BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J21

Length=576
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343869.1|  PREDICTED: abscisic acid receptor PYL9-like        256   2e-83   Solanum tuberosum [potatoes]
ref|XP_004245523.1|  PREDICTED: abscisic acid receptor PYL9             256   2e-83   Solanum lycopersicum
gb|KJB39701.1|  hypothetical protein B456_007G026100                    256   4e-83   Gossypium raimondii
ref|XP_007040497.1|  Regulatory components of ABA receptor 3            256   5e-83   
ref|XP_010659134.1|  PREDICTED: abscisic acid receptor PYL8-like        253   6e-82   Vitis vinifera
gb|KHG27844.1|  Abscisic acid receptor PYL8 -like protein               253   6e-82   Gossypium arboreum [tree cotton]
ref|XP_009603677.1|  PREDICTED: abscisic acid receptor PYL9-like        251   2e-81   Nicotiana tomentosiformis
gb|KHG11909.1|  Abscisic acid receptor PYL8 -like protein               251   2e-81   Gossypium arboreum [tree cotton]
ref|XP_011101032.1|  PREDICTED: abscisic acid receptor PYL8-like        251   3e-81   Sesamum indicum [beniseed]
ref|XP_007135240.1|  hypothetical protein PHAVU_010G112500g             251   5e-81   Phaseolus vulgaris [French bean]
emb|CBI34472.3|  unnamed protein product                                250   7e-81   Vitis vinifera
ref|XP_010261534.1|  PREDICTED: abscisic acid receptor PYL8-like        249   2e-80   Nelumbo nucifera [Indian lotus]
gb|KDP25308.1|  hypothetical protein JCGZ_20464                         249   3e-80   Jatropha curcas
gb|KJB52278.1|  hypothetical protein B456_008G253700                    248   4e-80   Gossypium raimondii
gb|AAT35532.1|  CAPIP1                                                  248   4e-80   Capsicum annuum
ref|XP_009769460.1|  PREDICTED: abscisic acid receptor PYL9-like        248   6e-80   Nicotiana sylvestris
emb|CAN64668.1|  hypothetical protein VITISV_029498                     247   9e-80   Vitis vinifera
ref|XP_008778779.1|  PREDICTED: abscisic acid receptor PYL8-like        248   1e-79   Phoenix dactylifera
ref|XP_002270037.3|  PREDICTED: abscisic acid receptor PYL8             247   2e-79   Vitis vinifera
gb|KHN06298.1|  Abscisic acid receptor PYL9                             246   4e-79   Glycine soja [wild soybean]
gb|ABF72432.1|  PIP1                                                    246   4e-79   Capsicum annuum
gb|AFK41699.1|  unknown                                                 245   6e-79   Lotus japonicus
ref|XP_009395763.1|  PREDICTED: abscisic acid receptor PYL8-like        246   8e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010266480.1|  PREDICTED: abscisic acid receptor PYL8             245   8e-79   Nelumbo nucifera [Indian lotus]
emb|CDP12146.1|  unnamed protein product                                244   8e-79   Coffea canephora [robusta coffee]
ref|XP_010924854.1|  PREDICTED: abscisic acid receptor PYL8             245   1e-78   Elaeis guineensis
ref|XP_010671508.1|  PREDICTED: abscisic acid receptor PYL8             244   1e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001242004.1|  uncharacterized protein LOC100810273               244   1e-78   Glycine max [soybeans]
ref|XP_004516407.1|  PREDICTED: abscisic acid receptor PYL9-like ...    244   1e-78   Cicer arietinum [garbanzo]
ref|XP_006444870.1|  hypothetical protein CICLE_v10022440mg             244   2e-78   Citrus clementina [clementine]
ref|NP_001275025.1|  abscisic acid receptor PYL8-like                   243   3e-78   Solanum tuberosum [potatoes]
ref|XP_011022513.1|  PREDICTED: abscisic acid receptor PYL8-like        244   3e-78   Populus euphratica
ref|NP_001236328.1|  uncharacterized protein LOC100500065               243   4e-78   Glycine max [soybeans]
ref|XP_006439364.1|  hypothetical protein CICLE_v10022206mg             243   4e-78   Citrus clementina [clementine]
ref|XP_010913806.1|  PREDICTED: abscisic acid receptor PYL8-like        245   5e-78   Elaeis guineensis
ref|XP_003637736.1|  Abscisic acid receptor PYL9                        243   8e-78   
ref|XP_002509950.1|  conserved hypothetical protein                     243   8e-78   Ricinus communis
gb|AAV85853.1|  AT-rich element binding factor 3                        242   9e-78   Pisum sativum [garden pea]
ref|XP_006476396.1|  PREDICTED: abscisic acid receptor PYL8-like        243   1e-77   Citrus sinensis [apfelsine]
ref|XP_004234175.1|  PREDICTED: abscisic acid receptor PYL8             242   1e-77   Solanum lycopersicum
ref|XP_002304553.1|  hypothetical protein POPTR_0003s13900g             241   2e-77   Populus trichocarpa [western balsam poplar]
gb|EYU25203.1|  hypothetical protein MIMGU_mgv1a014621mg                241   2e-77   Erythranthe guttata [common monkey flower]
ref|XP_011037987.1|  PREDICTED: abscisic acid receptor PYL9-like        241   2e-77   Populus euphratica
ref|XP_008791430.1|  PREDICTED: abscisic acid receptor PYL8-like        242   2e-77   Phoenix dactylifera
gb|EYU23369.1|  hypothetical protein MIMGU_mgv1a014495mg                241   3e-77   Erythranthe guttata [common monkey flower]
ref|XP_011084493.1|  PREDICTED: abscisic acid receptor PYL8             241   3e-77   Sesamum indicum [beniseed]
ref|XP_002320857.1|  hypothetical protein POPTR_0014s09280g             240   6e-77   Populus trichocarpa [western balsam poplar]
gb|ABK92491.1|  unknown                                                 240   7e-77   Populus trichocarpa [western balsam poplar]
gb|ACJ85952.1|  unknown                                                 240   7e-77   Medicago truncatula
ref|XP_002302624.1|  hypothetical protein POPTR_0002s17070g             240   8e-77   Populus trichocarpa [western balsam poplar]
ref|XP_010915668.1|  PREDICTED: abscisic acid receptor PYL8-like        241   9e-77   Elaeis guineensis
ref|XP_009589647.1|  PREDICTED: abscisic acid receptor PYL8             239   1e-76   Nicotiana tomentosiformis
ref|XP_008376112.1|  PREDICTED: abscisic acid receptor PYL9-like        239   1e-76   Malus domestica [apple tree]
ref|XP_004306686.1|  PREDICTED: abscisic acid receptor PYL9-like        239   1e-76   Fragaria vesca subsp. vesca
gb|ACG76109.1|  pathogenesis-induced protein                            239   1e-76   Arachis hypogaea [goober]
ref|XP_011026905.1|  PREDICTED: abscisic acid receptor PYL8-like        239   2e-76   Populus euphratica
ref|XP_002297980.2|  hypothetical protein POPTR_0001s10530g             239   2e-76   
ref|XP_007051579.1|  Regulatory component of ABA receptor 1             239   2e-76   Theobroma cacao [chocolate]
gb|KJB24579.1|  hypothetical protein B456_004G152300                    239   2e-76   Gossypium raimondii
ref|XP_006360709.1|  PREDICTED: abscisic acid receptor PYL8-like ...    238   2e-76   Solanum tuberosum [potatoes]
ref|XP_007038971.1|  Regulatory components of ABA receptor 3 isof...    239   2e-76   Theobroma cacao [chocolate]
ref|XP_010925745.1|  PREDICTED: abscisic acid receptor PYL8-like ...    239   3e-76   Elaeis guineensis
ref|XP_009786635.1|  PREDICTED: abscisic acid receptor PYL8-like        238   3e-76   Nicotiana sylvestris
ref|XP_007038970.1|  Regulatory components of ABA receptor 3 isof...    240   5e-76   
ref|XP_010049392.1|  PREDICTED: abscisic acid receptor PYL8             238   5e-76   Eucalyptus grandis [rose gum]
ref|XP_008783837.1|  PREDICTED: abscisic acid receptor PYL8-like        239   6e-76   Phoenix dactylifera
ref|XP_011023201.1|  PREDICTED: abscisic acid receptor PYL9-like        238   7e-76   Populus euphratica
ref|XP_002523369.1|  conserved hypothetical protein                     237   1e-75   Ricinus communis
ref|XP_004252608.1|  PREDICTED: abscisic acid receptor PYL9-like ...    237   1e-75   Solanum lycopersicum
ref|XP_009601305.1|  PREDICTED: abscisic acid receptor PYL9-like        237   1e-75   Nicotiana tomentosiformis
ref|XP_008350612.1|  PREDICTED: abscisic acid receptor PYL9             236   1e-75   Malus domestica [apple tree]
gb|KJB41501.1|  hypothetical protein B456_007G107500                    236   2e-75   Gossypium raimondii
ref|XP_009797969.1|  PREDICTED: abscisic acid receptor PYL9-like        235   4e-75   Nicotiana sylvestris
ref|XP_010537115.1|  PREDICTED: abscisic acid receptor PYL8-like ...    236   4e-75   Tarenaya hassleriana [spider flower]
ref|XP_009336806.1|  PREDICTED: abscisic acid receptor PYL9             235   6e-75   Pyrus x bretschneideri [bai li]
gb|KDP22164.1|  hypothetical protein JCGZ_25995                         235   8e-75   Jatropha curcas
ref|XP_002513580.1|  conserved hypothetical protein                     235   1e-74   Ricinus communis
ref|XP_008789785.1|  PREDICTED: abscisic acid receptor PYL8-like        235   1e-74   Phoenix dactylifera
ref|XP_009396565.1|  PREDICTED: abscisic acid receptor PYL8-like        234   2e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG17720.1|  Abscisic acid receptor PYL9 -like protein               234   2e-74   Gossypium arboreum [tree cotton]
ref|XP_011470277.1|  PREDICTED: abscisic acid receptor PYL8 isofo...    234   2e-74   Fragaria vesca subsp. vesca
ref|XP_008380616.1|  PREDICTED: abscisic acid receptor PYL8-like        234   3e-74   Malus domestica [apple tree]
dbj|BAN15743.1|  pyrabactin resistance                                  233   4e-74   Dianthus caryophyllus [carnation]
ref|XP_006439365.1|  hypothetical protein CICLE_v10022206mg             234   5e-74   
ref|XP_010053803.1|  PREDICTED: abscisic acid receptor PYL9-like        233   5e-74   Eucalyptus grandis [rose gum]
ref|XP_003541499.1|  PREDICTED: abscisic acid receptor PYL8-like ...    233   7e-74   Glycine max [soybeans]
ref|XP_003544752.1|  PREDICTED: abscisic acid receptor PYL8-like ...    233   7e-74   Glycine max [soybeans]
ref|XP_009352050.1|  PREDICTED: abscisic acid receptor PYL8-like        233   8e-74   Pyrus x bretschneideri [bai li]
ref|XP_010097852.1|  hypothetical protein L484_011451                   233   8e-74   Morus notabilis
ref|XP_008234775.1|  PREDICTED: abscisic acid receptor PYL8             232   8e-74   Prunus mume [ume]
ref|XP_004308004.1|  PREDICTED: abscisic acid receptor PYL8 isofo...    233   1e-73   Fragaria vesca subsp. vesca
ref|XP_009368678.1|  PREDICTED: abscisic acid receptor PYL8-like        232   1e-73   Pyrus x bretschneideri [bai li]
gb|KJB74714.1|  hypothetical protein B456_012G003800                    231   2e-73   Gossypium raimondii
gb|ACJ83958.1|  unknown                                                 231   2e-73   Medicago truncatula
gb|ACJ86004.1|  unknown                                                 231   3e-73   Medicago truncatula
ref|XP_009357323.1|  PREDICTED: abscisic acid receptor PYL8-like        231   3e-73   Pyrus x bretschneideri [bai li]
ref|XP_003602205.1|  Abscisic acid receptor PYL8                        231   3e-73   Medicago truncatula
ref|XP_007218488.1|  hypothetical protein PRUPE_ppa012114mg             230   4e-73   Prunus persica
ref|XP_007218467.1|  hypothetical protein PRUPE_ppa011927mg             231   4e-73   Prunus persica
gb|KHG04020.1|  Abscisic acid receptor PYL8 -like protein               230   9e-73   Gossypium arboreum [tree cotton]
ref|XP_002318380.1|  hypothetical protein POPTR_0012s01550g             230   9e-73   Populus trichocarpa [western balsam poplar]
ref|XP_008376697.1|  PREDICTED: abscisic acid receptor PYL8             230   1e-72   
ref|XP_010556594.1|  PREDICTED: abscisic acid receptor PYL9             229   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_006305674.1|  hypothetical protein CARUB_v10010391mg             229   1e-72   Capsella rubella
gb|KJB37343.1|  hypothetical protein B456_006G200700                    228   3e-72   Gossypium raimondii
gb|KJB39703.1|  hypothetical protein B456_007G026100                    228   3e-72   Gossypium raimondii
ref|XP_008465378.1|  PREDICTED: abscisic acid receptor PYL8-like        228   5e-72   Cucumis melo [Oriental melon]
gb|KJB37344.1|  hypothetical protein B456_006G200700                    228   5e-72   Gossypium raimondii
ref|XP_010521388.1|  PREDICTED: abscisic acid receptor PYL8             228   7e-72   Tarenaya hassleriana [spider flower]
emb|CDP05086.1|  unnamed protein product                                227   7e-72   Coffea canephora [robusta coffee]
ref|XP_006418416.1|  hypothetical protein EUTSA_v10008854mg             227   9e-72   Eutrema salsugineum [saltwater cress]
ref|XP_002864227.1|  hypothetical protein ARALYDRAFT_918386             227   1e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_002892069.1|  predicted protein                                  226   2e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_011005521.1|  PREDICTED: abscisic acid receptor PYL8-like ...    226   2e-71   Populus euphratica
emb|CAN82501.1|  hypothetical protein VITISV_004915                     226   2e-71   Vitis vinifera
ref|XP_002321450.1|  hypothetical protein POPTR_0015s02210g             226   2e-71   Populus trichocarpa [western balsam poplar]
ref|XP_010055027.1|  PREDICTED: abscisic acid receptor PYL9-like        226   2e-71   Eucalyptus grandis [rose gum]
ref|XP_002281200.1|  PREDICTED: abscisic acid receptor PYL9             226   2e-71   Vitis vinifera
ref|NP_200128.1|  regulatory component of ABA receptor 3                226   3e-71   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00266.1|  hypothetical protein                                   226   4e-71   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF63139.1|  hypothetical protein                                   226   4e-71   Arabidopsis suecica
emb|CDY15183.1|  BnaC05g00620D                                          225   4e-71   Brassica napus [oilseed rape]
ref|XP_010448063.1|  PREDICTED: abscisic acid receptor PYL10-like       225   5e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006655099.1|  PREDICTED: abscisic acid receptor PYL8-like        225   5e-71   Oryza brachyantha
ref|XP_004149459.1|  PREDICTED: abscisic acid receptor PYL8-like ...    225   6e-71   Cucumis sativus [cucumbers]
ref|XP_009786413.1|  PREDICTED: abscisic acid receptor PYL8-like        225   6e-71   Nicotiana sylvestris
ref|NP_001284557.1|  abscisic acid receptor PYL8-like                   225   7e-71   Solanum tuberosum [potatoes]
ref|XP_010474732.1|  PREDICTED: abscisic acid receptor PYL9-like        224   7e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009380524.1|  PREDICTED: abscisic acid receptor PYL8-like        225   7e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010438531.1|  PREDICTED: abscisic acid receptor PYL10-like       224   7e-71   Camelina sativa [gold-of-pleasure]
gb|KJB52578.1|  hypothetical protein B456_008G270200                    224   8e-71   Gossypium raimondii
ref|XP_004231210.1|  PREDICTED: abscisic acid receptor PYL8             224   1e-70   
ref|XP_006837452.1|  hypothetical protein AMTR_s00107p00103680          224   2e-70   
ref|XP_011093668.1|  PREDICTED: abscisic acid receptor PYL9             223   2e-70   Sesamum indicum [beniseed]
ref|NP_563626.1|  regulatory component of ABA receptor 1                224   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401738.1|  hypothetical protein EUTSA_v10014777mg             224   2e-70   Eutrema salsugineum [saltwater cress]
ref|XP_010480374.1|  PREDICTED: abscisic acid receptor PYL9-like        224   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_004498400.1|  PREDICTED: LOW QUALITY PROTEIN: abscisic aci...    224   2e-70   
gb|EAZ22456.1|  hypothetical protein OsJ_06125                          224   2e-70   Oryza sativa Japonica Group [Japonica rice]
gb|AAM65514.1|  unknown                                                 224   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAF97339.1|AC023628_20  Unknown protein                              223   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119689.1|  PREDICTED: abscisic acid receptor PYL9             223   2e-70   Brassica rapa
ref|NP_001046464.1|  Os02g0255500                                       224   2e-70   
ref|XP_009388710.1|  PREDICTED: abscisic acid receptor PYL8-like        225   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010457135.1|  PREDICTED: abscisic acid receptor PYL9             223   2e-70   Camelina sativa [gold-of-pleasure]
emb|CBH19550.1|  polyketide cyclase                                     224   2e-70   Oryza sativa Indica Group [Indian rice]
pdb|3OQU|A  Chain A, Crystal Structure Of Native Abscisic Acid Re...    224   2e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90028.1|  BnaA10g00540D                                          223   2e-70   
