| hypothetical protein B456_012G154000 [Gossypium raimondii]
Length=166

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 147/149 (99%), Positives = 147/149 (99%), Gaps = 1/149 (1%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VR-ANAQQPKLFVGMililifaealalYG  529
            VR ANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRYANAQQPKLFVGMILILIFAEALALYG  149



>ref|XP_002279080.1| PREDICTED: V-type proton ATPase subunit c1 [Vitis vinifera]
 emb|CAN78114.1| hypothetical protein VITISV_027417 [Vitis vinifera]
 emb|CBI19803.3| unnamed protein product [Vitis vinifera]
Length=164

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            +TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    TTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>gb|KDP46708.1| hypothetical protein JCGZ_06496 [Jatropha curcas]
Length=165

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 146/148 (99%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M++ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MATGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_006411682.1| hypothetical protein EUTSA_v10026433mg [Eutrema salsugineum]
 gb|ESQ53135.1| hypothetical protein EUTSA_v10026433mg [Eutrema salsugineum]
Length=164

 Score =   188 bits (477),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    SSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_011047217.1| PREDICTED: V-type proton ATPase subunit c1 [Populus euphratica]
Length=207

 Score =   189 bits (481),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  45   STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  104

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  105  GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  164

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  165  ANAQQPKLFVGMILILIFAEALALYG  190



>ref|XP_010930879.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
Length=164

 Score =   188 bits (477),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 143/146 (98%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    SSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_009149488.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c2 
[Brassica rapa]
Length=165

 Score =   188 bits (477),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+S FSGDETAPFFGFLGAAAA VFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASGFSGDETAPFFGFLGAAAAPVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_004978799.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Setaria italica]
Length=165

 Score =   188 bits (477),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_008781499.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Phoenix 
dactylifera]
 ref|XP_008784205.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Phoenix 
dactylifera]
 ref|XP_008805578.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Phoenix 
dactylifera]
 ref|XP_010555255.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tarenaya 
hassleriana]
 ref|XP_010526574.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tarenaya 
hassleriana]
 ref|XP_010526908.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tarenaya 
hassleriana]
 ref|XP_010911678.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Elaeis 
guineensis]
Length=164

 Score =   188 bits (477),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    SSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_002313006.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 family 
protein [Populus trichocarpa]
 gb|EEE86961.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 family 
protein [Populus trichocarpa]
Length=207

 Score =   189 bits (481),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  45   STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  104

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  105  GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  164

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  165  ANAQQPKLFVGMILILIFAEALALYG  190



>gb|ABK93522.1| unknown [Populus trichocarpa]
Length=141

 Score =   187 bits (474),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 130/132 (98%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFV  481
            VRANAQQPKLFV
Sbjct  121  VRANAQQPKLFV  132



>ref|XP_009109515.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
Length=164

 Score =   187 bits (476),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVII TGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIIRTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>sp|P23957.1|VATL_AVESA RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Avena sativa]
 gb|AAA32712.1| H+-ATPase [Avena sativa]
 gb|ABG23316.1| vacuolar ATPase subunit c [Triticum aestivum]
 gb|ACV20869.1| vacuolar H+-ATPase subunit c [Leymus chinensis]
 dbj|BAJ92041.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT32401.1| V-type proton ATPase 16 kDa proteolipid subunit [Aegilops tauschii]
 gb|AHW46300.1| vacuolar-type H+-ATPase 16 kDa subunit c [Puccinellia tenuiflora]
Length=165

 Score =   187 bits (476),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K Y+LFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_009103374.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c2-like 
[Brassica rapa]
Length=165

 Score =   187 bits (476),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+S FSGDET+PFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASGFSGDETSPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTG+NPK KSYYLFDGYAHLSSGLA GLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGVNPKAKSYYLFDGYAHLSSGLAWGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_008793919.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Phoenix dactylifera]
Length=164

 Score =   187 bits (476),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    SNFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_006653951.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Oryza brachyantha]
Length=165

 Score =   187 bits (476),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAA+ALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSAFSGDETAPFFGFLGAASALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K Y+LFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|NP_001054416.1| Os05g0106100 [Oryza sativa Japonica Group]
 gb|AAU44174.1| putative vacuolar ATP synthase 16 kDa proteolipid subunit [Oryza 
sativa Japonica Group]
 dbj|BAF16330.1| Os05g0106100 [Oryza sativa Japonica Group]
 gb|EAY96230.1| hypothetical protein OsI_18123 [Oryza sativa Indica Group]
 dbj|BAG88579.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62035.1| hypothetical protein OsJ_16817 [Oryza sativa Japonica Group]
Length=166

 Score =   187 bits (476),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            SSTFSGDETAPFFGFLGAA+ALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    SSTFSGDETAPFFGFLGAASALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK K Y+LFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>ref|XP_008377172.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Malus domestica]
 ref|XP_008347353.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Malus 
domestica]
Length=166

 Score =   187 bits (476),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 144/147 (98%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            S+TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    STTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>ref|XP_008785887.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Phoenix dactylifera]
Length=164

 Score =   187 bits (476),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    SNFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_002510486.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
 gb|EEF52673.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
Length=165

 Score =   187 bits (475),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+  FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MAPAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIG+VGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGVVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>gb|ABK21313.1| unknown [Picea sitchensis]
 gb|ABK25220.1| unknown [Picea sitchensis]
 gb|ABK25983.1| unknown [Picea sitchensis]
Length=165

 Score =   187 bits (475),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M   FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MVEAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGL+GL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLSGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_010531483.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Tarenaya hassleriana]
Length=164

 Score =   187 bits (475),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    SAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>gb|AEB97956.1| vacuolar H+-ATPase 16 kDa proteolipid subunit c [Aeluropus littoralis]
Length=165

 Score =   187 bits (475),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSG+ETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSVFSGEETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_003569121.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Brachypodium 
distachyon]
Length=165

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 142/148 (96%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K Y+LFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_007131746.1| hypothetical protein PHAVU_011G038500g [Phaseolus vulgaris]
 sp|O22552.1|VATL_VIGRR RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Vigna radiata 
var. radiata]
 gb|AAC12798.1| adenosine triphosphatase [Vigna radiata]
 gb|ESW03740.1| hypothetical protein PHAVU_011G038500g [Phaseolus vulgaris]
Length=164

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 143/146 (98%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            ++FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    ASFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|NP_001150274.1| LOC100283904 [Zea mays]
 gb|ACF85712.1| unknown [Zea mays]
 gb|ACG33481.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|ACG38468.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|AFW75023.1| Vacuolar ATP synthase proteolipid subunit [Zea mays]
Length=166

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            +STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    ASTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK K Y+LFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>ref|XP_010912480.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
Length=164

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 143/146 (98%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            S+FSGD+TAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    SSFSGDQTAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>gb|KHN41911.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
Length=212

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 149/161 (93%), Gaps = 4/161 (2%)
 Frame = +2

Query  47   QIRSNPRSTKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVM  226
             +R +P   K     + FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVM
Sbjct  39   DLRFSPNKHKM----AAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVM  94

Query  227  RPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglagl  406
            RPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGL
Sbjct  95   RPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGL  154

Query  407  sagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            SAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  155  SAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  195



>ref|XP_002972795.1| hypothetical protein SELMODRAFT_228159 [Selaginella moellendorffii]
 ref|XP_002984370.1| hypothetical protein SELMODRAFT_271704 [Selaginella moellendorffii]
 gb|EFJ14420.1| hypothetical protein SELMODRAFT_271704 [Selaginella moellendorffii]
 gb|EFJ26016.1| hypothetical protein SELMODRAFT_228159 [Selaginella moellendorffii]
Length=166

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 145/150 (97%), Positives = 147/150 (98%), Gaps = 2/150 (1%)
 Frame = +2

Query  86   MSST--FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVP  259
            M+ST  FSGDETAPFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVP
Sbjct  1    MASTDAFSGDETAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVP  60

Query  260  VVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGD  439
            VVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGD
Sbjct  61   VVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGD  120

Query  440  AGVRANAQQPKLFVGMililifaealalYG  529
            AGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  AGVRANAQQPKLFVGMILILIFAEALALYG  150



>ref|XP_011037226.1| PREDICTED: V-type proton ATPase subunit c1 [Populus euphratica]
Length=164

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
             VLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   CVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_006647358.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Oryza brachyantha]
Length=167

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            ++TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  4    ATTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  63

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGV
Sbjct  64   AGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGV  123

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  124  RANAQQPKLFVGMILILIFAEALALYG  150



>ref|NP_001047092.1| Os02g0550100 [Oryza sativa Japonica Group]
 dbj|BAD16200.1| putative Vacuolar ATP synthase 16 kDa proteolipid subunit [Oryza 
sativa Japonica Group]
 dbj|BAD33262.1| putative Vacuolar ATP synthase 16 kDa proteolipid subunit [Oryza 
sativa Japonica Group]
 dbj|BAF09006.1| Os02g0550100 [Oryza sativa Japonica Group]
 gb|EEC73374.1| hypothetical protein OsI_07608 [Oryza sativa Indica Group]
 gb|EEE57166.1| hypothetical protein OsJ_07092 [Oryza sativa Japonica Group]
Length=167

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            +STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  4    ASTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  63

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK K Y+LFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGV
Sbjct  64   AGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGV  123

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  124  RANAQQPKLFVGMILILIFAEALALYG  150



>ref|XP_010933937.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
Length=164

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    SGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>gb|ACX50967.1| vacuolar membrane H+-ATPase c subunit [Tamarix hispida]
Length=165

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 141/148 (95%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MS+ F+GDETAPFFGFLGAAAALVFSCMGAAYGTAK GVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSTVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKGGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGL+AGMA+GIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLAAGMAVGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>gb|KGN62657.1| hypothetical protein Csa_2G365640 [Cucumis sativus]
Length=165

 Score =   186 bits (472),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 144/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPEL MKSIVPVV
Sbjct  1    MSSSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELGMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFV MILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVWMILILIFAEALALYG  148



>ref|XP_003520270.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
 ref|XP_003522823.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
 ref|XP_003547948.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
 ref|XP_007156122.1| hypothetical protein PHAVU_003G260400g [Phaseolus vulgaris]
 gb|ESW28116.1| hypothetical protein PHAVU_003G260400g [Phaseolus vulgaris]
 gb|KHN20025.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
 gb|KHN33708.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
 gb|KHN34303.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
Length=164

 Score =   186 bits (472),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 143/146 (98%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            + FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    AAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_009414595.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Musa acuminata subsp. malaccensis]
Length=164

 Score =   186 bits (471),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 143/146 (98%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STF+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    STFTGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_003629349.1| V-type proton ATPase 16 kDa proteolipid subunit c1/c3/c5 [Medicago 
truncatula]
 gb|AET03825.1| vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 [Medicago 
truncatula]
Length=164

 Score =   186 bits (471),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 142/144 (99%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAP FGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPLFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>ref|XP_010912057.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X1 [Elaeis guineensis]
Length=164

 Score =   186 bits (471),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 143/146 (98%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            S FSGD+TAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    SDFSGDQTAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_003543079.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
 ref|XP_003544693.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform 1 [Glycine max]
 ref|XP_007141015.1| hypothetical protein PHAVU_008G160200g [Phaseolus vulgaris]
 gb|ESW13009.1| hypothetical protein PHAVU_008G160200g [Phaseolus vulgaris]
 gb|KHN04119.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
 gb|KHN33841.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
Length=164