pdb|3W9R|A  Chain A, Crystal Structure Of The High-affinity Absci...    223   3e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ACF86162.1|  unknown                                                 224   3e-70   Zea mays [maize]
ref|XP_006279661.1|  hypothetical protein CARUB_v10026826mg             227   4e-70   
emb|CDX96197.1|  BnaC02g14540D                                          223   5e-70   
gb|KEH40405.1|  abscisic acid receptor PYL9-like protein                223   6e-70   Medicago truncatula
ref|XP_008437581.1|  PREDICTED: abscisic acid receptor PYL8-like        223   7e-70   Cucumis melo [Oriental melon]
ref|XP_004145925.1|  PREDICTED: abscisic acid receptor PYL8-like        223   7e-70   
ref|XP_006422129.1|  hypothetical protein CICLE_v10005981mg             222   8e-70   Citrus clementina [clementine]
gb|KHN23391.1|  Abscisic acid receptor PYL8                             222   1e-69   Glycine soja [wild soybean]
ref|XP_004951286.1|  PREDICTED: abscisic acid receptor PYL8-like        223   1e-69   Setaria italica
emb|CDY38728.1|  BnaC03g15210D                                          222   1e-69   Brassica napus [oilseed rape]
ref|XP_009421249.1|  PREDICTED: abscisic acid receptor PYL8-like        223   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010433291.1|  PREDICTED: abscisic acid receptor PYL10-like       221   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009413834.1|  PREDICTED: abscisic acid receptor PYL8-like        222   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK26935.1|  hypothetical protein AALP_AA8G312900                    221   1e-69   Arabis alpina [alpine rockcress]
ref|NP_001236049.1|  uncharacterized protein LOC100526923               221   2e-69   Glycine max [soybeans]
ref|XP_010095784.1|  hypothetical protein L484_017591                   222   2e-69   
ref|XP_010533591.1|  PREDICTED: abscisic acid receptor PYL8-like        221   2e-69   
emb|CDY04688.1|  BnaC05g17260D                                          221   2e-69   
ref|XP_009390679.1|  PREDICTED: abscisic acid receptor PYL8-like        221   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
pdb|3RT0|C  Chain C, Crystal Structure Of Pyl10-Hab1 Complex In T...    221   3e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132498.1|  PREDICTED: abscisic acid receptor PYL8             220   3e-69   Brassica rapa
ref|XP_008676769.1|  PREDICTED: uncharacterized protein LOC100272...    221   4e-69   Zea mays [maize]
ref|NP_194521.2|  abscisic acid receptor PYL10                          220   4e-69   Arabidopsis thaliana [mouse-ear cress]
pdb|3UQH|A  Chain A, Crystal Strcuture Of Aba Receptor Pyl10 (Apo)      220   5e-69   Arabidopsis thaliana [mouse-ear cress]
gb|EPS61080.1|  hypothetical protein M569_13720                         220   5e-69   Genlisea aurea
ref|XP_009127190.1|  PREDICTED: abscisic acid receptor PYL8-like        220   6e-69   Brassica rapa
ref|XP_009757093.1|  PREDICTED: abscisic acid receptor PYL9-like        219   6e-69   Nicotiana sylvestris
gb|ACG39386.1|  AT-rich element binding factor 3                        221   6e-69   Zea mays [maize]
ref|XP_002451888.1|  hypothetical protein SORBIDRAFT_04g009280          221   7e-69   Sorghum bicolor [broomcorn]
ref|XP_006647127.1|  PREDICTED: abscisic acid receptor PYL8-like        220   7e-69   Oryza brachyantha
ref|NP_001054923.1|  Os05g0213500                                       220   8e-69   
ref|XP_010413366.1|  PREDICTED: abscisic acid receptor PYL9-like        219   9e-69   Camelina sativa [gold-of-pleasure]
gb|EMS52737.1|  hypothetical protein TRIUR3_23584                       224   9e-69   Triticum urartu
gb|KDP28503.1|  hypothetical protein JCGZ_14274                         219   9e-69   Jatropha curcas
ref|XP_009599268.1|  PREDICTED: abscisic acid receptor PYL9-like        219   9e-69   Nicotiana tomentosiformis
ref|XP_003572108.1|  PREDICTED: abscisic acid receptor PYL8             220   1e-68   Brachypodium distachyon [annual false brome]
ref|XP_011093045.1|  PREDICTED: abscisic acid receptor PYL9-like        218   1e-68   Sesamum indicum [beniseed]
ref|XP_006402457.1|  hypothetical protein EUTSA_v10006254mg             219   2e-68   Eutrema salsugineum [saltwater cress]
emb|CDY49462.1|  BnaA10g06520D                                          218   3e-68   Brassica napus [oilseed rape]
ref|XP_009388314.1|  PREDICTED: abscisic acid receptor PYL8-like        219   3e-68   
ref|XP_010537116.1|  PREDICTED: abscisic acid receptor PYL8-like ...    217   3e-68   Tarenaya hassleriana [spider flower]
ref|XP_010668998.1|  PREDICTED: abscisic acid receptor PYL9-like        217   3e-68   Beta vulgaris subsp. vulgaris [field beet]
emb|CBH19551.1|  polyketide cyclase                                     219   4e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_010512532.1|  PREDICTED: abscisic acid receptor PYL9-like        218   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010469112.1|  PREDICTED: abscisic acid receptor PYL9-like        218   5e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009119857.1|  PREDICTED: abscisic acid receptor PYL8-like        217   6e-68   Brassica rapa
gb|KCW71518.1|  hypothetical protein EUGRSUZ_E00065                     215   7e-68   Eucalyptus grandis [rose gum]
ref|XP_010537114.1|  PREDICTED: abscisic acid receptor PYL8-like ...    218   1e-67   Tarenaya hassleriana [spider flower]
emb|CDY25052.1|  BnaC06g17940D                                          216   2e-67   Brassica napus [oilseed rape]
gb|ACH63237.1|  pathogen-induced protein-like protein                   216   2e-67   Rheum australe [Himalayan rhubarb]
emb|CDY61488.1|  BnaCnng37890D                                          215   3e-67   Brassica napus [oilseed rape]
ref|XP_008461524.1|  PREDICTED: abscisic acid receptor PYL8-like        215   3e-67   Cucumis melo [Oriental melon]
ref|XP_003568737.1|  PREDICTED: abscisic acid receptor PYL8             216   5e-67   Brachypodium distachyon [annual false brome]
emb|CDY64350.1|  BnaA03g12450D                                          215   5e-67   Brassica napus [oilseed rape]
ref|XP_004139662.1|  PREDICTED: abscisic acid receptor PYL8-like        214   8e-67   Cucumis sativus [cucumbers]
gb|EEE62745.1|  hypothetical protein OsJ_17548                          214   9e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002869531.1|  predicted protein                                  214   1e-66   Arabidopsis lyrata subsp. lyrata
emb|CDY70517.1|  BnaCnng68710D                                          214   1e-66   Brassica napus [oilseed rape]
ref|XP_006288718.1|  hypothetical protein CARUB_v10002029mg             214   1e-66   Capsella rubella
ref|XP_004960624.1|  PREDICTED: abscisic acid receptor PYL8-like        214   2e-66   Setaria italica
emb|CDY27022.1|  BnaA02g10420D                                          214   2e-66   Brassica napus [oilseed rape]
ref|XP_006396310.1|  hypothetical protein EUTSA_v10028988mg             214   2e-66   Eutrema salsugineum [saltwater cress]
ref|XP_009134503.1|  PREDICTED: abscisic acid receptor PYL7-like        213   3e-66   Brassica rapa
emb|CDX74368.1|  BnaA03g26790D                                          213   4e-66   
emb|CAB36761.1|  putative protein                                       213   5e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001266502.1|  CAPIP1                                             213   6e-66   
ref|XP_008654596.1|  PREDICTED: uncharacterized protein LOC100273...    212   7e-66   
ref|XP_008437914.1|  PREDICTED: abscisic acid receptor PYL9             212   7e-66   Cucumis melo [Oriental melon]
ref|XP_002875002.1|  hypothetical protein ARALYDRAFT_912134             213   8e-66   Arabidopsis lyrata subsp. lyrata
gb|KFK30677.1|  hypothetical protein AALP_AA6G013900                    212   9e-66   Arabis alpina [alpine rockcress]
gb|ABK23752.1|  unknown                                                 212   1e-65   Picea sitchensis
ref|XP_004133818.1|  PREDICTED: abscisic acid receptor PYL9-like        211   1e-65   Cucumis sativus [cucumbers]
emb|CDX89219.1|  BnaA01g16740D                                          211   1e-65   
ref|XP_010422757.1|  PREDICTED: abscisic acid receptor PYL7-like        211   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010559125.1|  PREDICTED: abscisic acid receptor PYL9-like        210   3e-65   Tarenaya hassleriana [spider flower]
ref|XP_002439456.1|  hypothetical protein SORBIDRAFT_09g006700          211   4e-65   Sorghum bicolor [broomcorn]
ref|XP_002878400.1|  predicted protein                                  210   4e-65   
ref|XP_010427934.1|  PREDICTED: abscisic acid receptor PYL7             210   4e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009389976.1|  PREDICTED: abscisic acid receptor PYL8-like        211   4e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY53905.1|  BnaA07g38130D                                          210   5e-65   Brassica napus [oilseed rape]
gb|AAM65054.1|  unknown                                                 210   8e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001140969.1|  CAPIP1                                             210   8e-65   Zea mays [maize]
ref|NP_567208.1|  abscisic acid receptor PYL7                           210   9e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104333.1|  PREDICTED: abscisic acid receptor PYL9-like        209   9e-65   Brassica rapa
ref|XP_009144044.1|  PREDICTED: abscisic acid receptor PYL10-like       210   1e-64   Brassica rapa
ref|XP_010456196.1|  PREDICTED: abscisic acid receptor PYL7-like        209   1e-64   Camelina sativa [gold-of-pleasure]
gb|AFK34655.1|  unknown                                                 210   2e-64   Lotus japonicus
emb|CDP08696.1|  unnamed protein product                                207   3e-64   Coffea canephora [robusta coffee]
gb|KJB39704.1|  hypothetical protein B456_007G026100                    206   5e-64   Gossypium raimondii
ref|XP_010445584.1|  PREDICTED: abscisic acid receptor PYL8             207   5e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010442871.1|  PREDICTED: abscisic acid receptor PYL8-like        207   5e-64   Camelina sativa [gold-of-pleasure]
emb|CDX91871.1|  BnaC03g31730D                                          207   9e-64   
ref|XP_011462052.1|  PREDICTED: abscisic acid receptor PYL8-like        206   6e-63   Fragaria vesca subsp. vesca
gb|ACL54318.1|  unknown                                                 201   6e-62   Zea mays [maize]
ref|XP_010692257.1|  PREDICTED: abscisic acid receptor PYL8-like        199   5e-61   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO76507.1|  hypothetical protein CISIN_1g028067mg                   191   4e-58   Citrus sinensis [apfelsine]
ref|XP_002982856.1|  hypothetical protein SELMODRAFT_117026             192   5e-58   Selaginella moellendorffii
ref|XP_006439366.1|  hypothetical protein CICLE_v10022206mg             191   7e-58   Citrus clementina [clementine]
ref|XP_010314502.1|  PREDICTED: abscisic acid receptor PYL8-like ...    187   3e-57   
ref|XP_010925746.1|  PREDICTED: abscisic acid receptor PYL8-like ...    189   7e-57   Elaeis guineensis
gb|KCW78164.1|  hypothetical protein EUGRSUZ_D02364                     186   1e-56   Eucalyptus grandis [rose gum]
ref|XP_007140995.1|  hypothetical protein PHAVU_008G158300g             184   1e-55   Phaseolus vulgaris [French bean]
ref|NP_851180.1|  regulatory component of ABA receptor 3                184   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003602206.1|  Abscisic acid receptor PYL8                        182   3e-55   
gb|EAZ01191.1|  hypothetical protein OsI_23218                          185   5e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_011005522.1|  PREDICTED: abscisic acid receptor PYL8-like ...    183   6e-55   Populus euphratica
ref|NP_001057771.1|  Os06g0527800                                       184   1e-54   
gb|KJB74713.1|  hypothetical protein B456_012G003800                    182   1e-54   Gossypium raimondii
ref|NP_001057772.1|  Os06g0528300                                       184   1e-54   
gb|KCW78163.1|  hypothetical protein EUGRSUZ_D02364                     182   2e-54   Eucalyptus grandis [rose gum]
gb|EAZ01188.1|  hypothetical protein OsI_23215                          183   3e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_010485096.1|  PREDICTED: abscisic acid receptor PYL8-like        180   6e-54   Camelina sativa [gold-of-pleasure]
gb|KJB52579.1|  hypothetical protein B456_008G270200                    180   9e-54   Gossypium raimondii
gb|EMT05290.1|  hypothetical protein F775_08513                         181   2e-53   
gb|EPS66033.1|  hypothetical protein M569_08746                         179   2e-53   Genlisea aurea
ref|XP_006657015.1|  PREDICTED: abscisic acid receptor PYL8-like        180   3e-53   Oryza brachyantha
gb|KJB37345.1|  hypothetical protein B456_006G200700                    177   5e-53   Gossypium raimondii
ref|XP_002894315.1|  predicted protein                                  178   1e-52   
gb|EMS51657.1|  hypothetical protein TRIUR3_18714                       175   3e-51   Triticum urartu
ref|XP_002969013.1|  hypothetical protein SELMODRAFT_231224             174   3e-51   
ref|XP_011457407.1|  PREDICTED: abscisic acid receptor PYL8-like        172   2e-50   Fragaria vesca subsp. vesca
gb|EYU32227.1|  hypothetical protein MIMGU_mgv1a026086mg                169   1e-49   Erythranthe guttata [common monkey flower]
ref|NP_001140789.1|  uncharacterized protein LOC100272864               170   3e-49   Zea mays [maize]
gb|EEE65809.1|  hypothetical protein OsJ_21539                          166   5e-48   Oryza sativa Japonica Group [Japonica rice]
gb|AFW82111.1|  hypothetical protein ZEAMMB73_305823                    163   2e-47   
gb|ABK22940.1|  unknown                                                 165   3e-47   Picea sitchensis
ref|NP_001141578.1|  uncharacterized protein LOC100273694               163   6e-47   
ref|XP_006413012.1|  hypothetical protein EUTSA_v10026943mg             162   9e-47   
ref|XP_004149460.1|  PREDICTED: abscisic acid receptor PYL8-like ...    160   4e-46   
ref|XP_008668979.1|  PREDICTED: abscisic acid receptor PYL9-like        159   7e-46   
emb|CAB45785.1|  putative protein                                       172   2e-45   
tpg|DAA36292.1|  TPA: hypothetical protein ZEAMMB73_847233              161   6e-45   
ref|XP_006648510.1|  PREDICTED: abscisic acid receptor PYL8-like        156   4e-44   
dbj|BAD29692.1|  Bet v I allergen-like                                  154   2e-43   
gb|EEE56680.1|  hypothetical protein OsJ_06123                          154   3e-43   
ref|XP_001762113.1|  predicted protein                                  153   9e-43   
gb|ADE76473.1|  unknown                                                 152   2e-42   
ref|XP_001778048.1|  predicted protein                                  150   5e-42   
ref|XP_006356474.1|  PREDICTED: abscisic acid receptor PYL4-like        151   5e-42   
ref|XP_004235232.1|  PREDICTED: abscisic acid receptor PYL4-like        151   6e-42   
gb|EEC72859.1|  hypothetical protein OsI_06615                          150   7e-42   
ref|XP_009384785.1|  PREDICTED: abscisic acid receptor PYL4-like        150   1e-41   
ref|XP_009402223.1|  PREDICTED: abscisic acid receptor PYL4-like        150   2e-41   
ref|XP_002264158.1|  PREDICTED: abscisic acid receptor PYL4             150   3e-41   
dbj|BAD46117.1|  Bet v I allergen-like                                  147   3e-41   
ref|XP_010264535.1|  PREDICTED: abscisic acid receptor PYL4             149   4e-41   
gb|ACG26321.1|  AT-rich element binding factor 3                        149   4e-41   
ref|NP_001147241.1|  AT-rich element binding factor 3                   149   5e-41   
ref|XP_004984885.1|  PREDICTED: abscisic acid receptor PYL4-like        149   6e-41   
ref|XP_010257037.1|  PREDICTED: abscisic acid receptor PYL4             149   7e-41   
ref|XP_002963288.1|  hypothetical protein SELMODRAFT_80077              147   1e-40   
ref|XP_009776819.1|  PREDICTED: abscisic acid receptor PYL2-like        147   2e-40   
ref|NP_001169534.1|  hypothetical protein                               147   2e-40   
ref|XP_009376394.1|  PREDICTED: abscisic acid receptor PYL4-like        147   2e-40   
ref|XP_006450814.1|  hypothetical protein CICLE_v10010262mg             146   3e-40   
gb|KDO80051.1|  hypothetical protein CISIN_1g046697mg                   146   3e-40   
ref|XP_006828124.1|  hypothetical protein AMTR_s00023p00037680          146   4e-40   
ref|XP_006360983.1|  PREDICTED: abscisic acid receptor PYL2-like        145   5e-40   
tpg|DAA57022.1|  TPA: hypothetical protein ZEAMMB73_923269              147   5e-40   
ref|XP_011081692.1|  PREDICTED: abscisic acid receptor PYL2             145   1e-39   
ref|XP_004148626.1|  PREDICTED: abscisic acid receptor PYL4-like        145   1e-39   
ref|XP_004291031.1|  PREDICTED: abscisic acid receptor PYL2             145   1e-39   
ref|XP_011095066.1|  PREDICTED: abscisic acid receptor PYL4             145   1e-39   
emb|CAI84653.1|  hypothetical protein                                   145   2e-39   
gb|KDP22835.1|  hypothetical protein JCGZ_00422                         145   2e-39   
ref|XP_003538484.2|  PREDICTED: abscisic acid receptor PYL4-like        146   2e-39   
ref|XP_009788171.1|  PREDICTED: abscisic acid receptor PYL4-like        145   2e-39   
gb|AFW84712.1|  AT-rich element binding factor 3                        147   2e-39   
gb|KHN37022.1|  Abscisic acid receptor PYL2                             144   2e-39   
ref|XP_003549356.1|  PREDICTED: abscisic acid receptor PYL2-like        144   2e-39   
ref|XP_008220457.1|  PREDICTED: abscisic acid receptor PYL2             144   2e-39   
ref|XP_001767821.1|  predicted protein                                  145   3e-39   
dbj|BAJ92835.1|  predicted protein                                      143   3e-39   
ref|XP_008464227.1|  PREDICTED: abscisic acid receptor PYL4             144   4e-39   
ref|XP_006359557.1|  PREDICTED: abscisic acid receptor PYL4-like        144   4e-39   
ref|XP_003519420.1|  PREDICTED: abscisic acid receptor PYL4-like        144   6e-39   
ref|XP_006363617.1|  PREDICTED: abscisic acid receptor PYL4-like        144   6e-39   
ref|XP_010031164.1|  PREDICTED: abscisic acid receptor PYL4-like        144   7e-39   
ref|XP_007008854.1|  Polyketide cyclase/dehydrase and lipid trans...    143   8e-39   
ref|XP_009589506.1|  PREDICTED: abscisic acid receptor PYL4-like        143   8e-39   
ref|XP_006342700.1|  PREDICTED: abscisic acid receptor PYL2-like        142   1e-38   
gb|AEW08235.1|  hypothetical protein 2_3824_01                          141   1e-38   
ref|XP_010529063.1|  PREDICTED: abscisic acid receptor PYL4-like        143   1e-38   
ref|XP_008243023.1|  PREDICTED: abscisic acid receptor PYL4             143   1e-38   
ref|XP_004498910.1|  PREDICTED: abscisic acid receptor PYL2-like        142   2e-38   
gb|KJB74359.1|  hypothetical protein B456_011G290300                    142   2e-38   
ref|XP_009788695.1|  PREDICTED: abscisic acid receptor PYL4-like        142   2e-38   
ref|XP_008452707.1|  PREDICTED: abscisic acid receptor PYL2 isofo...    142   2e-38   
ref|XP_009408881.1|  PREDICTED: abscisic acid receptor PYL2-like        142   2e-38   
ref|XP_009624074.1|  PREDICTED: abscisic acid receptor PYL4-like        142   2e-38   
ref|XP_008370174.1|  PREDICTED: abscisic acid receptor PYL4-like        142   2e-38   
ref|XP_004253195.1|  PREDICTED: abscisic acid receptor PYL2-like        142   2e-38   
ref|XP_010931296.1|  PREDICTED: abscisic acid receptor PYL4-like        142   2e-38   
ref|XP_008793174.1|  PREDICTED: abscisic acid receptor PYL2             141   2e-38   
ref|XP_003623366.1|  Abscisic acid receptor PYL4                        141   2e-38   
ref|XP_004249671.1|  PREDICTED: abscisic acid receptor PYL4             142   2e-38   
ref|XP_011046813.1|  PREDICTED: abscisic acid receptor PYL4             142   3e-38   
ref|XP_004491006.1|  PREDICTED: abscisic acid receptor PYL4-like        142   3e-38   
dbj|BAK07716.1|  predicted protein                                      142   3e-38   
ref|XP_004148169.1|  PREDICTED: abscisic acid receptor PYL4-like        142   3e-38   
ref|XP_004164703.1|  PREDICTED: abscisic acid receptor PYL4-like        142   3e-38   
ref|XP_010676816.1|  PREDICTED: abscisic acid receptor PYL4             142   3e-38   
ref|XP_010262194.1|  PREDICTED: abscisic acid receptor PYL2-like        141   3e-38   
gb|AIA57775.1|  pyrabactin resistance 1-like 5                          142   3e-38   
ref|XP_004500520.1|  PREDICTED: abscisic acid receptor PYL4-like        141   3e-38   
gb|KDP44699.1|  hypothetical protein JCGZ_01199                         142   3e-38   
ref|XP_006428417.1|  hypothetical protein CICLE_v10012769mg             141   4e-38   
gb|KJB36968.1|  hypothetical protein B456_006G185000                    142   4e-38   
ref|XP_002456569.1|  hypothetical protein SORBIDRAFT_03g038600          142   4e-38   
ref|XP_009766300.1|  PREDICTED: abscisic acid receptor PYL4-like        142   4e-38   
ref|NP_001136477.1|  hypothetical protein                               141   4e-38   
ref|XP_008442372.1|  PREDICTED: abscisic acid receptor PYL4-like        141   4e-38   
ref|XP_010937948.1|  PREDICTED: abscisic acid receptor PYL4-like        142   5e-38   
gb|AHA94927.1|  pyrabactin resistance 1-like protein 5                  141   5e-38   
ref|XP_002324762.2|  Bet 5 1 allergen family protein                    140   5e-38   
ref|XP_009631065.1|  PREDICTED: abscisic acid receptor PYL2-like        140   6e-38   
gb|AIA57774.1|  pyrabactin resistance 1-like 5                          141   6e-38   
ref|XP_008454842.1|  PREDICTED: abscisic acid receptor PYL4             142   6e-38   
ref|XP_006338971.1|  PREDICTED: abscisic acid receptor PYL4-like        141   6e-38   
ref|XP_009757212.1|  PREDICTED: abscisic acid receptor PYL2-like        140   6e-38   
ref|XP_007225598.1|  hypothetical protein PRUPE_ppa027232mg             139   6e-38   
ref|XP_003545372.1|  PREDICTED: abscisic acid receptor PYL2-like        141   7e-38   
ref|XP_010648333.1|  PREDICTED: abscisic acid receptor PYL2             140   7e-38   
ref|XP_002992747.1|  hypothetical protein SELMODRAFT_135818             142   7e-38   
ref|XP_004249065.1|  PREDICTED: abscisic acid receptor PYL4-like        140   7e-38   
ref|XP_009628019.1|  PREDICTED: abscisic acid receptor PYL4-like        142   7e-38   
ref|XP_002323024.1|  hypothetical protein POPTR_0016s13320g             141   7e-38   
ref|XP_007141731.1|  hypothetical protein PHAVU_008G220600g             140   8e-38   
ref|XP_008804142.1|  PREDICTED: abscisic acid receptor PYL4-like        140   8e-38   
dbj|BAJ93794.1|  predicted protein                                      140   8e-38   
ref|XP_009778521.1|  PREDICTED: abscisic acid receptor PYL4-like        140   8e-38   
ref|XP_004246292.1|  PREDICTED: abscisic acid receptor PYL4-like        140   9e-38   
ref|XP_001767012.1|  predicted protein                                  140   9e-38   
ref|XP_009625252.1|  PREDICTED: abscisic acid receptor PYL4-like        140   1e-37   
ref|XP_003544050.1|  PREDICTED: abscisic acid receptor PYL4-like        140   1e-37   
ref|XP_009337722.1|  PREDICTED: abscisic acid receptor PYL4-like        140   1e-37   
ref|XP_007026589.1|  Polyketide cyclase/dehydrase and lipid trans...    140   1e-37   
ref|XP_009614897.1|  PREDICTED: abscisic acid receptor PYL2-like        139   1e-37   
ref|XP_004156626.1|  PREDICTED: abscisic acid receptor PYL4-like        140   1e-37   
ref|XP_004137696.1|  PREDICTED: abscisic acid receptor PYL4-like        140   1e-37   
ref|XP_002993574.1|  hypothetical protein SELMODRAFT_49053              138   1e-37   
gb|AGV54213.1|  abscisic acid receptor PYL2                             139   2e-37   
ref|XP_007136822.1|  hypothetical protein PHAVU_009G077200g             139   2e-37   
ref|XP_008776287.1|  PREDICTED: abscisic acid receptor PYL4-like        140   2e-37   
ref|XP_011019068.1|  PREDICTED: abscisic acid receptor PYL4-like        140   2e-37   
gb|AHV90409.1|  abscisic acid receptor PYL3                             139   2e-37   
ref|XP_010922628.1|  PREDICTED: abscisic acid receptor PYL4             140   2e-37   
ref|XP_002520792.1|  conserved hypothetical protein                     140   2e-37   
gb|KJB60736.1|  hypothetical protein B456_009G323000                    140   2e-37   
ref|XP_002308236.2|  hypothetical protein POPTR_0006s10500g             140   2e-37   
ref|XP_007148044.1|  hypothetical protein PHAVU_006G175700g             139   2e-37   
ref|XP_002465407.1|  hypothetical protein SORBIDRAFT_01g038150          140   2e-37   
ref|XP_004516408.1|  PREDICTED: abscisic acid receptor PYL9-like ...    137   2e-37   
ref|NP_001049838.1|  Os03g0297600                                       140   2e-37   
ref|XP_008371472.1|  PREDICTED: abscisic acid receptor PYL12-like       139   2e-37   
ref|XP_009757566.1|  PREDICTED: abscisic acid receptor PYL4-like        140   2e-37   
ref|XP_009381216.1|  PREDICTED: abscisic acid receptor PYL2-like        139   2e-37   
ref|XP_008465973.1|  PREDICTED: abscisic acid receptor PYR1             140   3e-37   
ref|XP_008441480.1|  PREDICTED: abscisic acid receptor PYL4-like        139   3e-37   
ref|XP_007205946.1|  hypothetical protein PRUPE_ppa011811mg             139   3e-37   
gb|AIX10776.1|  ABA receptor 6                                          139   3e-37   
gb|EAY89631.1|  hypothetical protein OsI_11160                          139   3e-37   
gb|KJB67519.1|  hypothetical protein B456_010G194800                    139   4e-37   
ref|XP_003527747.1|  PREDICTED: abscisic acid receptor PYL2-like        138   4e-37   
ref|XP_011015347.1|  PREDICTED: abscisic acid receptor PYL4-like        139   4e-37   
ref|XP_002526675.1|  conserved hypothetical protein                     139   4e-37   
emb|CDP08244.1|  unnamed protein product                                138   4e-37   
ref|XP_010067564.1|  PREDICTED: abscisic acid receptor PYL4             140   5e-37   
ref|XP_008799865.1|  PREDICTED: abscisic acid receptor PYL4             139   5e-37   
ref|XP_011097052.1|  PREDICTED: abscisic acid receptor PYL2-like        138   5e-37   
ref|XP_003543001.1|  PREDICTED: abscisic acid receptor PYL6-like        138   5e-37   
gb|KDO68852.1|  hypothetical protein CISIN_1g038201mg                   138   6e-37   
emb|CDP13968.1|  unnamed protein product                                139   6e-37   
ref|XP_009359027.1|  PREDICTED: abscisic acid receptor PYL2-like        138   6e-37   
ref|XP_006288690.1|  hypothetical protein CARUB_v10002000mg             138   6e-37   
gb|ACU24180.1|  unknown                                                 137   6e-37   
ref|XP_008452706.1|  PREDICTED: abscisic acid receptor PYL2 isofo...    137   6e-37   
ref|XP_006435818.1|  hypothetical protein CICLE_v10032781mg             138   7e-37   
emb|CDO96802.1|  unnamed protein product                                137   7e-37   
ref|XP_004506801.1|  PREDICTED: abscisic acid receptor PYL4-like        138   7e-37   
gb|EAY76350.1|  hypothetical protein OsI_04285                          138   8e-37   
emb|CDP13024.1|  unnamed protein product                                139   8e-37   
ref|XP_002519819.1|  conserved hypothetical protein                     138   8e-37   
ref|XP_004970455.1|  PREDICTED: abscisic acid receptor PYL5-like        138   9e-37   
pdb|3NJ1|A  Chain A, X-Ray Crystal Structure Of The Pyl2(V114i)-P...    137   9e-37   
ref|XP_009347384.1|  PREDICTED: abscisic acid receptor PYR1-like        138   9e-37   
ref|XP_007012262.1|  PYR1-like 2                                        137   9e-37   
ref|XP_003523641.1|  PREDICTED: abscisic acid receptor PYL2-like        137   9e-37   
ref|XP_009626887.1|  PREDICTED: abscisic acid receptor PYL4-like        138   1e-36   
dbj|BAB68102.1|  Bet v I allergen-like                                  137   1e-36   
pdb|3KAZ|A  Chain A, Crystal Structure Of Abscisic Acid Receptor ...    137   1e-36   
gb|EMT07247.1|  hypothetical protein F775_09569                         137   1e-36   
pdb|3UJL|A  Chain A, Crystal Structure Of Abscisic Acid Bound Pyl...    137   1e-36   
ref|NP_180174.1|  abscisic acid receptor PYL2                           137   1e-36   
pdb|3NMH|A  Chain A, Crystal Structure Of The Abscisic Receptor P...    137   1e-36   
gb|EPS62137.1|  hypothetical protein M569_12657                         136   1e-36   
ref|XP_004138413.1|  PREDICTED: abscisic acid receptor PYL4-like        137   1e-36   
ref|XP_010277013.1|  PREDICTED: abscisic acid receptor PYL12-like       137   1e-36   
pdb|3NJ0|A  Chain A, X-Ray Crystal Structure Of The Pyl2-Pyrabact...    137   1e-36   
ref|XP_002516457.1|  conserved hypothetical protein                     137   1e-36   
ref|XP_002879739.1|  hypothetical protein ARALYDRAFT_903051             137   2e-36   
ref|XP_007134658.1|  hypothetical protein PHAVU_010G065400g             137   2e-36   
ref|XP_006296155.1|  hypothetical protein CARUB_v10025307mg             137   2e-36   
ref|NP_565887.1|  abscisic acid receptor PYL4                           137   2e-36   
ref|XP_010509188.1|  PREDICTED: abscisic acid receptor PYL4-like        137   2e-36   
emb|CDX91449.1|  BnaC04g07010D                                          137   2e-36   
ref|XP_008792174.1|  PREDICTED: abscisic acid receptor PYL4-like        137   2e-36   
ref|XP_007163581.1|  hypothetical protein PHAVU_001G246300g             137   2e-36   
ref|XP_010104305.1|  hypothetical protein L484_023255                   137   2e-36   
gb|EYU41948.1|  hypothetical protein MIMGU_mgv1a013808mg                137   2e-36   
ref|XP_006411045.1|  hypothetical protein EUTSA_v10017727mg             137   2e-36   
ref|XP_004961771.1|  PREDICTED: abscisic acid receptor PYL4-like        137   2e-36   
ref|XP_010921031.1|  PREDICTED: abscisic acid receptor PYL4-like        137   2e-36   
gb|EPS65339.1|  hypothetical protein M569_09438                         136   2e-36   
ref|XP_010553229.1|  PREDICTED: abscisic acid receptor PYL4-like ...    137   3e-36   
ref|XP_003589025.1|  Abscisic acid receptor PYL2                        136   3e-36   
ref|XP_009589421.1|  PREDICTED: abscisic acid receptor PYL4-like        137   3e-36   
ref|XP_008351952.1|  PREDICTED: abscisic acid receptor PYL2-like        136   3e-36   
ref|XP_007156433.1|  hypothetical protein PHAVU_003G285500g             138   3e-36   
gb|AES59276.2|  abscisic acid receptor                                  136   3e-36   
ref|XP_004245893.1|  PREDICTED: abscisic acid receptor PYR1-like        137   4e-36   
ref|NP_196163.1|  abscisic acid receptor PYL5                           136   4e-36   
ref|XP_007160995.1|  hypothetical protein PHAVU_001G034300g             135   4e-36   
ref|XP_002871158.1|  hypothetical protein ARALYDRAFT_325175             136   4e-36   
ref|XP_008238258.1|  PREDICTED: abscisic acid receptor PYR1 isofo...    136   4e-36   
ref|XP_006399005.1|  hypothetical protein EUTSA_v10014719mg             136   4e-36   
ref|XP_010505454.1|  PREDICTED: abscisic acid receptor PYL4-like        136   4e-36   
ref|XP_004141422.1|  PREDICTED: abscisic acid receptor PYL2-like        135   5e-36   
ref|XP_010925493.1|  PREDICTED: abscisic acid receptor PYL2-like        135   5e-36   
ref|XP_010452446.1|  PREDICTED: abscisic acid receptor PYL5             136   5e-36   
ref|XP_008377517.1|  PREDICTED: abscisic acid receptor PYL2             135   5e-36   
ref|XP_010517123.1|  PREDICTED: abscisic acid receptor PYL4             136   5e-36   
ref|XP_006353422.1|  PREDICTED: abscisic acid receptor PYL4-like ...    136   5e-36   
ref|XP_009361763.1|  PREDICTED: abscisic acid receptor PYL2             135   5e-36   
ref|XP_006853814.1|  hypothetical protein AMTR_s00056p00227590          136   5e-36   
gb|KJB27260.1|  hypothetical protein B456_004G287300                    135   5e-36   
ref|XP_010491076.1|  PREDICTED: abscisic acid receptor PYL5-like        135   6e-36   
ref|XP_008343633.1|  PREDICTED: abscisic acid receptor PYL4-like        135   6e-36   
pdb|4JDL|A  Chain A, Crystal Structure Of Native Abscisic Acid Re...    136   6e-36   
ref|XP_004302617.1|  PREDICTED: abscisic acid receptor PYL4             136   6e-36   
ref|XP_003551573.1|  PREDICTED: abscisic acid receptor PYL4-like        135   6e-36   
ref|XP_004492494.1|  PREDICTED: abscisic acid receptor PYL4-like        135   6e-36   
emb|CDY54453.1|  BnaAnng13200D                                          135   6e-36   
gb|ABR25904.1|  capip1                                                  132   6e-36   
ref|XP_011084867.1|  PREDICTED: abscisic acid receptor PYL4-like        135   7e-36   
ref|NP_001284559.1|  abscisic acid receptor PYL1-like                   136   7e-36   
ref|XP_003558125.1|  PREDICTED: abscisic acid receptor PYL4-like        136   8e-36   
ref|XP_008341960.1|  PREDICTED: abscisic acid receptor PYR1-like        135   9e-36   
ref|XP_003600988.1|  Abscisic acid receptor PYL6                        136   9e-36   
pdb|3NMP|A  Chain A, Crystal Structure Of The Abscisic Receptor P...    134   9e-36   
gb|AFK45734.1|  unknown                                                 136   1e-35   