 Score =   186 bits (471),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>gb|AFK34360.1| unknown [Lotus japonicus]
Length=164

 Score =   186 bits (471),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>ref|XP_003517187.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform 1 [Glycine max]
Length=164

 Score =   185 bits (470),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 142/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGL+CGLAGLSAGMAIGIVGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLSCGLAGLSAGMAIGIVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>ref|XP_003607079.1| V-type proton ATPase 16 kDa proteolipid subunit c1/c3/c5 [Medicago 
truncatula]
 ref|XP_004507511.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Cicer arietinum]
 ref|XP_004509343.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Cicer arietinum]
 gb|AES89276.1| vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 [Medicago 
truncatula]
 gb|AFK35156.1| unknown [Medicago truncatula]
 gb|AFK44894.1| unknown [Medicago truncatula]
Length=164

 Score =   185 bits (470),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>gb|AAF04597.1|AF193814_1 vacuolar H+-ATP synthase 16kDa proteolipid subunit [Dendrobium 
crumenatum]
Length=164

 Score =   185 bits (470),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>ref|XP_007157941.1| hypothetical protein PHAVU_002G111000g [Phaseolus vulgaris]
 gb|ESW29935.1| hypothetical protein PHAVU_002G111000g [Phaseolus vulgaris]
Length=239

 Score =   187 bits (476),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 152/165 (92%), Gaps = 7/165 (4%)
 Frame = +2

Query  53   RSNPRSTKA------EKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVAS  214
            RS+ R  KA      E+M   FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVAS
Sbjct  59   RSHSRLPKAKIQRRKERMVD-FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVAS  117

Query  215  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacg  394
            MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACG
Sbjct  118  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACG  177

Query  395  laglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            LAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  178  LAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  222



>ref|XP_002962220.1| hypothetical protein SELMODRAFT_77154 [Selaginella moellendorffii]
 ref|XP_002965134.1| hypothetical protein SELMODRAFT_82765 [Selaginella moellendorffii]
 gb|EFJ33972.1| hypothetical protein SELMODRAFT_82765 [Selaginella moellendorffii]
 gb|EFJ37480.1| hypothetical protein SELMODRAFT_77154 [Selaginella moellendorffii]
Length=163

 Score =   185 bits (470),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +2

Query  95   TFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  274
             FSGDETAPFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG
Sbjct  3    AFSGDETAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  62

Query  275  VLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRA  454
            VLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRA
Sbjct  63   VLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRA  122

Query  455  NAQQPKLFVGMililifaealalYG  529
            NAQQPKLFVGMILILIFAEALALYG
Sbjct  123  NAQQPKLFVGMILILIFAEALALYG  147



>gb|AGV54613.1| vacuolar H+-ATP synthase 16kDa proteolipid subunit [Phaseolus 
vulgaris]
Length=164

 Score =   185 bits (470),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>ref|NP_001276180.1| uncharacterized protein LOC100815182 [Glycine max]
 gb|ACU19338.1| unknown [Glycine max]
 gb|KHN25433.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
 gb|KHN39851.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
Length=164

 Score =   185 bits (470),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>gb|AFK44451.1| unknown [Lotus japonicus]
Length=164

 Score =   185 bits (469),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 142/144 (99%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLS GMAIGIVGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSVGMAIGIVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>gb|AAP15165.1| vacuolar H(+)-ATPase subunit c [Suaeda salsa]
 gb|AEP40376.1| vacuolar proton pump ATPase subunit C [Suaeda corniculata]
Length=164

 Score =   185 bits (469),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 142/146 (97%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            + F+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    AVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>gb|ACJ86024.1| unknown [Medicago truncatula]
Length=164

 Score =   185 bits (469),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 140/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIG+VGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGVVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALA YG
Sbjct  124  AQQPKLFVGMILILIFAEALASYG  147



>ref|XP_006590717.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
Length=164

 Score =   185 bits (469),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>gb|ACJ84165.1| unknown [Medicago truncatula]
Length=164

 Score =   185 bits (469),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 140/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGL CGLAGLSAGMAIG+VGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLTCGLAGLSAGMAIGVVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>ref|XP_004960548.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X2 [Setaria italica]
Length=166

 Score =   185 bits (469),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 141/146 (97%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            +TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    ATFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK K Y+LFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGVR
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGVR  123

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  124  ANAQQPKLFVGMILILIFAEALALYG  149



>ref|XP_003575109.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Brachypodium distachyon]
Length=166

 Score =   185 bits (469),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            +S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    ASVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK K Y+LFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>ref|XP_003612137.1| V-type proton ATPase 16 kDa proteolipid subunit c4 [Medicago 
truncatula]
 gb|AES95095.1| vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 [Medicago 
truncatula]
 gb|AFK43432.1| unknown [Medicago truncatula]
 gb|AFK45686.1| unknown [Medicago truncatula]
Length=164

 Score =   185 bits (469),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 141/144 (98%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIG+VGDAGVRAN
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGVVGDAGVRAN  123

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  124  AQQPKLFVGMILILIFAEALALYG  147



>ref|XP_011083597.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit isoform 
X3 [Sesamum indicum]
Length=177

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 147/160 (92%), Gaps = 12/160 (8%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGL------------IIAVIISTGINPKTKSYYLFDGYahlssglacglagls  409
            MAGVLGIYGL            IIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGL+
Sbjct  61   MAGVLGIYGLIIAVIISTGVFMIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLA  120

Query  410  agMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            AGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  AGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  160



>gb|AHY99590.1| vacuolar (H+)-ATPase c subunit [Annona cherimola]
Length=166

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            S+ FS DETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    SAGFSSDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINP+ KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPRAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILILIFAEALALYG  149



>gb|ABK24299.1| unknown [Picea sitchensis]
 gb|ACN40949.1| unknown [Picea sitchensis]
Length=165

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 144/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+  FSGDE APFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVM+PELVMKSIVPVV
Sbjct  1    MADAFSGDEMAPFFGFMGAAAALVFSCMGAAYGTAKSGVGVASMGVMKPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGL+GLSAGMAIG+VGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLSGLSAGMAIGVVGDAG  120

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VRANAQQPKLFVGMILILIFAEALALYG  148



>ref|XP_010927415.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
 ref|XP_010927416.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
 ref|XP_010927417.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
 ref|XP_010927418.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
Length=164

 Score =   184 bits (466),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 142/146 (97%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            + FSGDE APFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    TDFSGDEVAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  121

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  ANAQQPKLFVGMILILIFAEALALYG  147



>gb|ACZ65572.1| vacuolar H+-ATPase 16kDa subunit c [Iris lactea var. lactea]
 gb|ACZ65573.1| vacuolar H+-ATPase 16kDa subunit c [Iris lactea var. lactea]
Length=164

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +2

Query  95   TFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  274
            +FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG
Sbjct  3    SFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  62

Query  275  VLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRA  454
            VLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRA
Sbjct  63   VLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRA  122

Query  455  NAQQPKLFVGMililifaealalYG  529
            NAQQPKLFVGMILILIFAEALALYG
Sbjct  123  NAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_004977246.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X2 [Setaria italica]
Length=164

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +2

Query  95   TFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  274
             FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG
Sbjct  3    AFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  62

Query  275  VLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRA  454
            VLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGVRA
Sbjct  63   VLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGVRA  122

Query  455  NAQQPKLFVGMililifaealalYG  529
            NAQQPKLFVGMILILIFAEALALYG
Sbjct  123  NAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_007135912.1| hypothetical protein PHAVU_009G002400g [Phaseolus vulgaris]
 gb|ESW07906.1| hypothetical protein PHAVU_009G002400g [Phaseolus vulgaris]
Length=211

 Score =   185 bits (469),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 143/144 (99%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  51   FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  110

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN
Sbjct  111  LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN  170

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  171  AQQPKLFVGMILILIFAEALALYG  194



>ref|XP_006854856.1| hypothetical protein AMTR_s00182p00020350 [Amborella trichopoda]
 gb|ERN16323.1| hypothetical protein AMTR_s00182p00020350 [Amborella trichopoda]
Length=164

 Score =   183 bits (464),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +2

Query  95   TFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  274
            +FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG
Sbjct  3    SFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  62

Query  275  VLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRA  454
            VLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGLSAGMAIG+VGDAGVRA
Sbjct  63   VLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLSAGMAIGVVGDAGVRA  122

Query  455  NAQQPKLFVGMililifaealalYG  529
            NAQQPKLFVGMILILIFAEALALYG
Sbjct  123  NAQQPKLFVGMILILIFAEALALYG  147



>emb|CDY45329.1| BnaA03g53020D [Brassica napus]
Length=376

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  214  STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  273

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  274  GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  333

Query  452  ANAQQPKLFVGMililifaealalYG  529
            ANAQQPKLFVGMILILIFAEALALYG
Sbjct  334  ANAQQPKLFVGMILILIFAEALALYG  359



>gb|ACZ65574.1| vacuolar H+-ATPase 16kDa subunit c [Iris lactea var. lactea]
Length=164

 Score =   183 bits (464),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 128/131 (98%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  95   TFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  274
            +FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG
Sbjct  3    SFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  62

Query  275  VLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRA  454
            VLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRA
Sbjct  63   VLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRA  122

Query  455  NAQQPKLFVGM  487
            NAQQPKLFVGM
Sbjct  123  NAQQPKLFVGM  133



>ref|XP_006847027.1| hypothetical protein AMTR_s00017p00172260 [Amborella trichopoda]
 gb|ERN08608.1| hypothetical protein AMTR_s00017p00172260 [Amborella trichopoda]
Length=164

 Score =   182 bits (463),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +2

Query  95   TFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  274
             FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG
Sbjct  3    AFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  62

Query  275  VLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRA  454
            VLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGLSAGMAIG+VGDAGVRA
Sbjct  63   VLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLSAGMAIGVVGDAGVRA  122

Query  455  NAQQPKLFVGMililifaealalYG  529
            NAQQPKLFVGMILILIFAEALALYG
Sbjct  123  NAQQPKLFVGMILILIFAEALALYG  147



>ref|XP_001760844.1| predicted protein [Physcomitrella patens]
 gb|EDQ74233.1| predicted protein [Physcomitrella patens]
Length=167

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            ++ F+GDE APFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  4    AAVFNGDEVAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  63

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK+K+YY+FDGYAHLSSGL+CGLAGLSAGMAIGIVGDAGV
Sbjct  64   AGVLGIYGLIIAVIISTGINPKSKAYYVFDGYAHLSSGLSCGLAGLSAGMAIGIVGDAGV  123

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  124  RANAQQPKLFVGMILILIFAEALALYG  150



>ref|XP_001751438.1| predicted protein [Physcomitrella patens]
 ref|XP_001760927.1| predicted protein [Physcomitrella patens]
 ref|XP_001776059.1| predicted protein [Physcomitrella patens]
 gb|EDQ59104.1| predicted protein [Physcomitrella patens]
 gb|EDQ74316.1| predicted protein [Physcomitrella patens]
 gb|EDQ83755.1| predicted protein [Physcomitrella patens]
Length=167

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            S+ F+GDE APFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  4    SAVFNGDEVAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  63

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK+K YY+FDGYAHLSSGL+CGLAGLSAGMAIGIVGDAGV
Sbjct  64   AGVLGIYGLIIAVIISTGINPKSKPYYVFDGYAHLSSGLSCGLAGLSAGMAIGIVGDAGV  123

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  124  RANAQQPKLFVGMILILIFAEALALYG  150