>ref|XP_006343869.1| PREDICTED: abscisic acid receptor PYL9-like [Solanum tuberosum]
 gb|AHA43411.1| abscisic acid receptor PYL9-like protein [Solanum nigrum]
Length=189

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  147  AGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKP  326
              +MN DR+   EDEYIRRHH+H+VR+NQCSS LVKHI+APVHLVWSLVRRFDQPQRYKP
Sbjct  2    VSIMNVDRKISSEDEYIRRHHRHDVRDNQCSSSLVKHIKAPVHLVWSLVRRFDQPQRYKP  61

Query  327  FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDD+HI  ++IVGGDHRLRNY+S
Sbjct  62   FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDKHIFGVKIVGGDHRLRNYSS  121

Query  507  IVTVHPEIIDGRPGTLVIESFVV  575
            I+TVHPE+IDGRPGT+V+ESFVV
Sbjct  122  IITVHPEVIDGRPGTMVVESFVV  144



>ref|XP_004245523.1| PREDICTED: abscisic acid receptor PYL9 [Solanum lycopersicum]
Length=189

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  147  AGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKP  326
              +MN DR+   EDEYIRRHH+H+VR+NQCSS LVKHI+APVHLVWSLVRRFDQPQRYKP
Sbjct  2    VSIMNVDRKISSEDEYIRRHHRHDVRDNQCSSSLVKHIKAPVHLVWSLVRRFDQPQRYKP  61

Query  327  FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHI  ++IVGGDHRLRNY+S
Sbjct  62   FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHIFGVKIVGGDHRLRNYSS  121

Query  507  IVTVHPEIIDGRPGTLVIESFVV  575
            I+TVHP++IDGRPGT+V+ESFVV
Sbjct  122  IITVHPKVIDGRPGTMVVESFVV  144



>gb|KJB39701.1| hypothetical protein B456_007G026100 [Gossypium raimondii]
 gb|KJB39702.1| hypothetical protein B456_007G026100 [Gossypium raimondii]
 gb|KJB39705.1| hypothetical protein B456_007G026100 [Gossypium raimondii]
Length=193

 Score =   256 bits (654),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+R + VE+E+I+++HKH+V+ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  9    MNGNRFTKVEEEFIKKYHKHDVKENQCSSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVS  68

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC++QGDL+IGSVREVNVKSGLPATTS ERLE LDDDEHILSMRIVGGDHRL+NY+SIVT
Sbjct  69   RCVLQGDLQIGSVREVNVKSGLPATTSTERLEYLDDDEHILSMRIVGGDHRLKNYSSIVT  128

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHP++IDGRPGTLVIESFVV
Sbjct  129  VHPKVIDGRPGTLVIESFVV  148



>ref|XP_007040497.1| Regulatory components of ABA receptor 3 [Theobroma cacao]
 gb|EOY24998.1| Regulatory components of ABA receptor 3 [Theobroma cacao]
Length=193

 Score =   256 bits (653),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+  S +E+E+I+RHHKH+V+ENQC+S LVKHI+AP+HLVWSLVRRFDQPQ+YKPFVS
Sbjct  9    MNGNGFSKMEEEFIKRHHKHDVKENQCTSSLVKHIKAPIHLVWSLVRRFDQPQKYKPFVS  68

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQGDL+IGSVREVNVKSGLPATTS ERLE LDDDEHILSM+IVGGDHRL+NY+SIVT
Sbjct  69   RCVVQGDLQIGSVREVNVKSGLPATTSTERLEYLDDDEHILSMKIVGGDHRLKNYSSIVT  128

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE+IDGRPGTLVIESFVV
Sbjct  129  VHPEVIDGRPGTLVIESFVV  148



>ref|XP_010659134.1| PREDICTED: abscisic acid receptor PYL8-like [Vitis vinifera]
Length=189

 Score =   253 bits (646),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  150  GMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPF  329
             MM+G     +EDEYIRRHH+HE+R+NQCSS LVKHI+APVHLVWSLVR FDQPQ+YKPF
Sbjct  3    AMMSGYGCIKMEDEYIRRHHRHEIRDNQCSSSLVKHIKAPVHLVWSLVRSFDQPQKYKPF  62

Query  330  VSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSI  509
            VSRCIVQGDLEIGSVREVNVKSGLPATTS ERLELLDD+EHI  MRIVGGDHRL+NY+SI
Sbjct  63   VSRCIVQGDLEIGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLKNYSSI  122

Query  510  VTVHPEIIDGRPGTLVIESFVV  575
            VTVHPEIIDGRPGTLVIESFVV
Sbjct  123  VTVHPEIIDGRPGTLVIESFVV  144



>gb|KHG27844.1| Abscisic acid receptor PYL8 -like protein [Gossypium arboreum]
Length=193

 Score =   253 bits (646),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+R + VE+E+I+++HKH+V+ENQCSS LVKHI+APVHLVWSLVRRFD+PQ+YKPFVS
Sbjct  9    MNGNRFTKVEEEFIKKYHKHDVKENQCSSSLVKHIKAPVHLVWSLVRRFDEPQKYKPFVS  68

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC++QGDL+IGSVREVNVKSGLPATTS ERLE LDDD+HILSMRIVGGDHRL+NY+SIVT
Sbjct  69   RCVLQGDLQIGSVREVNVKSGLPATTSTERLEYLDDDKHILSMRIVGGDHRLKNYSSIVT  128

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHP++IDGRPGTLVIESFVV
Sbjct  129  VHPKVIDGRPGTLVIESFVV  148



>ref|XP_009603677.1| PREDICTED: abscisic acid receptor PYL9-like [Nicotiana tomentosiformis]
Length=187

 Score =   251 bits (642),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +3

Query  171  RSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQ  350
            RS  ED+YIRRHH+H++RENQCSS LVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQ
Sbjct  8    RSSSEDDYIRRHHRHDIRENQCSSSLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQ  67

Query  351  GDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEI  530
            GDLEIGSVREVNVKSGLPATTSKERLELL+D+EHI  ++IVGGDHRLRNY+SI+TVHPE+
Sbjct  68   GDLEIGSVREVNVKSGLPATTSKERLELLNDEEHIFGVKIVGGDHRLRNYSSIITVHPEV  127

Query  531  IDGRPGTLVIESFVV  575
            IDGRPGT+VIESFVV
Sbjct  128  IDGRPGTMVIESFVV  142



>gb|KHG11909.1| Abscisic acid receptor PYL8 -like protein [Gossypium arboreum]
Length=193

 Score =   251 bits (642),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+  S +E+E+I+R+HK EV+ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  9    MNGNGFSKMEEEFIKRYHKLEVKENQCSSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVS  68

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQGDL++GSVREVNVKSGLPATTS ERLE LDDDEHILSM IVGGDHRL+NY+SIVT
Sbjct  69   RCVVQGDLQVGSVREVNVKSGLPATTSTERLEYLDDDEHILSMTIVGGDHRLKNYSSIVT  128

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE+IDGRPGTLVIESFVV
Sbjct  129  VHPEVIDGRPGTLVIESFVV  148



>ref|XP_011101032.1| PREDICTED: abscisic acid receptor PYL8-like [Sesamum indicum]
Length=190

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 134/141 (95%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNGDRRSD-VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MNGDRR+   E+++IRRHHKH+VRENQC+S LVKHI+AP+ LVWSLVRRFDQPQRYKPFV
Sbjct  5    MNGDRRTGGPEEDFIRRHHKHDVRENQCTSSLVKHIKAPLPLVWSLVRRFDQPQRYKPFV  64

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCIVQGDL+IG+VREVNVKSGLPATTSKERLELLDD+EHI SMRIVGGDHRL+NY+S +
Sbjct  65   SRCIVQGDLQIGTVREVNVKSGLPATTSKERLELLDDEEHIFSMRIVGGDHRLKNYSSTI  124

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPEIIDGRPGT+VIESFVV
Sbjct  125  TVHPEIIDGRPGTMVIESFVV  145



>ref|XP_007135240.1| hypothetical protein PHAVU_010G112500g [Phaseolus vulgaris]
 gb|AFW90514.1| pathogenesis-induced protein [Phaseolus vulgaris]
 gb|ESW07234.1| hypothetical protein PHAVU_010G112500g [Phaseolus vulgaris]
Length=185

 Score =   251 bits (640),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MMNGD R  +E +YIRRHH+HE RENQC+S LVKHI+APVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MMNGDSRGALEAQYIRRHHRHEPRENQCTSALVKHIKAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCI+QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHIL +RIVGGDHRLRNY+SI+
Sbjct  61   SRCIMQGDLGIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIRIVGGDHRLRNYSSII  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+I+GRPGT+VIESFVV
Sbjct  121  TVHPEVIEGRPGTMVIESFVV  141



>emb|CBI34472.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   250 bits (638),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            M+G     +EDEYIRRHH+HE+R+NQCSS LVKHI+APVHLVWSLVR FDQPQ+YKPFVS
Sbjct  1    MSGYGCIKMEDEYIRRHHRHEIRDNQCSSSLVKHIKAPVHLVWSLVRSFDQPQKYKPFVS  60

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RCIVQGDLEIGSVREVNVKSGLPATTS ERLELLDD+EHI  MRIVGGDHRL+NY+SIVT
Sbjct  61   RCIVQGDLEIGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLKNYSSIVT  120

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPEIIDGRPGTLVIESFVV
Sbjct  121  VHPEIIDGRPGTLVIESFVV  140



>ref|XP_010261534.1| PREDICTED: abscisic acid receptor PYL8-like [Nelumbo nucifera]
Length=185

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+  S +E EYI RHH+HE ++NQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPF+S
Sbjct  1    MNGNGYSRMEAEYIWRHHRHETKDNQCSSALVKHIKAPVHLVWSLVRRFDQPQKYKPFIS  60

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQGDLEIGSVREVNVKSGLPATTS ERLELLDD+EHILS+RIVGGDHRLRNY+SI+T
Sbjct  61   RCVVQGDLEIGSVREVNVKSGLPATTSTERLELLDDEEHILSIRIVGGDHRLRNYSSIIT  120

Query  516  VHPEIIDGRPGTLVIESFVV  575
            +HPE+I+GRPGTLVIESFVV
Sbjct  121  LHPEVIEGRPGTLVIESFVV  140



>gb|KDP25308.1| hypothetical protein JCGZ_20464 [Jatropha curcas]
Length=193

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            +N +  S +ED+YIRRHHKHEV+++QCSS LVKHI+APVHLVWSLVRRFDQPQRYKPF+S
Sbjct  9    VNSNAFSKMEDDYIRRHHKHEVKDHQCSSSLVKHIKAPVHLVWSLVRRFDQPQRYKPFIS  68

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RCIVQGDL+IGSVREVNVKSGLPATTS ERLELLDD+EHI  M IVGGDHRL+NY+SIVT
Sbjct  69   RCIVQGDLQIGSVREVNVKSGLPATTSTERLELLDDEEHIFRMTIVGGDHRLKNYSSIVT  128

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE++DGRPGT+VIESFVV
Sbjct  129  VHPEVVDGRPGTMVIESFVV  148



>gb|KJB52278.1| hypothetical protein B456_008G253700 [Gossypium raimondii]
 gb|KJB52279.1| hypothetical protein B456_008G253700 [Gossypium raimondii]
Length=193

 Score =   248 bits (634),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+  S   +E+I+R+HK EV+ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  9    MNGNGSSKRAEEFIKRYHKLEVKENQCSSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVS  68

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQGDL++GSVREVNVKSGLPATTS ERLE LDDDEHILSM IVGGDHRL+NY+SIVT
Sbjct  69   RCVVQGDLQVGSVREVNVKSGLPATTSTERLEYLDDDEHILSMTIVGGDHRLKNYSSIVT  128

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE+IDGRPGTLVIESFVV
Sbjct  129  VHPEVIDGRPGTLVIESFVV  148



>gb|AAT35532.1| CAPIP1 [Capsicum annuum]
Length=186

 Score =   248 bits (634),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MMN +  S VE EYIR+HH H+ +ENQCSS LVKHIRAPVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MMNANGFSGVEKEYIRKHHLHQPKENQCSSFLVKHIRAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCI QGDLEIGS+REV+VKSGLPATTS ERLELLDD+EHILS RI+GGDHRLRNY+SI+
Sbjct  61   SRCIAQGDLEIGSLREVDVKSGLPATTSTERLELLDDEEHILSFRIIGGDHRLRNYSSII  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            ++HPE+IDGRPGTLVIESFVV
Sbjct  121  SLHPEVIDGRPGTLVIESFVV  141



>ref|XP_009769460.1| PREDICTED: abscisic acid receptor PYL9-like [Nicotiana sylvestris]
Length=187

 Score =   248 bits (633),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            ED+YIRRHH+H+VR+NQCSS LVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE
Sbjct  12   EDDYIRRHHRHDVRDNQCSSSLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  71

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGR  542
            IGSVREVNVKSGLPATTSKERLELL+D+EHI  ++IVGGDHRLRNY+SI+TVHPE+IDGR
Sbjct  72   IGSVREVNVKSGLPATTSKERLELLNDEEHIFGVKIVGGDHRLRNYSSIITVHPEVIDGR  131

Query  543  PGTLVIESFVV  575
            PGT+VIESFVV
Sbjct  132  PGTMVIESFVV  142



>emb|CAN64668.1| hypothetical protein VITISV_029498 [Vitis vinifera]
Length=176

 Score =   247 bits (630),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+  S +E EYIRRHH+HE  ENQCSS LVKHI+APV LVWSLVRRFDQPQ+YKPF+S
Sbjct  1    MNGNGLSSMESEYIRRHHRHEPAENQCSSALVKHIKAPVPLVWSLVRRFDQPQKYKPFIS  60

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQG+LEIGS+REV+VKSGLPATTS ERLELLDDDEHILSMRI+GGDHRLRNY+SI++
Sbjct  61   RCVVQGNLEIGSLREVDVKSGLPATTSTERLELLDDDEHILSMRIIGGDHRLRNYSSIIS  120

Query  516  VHPEIIDGRPGTLVIESFVV  575
            +HPEIIDGRPGT+VIES+VV
Sbjct  121  LHPEIIDGRPGTMVIESYVV  140



>ref|XP_008778779.1| PREDICTED: abscisic acid receptor PYL8-like [Phoenix dactylifera]
Length=205

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E E +RRHH+HE+RENQCSS LVKHIRAPVHLVWSLVRRFDQPQ+YKPFVSRC+VQGDL
Sbjct  31   MEVELVRRHHRHELRENQCSSTLVKHIRAPVHLVWSLVRRFDQPQKYKPFVSRCVVQGDL  90

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGSVREVNVKSGLPATTS ERLELLDDDEHILS++IVGGDHRLRNY+S++TVHPEIIDG
Sbjct  91   EIGSVREVNVKSGLPATTSTERLELLDDDEHILSIKIVGGDHRLRNYSSVITVHPEIIDG  150

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  151  RPGTLVIESFVV  162



>ref|XP_002270037.3| PREDICTED: abscisic acid receptor PYL8 [Vitis vinifera]
 emb|CBI22536.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+  S +E EYIRRHH+HE  ENQCSS LVKHI+APV LVWSLVRRFDQPQ+YKPF+S
Sbjct  1    MNGNGLSSMESEYIRRHHRHEPAENQCSSALVKHIKAPVPLVWSLVRRFDQPQKYKPFIS  60

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQG+LEIGS+REV+VKSGLPATTS ERLELLDDDEHILSMRI+GGDHRLRNY+SI++
Sbjct  61   RCVVQGNLEIGSLREVDVKSGLPATTSTERLELLDDDEHILSMRIIGGDHRLRNYSSIIS  120

Query  516  VHPEIIDGRPGTLVIESFVV  575
            +HPEIIDGRPGT+VIES+VV
Sbjct  121  LHPEIIDGRPGTMVIESYVV  140



>gb|KHN06298.1| Abscisic acid receptor PYL9 [Glycine soja]
Length=185

 Score =   246 bits (627),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M  G+    +E +YIRRHHKHE RENQC+S LVKHIRAPVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNGGESYGAIETQYIRRHHKHEPRENQCTSALVKHIRAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCI+QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHIL +RIVGGDHRLRNY+SI+
Sbjct  61   SRCIMQGDLGIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIRIVGGDHRLRNYSSII  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGT+VIESFVV
Sbjct  121  TVHPEVIDGRPGTMVIESFVV  141



>gb|ABF72432.1| PIP1 [Capsicum annuum]
Length=185

 Score =   246 bits (627),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MN +  S VE EYIR+HH H+ +ENQCSS LVKHIRAPVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  1    MNANGFSGVEKEYIRKHHLHQPKENQCSSFLVKHIRAPVHLVWSLVRRFDQPQKYKPFVS  60

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RCI QGDLEIGS+REV+VKSGLPATTS ERLELLDD+EHILS RI+GGDHRLRNY+SI++
Sbjct  61   RCIAQGDLEIGSLREVDVKSGLPATTSTERLELLDDEEHILSFRIIGGDHRLRNYSSIIS  120

Query  516  VHPEIIDGRPGTLVIESFVV  575
            +HPE+IDGRPGTLVIESFVV
Sbjct  121  LHPEVIDGRPGTLVIESFVV  140



>gb|AFK41699.1| unknown [Lotus japonicus]
Length=185

 Score =   245 bits (626),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 130/141 (92%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNGDR-RSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MNGD   S +E +YIRRHHKHE+R+NQC+S LVKHI+APVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNGDEPYSAIESQYIRRHHKHELRDNQCTSALVKHIKAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCI+QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHIL +RIVGGDHRLRNY SI+
Sbjct  61   SRCIMQGDLGIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIRIVGGDHRLRNYCSII  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGT+VIESFVV
Sbjct  121  TVHPEVIDGRPGTMVIESFVV  141



>ref|XP_009395763.1| PREDICTED: abscisic acid receptor PYL8-like [Musa acuminata subsp. 
malaccensis]
Length=227

 Score =   246 bits (629),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M  GD    +E EY+RRHH+HE R+NQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFV
Sbjct  29   MSGGDGCRLMEAEYVRRHHRHEPRDNQCSSTLVKHIKAPVHLVWSLVRRFDQPQKYKPFV  88

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC+VQGDLE+GSVREVNVKSGLPATTS ERLELLDD+EH+LS++IVGGDHRLRNY+SI+
Sbjct  89   SRCVVQGDLEVGSVREVNVKSGLPATTSTERLELLDDNEHVLSVKIVGGDHRLRNYSSII  148

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+ID RPGTLVIESFVV
Sbjct  149  TVHPEVIDARPGTLVIESFVV  169



>ref|XP_010266480.1| PREDICTED: abscisic acid receptor PYL8 [Nelumbo nucifera]
Length=185

 Score =   245 bits (625),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+  + +E +YI RHH+HE R+NQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPF+S
Sbjct  1    MNGNGYTRMEGDYIIRHHRHETRDNQCSSALVKHIKAPVHLVWSLVRRFDQPQKYKPFIS  60

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQGDLEIGSVREV+VKSGLPATTS ERLELLDD+EHIL +RIVGGDHRLRNY+S++T
Sbjct  61   RCVVQGDLEIGSVREVDVKSGLPATTSTERLELLDDEEHILGIRIVGGDHRLRNYSSVIT  120

Query  516  VHPEIIDGRPGTLVIESFVV  575
            +HPEIIDGRPGTLVIESFVV
Sbjct  121  LHPEIIDGRPGTLVIESFVV  140



>emb|CDP12146.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   244 bits (624),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            +DE+IRRHH HEVR NQCSS LVKHI+APVHLVWSLVRRFDQPQRYKPFVSRC+VQGDLE
Sbjct  3    DDEHIRRHHMHEVRANQCSSSLVKHIKAPVHLVWSLVRRFDQPQRYKPFVSRCVVQGDLE  62

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGR  542
            IGSVREVNVKSGLPATTS ERLE LDD+EHI SMRIVGGDHRL+NY S VTVHPE+IDGR
Sbjct  63   IGSVREVNVKSGLPATTSTERLEFLDDEEHIFSMRIVGGDHRLKNYMSTVTVHPEVIDGR  122

Query  543  PGTLVIESFVV  575
            PGTLVIESFVV
Sbjct  123  PGTLVIESFVV  133



>ref|XP_010924854.1| PREDICTED: abscisic acid receptor PYL8 [Elaeis guineensis]
Length=202

 Score =   245 bits (626),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            M+G     +E E++RR+H+H+ RENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  23   MSGHGCRQMEAEFVRRYHRHQPRENQCSSTLVKHIKAPVHLVWSLVRRFDQPQKYKPFVS  82

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQGDLEIGSVREVNVKSGLPATTS ERLELLDDDEHILS++IVGGDHRLRNY+S++T
Sbjct  83   RCVVQGDLEIGSVREVNVKSGLPATTSTERLELLDDDEHILSIKIVGGDHRLRNYSSVIT  142

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE+IDGRPGTLVIESFVV
Sbjct  143  VHPEVIDGRPGTLVIESFVV  162



>ref|XP_010671508.1| PREDICTED: abscisic acid receptor PYL8 [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG     VE+E++RRHH+HE  +NQCSS L+KHI+APVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  3    MNGKGYGGVEEEFVRRHHQHEAADNQCSSLLIKHIKAPVHLVWSLVRRFDQPQKYKPFVS  62

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQG+LEIGSVREV+VKSGLPATTS ERLE+LDD+EHILS+RIVGGDHRLRNY+S+V+
Sbjct  63   RCVVQGNLEIGSVREVDVKSGLPATTSTERLEVLDDNEHILSIRIVGGDHRLRNYSSVVS  122

Query  516  VHPEIIDGRPGTLVIESFVV  575
            +HPEIIDGRPGT+VIESFVV
Sbjct  123  LHPEIIDGRPGTMVIESFVV  142



>ref|NP_001242004.1| uncharacterized protein LOC100810273 [Glycine max]
 gb|ACU21210.1| unknown [Glycine max]
Length=185

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M  G+    +E +YIRRHH+HE RENQC+S LVKHIRAPVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNGGESYGAIETQYIRRHHRHEPRENQCTSALVKHIRAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCI+QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHIL +RIVGGDHRLRNY+SI+
Sbjct  61   SRCIMQGDLGIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIRIVGGDHRLRNYSSII  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGT+VIESFVV
Sbjct  121  TVHPEVIDGRPGTMVIESFVV  141



>ref|XP_004516407.1| PREDICTED: abscisic acid receptor PYL9-like isoform X1 [Cicer 
arietinum]
Length=188

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  162  GDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRC  341
            G++ S +E +YIRRHHKH+ R+NQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC
Sbjct  5    GEQYSSIETQYIRRHHKHDPRDNQCSSALVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRC  64

Query  342  IVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVH  521
            I+QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHIL +RIVGGDHRLRNY+SI+TVH
Sbjct  65   IMQGDLGIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIRIVGGDHRLRNYSSIITVH  124

Query  522  PEIIDGRPGTLVIESFVV  575
            PE+IDGRPGT+VIESFVV
Sbjct  125  PEVIDGRPGTMVIESFVV  142



>ref|XP_006444870.1| hypothetical protein CICLE_v10022440mg [Citrus clementina]
 ref|XP_006491255.1| PREDICTED: abscisic acid receptor PYL9-like [Citrus sinensis]
 gb|ESR58110.1| hypothetical protein CICLE_v10022440mg [Citrus clementina]
 gb|KDO86430.1| hypothetical protein CISIN_1g043944mg [Citrus sinensis]
Length=186

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 129/141 (91%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNG-DRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MNG D    +E +YIRRHH+HE RENQC+S LVKHIRAPVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNGVDAYGVMEAQYIRRHHRHEPRENQCTSALVKHIRAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC+V GDL IGSVREVNVKSGLPATTS ERLELLDD+EHIL ++IVGGDHRLRNY+SI+
Sbjct  61   SRCVVNGDLGIGSVREVNVKSGLPATTSTERLELLDDEEHILGIKIVGGDHRLRNYSSIM  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPEIIDGRPGTLVIESFVV
Sbjct  121  TVHPEIIDGRPGTLVIESFVV  141



>ref|NP_001275025.1| abscisic acid receptor PYL8-like [Solanum tuberosum]
 gb|ABB29920.1| CAPIP1-like [Solanum tuberosum]
Length=185

 Score =   243 bits (621),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MN +    VE EYIR+HH HE +ENQCSS LVKHIRAPVHLVWSLVRRFDQPQ+YKPF+S
Sbjct  1    MNANGFCGVEKEYIRKHHLHEPKENQCSSFLVKHIRAPVHLVWSLVRRFDQPQKYKPFIS  60

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RCIVQGDLEIGS+REV+VKSGLPATTS ERLELLDD+EHILS+RIVGGDHRLRNY+S+++
Sbjct  61   RCIVQGDLEIGSLREVDVKSGLPATTSTERLELLDDEEHILSVRIVGGDHRLRNYSSVIS  120

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE+IDGRPGT+V+ESFVV
Sbjct  121  VHPEVIDGRPGTVVLESFVV  140



>ref|XP_011022513.1| PREDICTED: abscisic acid receptor PYL8-like [Populus euphratica]
Length=190

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +EDE+I+RHHKH+V+E+QCSS LVKHI+APV LVWSLVRRFDQPQ+YKPFVSRCIVQGDL
Sbjct  14   MEDEFIKRHHKHDVKEHQCSSSLVKHIKAPVPLVWSLVRRFDQPQKYKPFVSRCIVQGDL  73

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            +IGSVREVNVKSGLPATTS ERLELLDD+EHI SM+IVGGDHRL+NY+S VTVHPE+IDG
Sbjct  74   QIGSVREVNVKSGLPATTSTERLELLDDEEHIFSMKIVGGDHRLKNYSSTVTVHPEVIDG  133

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  134  RPGTLVIESFVV  145



>ref|NP_001236328.1| uncharacterized protein LOC100500065 [Glycine max]
 gb|ACU14811.1| unknown [Glycine max]
 gb|KHN15946.1| Abscisic acid receptor PYL9 [Glycine soja]
Length=185

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M  G+    +E +YIRRHHKHE RENQC+S LVKHIRAPVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNGGESYGAIETQYIRRHHKHEPRENQCTSALVKHIRAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCI+QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHIL +RIVGGDHRLRNY+SI+
Sbjct  61   SRCIMQGDLGIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIRIVGGDHRLRNYSSII  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRP T+VIESFVV
Sbjct  121  TVHPEVIDGRPSTMVIESFVV  141



>ref|XP_006439364.1| hypothetical protein CICLE_v10022206mg [Citrus clementina]
 gb|ESR52604.1| hypothetical protein CICLE_v10022206mg [Citrus clementina]
 gb|KDO76505.1| hypothetical protein CISIN_1g028067mg [Citrus sinensis]
Length=197

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E++YI+RHHKH+V ++QCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRCIVQGDL
Sbjct  21   IEEDYIKRHHKHDVHDHQCSSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCIVQGDL  80

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            +IGSVREVNVKSGLPATTS ERLELLDD+EHI  MRIVGGDHRL+NY+SIVTVHPE+IDG
Sbjct  81   QIGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLKNYSSIVTVHPEVIDG  140

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  141  RPGTLVIESFVV  152



>ref|XP_010913806.1| PREDICTED: abscisic acid receptor PYL8-like [Elaeis guineensis]
Length=253

 Score =   245 bits (626),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            M+G     +E E +RRHH+HE RENQCSS LVKHI+APVHLVWSLVR FDQPQ+YKPFVS
Sbjct  71   MSGQECRQMETELVRRHHRHEPRENQCSSTLVKHIKAPVHLVWSLVRSFDQPQKYKPFVS  130