>gb|ACZ65575.1| vacuolar H+-ATPase 16kDa subunit c [Iris lactea var. lactea]
Length=164

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 127/131 (97%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  95   TFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  274
            +FSGDE APFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG
Sbjct  3    SFSGDEAAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  62

Query  275  VLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRA  454
            VLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRA
Sbjct  63   VLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRA  122

Query  455  NAQQPKLFVGM  487
            NAQQPKLFVGM
Sbjct  123  NAQQPKLFVGM  133



>ref|XP_001751697.1| predicted protein [Physcomitrella patens]
 gb|EDQ83132.1| predicted protein [Physcomitrella patens]
Length=167

 Score =   180 bits (457),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            ++ F+GDE APFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  4    AAAFNGDEVAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  63

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK+K YY+FDGYAHLSSGL+CGLAGLSAGMAIGIVGDAGV
Sbjct  64   AGVLGIYGLIIAVIISTGINPKSKPYYVFDGYAHLSSGLSCGLAGLSAGMAIGIVGDAGV  123

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  124  RANAQQPKLFVGMILILIFAEALALYG  150



>gb|ACZ65576.1| vacuolar H+-ATPase 16kDa subunit c [Iris lactea var. lactea]
Length=164

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +2

Query  95   TFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  274
            +FSGDETAPFFGFLGAA ALVFSCMGAAYGTAKSGVG ASMGVMRPELVMKS VPVVMAG
Sbjct  3    SFSGDETAPFFGFLGAAVALVFSCMGAAYGTAKSGVGAASMGVMRPELVMKSTVPVVMAG  62

Query  275  VLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRA  454
            VLGIYGLI+AVIISTGINPK K YYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRA
Sbjct  63   VLGIYGLIMAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRA  122

Query  455  NAQQPKLFVGMililifaealalYG  529
            NAQQPKLFVGMILILIFAEALALYG
Sbjct  123  NAQQPKLFVGMILILIFAEALALYG  147



>gb|AAA99934.1| vacuolar H+-pumping ATPase 16 kDa proteolipid, partial [Arabidopsis 
thaliana]
Length=157

 Score =   177 bits (448),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 139/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  110  ETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY  289
            ETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY
Sbjct  1    ETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY  60

Query  290  GLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQP  469
            GLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQP
Sbjct  61   GLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQP  120

Query  470  KLFVGMililifaealalYG  529
            KLFVGMILILIFAEALALYG
Sbjct  121  KLFVGMILILIFAEALALYG  140



>ref|XP_010091197.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 ref|XP_010091198.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 gb|EXB43297.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 gb|EXB43298.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
Length=182

 Score =   176 bits (446),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 145/165 (88%), Gaps = 17/165 (10%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvf---------------SC--MGAAYGTAKSGVGVAS  214
            MSSTFSGDETAPFFGFLGAAAAL+                 C  MGAAYGTAKSGVGVAS
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALIQISEIRLKLTVFGVNLGCIGMGAAYGTAKSGVGVAS  60

Query  215  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacg  394
            MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACG
Sbjct  61   MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACG  120

Query  395  laglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            LAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  LAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  165



>gb|AAC12797.1| adenosine triphosphatase [Vigna radiata]
Length=145

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K
Sbjct  6    SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAK  65

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
            SYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALA
Sbjct  66   SYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALA  125

Query  521  lYG  529
            LYG
Sbjct  126  LYG  128



>gb|AFK44243.1| unknown [Medicago truncatula]
Length=158

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K
Sbjct  19   SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAK  78

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
            SYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALA
Sbjct  79   SYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALA  138

Query  521  lYG  529
            LYG
Sbjct  139  LYG  141



>gb|AAT08734.1| vacuolar H+-ATPase proteolipid 16 kDa subunit [Hyacinthus orientalis]
Length=158

 Score =   172 bits (437),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  110  ETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY  289
             TAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY
Sbjct  2    STAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY  61

Query  290  GLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQP  469
            GLIIAVIISTGINP  KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQP
Sbjct  62   GLIIAVIISTGINPNAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQP  121

Query  470  KLFVGMililifaealalYG  529
            KLFVGMILILIFAEALALYG
Sbjct  122  KLFVGMILILIFAEALALYG  141



>gb|KJB43371.1| hypothetical protein B456_007G196500, partial [Gossypium raimondii]
Length=216

 Score =   174 bits (441),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 129/139 (93%), Gaps = 4/139 (3%)
 Frame = +2

Query  47   QIRSNPR----STKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVAS  214
            ++ SNPR      K  KM+STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVAS
Sbjct  44   KLPSNPRLNNFCLKPSKMASTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVAS  103

Query  215  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacg  394
            MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACG
Sbjct  104  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACG  163

Query  395  laglsagMAIGIVGDAGVR  451
            LAGLSAGMAIGIVGDAGVR
Sbjct  164  LAGLSAGMAIGIVGDAGVR  182



>ref|NP_001045477.1| Os01g0962300 [Oryza sativa Japonica Group]
 dbj|BAB63620.1| putative vacuolar H+-ATPase 16 kDa proteolipid subunit c [Oryza 
sativa Japonica Group]
 dbj|BAF07391.1| Os01g0962300 [Oryza sativa Japonica Group]
 gb|EAY77328.1| hypothetical protein OsI_05310 [Oryza sativa Indica Group]
 gb|EAZ14921.1| hypothetical protein OsJ_04853 [Oryza sativa Japonica Group]
Length=165

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTF+GDE APF GF+GAA ALVFSCMGAAYGTA+SGVGVA MGVMRPELVMKSIVPVV
Sbjct  1    MSSTFNGDEFAPFLGFIGAALALVFSCMGAAYGTARSGVGVAHMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVII+TGINP    YY FDG  HL++GLA GL  L+AG+AIG+VGDAG
Sbjct  61   MAGVLGIYGLIIAVIITTGINPTAMPYYHFDGSVHLAAGLATGLCALAAGLAIGVVGDAG  120

Query  446  VRANAQQPKLFVGM  487
            VRANAQQPKLFVGM
Sbjct  121  VRANAQQPKLFVGM  134



>ref|XP_004971351.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Setaria italica]
Length=166

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            S  F+GDE APFFGF+GAA+ALVFSCMGAAYGTAKSGVGVA MGVMRPELV KSIVPVVM
Sbjct  3    SVMFNGDEVAPFFGFIGAASALVFSCMGAAYGTAKSGVGVAHMGVMRPELVTKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLI+AVIIS+GINP  K YYLFDG+AHL++GL+CG++GL+AGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIVAVIISSGINPVAKPYYLFDGFAHLAAGLSCGVSGLAAGMAIGIVGDAGV  122

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMIL+LIFAEALALYG
Sbjct  123  RANAQQPKLFVGMILMLIFAEALALYG  149



>gb|KJB14926.1| hypothetical protein B456_002G149400 [Gossypium raimondii]
Length=134

 Score =   169 bits (428),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQP  469
            VR  A  P
Sbjct  121  VRYAAFNP  128



>ref|NP_001185404.1| V-type proton ATPase proteolipid subunit c4 [Arabidopsis thaliana]
 gb|AEE35740.1| V-type proton ATPase proteolipid subunit c4 [Arabidopsis thaliana]
Length=200

 Score =   171 bits (433),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 145/181 (80%), Gaps = 34/181 (19%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            SS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    SSGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGV  122

Query  449  R----------------------------------ANAQQPKLFVGMililifaealalY  526
            R                                  ANAQQPKLFVGMILILIFAEALALY
Sbjct  123  RVVDCNPDSKIKIYSFTTSFLSNLSQKELFIDLLSANAQQPKLFVGMILILIFAEALALY  182

Query  527  G  529
            G
Sbjct  183  G  183



>gb|KJB77736.1| hypothetical protein B456_012G154000 [Gossypium raimondii]
Length=136

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQPKLF  478
            VR  A  P  F
Sbjct  121  VRYGAFIPLGF  131



>gb|EPS65806.1| hypothetical protein M569_08973 [Genlisea aurea]
Length=138

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  346
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  1    MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY  60

Query  347  YLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalY  526
            YLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY
Sbjct  61   YLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY  120

Query  527  G  529
            G
Sbjct  121  G  121



>gb|KJB32611.1| hypothetical protein B456_005G248800 [Gossypium raimondii]
Length=138

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/121 (99%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  346
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  1    MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY  60

Query  347  YLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalY  526
            YLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY
Sbjct  61   YLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY  120

Query  527  G  529
            G
Sbjct  121  G  121



>ref|XP_010912058.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X2 [Elaeis guineensis]
 gb|KCW55428.1| hypothetical protein EUGRSUZ_I01331 [Eucalyptus grandis]
Length=138

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/121 (99%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  346
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  1    MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY  60

Query  347  YLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalY  526
            YLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY
Sbjct  61   YLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY  120

Query  527  G  529
            G
Sbjct  121  G  121



>ref|XP_008388136.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Malus domestica]
Length=125

 Score =   166 bits (421),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 121/122 (99%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VR  451
            VR
Sbjct  121  VR  122



>gb|KJB77738.1| hypothetical protein B456_012G154000 [Gossypium raimondii]
Length=145

 Score =   167 bits (423),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 120/121 (99%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  346
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  8    MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY  67

Query  347  YLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalY  526
            YLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY
Sbjct  68   YLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY  127

Query  527  G  529
            G
Sbjct  128  G  128



>ref|XP_008467065.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis melo]
Length=130

 Score =   166 bits (421),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 121/122 (99%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VR  451
            VR
Sbjct  121  VR  122



>gb|KJB17312.1| hypothetical protein B456_003G010900 [Gossypium raimondii]
Length=154

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K
Sbjct  15   SGMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAK  74

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
            SYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALA
Sbjct  75   SYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALA  134

Query  521  lYG  529
            LYG
Sbjct  135  LYG  137



>gb|KJB14925.1| hypothetical protein B456_002G149400 [Gossypium raimondii]
Length=141

 Score =   166 bits (421),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANAQQP  469
            V   + +P
Sbjct  121  VSFGSLRP  128



>gb|AAL09329.1|AF303372_1 vacuolar-type H(+)-ATPase subunit c [Syntrichia ruralis]
Length=167

 Score =   167 bits (423),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            ++ F+GDE APFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  4    AAVFNGDEVAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  63

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVIISTGINPK+K YY+FDGYAHLSSGL+CGLAGLSAG AIG+VGD G 
Sbjct  64   AGVLGIYGLIIAVIISTGINPKSKPYYVFDGYAHLSSGLSCGLAGLSAGRAIGMVGDPGG  123

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLF GMILILIFAEALALYG
Sbjct  124  RANAQQPKLFGGMILILIFAEALALYG  150



>gb|KJB32612.1| hypothetical protein B456_005G248800 [Gossypium raimondii]
Length=124

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 120/122 (98%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VR  451
            VR
Sbjct  121  VR  122



>ref|XP_006646714.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Oryza brachyantha]
Length=165

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvf-SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            STFSGDE APFFGFLGAAAA +  SCMGAAYGTA+SGVGVASMGV RPELVMKSIVPVVM
Sbjct  2    STFSGDEVAPFFGFLGAAAAALVFSCMGAAYGTARSGVGVASMGVRRPELVMKSIVPVVM  61

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            AGVLGIYGLIIAVI+STGINP  + Y LFDGYAHL++GL+ GL  L+AG+AIG+VGDAGV
Sbjct  62   AGVLGIYGLIIAVIVSTGINPMAQPYLLFDGYAHLAAGLSTGLCSLAAGLAIGVVGDAGV  121

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFV MILILIFAEALALYG
Sbjct  122  RANAQQPKLFVSMILILIFAEALALYG  148



>gb|KDO41481.1| hypothetical protein CISIN_1g031125mg [Citrus sinensis]
Length=145

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 120/122 (98%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VR  451
            VR
Sbjct  121  VR  122



>ref|XP_006423504.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
 gb|ESR36744.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
Length=151

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 120/125 (96%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MPSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VRANA  460
            VR ++
Sbjct  121  VRHHS  125



>gb|KDO41482.1| hypothetical protein CISIN_1g031125mg [Citrus sinensis]
Length=151

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 120/122 (98%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VR  451
            VR
Sbjct  121  VR  122



>gb|KDO41483.1| hypothetical protein CISIN_1g031125mg [Citrus sinensis]
Length=132

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 120/122 (98%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VR  451
            VR
Sbjct  121  VR  122



>ref|XP_009109955.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Brassica rapa]
Length=195

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +2

Query  53   RSNPRSTKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRP  232
            RS     K E++     G E+     F+     ++ S MGAAYGTAKSGVGVASMGVMRP
Sbjct  21   RSVDCFEKLEQIGEGTYGGESISEEMFIVRCCLMLQSGMGAAYGTAKSGVGVASMGVMRP  80

Query  233  ELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsa  412
            ELVMKSIVPVVMAGVLGIYGLII VIISTGINPK KSYYLFDGYAHLSSGL CGLAGLSA
Sbjct  81   ELVMKSIVPVVMAGVLGIYGLIIDVIISTGINPKAKSYYLFDGYAHLSSGLTCGLAGLSA  140

Query  413  gMAIGIVGDAGVRANAQQPKLFVGM  487
            GMAIGIVGDAGVRANAQQPKLFVGM
Sbjct  141  GMAIGIVGDAGVRANAQQPKLFVGM  165



>ref|XP_006423503.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
 gb|ESR36743.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
Length=146

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 120/122 (98%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MPSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VR  451
            VR
Sbjct  121  VR  122



>ref|XP_004977245.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X1 [Setaria italica]
Length=192

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  346
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K Y
Sbjct  55   MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPY  114

Query  347  YLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalY  526
            YLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY
Sbjct  115  YLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY  174

Query  527  G  529
            G
Sbjct  175  G  175



>ref|XP_005848107.1| hypothetical protein CHLNCDRAFT_30996 [Chlorella variabilis]
 gb|EFN56005.1| hypothetical protein CHLNCDRAFT_30996 [Chlorella variabilis]
Length=169

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 3/151 (2%)
 Frame = +2

Query  86   MSST--FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVP  259
            MS+T  ++GD+ AP FG+LGAA+ALVFSC GAAYGTAKSGVG+ASMGVMRPELVMKSIVP
Sbjct  1    MSTTVVWNGDQVAPLFGYLGAASALVFSCFGAAYGTAKSGVGIASMGVMRPELVMKSIVP  60

Query  260  VVMAGVLGIYGLIIAVIISTGINP-KTKSYYLFDGYahlssglacglaglsagMAIGIVG  436
            VVMAGVLGIYGLIIAVIIST IN  + K+YY FDGYAH ++GLACGLAGL AGMAIGIVG
Sbjct  61   VVMAGVLGIYGLIIAVIISTNINQTQDKAYYFFDGYAHFAAGLACGLAGLGAGMAIGIVG  120

Query  437  DAGVRANAQQPKLFVGMililifaealalYG  529
            DAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  DAGVRANAQQPKLFVGMILILIFAEALALYG  151



>gb|EAY82401.1| hypothetical protein OsI_37615 [Oryza sativa Indica Group]
Length=167

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  346
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K Y
Sbjct  30   MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPY  89

Query  347  YLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalY  526
            YLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY
Sbjct  90   YLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY  149

Query  527  G  529
            G
Sbjct  150  G  150



>gb|ABG22382.1| Vacuolar ATP synthase 16 kDa proteolipid subunit, putative, expressed 
[Oryza sativa Japonica Group]
Length=122

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAA+AL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSVFSGDETAPFFGFLGAASALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VR  451
            VR
Sbjct  121  VR  122



>ref|XP_010451050.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Camelina 
sativa]
Length=159

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/120 (98%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  170  GAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYY  349
            GAAYGTAKSGVGVASMGVMRPELVMKSIV VVMAGVLGIYGLIIAVIISTGINPK KSYY
Sbjct  23   GAAYGTAKSGVGVASMGVMRPELVMKSIVTVVMAGVLGIYGLIIAVIISTGINPKAKSYY  82

Query  350  LFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            LFDGYAHLSSG ACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  83   LFDGYAHLSSGFACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  142



>gb|EMS55033.1| V-type proton ATPase 16 kDa proteolipid subunit [Triticum urartu]
Length=162

 Score =   162 bits (411),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 127/148 (86%), Gaps = 3/148 (2%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K Y+LFDGYAHLSSGL   L    A       G   
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLRARLWPRGARRR---HGHWH  117

Query  446  VRANAQQPKLFVGMililifaealalYG  529
             RANAQQPKLFVGMILILIFAEALALYG
Sbjct  118  CRANAQQPKLFVGMILILIFAEALALYG  145



>ref|XP_006435120.1| hypothetical protein CICLE_v10002710mg [Citrus clementina]
 gb|ESR48360.1| hypothetical protein CICLE_v10002710mg [Citrus clementina]
Length=148

 Score =   162 bits (409),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 121/123 (98%), Gaps = 1/123 (1%)
 Frame = +2

Query  86   MSST-FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV  262
            MSST FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV
Sbjct  1    MSSTLFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV  60

Query  263  VMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDA  442
            VMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDA
Sbjct  61   VMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDA  120

Query  443  GVR  451
            GVR
Sbjct  121  GVR  123



>gb|EYU38851.1| hypothetical protein MIMGU_mgv1a026590mg [Erythranthe guttata]
Length=152

 Score =   162 bits (409),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 134/148 (91%), Gaps = 13/148 (9%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGV             TGINPK KSYYLFDGYAHLSSGL+CGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGV-------------TGINPKAKSYYLFDGYAHLSSGLSCGLAGLAAGMAIGIVGDAG  107

Query  446  VRANAQQPKLFVGMililifaealalYG  529
            VRANAQQPKLFVGMILILIFAEALALYG
Sbjct  108  VRANAQQPKLFVGMILILIFAEALALYG  135



>ref|XP_006425528.1| hypothetical protein CICLE_v10026647mg [Citrus clementina]
 gb|ESR38768.1| hypothetical protein CICLE_v10026647mg [Citrus clementina]
Length=167

 Score =   162 bits (410),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 119/122 (98%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS F GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSAFIGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  VR  451
            VR
Sbjct  121  VR  122



>ref|XP_004512226.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c4-like 
[Cicer arietinum]
Length=155

 Score =   162 bits (409),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 134/144 (93%), Gaps = 9/144 (6%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAALVFSCMGA         GVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALVFSCMGA---------GVASMGVMRPELVMKSIVPVVMAGV  54

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRAN  457
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN
Sbjct  55   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRAN  114

Query  458  AQQPKLFVGMililifaealalYG  529
            AQQPKLFVGMILILIFAEALALYG
Sbjct  115  AQQPKLFVGMILILIFAEALALYG  138



>dbj|BAJ90634.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=145

 Score =   161 bits (408),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFL AAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSVFSGDETAPFFGFLDAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK K Y+LFDGYAHLSSGLACGLAGL+AGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG  120

Query  446  VR  451
            VR
Sbjct  121  VR  122



>dbj|BAA23352.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=168

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 142/154 (92%), Gaps = 2/154 (1%)
 Frame = +2

Query  68   STKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMK  247
            +T +E +S+  +G++TAPFFGF+GAA+ALVF+CMGAAYGTAKSGVG+ASMGVMRPELVMK
Sbjct  3    ATPSETLSTASAGNDTAPFFGFMGAASALVFACMGAAYGTAKSGVGIASMGVMRPELVMK  62

Query  248  SIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIG  427
            SIVPVVMAGVLGIYGLIIAVIIST  N K   Y L+DGYAHLS+GLACGLAGL AGMAIG
Sbjct  63   SIVPVVMAGVLGIYGLIIAVIIST--NVKRDVYKLYDGYAHLSAGLACGLAGLPAGMAIG  120

Query  428  IVGDAGVRANAQQPKLFVGMililifaealalYG  529
            IVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  IVGDAGVRANAQQPKLFVGMILILIFAEALALYG  154



>gb|ADH44696.1| vacuolar H(+)-ATPase subunit c [Salvia miltiorrhiza]
Length=117

 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/103 (98%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K
Sbjct  15   SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAK  74

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQP  469
            SYYLFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGVRANAQQP
Sbjct  75   SYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGVRANAQQP  117



>ref|XP_001696361.1| vacuolar H(+)-ATPase V0 sector, c/c' subunits [Chlamydomonas 
reinhardtii]
 gb|EDP08338.1| vacuolar H(+)-ATPase V0 sector, c/c' subunits [Chlamydomonas 
reinhardtii]
Length=176

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 141/155 (91%), Gaps = 5/155 (3%)
 Frame = +2

Query  65   RSTKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVM  244
            RS   E  +S     +TAPFFGF+GAAAALVFSCMGAAYGTAKSGVG+ASMGVMRPELVM
Sbjct  5    RSLLQETAASN---QDTAPFFGFIGAAAALVFSCMGAAYGTAKSGVGIASMGVMRPELVM  61

Query  245  KSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAI  424
            KSIVPVVMAGVLGIYGLIIAVIISTG+NP T  Y L+DG+AHL+SGLACGLAGL+AGMAI
Sbjct  62   KSIVPVVMAGVLGIYGLIIAVIISTGVNPAT--YKLYDGFAHLASGLACGLAGLAAGMAI  119

Query  425  GIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            GIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  120  GIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  154



>emb|CAA71930.1| BV-16/1 [Beta vulgaris subsp. vulgaris]
Length=121

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MS+ F+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSTVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG  120

Query  446  V  448
            V
Sbjct  121  V  121



>gb|KHG30045.1| hypothetical protein F383_01577 [Gossypium arboreum]
Length=484

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 120/121 (99%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  346
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  347  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY  406

Query  347  YLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalY  526
            YLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY
Sbjct  407  YLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY  466

Query  527  G  529
            G
Sbjct  467  G  467



>gb|ADI46947.1| ATPvL1m [Volvox carteri f. nagariensis]
Length=174

 Score =   160 bits (404),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 143/161 (89%), Gaps = 8/161 (5%)
 Frame = +2

Query  47   QIRSNPRSTKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVM  226
            Q R+  +S+    +S+T      APFFGF+GAAAALVFSCMGAAYGTAKSGVG+ASMGVM
Sbjct  4    QYRALLQSSSGSDVSAT------APFFGFIGAAAALVFSCMGAAYGTAKSGVGIASMGVM  57

Query  227  RPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglagl  406
            RPELVMKSIVPVVMAGVLGIYGLIIAVIISTG+NP    Y LFDG+AHL+SGLACGLAGL
Sbjct  58   RPELVMKSIVPVVMAGVLGIYGLIIAVIISTGVNP--AKYQLFDGFAHLASGLACGLAGL  115

Query  407  sagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            +AGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  116  AAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  156