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQGDLEIGSVREVNVKSGLPATTS ERLELLDD+EHIL M+IVGGDHRLRNY+S++T
Sbjct  131  RCVVQGDLEIGSVREVNVKSGLPATTSTERLELLDDNEHILGMKIVGGDHRLRNYSSVIT  190

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPEIIDGRPGTLVIESF+V
Sbjct  191  VHPEIIDGRPGTLVIESFLV  210



>ref|XP_003637736.1| Abscisic acid receptor PYL9 [Medicago truncatula]
 gb|AFK47795.1| unknown [Medicago truncatula]
 gb|KEH18680.1| abscisic acid receptor PYL9-like protein [Medicago truncatula]
Length=190

 Score =   243 bits (619),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 131/144 (91%), Gaps = 3/144 (2%)
 Frame = +3

Query  153  MMNG---DRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYK  323
            M NG    + S +E +YIRRHHKH++R+NQCSS LVKHI+APVHLVWSLVRRFDQPQ+YK
Sbjct  1    MNNGCEQQQYSVIETQYIRRHHKHDLRDNQCSSALVKHIKAPVHLVWSLVRRFDQPQKYK  60

Query  324  PFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYT  503
            PF+SRCI+QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHIL +RIVGGDHRLRNY+
Sbjct  61   PFISRCIMQGDLSIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIRIVGGDHRLRNYS  120

Query  504  SIVTVHPEIIDGRPGTLVIESFVV  575
            SI+TVHPE+IDGRPGT+VIESFVV
Sbjct  121  SIITVHPEVIDGRPGTMVIESFVV  144



>ref|XP_002509950.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51337.1| conserved hypothetical protein [Ricinus communis]
Length=196

 Score =   243 bits (619),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  141  MTAGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRY  320
            +T    N +  S +ED+YIRRHHKH+V+++QCSS LVKHI+APVHLVWSLVRRFDQPQRY
Sbjct  7    ITVLNTNNNIFSKMEDDYIRRHHKHDVKDHQCSSSLVKHIKAPVHLVWSLVRRFDQPQRY  66

Query  321  KPFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNY  500
            KPFVSRCI QGDL+IGS+REVNVKSGLPATTS ERLELLDD+EHI  M IVGGDHRL+NY
Sbjct  67   KPFVSRCIAQGDLQIGSLREVNVKSGLPATTSTERLELLDDEEHIFRMTIVGGDHRLKNY  126

Query  501  TSIVTVHPEIIDGRPGTLVIESFVV  575
            +SI+TVHPE+IDGRPGT+ IESFVV
Sbjct  127  SSIITVHPEVIDGRPGTMAIESFVV  151



>gb|AAV85853.1| AT-rich element binding factor 3 [Pisum sativum]
Length=188

 Score =   242 bits (618),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  162  GDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRC  341
            G++ S +E +YIRR HKH++R+NQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC
Sbjct  5    GEQYSAIETQYIRRRHKHDLRDNQCSSALVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRC  64

Query  342  IVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVH  521
            I+QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHIL +RIVGGDHRLRNY+S++TVH
Sbjct  65   IMQGDLGIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIRIVGGDHRLRNYSSVITVH  124

Query  522  PEIIDGRPGTLVIESFVV  575
            PE+IDGRPGT+VIESFVV
Sbjct  125  PEVIDGRPGTMVIESFVV  142



>ref|XP_006476396.1| PREDICTED: abscisic acid receptor PYL8-like [Citrus sinensis]
Length=197

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            E++YI+RHHKH+V ++QCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRCIVQGDL+
Sbjct  22   EEDYIKRHHKHDVHDHQCSSTLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCIVQGDLQ  81

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGR  542
            IGSVREVNVKSGLPATTS ERLELLDD+EHI  MRIVGGDHRL+NY+SIVTVHPE+IDGR
Sbjct  82   IGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLKNYSSIVTVHPEVIDGR  141

Query  543  PGTLVIESFVV  575
            PGTLVIESFVV
Sbjct  142  PGTLVIESFVV  152



>ref|XP_004234175.1| PREDICTED: abscisic acid receptor PYL8 [Solanum lycopersicum]
Length=185

 Score =   242 bits (617),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MN +    VE EYIR+HH HE +ENQCSS LVKHIRAPVHLVWSLVRRFDQPQ+YKPF+S
Sbjct  1    MNANGFCGVEKEYIRKHHIHEPKENQCSSFLVKHIRAPVHLVWSLVRRFDQPQKYKPFIS  60

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RCIVQGDL IGS+REV+VKSGLPATTS ERLELLDD+EHILS+RIVGGDHRLRNY+S+++
Sbjct  61   RCIVQGDLGIGSLREVDVKSGLPATTSTERLELLDDEEHILSVRIVGGDHRLRNYSSVIS  120

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE+IDGRPGTLV+ESFVV
Sbjct  121  VHPEVIDGRPGTLVLESFVV  140



>ref|XP_002304553.1| hypothetical protein POPTR_0003s13900g [Populus trichocarpa]
 gb|EEE79532.1| hypothetical protein POPTR_0003s13900g [Populus trichocarpa]
Length=190

 Score =   241 bits (616),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +EDE+I+RHHKH+V+E+QCSS LVKHI+APV LVWSLVRRFDQPQ+YKPFVSRC+VQGDL
Sbjct  14   MEDEFIKRHHKHDVKEHQCSSSLVKHIKAPVPLVWSLVRRFDQPQKYKPFVSRCVVQGDL  73

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            +IGSVREVNVKSGLPATTS ERLELLDD+EHI SM+IVGGDHRL+NY S VTVHPE+IDG
Sbjct  74   QIGSVREVNVKSGLPATTSTERLELLDDEEHIFSMKIVGGDHRLKNYLSTVTVHPEVIDG  133

Query  540  RPGTLVIESFVV  575
            RPGTLVIESF+V
Sbjct  134  RPGTLVIESFIV  145



>gb|EYU25203.1| hypothetical protein MIMGU_mgv1a014621mg [Erythranthe guttata]
Length=184

 Score =   241 bits (615),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MM+    S VE EYI++HHKHE+++NQCSS L+KHI+APVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MMDVKGMSGVEIEYIKKHHKHEIKDNQCSSFLIKHIKAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC+V G+LEIGS+REV+VKSGLPATTS ERLELLDD+EHILS+RI+GGDHRL+NYTS V
Sbjct  61   SRCVVHGNLEIGSLREVDVKSGLPATTSTERLELLDDNEHILSVRIIGGDHRLKNYTSTV  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            +VHPE+I+GRPGT+VIESFVV
Sbjct  121  SVHPEVIEGRPGTMVIESFVV  141



>ref|XP_011037987.1| PREDICTED: abscisic acid receptor PYL9-like [Populus euphratica]
Length=186

 Score =   241 bits (615),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNG-DRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MNG D  S  E +Y+RRHHKHE RENQC+S LVKHIRAP HLVWSLVRRFDQPQRYKPFV
Sbjct  1    MNGSDAYSATEAQYVRRHHKHEPRENQCTSALVKHIRAPAHLVWSLVRRFDQPQRYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC++ G+L IGSVREVNVKSGLPATTS ERLELLDD+EHIL ++IVGGDHRL+NY+SI+
Sbjct  61   SRCVMNGELGIGSVREVNVKSGLPATTSTERLELLDDEEHILGVQIVGGDHRLKNYSSIM  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE IDGRPGTLVIESFVV
Sbjct  121  TVHPEFIDGRPGTLVIESFVV  141



>ref|XP_008791430.1| PREDICTED: abscisic acid receptor PYL8-like [Phoenix dactylifera]
Length=202

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            M+G     +E E++RRHH+H+  ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  23   MSGHGCRQMEAEFVRRHHRHQPTENQCSSTLVKHIKAPVHLVWSLVRRFDQPQKYKPFVS  82

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQGDLEIGSVREVNVKSGLPATTS ERLELLDD+EHIL ++IVGGDHRLRNY+S+ T
Sbjct  83   RCVVQGDLEIGSVREVNVKSGLPATTSTERLELLDDNEHILGIKIVGGDHRLRNYSSVTT  142

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE+IDGRPGTLVIESFVV
Sbjct  143  VHPEVIDGRPGTLVIESFVV  162



>gb|EYU23369.1| hypothetical protein MIMGU_mgv1a014495mg [Erythranthe guttata]
Length=187

 Score =   241 bits (615),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 131/141 (93%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNGDRRSD-VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MNGDRR+   E+ +I RHH+H+VR+NQC+S LVKHI+AP+ +VWSLVRRFDQPQRYKPFV
Sbjct  5    MNGDRRTGGPEEAFITRHHRHDVRDNQCTSSLVKHIKAPLPIVWSLVRRFDQPQRYKPFV  64

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCIV+GDL IG+VREVNVKSGLPATTSKERLELLDD+EHI SMRIVGGDHRL+NY+SI+
Sbjct  65   SRCIVEGDLRIGTVREVNVKSGLPATTSKERLELLDDEEHIFSMRIVGGDHRLKNYSSII  124

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE IDGRPGT+VIESFVV
Sbjct  125  TVHPETIDGRPGTMVIESFVV  145



>ref|XP_011084493.1| PREDICTED: abscisic acid receptor PYL8 [Sesamum indicum]
Length=185

 Score =   241 bits (615),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MN    S VE EYI +HHKHE+++NQC+S L+KH++APVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  1    MNARGLSGVEKEYINKHHKHEIKDNQCTSFLIKHVKAPVHLVWSLVRRFDQPQKYKPFVS  60

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+VQG+LEIGS+REV+VKSGLPATTS ERLELLDD+EH+LS+RI+GGDHRLRNY+SIV+
Sbjct  61   RCVVQGNLEIGSLREVDVKSGLPATTSTERLELLDDNEHVLSVRIIGGDHRLRNYSSIVS  120

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE+I+GRPGT+VIESFVV
Sbjct  121  VHPEVIEGRPGTMVIESFVV  140



>ref|XP_002320857.1| hypothetical protein POPTR_0014s09280g [Populus trichocarpa]
 gb|ABK96505.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE99172.1| hypothetical protein POPTR_0014s09280g [Populus trichocarpa]
Length=186

 Score =   240 bits (613),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNG-DRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MNG D  S  E +Y+RRHHKHE RENQC+S LVKHI+AP HLVWSLVRRFDQPQRYKPFV
Sbjct  1    MNGSDAYSATEAQYVRRHHKHEPRENQCTSALVKHIKAPAHLVWSLVRRFDQPQRYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC++ G+L IGSVREVNVKSGLPATTS ERLELLDD+EHIL ++IVGGDHRL+NY+SI+
Sbjct  61   SRCVMNGELGIGSVREVNVKSGLPATTSTERLELLDDEEHILGVQIVGGDHRLKNYSSIM  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE IDGRPGTLVIESF+V
Sbjct  121  TVHPEFIDGRPGTLVIESFIV  141



>gb|ABK92491.1| unknown [Populus trichocarpa]
Length=186

 Score =   240 bits (612),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNG-DRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MNG D  S  E +Y+RRHHKHE RENQC+S LVKHI+AP HLVWSLVRRFDQPQRYKPFV
Sbjct  1    MNGSDAYSATEAQYVRRHHKHEPRENQCTSALVKHIKAPAHLVWSLVRRFDQPQRYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC++ G+L IGSVREVNVKSGLPATTS ERLELLDD+EHIL ++IVGGDHRL+NY+SI+
Sbjct  61   SRCVMNGELGIGSVREVNVKSGLPATTSTERLELLDDEEHILGVQIVGGDHRLKNYSSIM  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE IDGRPGTLVIESF+V
Sbjct  121  TVHPEFIDGRPGTLVIESFIV  141



>gb|ACJ85952.1| unknown [Medicago truncatula]
Length=190

 Score =   240 bits (613),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 130/144 (90%), Gaps = 3/144 (2%)
 Frame = +3

Query  153  MMNG---DRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYK  323
            M NG    + S +E +YIRRHHKH++R+NQCSS LVKHI+APVHLVWSLVRRFDQPQ+YK
Sbjct  1    MNNGCEQQQYSVIETQYIRRHHKHDLRDNQCSSALVKHIKAPVHLVWSLVRRFDQPQKYK  60

Query  324  PFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYT  503
            PF+SRCI+QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHIL +RIVGGDHRLRNY+
Sbjct  61   PFISRCIMQGDLSIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIRIVGGDHRLRNYS  120

Query  504  SIVTVHPEIIDGRPGTLVIESFVV  575
            SI+TVHP +IDGRPGT+VIESFVV
Sbjct  121  SIITVHPGVIDGRPGTMVIESFVV  144



>ref|XP_002302624.1| hypothetical protein POPTR_0002s17070g [Populus trichocarpa]
 gb|EEE81897.1| hypothetical protein POPTR_0002s17070g [Populus trichocarpa]
Length=186

 Score =   240 bits (612),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M  GD  S  E +YIRRHH+HE  ENQC+S LVKHI+AP HLVWSLVRRFDQPQRYKPFV
Sbjct  1    MNGGDAYSAAEVQYIRRHHQHEPAENQCTSALVKHIKAPAHLVWSLVRRFDQPQRYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC++ G+L IGSVREVNVKSGLPATTS ERLELLDD+EHIL ++IVGGDHRL+NY+SI+
Sbjct  61   SRCVMNGELGIGSVREVNVKSGLPATTSTERLELLDDEEHILGVKIVGGDHRLKNYSSIM  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPEIIDGRPGTLVIESF+V
Sbjct  121  TVHPEIIDGRPGTLVIESFIV  141



>ref|XP_010915668.1| PREDICTED: abscisic acid receptor PYL8-like [Elaeis guineensis]
Length=219

 Score =   241 bits (615),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  147  AGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKP  326
            A  MN +    VE EY+RR H+HE RENQCSS L KHIRAPVHLVWSLVRRFDQPQ+YKP
Sbjct  33   ADEMNSNGCRGVESEYVRRLHRHEPRENQCSSTLFKHIRAPVHLVWSLVRRFDQPQKYKP  92

Query  327  FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            FVSRC+VQGDL IGSVREVNVKSGLPATTS ERLE LDD+EHILSM+IVGGDHRL+NY+S
Sbjct  93   FVSRCVVQGDLGIGSVREVNVKSGLPATTSTERLEFLDDNEHILSMKIVGGDHRLKNYSS  152

Query  507  IVTVHPEIIDGRPGTLVIESFVV  575
            IVT+HPE  DGRPGTLVIESFVV
Sbjct  153  IVTLHPESFDGRPGTLVIESFVV  175



>ref|XP_009589647.1| PREDICTED: abscisic acid receptor PYL8 [Nicotiana tomentosiformis]
Length=185

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            M+ +  S +E EYIR+HH H++ ENQCSS LVKHIRAPVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  1    MSPNGFSGLEKEYIRKHHHHDLAENQCSSFLVKHIRAPVHLVWSLVRRFDQPQKYKPFVS  60

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RCIVQG+LEIGS+REV+VKSGLPATTS ERLELLDD+EHIL +RI+GGDHRLRNY+SI++
Sbjct  61   RCIVQGNLEIGSLREVDVKSGLPATTSTERLELLDDEEHILIVRIIGGDHRLRNYSSIIS  120

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE+IDGRPGTLVIESFVV
Sbjct  121  VHPEVIDGRPGTLVIESFVV  140



>ref|XP_008376112.1| PREDICTED: abscisic acid receptor PYL9-like [Malus domestica]
Length=184

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            M+      +E EYIRRHH+HE RENQC+S LV+HI+APVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  1    MSSGGGDSMEAEYIRRHHRHEPRENQCTSALVRHIKAPVHLVWSLVRRFDQPQKYKPFVS  60

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC ++GDL IGSVREVNVKSGLPATTS ERLELLDDDEHIL +RIVGGDHRLRNY+SI+T
Sbjct  61   RCTMKGDLGIGSVREVNVKSGLPATTSTERLELLDDDEHILGIRIVGGDHRLRNYSSIIT  120

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE+I+GRPGTLVIESFVV
Sbjct  121  VHPEVIEGRPGTLVIESFVV  140



>ref|XP_004306686.1| PREDICTED: abscisic acid receptor PYL9-like [Fragaria vesca subsp. 
vesca]
Length=184

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E +YIRRHH+HE RENQC+S LV+H++APVHLVWSLVRRFDQPQ+YKPFVSRCI++GDL
Sbjct  9    MEAQYIRRHHRHEPRENQCTSALVRHVKAPVHLVWSLVRRFDQPQKYKPFVSRCIMKGDL  68