>gb|KEH27580.1| vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 [Medicago 
truncatula]
Length=132

 Score =   158 bits (400),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 115/118 (97%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +2

Query  98   FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  277
            FSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  4    FSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  63

Query  278  LGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIG+VGDAGVR
Sbjct  64   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGVVGDAGVR  121



>gb|ABN48303.1| vacuolar ATPase subunit c [Cucumis sativus]
Length=106

 Score =   157 bits (398),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/102 (99%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K
Sbjct  5    SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAK  64

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQ  466
            SYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQ
Sbjct  65   SYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQ  106



>ref|XP_002887606.1| hypothetical protein ARALYDRAFT_476712 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63865.1| hypothetical protein ARALYDRAFT_476712 [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 131/166 (79%), Gaps = 18/166 (11%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            M+S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MASGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahls------sglacglaglsagMAIG  427
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLS        L   L   S  + + 
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLSLLVWLLESSVMLVLE  120

Query  428  IVGDAGV------------RANAQQPKLFVGMililifaealalYG  529
            + G A V            +ANAQQPKLFVGMILILIFAEALALYG
Sbjct  121  VFGIALVFVVLHRLIGKMIKANAQQPKLFVGMILILIFAEALALYG  166



>ref|XP_002957938.1| hypothetical protein VOLCADRAFT_107886 [Volvox carteri f. nagariensis]
 gb|ADI46881.1| ATPvL1f [Volvox carteri f. nagariensis]
 gb|EFJ40964.1| hypothetical protein VOLCADRAFT_107886 [Volvox carteri f. nagariensis]
Length=174

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +2

Query  83   KMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV  262
            + SS      TAPFFGF+GAAAALVFSCMGAAYGTAKSGVG+ASMGVMRPELVMKSIVPV
Sbjct  10   QSSSGSDASATAPFFGFIGAAAALVFSCMGAAYGTAKSGVGIASMGVMRPELVMKSIVPV  69

Query  263  VMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDA  442
            VMAGVLGIYGLIIAVIISTG+NP    Y LFDG+AHL+SGLACGLAGL+AGMAIGIVGDA
Sbjct  70   VMAGVLGIYGLIIAVIISTGVNP--VKYQLFDGFAHLASGLACGLAGLAAGMAIGIVGDA  127

Query  443  GVRANAQQPKLFVGMililifaealalYG  529
            GVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  128  GVRANAQQPKLFVGMILILIFAEALALYG  156



>gb|KHN00493.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
Length=133

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            + FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  2    AAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  61

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG++
Sbjct  62   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGLK  121



>ref|XP_005652095.1| V-type ATPase [Coccomyxa subellipsoidea C-169]
 gb|EIE27551.1| V-type ATPase [Coccomyxa subellipsoidea C-169]
Length=176

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
              + GD   PFFGF+GAAAALVF+C GAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMA
Sbjct  12   EQWVGDSVGPFFGFMGAAAALVFACFGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMA  71

Query  272  GVLGIYGLIIAVIISTGINPKT-KSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            GVLGIYGLIIAVIISTGIN    K YYLFDGYAHL++GL+CGLAGL+AGMAIGIVGDAGV
Sbjct  72   GVLGIYGLIIAVIISTGINQTADKPYYLFDGYAHLAAGLSCGLAGLAAGMAIGIVGDAGV  131

Query  449  RANAQQPKLFVGMililifaealalYG  529
            RANAQQPKLFVGMILILIFAEALALYG
Sbjct  132  RANAQQPKLFVGMILILIFAEALALYG  158



>emb|CEF98686.1| V-ATPase proteolipid subunit [Ostreococcus tauri]
Length=158

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 135/143 (94%), Gaps = 2/143 (1%)
 Frame = +2

Query  101  SGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVL  280
            SGDE APFFGF+GA++ALVFSCMGAAYGTAKSGVG+ASMGVMRPELVMKSI+PVV +G+L
Sbjct  3    SGDEVAPFFGFMGASSALVFSCMGAAYGTAKSGVGIASMGVMRPELVMKSILPVVFSGIL  62

Query  281  GIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANA  460
            GIYGLIIAV+IS+GINP  KSY LF GYAHL SGLACGL+GLSAGM IGIVGDAGVRANA
Sbjct  63   GIYGLIIAVVISSGINP--KSYTLFQGYAHLGSGLACGLSGLSAGMCIGIVGDAGVRANA  120

Query  461  QQPKLFVGMililifaealalYG  529
            QQPKLFVG++LILIFAEALALYG
Sbjct  121  QQPKLFVGLVLILIFAEALALYG  143



>ref|XP_004960547.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X1 [Setaria italica]
Length=175

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  92   STFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  271
            +TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    ATFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  272  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            GVLGIYGLIIAVIISTGINPK K Y+LFDGYAHLSSGLACGLAGL+AGMAIGIVGDAGVR
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAGVR  123

Query  452  AN  457
             +
Sbjct  124  YH  125



>ref|XP_011399797.1| V-type proton ATPase 16 kDa proteolipid subunit [Auxenochlorella 
protothecoides]
 gb|KFM26849.1| V-type proton ATPase 16 kDa proteolipid subunit [Auxenochlorella 
protothecoides]
Length=176

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = +2

Query  83   KMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV  262
            + ++ ++GD+ AP FG+LGAA+AL FSC GAAYGTAK+GVG+ASMGV+RP+LV+KSI+PV
Sbjct  10   ETTTQWNGDQVAPLFGYLGAASALAFSCFGAAYGTAKAGVGIASMGVLRPDLVIKSIIPV  69

Query  263  VMAGVLGIYGLIIAVIISTGINPKT-KSYYLFDGYahlssglacglaglsagMAIGIVGD  439
            VMAGVLGIYGLIIAVIISTGIN    K+YY FDGYAH + GLACGLAGL AGMAIGIVGD
Sbjct  70   VMAGVLGIYGLIIAVIISTGINQTADKAYYYFDGYAHFAGGLACGLAGLGAGMAIGIVGD  129

Query  440  AGVRANAQQPKLFVGMililifaealalYG  529
            AGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  130  AGVRANAQQPKLFVGMILILIFAEALALYG  159



>gb|KDD76967.1| hypothetical protein H632_c53p3 [Helicosporidium sp. ATCC 50920]
Length=176

 Score =   157 bits (398),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = +2

Query  83   KMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV  262
            + ++ ++GD+ AP FG+LGAA+ALVF+C G+AYGTAKSGVG+A+MGVMRPELV+KS+VPV
Sbjct  10   QTNAQWNGDQVAPLFGYLGAASALVFACFGSAYGTAKSGVGIAAMGVMRPELVIKSVVPV  69

Query  263  VMAGVLGIYGLIIAVIISTGINPKT-KSYYLFDGYahlssglacglaglsagMAIGIVGD  439
            VMAG+LGIYGLIIAVIISTGI     K+YYLFDGYAHL++GLACGLA L AGMAIGIVGD
Sbjct  70   VMAGILGIYGLIIAVIISTGITQTADKAYYLFDGYAHLAAGLACGLAALGAGMAIGIVGD  129

Query  440  AGVRANAQQPKLFVGM  487
            AGVRANAQQPKLFVGM
Sbjct  130  AGVRANAQQPKLFVGM  145



>ref|XP_007017704.1| Vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 isoform 
2, partial [Theobroma cacao]
 gb|EOY14929.1| Vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 isoform 
2, partial [Theobroma cacao]
Length=137

 Score =   156 bits (394),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 100/109 (92%), Gaps = 3/109 (3%)
 Frame = +2

Query  38   RDFQIRSNPRSTKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASM  217
            ++ QIRS    T   KMSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASM
Sbjct  15   QEQQIRS---ITIFGKMSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASM  71

Query  218  GVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGY  364
            GVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGY
Sbjct  72   GVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGY  120



>dbj|BAA23351.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=167

 Score =   155 bits (393),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 140/152 (92%), Gaps = 3/152 (2%)
 Frame = +2

Query  77   AEKMSST-FSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSI  253
            AE  S+T  +G++TAPFFGF+GAA+ALVF+CMGAAYGTAKSGVG+ASMGVMRPELVMKSI
Sbjct  4    AETPSATPAAGNDTAPFFGFMGAASALVFACMGAAYGTAKSGVGIASMGVMRPELVMKSI  63

Query  254  VPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIV  433
            VPVVMAGVLGIYGLIIAVIIST  N K   Y L+DGYAHLS+GLACGLAGL AGMAIGIV
Sbjct  64   VPVVMAGVLGIYGLIIAVIIST--NVKRDVYKLYDGYAHLSAGLACGLAGLPAGMAIGIV  121

Query  434  GDAGVRANAQQPKLFVGMililifaealalYG  529
            GDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  122  GDAGVRANAQQPKLFVGMILILIFAEALALYG  153



>dbj|BAA21683.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=176

 Score =   155 bits (393),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 2/143 (1%)
 Frame = +2

Query  101  SGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVL  280
            SG++TAPFFGF+GAA+ALVF+CMGAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVL
Sbjct  22   SGNDTAPFFGFMGAASALVFACMGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVL  81

Query  281  GIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANA  460
            GIYGLIIAVIIST  N K   Y L+DGYAHLS+GLACGLAGL AGMAIGIVGDAGVRANA
Sbjct  82   GIYGLIIAVIIST--NVKRDVYKLYDGYAHLSAGLACGLAGLPAGMAIGIVGDAGVRANA  139

Query  461  QQPKLFVGMililifaealalYG  529
            QQPKLFVGMILILIFAEALALYG
Sbjct  140  QQPKLFVGMILILIFAEALALYG  162



>dbj|BAA23350.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=168

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 134/142 (94%), Gaps = 2/142 (1%)
 Frame = +2

Query  104  GDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLG  283
            G++TAPFFGF+GAA+ALVF+CMGAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVLG
Sbjct  15   GNDTAPFFGFMGAASALVFACMGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVLG  74

Query  284  IYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQ  463
            IYGLIIAVIIST  N K   Y L+DGYAHLS+GLACGLAGL AGMAIGIVGDAGVRANAQ
Sbjct  75   IYGLIIAVIIST--NVKRDVYKLYDGYAHLSAGLACGLAGLPAGMAIGIVGDAGVRANAQ  132

Query  464  QPKLFVGMililifaealalYG  529
            QPKLFVGMILILIFAEALALYG
Sbjct  133  QPKLFVGMILILIFAEALALYG  154



>ref|XP_001418919.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO97212.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
Length=159

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 131/143 (92%), Gaps = 2/143 (1%)
 Frame = +2

Query  101  SGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVL  280
            + DE APFFGF+GA +ALVFSCMGAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVL
Sbjct  3    TSDEVAPFFGFMGATSALVFSCMGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVL  62

Query  281  GIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANA  460
            GIYGLIIAV+IST I+    SY LF GYAHL SGLACGL+GLSAGM IGIVGDAGVRANA
Sbjct  63   GIYGLIIAVVISTNID--ASSYTLFQGYAHLGSGLACGLSGLSAGMCIGIVGDAGVRANA  120

Query  461  QQPKLFVGMililifaealalYG  529
            QQPKLFVG+ILILIFAEALALYG
Sbjct  121  QQPKLFVGVILILIFAEALALYG  143



>ref|XP_003080310.1| vacuolar ATPase subunit c (ISS) [Ostreococcus tauri]
Length=226

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 102/109 (94%), Gaps = 2/109 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SCMGAAYGTAKSGVG+ASMGVMRPELVMKSI+PVV +G+LGIYGLIIAV+IS+GINP  K
Sbjct  91   SCMGAAYGTAKSGVGIASMGVMRPELVMKSILPVVFSGILGIYGLIIAVVISSGINP--K  148

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
            SY LF GYAHL SGLACGL+GLSAGM IGIVGDAGVRANAQQPKLFVG+
Sbjct  149  SYTLFQGYAHLGSGLACGLSGLSAGMCIGIVGDAGVRANAQQPKLFVGL  197



>gb|KIY99747.1| hypothetical protein MNEG_8216 [Monoraphidium neglectum]
 gb|KIZ02747.1| V-type H+-transporting ATPase 16kDa proteolipid subunit [Monoraphidium 
neglectum]
Length=134

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 115/121 (95%), Gaps = 2/121 (2%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  346
            MGAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIIST I+P    Y
Sbjct  1    MGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTNISP--AKY  58

Query  347  YLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalY  526
             LFDG+AHLSSGL+CGLAGL+AGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY
Sbjct  59   TLFDGFAHLSSGLSCGLAGLAAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALY  118

Query  527  G  529
            G
Sbjct  119  G  119



>gb|EYU37872.1| hypothetical protein MIMGU_mgv1a020126mg [Erythranthe guttata]
Length=147

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 115/134 (86%), Gaps = 18/134 (13%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGV              
Sbjct  1    MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGV--------------  46

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
                LGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGL+CGLAGL+AG+AIGIVGDAG
Sbjct  47   ----LGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLSCGLAGLAAGVAIGIVGDAG  102

Query  446  VRANAQQPKLFVGM  487
            VRANAQQPKLFVGM
Sbjct  103  VRANAQQPKLFVGM  116



>dbj|BAA21682.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=164

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 2/123 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SCMGAAYGTAKSG+G+A MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIIST  N K  
Sbjct  28   SCMGAAYGTAKSGIGIAQMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIIST--NVKKT  85

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
             Y L+DGYAH+ +G+ACG+AG+ AGMAIGIVGDAGVRANAQQPKLFVG+ILILIFAEALA
Sbjct  86   GYTLYDGYAHIGAGIACGMAGMPAGMAIGIVGDAGVRANAQQPKLFVGVILILIFAEALA  145

Query  521  lYG  529
            LYG
Sbjct  146  LYG  148



>dbj|BAA23349.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=164

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 114/123 (93%), Gaps = 2/123 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SCMGAAYGTAKSG+G+A MGVM+PELVMKSIVPVVMAGVLGIYGLIIAVIIST  N K  
Sbjct  28   SCMGAAYGTAKSGIGIAQMGVMKPELVMKSIVPVVMAGVLGIYGLIIAVIIST--NVKKT  85

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
            +Y L+DGYAH+ +G+ACG+AG+ AGMAIGIVGDAGVRANAQQPKLFVG+ILILIFAEALA
Sbjct  86   AYTLYDGYAHMGAGIACGMAGMPAGMAIGIVGDAGVRANAQQPKLFVGVILILIFAEALA  145

Query  521  lYG  529
            LYG
Sbjct  146  LYG  148



>ref|XP_003058268.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas pusilla CCMP1545]
 gb|EEH58219.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas pusilla CCMP1545]
Length=145

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SCMGAAYGTAKSGVG+A+MGV RPELVMKSIVPVVMAGVLGIYGLIIAVIIST  +P   
Sbjct  7    SCMGAAYGTAKSGVGIAAMGVFRPELVMKSIVPVVMAGVLGIYGLIIAVIISTNTSPG-G  65

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
            +Y LF GYAHL SGL+CGL+GL+AGMAIGIVGDAGVRANAQQPKLF GMILILIFAEALA
Sbjct  66   TYTLFQGYAHLGSGLSCGLSGLAAGMAIGIVGDAGVRANAQQPKLFTGMILILIFAEALA  125

Query  521  lYG  529
            LYG
Sbjct  126  LYG  128



>ref|XP_002499550.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO60808.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=180

 Score =   144 bits (364),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SC GAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVLGIYGLI++VII+T I+P   
Sbjct  43   SCFGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVLGIYGLIVSVIIATNIHP--T  100

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
             Y LF GYAHL SGL  GLAGL+AGMAIGI+GDAGVRANAQQPKLF GM+L+LIFAEALA
Sbjct  101  GYTLFQGYAHLGSGLTTGLAGLAAGMAIGIIGDAGVRANAQQPKLFTGMLLMLIFAEALA  160

Query  521  lYG  529
            LYG
Sbjct  161  LYG  163



>ref|XP_008388137.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Malus domestica]
Length=110

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  346
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  13   MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY  72

Query  347  YLFDGYahlssglacglaglsagMAIGIVGDAGVR  451
            YLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR
Sbjct  73   YLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR  107



>ref|XP_007514510.1| unknown [Bathycoccus prasinos]
 emb|CCO14750.1| unknown [Bathycoccus prasinos]
Length=190

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = +2

Query  50   IRSNPRSTKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMR  229
            I S  +   A+    + SGD  APFFGF+GAA+ALVF+ +GAAYGTAKSGVG+ASMGVMR
Sbjct  16   ISSGTKGALAQTNDDS-SGDAVAPFFGFMGAASALVFANIGAAYGTAKSGVGIASMGVMR  74

Query  230  PELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglagls  409
            PELVMKS++  VMAGVLGIYGLIIAVIIST I P    Y LF GYAHLSSGLACGL+GL+
Sbjct  75   PELVMKSVIAPVMAGVLGIYGLIIAVIISTNITP--TGYTLFQGYAHLSSGLACGLSGLA  132

Query  410  agMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            AGMAIGI+GDAGVRANAQQPKLFVGM+L+LIF EALALYG
Sbjct  133  AGMAIGIIGDAGVRANAQQPKLFVGMVLMLIFCEALALYG  172



>ref|XP_009393807.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Musa acuminata subsp. malaccensis]
Length=122

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/105 (99%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +2

Query  215  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacg  394
            MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHLSSGLACG
Sbjct  1    MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACG  60

Query  395  laglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            LAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  61   LAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  105



>gb|ABA95924.2| expressed protein [Oryza sativa Japonica Group]
Length=117

 Score =   138 bits (347),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSS FSGDETAPFFGFLGAA+ALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSVFSGDETAPFFGFLGAASALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFD  358
            MAGVLGIYGLIIAVIISTGINPK K YYL  
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKPYYLLR  91



>gb|AFW56182.1| V-type proton ATPase proteolipid subunit [Zea mays]
Length=122

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/105 (97%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +2

Query  215  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacg  394
            MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHLSSGLACG
Sbjct  1    MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACG  60

Query  395  laglsagMAIGIVGDAGVRANAQQPKLFVGMililifaealalYG  529
            LAGL+AGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG
Sbjct  61   LAGLAAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYG  105



>ref|XP_008368022.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c4-like 
[Malus domestica]
Length=122

 Score =   136 bits (343),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  89   SSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  268
            SSTFSGDETA FFGFL AA  LVF CMG AYGTA SG+G+ SMGV+R ELVMKSIVPVVM
Sbjct  3    SSTFSGDETATFFGFLNAATTLVFFCMGTAYGTANSGMGMVSMGVIRSELVMKSIVPVVM  62

Query  269  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGV  448
            A VLGIYGLIIAVIISTGINPK KSYYLFDGY HLSSGLACGLAGL AGMA GIVG AGV
Sbjct  63   ARVLGIYGLIIAVIISTGINPKAKSYYLFDGYTHLSSGLACGLAGLFAGMATGIVGGAGV  122



>ref|XP_010089505.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 gb|EXB37915.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
Length=168

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 120/158 (76%), Gaps = 17/158 (11%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSSTF+G                  S MGAAYGTA+SGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSSTFNG-------AVRWLPRCRRGSRMGAAYGTARSGVGVASMGVMRPELVMKSIVPVV  53

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIV--GD  439
            M GVLGIYGLIIAVI STGINPK KSYYLFDGYAHLSSG ACGLAGLSAGM +G++    
Sbjct  54   MGGVLGIYGLIIAVINSTGINPKAKSYYLFDGYAHLSSGRACGLAGLSAGMVLGLLVMPV  113

Query  440  AGVR--------ANAQQPKLFVGMililifaealalYG  529
              +R        ANAQQPKLFVGMILILIFAEALALYG
Sbjct  114  LAIRKFLLVLALANAQQPKLFVGMILILIFAEALALYG  151



>gb|AIZ49544.1| V-ATPase subunit c2 [Eriobotrya japonica]
Length=99

 Score =   128 bits (322),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  346
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  1    MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKVKSY  60

Query  347  YLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQ  463
            YLFDGYAHLSSGLACGLAGLSAGMAIGI+     ++ A 
Sbjct  61   YLFDGYAHLSSGLACGLAGLSAGMAIGILSSRSGQSRAD  99



>ref|XP_004344009.1| Vtype ATPase, C subunit [Acanthamoeba castellanii str. Neff]
 gb|ELR20606.1| Vtype ATPase, C subunit [Acanthamoeba castellanii str. Neff]
Length=167

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 97/109 (89%), Gaps = 2/109 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            +C+GAAYGTAKSGVGVA+MGV +P++VMKSI+PVVMAGV+GIYGLIIAVI++T + P   
Sbjct  37   ACLGAAYGTAKSGVGVAAMGVTKPDMVMKSIIPVVMAGVIGIYGLIIAVILATNVTP--T  94

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
            +Y  F G+AHL+SGL+ GL+GL+AGMAIGIVGDAGVRA AQQP+LF GM
Sbjct  95   AYTAFRGFAHLASGLSVGLSGLAAGMAIGIVGDAGVRATAQQPRLFTGM  143



>gb|AAW79383.1| vacuolar ATP synthase [Heterocapsa triquetra]
Length=178

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 2/107 (2%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  346
            +GAAYGTAKSGVG++SMGVMRP++VM+SI+PVVMAGVLGIYGLI AVII+  I+    SY
Sbjct  36   LGAAYGTAKSGVGISSMGVMRPDMVMRSIIPVVMAGVLGIYGLITAVIINGKIH--APSY  93

Query  347  YLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
              F GYAHL++GL  G++ L+AG+AIGIVGDAGVRANAQQPKLFVGM
Sbjct  94   SAFSGYAHLAAGLTVGMSSLAAGLAIGIVGDAGVRANAQQPKLFVGM  140



>ref|XP_005758268.1| vacuolar H+-ATPase V0 sector, subunits c/c [Emiliania huxleyi 
CCMP1516]
 ref|XP_005789998.1| vacuolar H+-ATPase, subunit C [Emiliania huxleyi CCMP1516]
 gb|EOD05839.1| vacuolar H+-ATPase V0 sector, subunits c/c [Emiliania huxleyi 
CCMP1516]
 gb|EOD37569.1| vacuolar H+-ATPase, subunit C [Emiliania huxleyi CCMP1516]
Length=170

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 114/129 (88%), Gaps = 4/129 (3%)
 Frame = +2

Query  113  TAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYG  292
            TAPFFGF+GAA AL+F+ +GAAYGTAKSGVGV+SMGVM+P+L+MKSI+PVVMAGVLGIYG
Sbjct  12   TAPFFGFMGAAVALIFANLGAAYGTAKSGVGVSSMGVMKPDLIMKSIIPVVMAGVLGIYG  71