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGS+REVNVKSGLPATTS ERLELLDDDEHIL +RIVGGDHRLRNY+SI+TVHPE+IDG
Sbjct  69   GIGSLREVNVKSGLPATTSTERLELLDDDEHILGIRIVGGDHRLRNYSSIITVHPEVIDG  128

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  129  RPGTLVIESFVV  140



>gb|ACG76109.1| pathogenesis-induced protein [Arachis hypogaea]
Length=193

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 130/149 (87%), Gaps = 8/149 (5%)
 Frame = +3

Query  153  MMNG--------DRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQ  308
            MMNG        +    +E +YIRRHH+HE R+NQC+S LVKHIRAPVHLVWSLVRRFDQ
Sbjct  1    MMNGSCGGGGGGEAYGAIEAQYIRRHHRHEPRDNQCTSALVKHIRAPVHLVWSLVRRFDQ  60

Query  309  PQRYKPFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHR  488
            PQ+YKPFVSRCI+QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHIL +RIVGGDHR
Sbjct  61   PQKYKPFVSRCIMQGDLGIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIRIVGGDHR  120

Query  489  LRNYTSIVTVHPEIIDGRPGTLVIESFVV  575
            LRNY+SI+TVHPE+I+GRPGT+VIESFVV
Sbjct  121  LRNYSSIITVHPEVIEGRPGTMVIESFVV  149



>ref|XP_011026905.1| PREDICTED: abscisic acid receptor PYL8-like [Populus euphratica]
Length=190

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +EDE+++RHHKH+V+E+QCSS LVKHI+APV LVWSLVRRFDQPQ+YKPFVSRCI QGDL
Sbjct  14   MEDEFVKRHHKHDVKEHQCSSSLVKHIKAPVPLVWSLVRRFDQPQKYKPFVSRCIAQGDL  73

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            +IGSVRE NVKSGLPATTS ERLELLDDDEHI  M+IVGGDHRL+NY+SIVTVHP++IDG
Sbjct  74   QIGSVREGNVKSGLPATTSTERLELLDDDEHIFGMKIVGGDHRLKNYSSIVTVHPKVIDG  133

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  134  RPGTLVIESFVV  145



>ref|XP_002297980.2| hypothetical protein POPTR_0001s10530g [Populus trichocarpa]
 gb|EEE82785.2| hypothetical protein POPTR_0001s10530g [Populus trichocarpa]
Length=190

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +EDE+I+RHHKH+V+E+QCSS LVKHI+APV LVWSLVRRFDQPQ+YKPFVSRCI QGDL
Sbjct  14   MEDEFIKRHHKHDVKEHQCSSSLVKHIKAPVPLVWSLVRRFDQPQKYKPFVSRCIAQGDL  73

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            +IGSVREVNVKSGLPATTS ERLELLDDDEHI  M+IVGGDHRL+NY+SIVTVHP++ID 
Sbjct  74   QIGSVREVNVKSGLPATTSTERLELLDDDEHIFGMKIVGGDHRLKNYSSIVTVHPKVIDE  133

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  134  RPGTLVIESFVV  145



>ref|XP_007051579.1| Regulatory component of ABA receptor 1 [Theobroma cacao]
 gb|EOX95736.1| Regulatory component of ABA receptor 1 [Theobroma cacao]
Length=186

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M  G+  S +E +Y+RRHH+HE+R++QC+S LVKHI+APVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNGGEAYSMMEAQYVRRHHRHEIRDDQCTSALVKHIKAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCI+QGDL IGSVREVNVKSGLPATTS ERLELLDD+EHIL ++IV GDHRLRNY+SI+
Sbjct  61   SRCIMQGDLGIGSVREVNVKSGLPATTSTERLELLDDEEHILGIKIVDGDHRLRNYSSII  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+I+GRPGT+VIESFVV
Sbjct  121  TVHPEVIEGRPGTMVIESFVV  141



>gb|KJB24579.1| hypothetical protein B456_004G152300 [Gossypium raimondii]
 gb|KJB24580.1| hypothetical protein B456_004G152300 [Gossypium raimondii]
Length=186

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 132/141 (94%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNGD-RRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MNGD  +S +E +YI+RHH+H +R++QC+S LVKHI+APVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNGDDAQSMMESQYIQRHHRHNIRDDQCTSALVKHIKAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCI++GDL IGSVREVNVKSGLPATTS ERLELLDD+EHIL ++IVGGDHRLRNY+SI+
Sbjct  61   SRCIMKGDLGIGSVREVNVKSGLPATTSTERLELLDDEEHILGIKIVGGDHRLRNYSSIM  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+I+GRPGT+VIESFVV
Sbjct  121  TVHPEVIEGRPGTMVIESFVV  141



>ref|XP_006360709.1| PREDICTED: abscisic acid receptor PYL8-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006360710.1| PREDICTED: abscisic acid receptor PYL8-like isoform X2 [Solanum 
tuberosum]
Length=181

 Score =   238 bits (608),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 130/141 (92%), Gaps = 5/141 (4%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MMN     ++EDEYIRRHH+H + +NQCSS LVK IRAPV+LVWSLVRRFDQPQRYKPFV
Sbjct  1    MMN-----NMEDEYIRRHHRHVLNDNQCSSSLVKRIRAPVNLVWSLVRRFDQPQRYKPFV  55

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC+VQGDLEIGSVREVNV+SGLPATTSKERLELLDD+EHI  ++IVGGDHRL+NY+SI+
Sbjct  56   SRCVVQGDLEIGSVREVNVRSGLPATTSKERLELLDDEEHIFGVKIVGGDHRLQNYSSII  115

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGT+VIESFVV
Sbjct  116  TVHPEVIDGRPGTIVIESFVV  136



>ref|XP_007038971.1| Regulatory components of ABA receptor 3 isoform 2 [Theobroma 
cacao]
 gb|EOY23472.1| Regulatory components of ABA receptor 3 isoform 2 [Theobroma 
cacao]
Length=190

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  162  GDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRC  341
            G   + V  EY+RRHH+HE+ ENQCSS LVKHI+APV LVWSLVRRFDQPQ+YKPFVSRC
Sbjct  9    GSGAAVVASEYVRRHHRHEIGENQCSSALVKHIKAPVPLVWSLVRRFDQPQKYKPFVSRC  68

Query  342  IVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVH  521
            +VQG+LEIGS+REV+VKSGLPATTS ERLELLDDDEHILS+RIVGGDHRL+NY+SI ++H
Sbjct  69   VVQGNLEIGSLREVDVKSGLPATTSTERLELLDDDEHILSIRIVGGDHRLKNYSSISSLH  128

Query  522  PEIIDGRPGTLVIESFVV  575
            PEIIDGRPGTLVIESFVV
Sbjct  129  PEIIDGRPGTLVIESFVV  146



>ref|XP_010925745.1| PREDICTED: abscisic acid receptor PYL8-like isoform X1 [Elaeis 
guineensis]
Length=206

 Score =   239 bits (610),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  147  AGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKP  326
            A  MN +    VE EY+RR H+HE+RENQCSS L KHI+APVHLVWSLVRRFDQPQ+YKP
Sbjct  20   ADEMNSNGCCGVESEYVRRLHRHELRENQCSSTLFKHIKAPVHLVWSLVRRFDQPQKYKP  79

Query  327  FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            FVSRC++QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHILS++IVGGDHRL+NY+S
Sbjct  80   FVSRCVMQGDLGIGSVREVNVKSGLPATTSTERLEFLDDNEHILSIKIVGGDHRLKNYSS  139

Query  507  IVTVHPEIIDGRPGTLVIESFVV  575
            IVT+HPE IDGRPGTLVIESFVV
Sbjct  140  IVTLHPESIDGRPGTLVIESFVV  162



>ref|XP_009786635.1| PREDICTED: abscisic acid receptor PYL8-like [Nicotiana sylvestris]
Length=186

 Score =   238 bits (608),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 131/141 (93%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKH-EVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M+ +  S VE EYIR+HH H ++ ENQCSS LVKHIRAPVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MSPNGFSGVEKEYIRKHHHHHDLAENQCSSFLVKHIRAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCIVQG+LEIGS+REV+VKSGLPATTS ERLELLDD+EHILS+RI+GGDHRLRNY+SI+
Sbjct  61   SRCIVQGNLEIGSLREVDVKSGLPATTSTERLELLDDEEHILSVRIIGGDHRLRNYSSII  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            +VHPE+IDGRPGTLVIESFVV
Sbjct  121  SVHPEVIDGRPGTLVIESFVV  141



>ref|XP_007038970.1| Regulatory components of ABA receptor 3 isoform 1 [Theobroma 
cacao]
 gb|EOY23471.1| Regulatory components of ABA receptor 3 isoform 1 [Theobroma 
cacao]
Length=254

 Score =   240 bits (613),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  162  GDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRC  341
            G   + V  EY+RRHH+HE+ ENQCSS LVKHI+APV LVWSLVRRFDQPQ+YKPFVSRC
Sbjct  73   GSGAAVVASEYVRRHHRHEIGENQCSSALVKHIKAPVPLVWSLVRRFDQPQKYKPFVSRC  132

Query  342  IVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVH  521
            +VQG+LEIGS+REV+VKSGLPATTS ERLELLDDDEHILS+RIVGGDHRL+NY+SI ++H
Sbjct  133  VVQGNLEIGSLREVDVKSGLPATTSTERLELLDDDEHILSIRIVGGDHRLKNYSSISSLH  192

Query  522  PEIIDGRPGTLVIESFVV  575
            PEIIDGRPGTLVIESFVV
Sbjct  193  PEIIDGRPGTLVIESFVV  210



>ref|XP_010049392.1| PREDICTED: abscisic acid receptor PYL8 [Eucalyptus grandis]
 gb|KCW89183.1| hypothetical protein EUGRSUZ_A01495 [Eucalyptus grandis]
Length=193

 Score =   238 bits (607),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E EY+RRHH+HEV ENQCSS LVKHIRAPV LVWSLVRRFDQPQ+YKPFVSRC+V+G+L
Sbjct  17   MEREYMRRHHRHEVAENQCSSALVKHIRAPVPLVWSLVRRFDQPQKYKPFVSRCVVRGNL  76

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGS+REV+VKSGLPATTS ERLELLDDDEHILS+RI+GGDHRLRNY+SI++VHPEII+G
Sbjct  77   EIGSLREVDVKSGLPATTSTERLELLDDDEHILSIRIIGGDHRLRNYSSIISVHPEIIEG  136

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  137  RPGTLVIESFVV  148



>ref|XP_008783837.1| PREDICTED: abscisic acid receptor PYL8-like [Phoenix dactylifera]
Length=215

 Score =   239 bits (609),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  147  AGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKP  326
            A  MN +    VE EY+RR H+HE RENQCSS L KHIRAPVHLVWSLVRRFDQPQ+YKP
Sbjct  29   ADEMNSNGCRGVESEYVRRLHRHEPRENQCSSTLFKHIRAPVHLVWSLVRRFDQPQKYKP  88

Query  327  FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            FVSRC++QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHILS++IVGGDHRL+NY+S
Sbjct  89   FVSRCVMQGDLGIGSVREVNVKSGLPATTSTERLEFLDDNEHILSIKIVGGDHRLKNYSS  148

Query  507  IVTVHPEIIDGRPGTLVIESFVV  575
            I+T+HPE IDGRPGTLVIESFVV
Sbjct  149  IITLHPESIDGRPGTLVIESFVV  171



>ref|XP_011023201.1| PREDICTED: abscisic acid receptor PYL9-like [Populus euphratica]
Length=186

 Score =   238 bits (606),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M  GD  S  E +YIRRHH+HE  ENQC+S LVKHI+AP  LVWSLVRRFDQPQRYKPFV
Sbjct  1    MNGGDAYSAAEAQYIRRHHQHEPTENQCTSALVKHIKAPAPLVWSLVRRFDQPQRYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC++ G+L IGSVREVNVKSGLPATTS ERLELLDD+EHIL ++IVGGDHRL+NY+SI+
Sbjct  61   SRCVMNGELGIGSVREVNVKSGLPATTSTERLELLDDEEHILGVKIVGGDHRLKNYSSIM  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPEIIDGRPGTLVIESF+V
Sbjct  121  TVHPEIIDGRPGTLVIESFIV  141



>ref|XP_002523369.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39085.1| conserved hypothetical protein [Ricinus communis]
Length=186

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M  GD  S VE +YIRRHH+H+  ENQC+S LVKHI+APVHLVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNCGDVYSVVESQYIRRHHRHQPMENQCTSALVKHIKAPVHLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC+V G+L IGSVREVNVKSGLPATTS E LELLDD+EHIL ++IVGGDHRL+NY+SI+
Sbjct  61   SRCVVSGELGIGSVREVNVKSGLPATTSTEMLELLDDEEHILGIKIVGGDHRLKNYSSIM  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGTLVIESFVV
Sbjct  121  TVHPEVIDGRPGTLVIESFVV  141



>ref|XP_004252608.1| PREDICTED: abscisic acid receptor PYL9-like isoform X1 [Solanum 
lycopersicum]
Length=181

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 129/141 (91%), Gaps = 5/141 (4%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MMN     ++EDEYIRRHH+H +  NQCSS LVK IRAPV+LVWSLVRRFDQPQRYKPFV
Sbjct  1    MMN-----NMEDEYIRRHHRHVLDHNQCSSSLVKRIRAPVNLVWSLVRRFDQPQRYKPFV  55

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC+VQGDLEIGSVREVNV+SGLPATTSKERLELLDD+EHI  ++IVGGDHRL+NY+SI+
Sbjct  56   SRCVVQGDLEIGSVREVNVRSGLPATTSKERLELLDDEEHIFGVKIVGGDHRLQNYSSII  115

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGT+VIESFVV
Sbjct  116  TVHPEVIDGRPGTIVIESFVV  136



>ref|XP_009601305.1| PREDICTED: abscisic acid receptor PYL9-like [Nicotiana tomentosiformis]
Length=177

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E+EYIRRHH+H ++++QCSS LVK IRAPV+LVWSLVRRFDQPQRYKPFVSRC+VQGDL
Sbjct  1    MEEEYIRRHHRHVIKDDQCSSSLVKRIRAPVNLVWSLVRRFDQPQRYKPFVSRCVVQGDL  60

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGSVREVNV+SGLPATTSKERLELLDD+EHI  ++IVGGDHRLRNY+SI+TVHPE+IDG
Sbjct  61   EIGSVREVNVRSGLPATTSKERLELLDDEEHIFGVKIVGGDHRLRNYSSIITVHPEVIDG  120

Query  540  RPGTLVIESFVV  575
            RPGT+VIESFVV
Sbjct  121  RPGTIVIESFVV  132



>ref|XP_008350612.1| PREDICTED: abscisic acid receptor PYL9 [Malus domestica]
Length=184

 Score =   236 bits (603),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            VE EYIRRHH+HE RENQC+S LV+HI+APVHLVWSLVRRFDQPQ+YKPFVSRC ++GDL
Sbjct  9    VEAEYIRRHHRHEPRENQCTSALVRHIKAPVHLVWSLVRRFDQPQKYKPFVSRCTMKGDL  68

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGSVREVNVKSGLPATTS ERLELLDDDEHIL +RIVGGDHRLRNY+SI+TVH E+I+G
Sbjct  69   GIGSVREVNVKSGLPATTSTERLELLDDDEHILGIRIVGGDHRLRNYSSIITVHREVIEG  128

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  129  RPGTLVIESFVV  140



>gb|KJB41501.1| hypothetical protein B456_007G107500 [Gossypium raimondii]
Length=186

 Score =   236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M  GD    +E +YIRRHH+H++R++QCSS LVKH++APV+LVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNGGDAYGMMEAQYIRRHHRHDIRDDQCSSALVKHVKAPVNLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCI++GDL IGSVREVNVKSGLPATTS ERLELLDD+EHIL ++IVGGDHRLRNY+SI+
Sbjct  61   SRCIMKGDLGIGSVREVNVKSGLPATTSTERLELLDDEEHILGIKIVGGDHRLRNYSSII  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+I+GRPGT+VIESF V
Sbjct  121  TVHPEVIEGRPGTMVIESFAV  141