Query  293  LIIAVIISTGINPKTKS----YYLFDGYahlssglacglaglsagMAIGIVGDAGVRANA  460
            LIIAVII+ G+ P T      Y  F G+AHL++GLACGL+GL+AG+AIGIVGDAGVRANA
Sbjct  72   LIIAVIIANGVMPPTSEGTTKYSSFTGFAHLAAGLACGLSGLAAGIAIGIVGDAGVRANA  131

Query  461  QQPKLFVGM  487
            QQ KL+VGM
Sbjct  132  QQAKLYVGM  140



>ref|XP_009345640.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c4-like 
[Pyrus x bretschneideri]
Length=181

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/68 (94%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SCMGAAYGTAKS VGVASMGV RPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP+ K
Sbjct  87   SCMGAAYGTAKSRVGVASMGVTRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPEAK  146

Query  341  SYYLFDGY  364
            SYYLFDGY
Sbjct  147  SYYLFDGY  154



>ref|XP_002371832.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Toxoplasma 
gondii ME49]
 ref|XP_008881718.1| vacuolar ATP synthetase [Hammondia hammondi]
 gb|EPR61908.1| vacuolar ATP synthetase [Toxoplasma gondii GT1]
 gb|KEP67283.1| vacuolar ATP synthetase [Hammondia hammondi]
Length=170

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGIN-PKT  337
            S +GAAYGTAKSGVG++SMGVMRP+LVM+SI+PVVMAG+LGIYGLII+++I+  ++ P T
Sbjct  28   SNLGAAYGTAKSGVGISSMGVMRPDLVMRSIIPVVMAGILGIYGLIISIVINGSMDTPDT  87

Query  338  KSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             S Y   GY HL++GL  GL+ ++AG+AIGIVGDAGVRANAQQPKLFVGM
Sbjct  88   YSSY--AGYGHLAAGLTVGLSAMAAGLAIGIVGDAGVRANAQQPKLFVGM  135



>ref|XP_003884509.1| hypothetical protein NCLIV_049080 [Neospora caninum Liverpool]
 emb|CBZ54479.1| hypothetical protein NCLIV_049080 [Neospora caninum Liverpool]
Length=170

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGIN-PKT  337
            S +GAAYGTAKSGVG++SMGVMRP+LVM+SI+PVVMAG+LGIYGLII+++I+  ++ P T
Sbjct  28   SNLGAAYGTAKSGVGISSMGVMRPDLVMRSIIPVVMAGILGIYGLIISIVINGSMDTPDT  87

Query  338  KSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             S Y   GY HL++GL  GL+ ++AG+AIGIVGDAGVRANAQQPKLFVGM
Sbjct  88   YSSY--AGYGHLAAGLTVGLSAMAAGLAIGIVGDAGVRANAQQPKLFVGM  135



>ref|XP_005703524.1| V-type H+-transporting ATPase subunit c [Galdieria sulphuraria]
 gb|EME27004.1| V-type H+-transporting ATPase subunit c [Galdieria sulphuraria]
Length=159

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 108/123 (88%), Gaps = 2/123 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTAKSGVGVASMGVMRPELVM+SI+PVVMAGVLGIYGLI+AVI+   I     
Sbjct  23   SNLGAAYGTAKSGVGVASMGVMRPELVMRSIIPVVMAGVLGIYGLIVAVILVGQIAETNY  82

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
             Y+L  G+AHL+SGLA GL+GL+AG+ IGIVGDAGVRA AQQPKLFVGMILILIFAEALA
Sbjct  83   PYFL--GFAHLASGLANGLSGLAAGICIGIVGDAGVRATAQQPKLFVGMILILIFAEALA  140

Query  521  lYG  529
            LYG
Sbjct  141  LYG  143



>ref|XP_967959.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tribolium 
castaneum]
 gb|EEZ97227.1| hypothetical protein TcasGA2_TC011025 [Tribolium castaneum]
Length=159

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL+IAV+I+ GI+    
Sbjct  27   SSLGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVIAVLIAGGIDSAAN  86

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
            +Y L+ G+ HL +GL+ G +GL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  87   NYSLYKGFVHLGAGLSVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  135



>ref|XP_009692511.1| vacuolar H+-ATPase subunit [Theileria orientalis strain Shintoku]
 dbj|BAM42210.1| vacuolar H+-ATPase subunit [Theileria orientalis strain Shintoku]
Length=166

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTA+SGVG++SMGVMRP+LVMKSIVPV+MAGVLGIYGLII+++I+T    K  
Sbjct  24   SNLGAAYGTARSGVGISSMGVMRPDLVMKSIVPVIMAGVLGIYGLIISIVITTNYG-KPG  82

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
             Y  F GY+HL++GL  GL  L+AG+AIGIVGDAGVRA+AQQ +LFVGMIL L+FAE LA
Sbjct  83   EYSHFSGYSHLAAGLVVGLCSLAAGLAIGIVGDAGVRAHAQQTRLFVGMILTLVFAETLA  142

Query  521  lYG  529
            LYG
Sbjct  143  LYG  145



>ref|XP_002767877.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002769335.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002769336.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002773961.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002773962.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002774253.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002777951.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER00595.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER02053.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER02054.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER05777.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER05778.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER06069.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER09746.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
Length=176

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 3/108 (3%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGIN-PKTKS  343
            +GAAYGTAKSGVG+ SMGVMRP+LVM+SI+PVVMAGVLGIYGLI +VII+  ++ P T S
Sbjct  32   LGAAYGTAKSGVGICSMGVMRPDLVMRSIIPVVMAGVLGIYGLITSVIINGKMDTPATYS  91

Query  344  YYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             Y   GYAHL +GL  GL+ L+AG+AIGIVGD+GVRANAQQPKLFVGM
Sbjct  92   QY--SGYAHLGAGLTVGLSSLAAGLAIGIVGDSGVRANAQQPKLFVGM  137



>gb|KHJ49390.1| AP-3 complex subunit beta-2 [Trichuris suis]
Length=1318

 Score =   132 bits (332),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 81/123 (66%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = +2

Query  161   SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
             + +GAAYGTAKSG G+++MGVMRPE +M+SI+PVVMAG++GIYGL+++VII+ G++   K
Sbjct  1187  TALGAAYGTAKSGTGISAMGVMRPEFIMRSIIPVVMAGIIGIYGLVVSVIIAQGLDAAPK  1246

Query  341   SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
              Y LF G+  L +GLA G +GL+AG AIGIVGD+GVR  AQQP+LFVGMILILIFAE L 
Sbjct  1247  -YTLFKGFCGLGAGLAVGFSGLAAGYAIGIVGDSGVRGTAQQPRLFVGMILILIFAEVLG  1305

Query  521   lYG  529
             LYG
Sbjct  1306  LYG  1308



>ref|XP_003661349.1| hypothetical protein MYCTH_2314502 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO56104.1| hypothetical protein MYCTH_2314502 [Myceliophthora thermophila 
ATCC 42464]
Length=162

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 95/109 (87%), Gaps = 2/109 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            +C+GA+YGTAKSGVG+A+MGV+RP+L++K+IVPV+MAG++GIYGL+++V+IS G+  K  
Sbjct  25   TCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISDGL--KQD  82

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
            +Y LF G+  L +GLA GLAG++AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  83   NYALFTGFIQLGAGLAVGLAGMAAGFAIGIVGDAGVRGTAQQPRLFVGM  131



>gb|KFM60257.1| V-type proton ATPase proteolipid subunit, partial [Stegodyphus 
mimosarum]
Length=157

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTAKSG G+A+M +MRPEL+MKSI+PVVMAG++ IYGL++AV+I+  I+  T 
Sbjct  24   SALGAAYGTAKSGTGIAAMSIMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANNISSSTD  83

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             Y L+ G+ H  +GL+ GL+GL+AG AIG+VGDAGVR  AQQP+LFVGM
Sbjct  84   GYKLYKGFLHFGAGLSVGLSGLAAGFAIGVVGDAGVRGTAQQPRLFVGM  132



>ref|XP_006873944.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Chrysochloris 
asiatica]
Length=155

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MS T SG E A FF  +GA+AA+VFS +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVV
Sbjct  1    MSETASGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAG++ IYGL++AV+I+  +N K     L+  +  L +GL+ GL+GL+AG AIGIVGDAG
Sbjct  61   MAGIIAIYGLVVAVLIANSLNDKIS---LYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAG  117

Query  446  VRANAQQPKLFVGM  487
            VR  AQQP+LFVGM
Sbjct  118  VRGTAQQPRLFVGM  131



>gb|EPE05694.1| vacuolar atp synthase 16 kda proteolipid subunit [Ophiostoma 
piceae UAMH 11346]
Length=162

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 94/109 (86%), Gaps = 2/109 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            +C+GA+YGTAKSGVG+A+MGV+RP+L++K+IVPV+MAG++GIYGL+++V+IS   N K K
Sbjct  25   TCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISD--NLKQK  82

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             Y L+ G+  L +GLA GLAGL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  83   EYALYTGFIQLGAGLAVGLAGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  131



>emb|CDY54164.1| BnaC02g47230D [Brassica napus]
Length=417

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  224  MRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglag  403
            +RPELVMKSIVPVVMAGVLGIYGLIIAVIIST INPK KSYYLFDGYAHLSSGLACGLAG
Sbjct  11   LRPELVMKSIVPVVMAGVLGIYGLIIAVIISTEINPKAKSYYLFDGYAHLSSGLACGLAG  70

Query  404  lsagMAIGIVGDAGVRANAQQPKLFVGM  487
            LSAGMAIGIV D+GVRANAQQPKLFVGM
Sbjct  71   LSAGMAIGIVRDSGVRANAQQPKLFVGM  98



>ref|XP_003709260.1| V-type proton ATPase proteolipid subunit [Magnaporthe oryzae 
70-15]
 gb|EHA56648.1| V-type proton ATPase proteolipid subunit [Magnaporthe oryzae 
70-15]
 gb|ELQ35163.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Magnaporthe 
oryzae Y34]
 gb|ELQ66331.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Magnaporthe 
oryzae P131]
Length=162

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            +C+GA+YGTAKSGVG+A+MGV+RP+L++K+IVPV+MAG++GIYGL+++V+IS   N K  
Sbjct  25   TCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISD--NLKQD  82

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             Y LF G+  L +GLA GLAGL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  83   EYALFTGFIQLGAGLAVGLAGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  131



>emb|CEP11926.1| hypothetical protein [Parasitella parasitica]
Length=1094

 Score =   130 bits (328),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 91/138 (66%), Positives = 118/138 (86%), Gaps = 3/138 (2%)
 Frame = +2

Query  116   APffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGL  295
             APFFG +G AAA+VFSC+GAAYGTAKSGVG+++MGV+RP+LV+K IVPVVMAG+LGIYG+
Sbjct  941   APFFGTMGCAAAIVFSCLGAAYGTAKSGVGLSAMGVLRPDLVLKCIVPVVMAGILGIYGV  1000

Query  296   IIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKL  475
             +++V++S G+  K     LF G+  +++GL+ GL+ L+AG+AIGI GDAGVRA AQQP++
Sbjct  1001  VVSVLLSGGLAMKQT---LFSGFIQMAAGLSVGLSCLAAGIAIGITGDAGVRATAQQPRM  1057

Query  476   FVGMililifaealalYG  529
             FVGMILILIFAE L LYG
Sbjct  1058  FVGMILILIFAEVLGLYG  1075



>ref|XP_002772137.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER03953.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
Length=240

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 3/108 (3%)
 Frame = +2

Query  167  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGIN-PKTKS  343
            +GAAYGTAKSGVG+ SMGVMRP+LVM+SI+PVVMAGVLGIYGLI +VII+  ++ P T S
Sbjct  96   LGAAYGTAKSGVGICSMGVMRPDLVMRSIIPVVMAGVLGIYGLITSVIINGKMDTPATYS  155

Query  344  YYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             Y   GYAHL +GL  GL+ L+AG+AIGIVGD+GVRANAQQPKLFVGM
Sbjct  156  QY--SGYAHLGAGLTVGLSSLAAGLAIGIVGDSGVRANAQQPKLFVGM  201



>ref|XP_797801.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Strongylocentrotus purpuratus]
Length=155

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTAKSG GVA+M VMRPEL+MKSI+PVVMAG++GIYGL++A +I+ GI     
Sbjct  23   SALGAAYGTAKSGTGVAAMSVMRPELIMKSIIPVVMAGIVGIYGLVVAAVIANGIPSDPS  82

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
            +Y L+  + HL +GL+ GL+GL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  83   AYTLYKSFMHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  131



>gb|KIW63616.1| V-type proton ATPase proteolipid subunit [Capronia semiimmersa]
Length=224

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 113/141 (80%), Gaps = 4/141 (3%)
 Frame = +2

Query  65   RSTKAEKMSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVM  244
            R+T++ KMSS       APFFG +G  +A+VF+C GAAYGTAKSGVG+++MGV+RP+L++
Sbjct  57   RATQSVKMSSDLC-PVYAPFFGAMGCTSAIVFTCFGAAYGTAKSGVGISAMGVLRPDLIV  115

Query  245  KSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAI  424
            K+IVPV+MAG++GIYGL+++V+IS  ++ K     LF G+  L +GL+ GLAGL+AG AI
Sbjct  116  KNIVPVIMAGIIGIYGLVVSVLISDNLSQKQA---LFTGFIQLGAGLSVGLAGLAAGFAI  172

Query  425  GIVGDAGVRANAQQPKLFVGM  487
            GIVGDAGVR  AQQP+LFVGM
Sbjct  173  GIVGDAGVRGTAQQPRLFVGM  193



>gb|ERT01764.1| V-type proton ATPase proteolipid subunit [Sporothrix schenckii 
ATCC 58251]
Length=147

 Score =   120 bits (302),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            +C+GA+YGTAKSGVG+A+MGV+RP+L++K+IVPV+MAG++GIYGL+++V+IS   N K  
Sbjct  10   TCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISD--NLKQD  67

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             Y L+ G+  L +GLA GLAGL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  68   QYALYTGFIQLGAGLAVGLAGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  116



>ref|NP_001011570.1| vacuolar H+ ATP synthase 16 kDa proteolipid subunit [Apis mellifera]
 ref|XP_003693843.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform 1 [Apis florea]
 ref|XP_003693844.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform 2 [Apis florea]
 ref|XP_006614834.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Apis dorsata]
 gb|AAQ21381.1| vacuolar H+ ATP synthase 16 kDa proteolipid subunit [Apis mellifera]
Length=156

 Score =   120 bits (302),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL++AV+I+ G+  + K
Sbjct  25   SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGGLE-EPK  83

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             Y LF G+ HL +GLA G +GL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  84   GYTLFKGFVHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  132



>ref|XP_007914202.1| putative vacuolar atp synthase 16 kda proteolipid subunit protein 
[Togninia minima UCRPA7]
 gb|EOO01044.1| putative vacuolar atp synthase 16 kda proteolipid subunit protein 
[Togninia minima UCRPA7]
Length=161

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 94/109 (86%), Gaps = 2/109 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            +C+GA+YGTAKSGVG+A+MGV+RP+L++K+IVPV+MAG++GIYGL+++V+IS   N K +
Sbjct  24   TCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISD--NLKQQ  81

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             Y L+ G+  L +GLA GLAG++AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  82   EYALYTGFIQLGAGLAVGLAGMAAGFAIGIVGDAGVRGTAQQPRLFVGM  130



>gb|EIE75365.1| V-type proton ATPase proteolipid subunit [Rhizopus delemar RA 
99-880]
Length=148

 Score =   120 bits (301),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 93/109 (85%), Gaps = 3/109 (3%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SC+GAAYGTAKSGVG+++MGV+RP+LV+K IVPVVMAG+LGIYG++++V++S G+  K  
Sbjct  10   SCLGAAYGTAKSGVGLSAMGVLRPDLVLKCIVPVVMAGILGIYGVVVSVLLSGGLAMKQT  69

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
               LF G+  +++GL+ GL+ L+AG+AIGI GDAGVRA AQQP++FVGM
Sbjct  70   ---LFSGFVQMAAGLSVGLSCLAAGIAIGITGDAGVRATAQQPRMFVGM  115



>sp|P55277.1|VATL_HELVI RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Heliothis virescens]
 gb|AAC37176.1| H+-ATPase V-type subunit [Heliothis virescens]
Length=156

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL++AV+I+  ++  + 
Sbjct  23   SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGSLDAPSN  82

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
            +Y L+ G+ HL +GLA G +GL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  83   NYTLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  131



>ref|XP_003228377.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Anolis 
carolinensis]
Length=155

 Score =   120 bits (301),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 108/134 (81%), Gaps = 3/134 (2%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MSST +  E +PFF  +GA+AA+VFS +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVV
Sbjct  1    MSSTSAPPEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAG++ IYGL++AV+I+   N  +++  LF  +  L +GL+ GL+GL+AG AIGIVGDAG
Sbjct  61   MAGIIAIYGLVVAVLIA---NSISETISLFKSFLQLGAGLSVGLSGLAAGFAIGIVGDAG  117

Query  446  VRANAQQPKLFVGM  487
            VR  AQQP+LFVGM
Sbjct  118  VRGTAQQPRLFVGM  131



>sp|P31403.1|VATL_MANSE RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Manduca sexta]
 emb|CAA46187.1| vacuolar ATPase 16 kD proteolipid subunit [Manduca sexta]
Length=156

 Score =   120 bits (301),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL++AV+I+  ++  + 
Sbjct  23   SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGSLDSPSN  82

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
            +Y L+ G+ HL +GLA G +GL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  83   NYTLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  131



>ref|XP_004712996.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Echinops telfairi]
Length=155

 Score =   120 bits (301),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 105/134 (78%), Gaps = 3/134 (2%)
 Frame = +2

Query  86   MSSTFSGDETAPffgflgaaaalvfSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  265
            MS T  G E A FFG +GA AA++FS +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVV
Sbjct  1    MSETIPGPEYAAFFGIMGATAAMIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVV  60

Query  266  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYahlssglacglaglsagMAIGIVGDAG  445
            MAG++ IYGL++AV+I+  +N K     L+  +  L +GL+ GL+GL+AG AIGIVGDAG
Sbjct  61   MAGIIAIYGLVVAVLIANSLNEKIT---LYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAG  117

Query  446  VRANAQQPKLFVGM  487
            VR  AQQP+LFVGM
Sbjct  118  VRGTAQQPRLFVGM  131



>tpg|DAA34683.1| TPA_inf: vacuolar H+-ATPase V0 sector subunits c/c' [Amblyomma 
variegatum]
Length=154

 Score =   120 bits (301),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 90/109 (83%), Gaps = 3/109 (3%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL++AV+IS+ I P   
Sbjct  24   SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLISSTIKPD--  81

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             Y LF  + HL +GL+ GL+GL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  82   -YKLFSAFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  129



>gb|EPB83018.1| V-type H+-transporting ATPase 16kDa proteolipid subunit [Mucor 
circinelloides f. circinelloides 1006PhL]
Length=148

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 93/109 (85%), Gaps = 3/109 (3%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            SC+GAAYGTAKSGVG+++MGV+RP+LV+K IVPVVMAG+LGIYG++++V++S G+  K  
Sbjct  10   SCLGAAYGTAKSGVGLSAMGVLRPDLVLKCIVPVVMAGILGIYGVVVSVLLSGGLAMKQT  69

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
               LF G+  +++GL+ GL+ L+AG+AIGI GDAGVRA AQQP++FVGM
Sbjct  70   ---LFSGFIQMAAGLSVGLSCLAAGIAIGITGDAGVRATAQQPRMFVGM  115



>ref|XP_008815161.1| V-type proton ATPase proteolipid subunit [Plasmodium inui San 
Antonio 1]
 gb|EUD68313.1| V-type proton ATPase proteolipid subunit [Plasmodium inui San 
Antonio 1]
Length=156

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTAKSGVGV S+GVMRP+L+MKSI+PVVMAGVLGIYG+I++++I   + P  +
Sbjct  23   SNLGAAYGTAKSGVGVCSVGVMRPDLIMKSILPVVMAGVLGIYGIIMSILIYGKMTP-AQ  81

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
             Y  F GY HL+SGL  GL+ L+AG+AIGIVGDAGVRANAQQ +LF+GMILIL+F+E LA
Sbjct  82   DYSTFSGYTHLASGLIVGLSSLAAGLAIGIVGDAGVRANAQQNRLFIGMILILVFSETLA  141

Query  521  lYG  529
            LYG
Sbjct  142  LYG  144



>gb|KDR23608.1| V-type proton ATPase 16 kDa proteolipid subunit, partial [Zootermopsis 
nevadensis]
Length=132

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG+L IYGL++AV+I+  +    K
Sbjct  1    SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGILAIYGLVVAVLIAGALEEPDK  60

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             Y LF G+ HL +GLA G +GL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  61   -YSLFKGFVHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  108



>gb|KIH88046.1| V-type H+-transporting ATPase 16kDa proteolipid subunit [Sporothrix 
brasiliensis 5110]
Length=162

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            +C+GA+YGTAKSGVG+A+MGV+RP+L++K+IVPV+MAG++GIYGL+++V+IS   N K  
Sbjct  25   TCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISD--NLKQD  82

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
             Y L+ G+  L +GLA GLAGL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  83   QYALYTGFIQLGAGLAVGLAGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  131



>gb|EHJ71500.1| hypothetical protein KGM_13250 [Danaus plexippus]
Length=157

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 90/109 (83%), Gaps = 1/109 (1%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL++AV+I+  + P   
Sbjct  24   SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGSLEPPA-  82

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGM  487
            +Y LF G+ HL +GLA G +GL+AG AIGIVGDAGVR  AQQP+LFVGM
Sbjct  83   TYSLFKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM  131



>ref|XP_001609797.1| proteolipid subunit c [Babesia bovis T2Bo]
 gb|EDO06229.1| proteolipid subunit c, putative [Babesia bovis]
Length=173

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = +2

Query  161  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  340
            S +GAAYGTA+SGVG++SMGVMRP+LVM+SI+PV+MAGVLGIYGLI+AVII   +     
Sbjct  31   SSLGAAYGTARSGVGISSMGVMRPDLVMRSIIPVIMAGVLGIYGLIMAVIIVLNMG-HPG  89

Query  341  SYYLFDGYahlssglacglaglsagMAIGIVGDAGVRANAQQPKLFVGMililifaeala  520
            SY  + GY+HLS+GL  G +GL++G+AIGIVGDAGVRANAQQ +LFVGM+L L+FAE LA
Sbjct  90   SYSAYAGYSHLSAGLIVGFSGLASGLAIGIVGDAGVRANAQQTRLFVGMVLTLVFAETLA  149

Query  521  lYG  529
            LYG
Sbjct  150  LYG  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400