>ref|XP_009797969.1| PREDICTED: abscisic acid receptor PYL9-like [Nicotiana sylvestris]
Length=177

 Score =   235 bits (600),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E+EYIRRHH+H V+++QCSS LVK IRAPV+LVWSLVRRFDQPQRYKPFVSRC+VQGDL
Sbjct  1    MEEEYIRRHHRHVVKDDQCSSSLVKRIRAPVNLVWSLVRRFDQPQRYKPFVSRCVVQGDL  60

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGSVREVNV+SGLPATTSKERLELLDD+EHI  ++IVGGDHRLRNY+SI+TVHPE+IDG
Sbjct  61   AIGSVREVNVRSGLPATTSKERLELLDDEEHIFGVKIVGGDHRLRNYSSIITVHPEVIDG  120

Query  540  RPGTLVIESFVV  575
            RPGT+VIESFVV
Sbjct  121  RPGTIVIESFVV  132



>ref|XP_010537115.1| PREDICTED: abscisic acid receptor PYL8-like isoform X2 [Tarenaya 
hassleriana]
Length=190

 Score =   236 bits (601),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            E EYIRRHH+HE +ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPF+SRC+V+G+LE
Sbjct  15   ESEYIRRHHRHEPKENQCSSTLVKHIKAPVHLVWSLVRRFDQPQKYKPFISRCVVKGNLE  74

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGR  542
            IG+VREV+VKSGLPAT S ERLELLDD++HILS+RIVGGDHRL+NY+SI+++HPE IDGR
Sbjct  75   IGTVREVDVKSGLPATKSTERLELLDDNDHILSIRIVGGDHRLKNYSSIISLHPETIDGR  134

Query  543  PGTLVIESFVV  575
            PGTLVIESFVV
Sbjct  135  PGTLVIESFVV  145



>ref|XP_009336806.1| PREDICTED: abscisic acid receptor PYL9 [Pyrus x bretschneideri]
Length=184

 Score =   235 bits (599),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            VE EYIRRHH+HE RENQC+S LV+HI+APVHLVWSLVRRFDQPQ+YKPFVSRC ++GDL
Sbjct  9    VEAEYIRRHHRHEPRENQCTSALVRHIKAPVHLVWSLVRRFDQPQKYKPFVSRCTMKGDL  68

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGS+REVNVKSGLPATTS ERLELLDDDEHIL +RIVGGDHRLRNY SI+TVH E+I+G
Sbjct  69   GIGSLREVNVKSGLPATTSTERLELLDDDEHILGIRIVGGDHRLRNYASIITVHREVIEG  128

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  129  RPGTLVIESFVV  140



>gb|KDP22164.1| hypothetical protein JCGZ_25995 [Jatropha curcas]
Length=193

 Score =   235 bits (599),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  144  TAGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYK  323
            + G   G+    VE EYIRRHH+H+  ++QCSS LVKH++APVHLVWSLVRRFDQPQ+YK
Sbjct  5    SNGTALGNGFGSVESEYIRRHHRHDPADHQCSSALVKHVKAPVHLVWSLVRRFDQPQKYK  64

Query  324  PFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYT  503
            PF+SRC+ QG+++IGS+RE++VKSGLPATTS ERLE LDDDEHILS+RI+GGDHRLRNY+
Sbjct  65   PFISRCVAQGNIQIGSLREIDVKSGLPATTSTERLEFLDDDEHILSIRIIGGDHRLRNYS  124

Query  504  SIVTVHPEIIDGRPGTLVIESFVV  575
            SI+++HPEIIDGRPGTLVIESFVV
Sbjct  125  SIISLHPEIIDGRPGTLVIESFVV  148



>ref|XP_002513580.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48983.1| conserved hypothetical protein [Ricinus communis]
Length=195

 Score =   235 bits (599),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            VE EY+RRHH+H+  ++QCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPF+SRC+ QG+L
Sbjct  19   VESEYVRRHHRHDPADHQCSSALVKHIKAPVHLVWSLVRRFDQPQKYKPFISRCVAQGNL  78

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            +IGS+RE++VKSGLPATTS ERLE LDDDEHILSMRIVGGDHRL+NY+SI+++HPEIIDG
Sbjct  79   QIGSLREIDVKSGLPATTSTERLEFLDDDEHILSMRIVGGDHRLKNYSSIISLHPEIIDG  138

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  139  RPGTLVIESFVV  150



>ref|XP_008789785.1| PREDICTED: abscisic acid receptor PYL8-like [Phoenix dactylifera]
Length=206

 Score =   235 bits (599),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  147  AGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKP  326
            A  MN +    +E EY+RR H+HE RENQCSS L KHI+APVHLVWSLVRRFDQPQ+YKP
Sbjct  20   ADEMNSNGCRGMESEYVRRLHRHEPRENQCSSALFKHIKAPVHLVWSLVRRFDQPQKYKP  79

Query  327  FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            FVSRC+++GDL IGSVREVNVKSGLPATTS ERLE LDD+EHILS++IVGGDHRL+NY+S
Sbjct  80   FVSRCVMRGDLGIGSVREVNVKSGLPATTSTERLEFLDDNEHILSIKIVGGDHRLKNYSS  139

Query  507  IVTVHPEIIDGRPGTLVIESFVV  575
            I+T+HPE IDGRPGTLVIESFVV
Sbjct  140  IITLHPETIDGRPGTLVIESFVV  162



>ref|XP_009396565.1| PREDICTED: abscisic acid receptor PYL8-like [Musa acuminata subsp. 
malaccensis]
Length=182

 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E+EY+R+HH+ E R++QCSS LVKHI+APVHLVWSLVRRFDQP +YKPF+SRC+VQGDL
Sbjct  8    MEEEYVRKHHRQEARDDQCSSTLVKHIKAPVHLVWSLVRRFDQPHKYKPFISRCVVQGDL  67

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGSVREVNVKSGLPATTS ERLE+LDD EH+LS++IVGGDHRLRNY+SI+T HPE++DG
Sbjct  68   AIGSVREVNVKSGLPATTSTERLEVLDDQEHVLSVKIVGGDHRLRNYSSIITAHPEVMDG  127

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  128  RPGTLVIESFVV  139



>gb|KHG17720.1| Abscisic acid receptor PYL9 -like protein [Gossypium arboreum]
Length=186

 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M  GD    +E +YI RHH+H++R++QCSS LVKH++APV+LVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNGGDAYGMMEAQYIWRHHRHDIRDDQCSSALVKHVKAPVNLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRCI++GDL IGSVREVNVKSGLPATTS ERLELLDD+EHIL ++IVGGDHRLRNY+SI+
Sbjct  61   SRCIMKGDLGIGSVREVNVKSGLPATTSTERLELLDDEEHILGIKIVGGDHRLRNYSSII  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+I+GRPGT+VIESF V
Sbjct  121  TVHPEVIEGRPGTMVIESFAV  141



>ref|XP_011470277.1| PREDICTED: abscisic acid receptor PYL8 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=188

 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 127/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            EYIRRHH+HE++++QCSS LV+HI+APVHLVWSLVRRFDQPQ+YKPFVSRC+VQG+LEIG
Sbjct  15   EYIRRHHRHELKDHQCSSTLVRHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVVQGNLEIG  74

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV+VKSGLPATTS ERLELLDDDEH+LS++I+GGDHRLRNY+SI+++HPEI+DGRPG
Sbjct  75   SLREVDVKSGLPATTSTERLELLDDDEHLLSIKIIGGDHRLRNYSSIISLHPEIVDGRPG  134

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  135  TVVIESFVV  143



>ref|XP_008380616.1| PREDICTED: abscisic acid receptor PYL8-like [Malus domestica]
 ref|XP_008380624.1| PREDICTED: abscisic acid receptor PYL8-like [Malus domestica]
 ref|XP_008380630.1| PREDICTED: abscisic acid receptor PYL8-like [Malus domestica]
Length=198

 Score =   234 bits (596),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +YIRRHHKH++ ++QC+S LV+HI+APVHLVWSLVRRFDQPQ+YKPFVSRC+VQG+LEIG
Sbjct  25   DYIRRHHKHDLNDHQCTSTLVRHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVVQGNLEIG  84

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV+VKSGLPATTS ERLELLDDDEHILS++I+GGDHRLRNY+SI+++HPEIIDGRPG
Sbjct  85   SLREVDVKSGLPATTSTERLELLDDDEHILSIKIIGGDHRLRNYSSIISLHPEIIDGRPG  144

Query  549  TLVIESFVV  575
            TLVIESFVV
Sbjct  145  TLVIESFVV  153



>dbj|BAN15743.1| pyrabactin resistance [Dianthus caryophyllus]
Length=197

 Score =   233 bits (595),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            VEDEY+RRHHKH + +NQC+S L+KHI+APV LVWSLVRRFDQPQ+YKPF+SRC+VQG+L
Sbjct  17   VEDEYVRRHHKHVIADNQCTSVLIKHIKAPVPLVWSLVRRFDQPQKYKPFISRCVVQGNL  76

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGS+REV+VKSGLPATTS ERLELLDD+EH+LS+RIVGGDHRL+NY+S+V++HPEII+G
Sbjct  77   EIGSLREVDVKSGLPATTSTERLELLDDNEHVLSIRIVGGDHRLKNYSSVVSLHPEIIEG  136

Query  540  RPGTLVIESFVV  575
            RPGT+VIESFVV
Sbjct  137  RPGTMVIESFVV  148



>ref|XP_006439365.1| hypothetical protein CICLE_v10022206mg [Citrus clementina]
 gb|ESR52605.1| hypothetical protein CICLE_v10022206mg [Citrus clementina]
 gb|KDO76506.1| hypothetical protein CISIN_1g028067mg [Citrus sinensis]
Length=214

 Score =   234 bits (596),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 17/149 (11%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E++YI+RHHKH+V ++QCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRCIVQGDL
Sbjct  21   IEEDYIKRHHKHDVHDHQCSSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCIVQGDL  80

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLR---------------  494
            +IGSVREVNVKSGLPATTS ERLELLDD+EHI  MRIVGGDHRL+               
Sbjct  81   QIGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLKIIWNFSNFISTSSSK  140

Query  495  --NYTSIVTVHPEIIDGRPGTLVIESFVV  575
              NY+SIVTVHPE+IDGRPGTLVIESFVV
Sbjct  141  LQNYSSIVTVHPEVIDGRPGTLVIESFVV  169



>ref|XP_010053803.1| PREDICTED: abscisic acid receptor PYL9-like [Eucalyptus grandis]
 gb|KCW78162.1| hypothetical protein EUGRSUZ_D02364 [Eucalyptus grandis]
Length=187

 Score =   233 bits (593),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +3

Query  153  MMNGDRRSDV-EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPF  329
            M  GD  S + E EYIRRHHKHE  E QC+S ++K I+APVHLVWSLVRRFDQPQ+YKPF
Sbjct  1    MNGGDAVSGIMEAEYIRRHHKHEAGERQCTSAVIKRIKAPVHLVWSLVRRFDQPQKYKPF  60

Query  330  VSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSI  509
            VSRCI++GDL IGSVREVNVKSGLPATTS ERLELLDD+EHIL +RIVGGDHRL+NY+SI
Sbjct  61   VSRCIMKGDLGIGSVREVNVKSGLPATTSTERLELLDDEEHILGIRIVGGDHRLKNYSSI  120

Query  510  VTVHPEIIDGRPGTLVIESFVV  575
            +TVHP++++GRPGTLVIESFVV
Sbjct  121  MTVHPDMVEGRPGTLVIESFVV  142



>ref|XP_003541499.1| PREDICTED: abscisic acid receptor PYL8-like isoform X1 [Glycine 
max]
 gb|KHN47925.1| Abscisic acid receptor PYL8 [Glycine soja]
Length=191

 Score =   233 bits (593),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            S+VE EYIRRHH+HE  ENQC S LVKHIRAPV  VWSLVRRFDQPQ+YKPFVSRC+V+G
Sbjct  13   SNVEMEYIRRHHRHEPGENQCGSALVKHIRAPVPQVWSLVRRFDQPQKYKPFVSRCVVRG  72

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            +LEIGS+REV+VKSGLPATTS ERLELLDD+EH+LS+RI+GGDHRLRNY+SI+++HPEII
Sbjct  73   NLEIGSLREVDVKSGLPATTSTERLELLDDNEHLLSIRIIGGDHRLRNYSSIMSLHPEII  132

Query  534  DGRPGTLVIESFVV  575
            DGRPGTLVIESFVV
Sbjct  133  DGRPGTLVIESFVV  146



>ref|XP_003544752.1| PREDICTED: abscisic acid receptor PYL8-like isoform X1 [Glycine 
max]
 gb|KHN23699.1| Abscisic acid receptor PYL8 [Glycine soja]
Length=193

 Score =   233 bits (593),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            S+VE EYIRRHH+HE  ENQC S LVKHIRAPV  VWSLVRRFDQPQ+YKPF+SRC+V+G
Sbjct  15   SNVEMEYIRRHHRHEPGENQCGSALVKHIRAPVPQVWSLVRRFDQPQKYKPFISRCVVRG  74

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            +LEIGS+REV+VKSGLPATTS ERLELLDD+EHILS+RI+GGDHRLRNY+SI+++HPEII
Sbjct  75   NLEIGSLREVDVKSGLPATTSTERLELLDDNEHILSIRIIGGDHRLRNYSSIMSLHPEII  134

Query  534  DGRPGTLVIESFVV  575
            DGRPGTLVIESFVV
Sbjct  135  DGRPGTLVIESFVV  148



>ref|XP_009352050.1| PREDICTED: abscisic acid receptor PYL8-like [Pyrus x bretschneideri]
 ref|XP_009352051.1| PREDICTED: abscisic acid receptor PYL8-like [Pyrus x bretschneideri]
Length=197

 Score =   233 bits (593),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 127/130 (98%), Gaps = 0/130 (0%)
 Frame = +3

Query  186  DEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEI  365
            ++YIRRHHKH++ ++QC+S LV+HI+APVHLVWSLVR+FDQPQ+YKPFVSRC+VQG+LEI
Sbjct  23   NDYIRRHHKHDLNDHQCTSTLVRHIKAPVHLVWSLVRQFDQPQKYKPFVSRCVVQGNLEI  82

Query  366  GSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRP  545
            GS+REV+VKSGLPATTS ERLELLDDDEHILS++I+GGDHRLRNY+SI+++HPEIIDGRP
Sbjct  83   GSLREVDVKSGLPATTSTERLELLDDDEHILSIKIIGGDHRLRNYSSIISLHPEIIDGRP  142

Query  546  GTLVIESFVV  575
            GTLVIESFVV
Sbjct  143  GTLVIESFVV  152



>ref|XP_010097852.1| hypothetical protein L484_011451 [Morus notabilis]
 gb|EXB72449.1| hypothetical protein L484_011451 [Morus notabilis]
Length=194

 Score =   233 bits (593),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E ++IRRHH+HE  +NQCSS L +HI+APVHLVWSLVRRFDQPQ+YKPF+SRC+VQG+L
Sbjct  18   LESDFIRRHHRHETGDNQCSSVLSRHIKAPVHLVWSLVRRFDQPQKYKPFISRCVVQGNL  77

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGS+REV+VKSGLPATTS ERLE LDD+EHILSMRI+GGDHRLRNY+SI ++HPEIIDG
Sbjct  78   EIGSLREVDVKSGLPATTSTERLEFLDDNEHILSMRIIGGDHRLRNYSSISSLHPEIIDG  137

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  138  RPGTLVIESFVV  149



>ref|XP_008234775.1| PREDICTED: abscisic acid receptor PYL8 [Prunus mume]
Length=191

 Score =   232 bits (592),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            EYIRRHHKH+ +++QC+S LV+HI+APVHLVWSLVRRFDQPQ+YKPFVSRC+VQG+LEIG
Sbjct  18   EYIRRHHKHDPKDHQCTSTLVRHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVVQGNLEIG  77

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV+VKSGLPATTS ERLELLDDDEHILS++I+GGDHRLRNY+SI+++HPEIIDGRPG
Sbjct  78   SLREVDVKSGLPATTSTERLELLDDDEHILSIKIIGGDHRLRNYSSIISLHPEIIDGRPG  137

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  138  TVVIESFVV  146



>ref|XP_004308004.1| PREDICTED: abscisic acid receptor PYL8 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=232

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 127/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            EYIRRHH+HE++++QCSS LV+HI+APVHLVWSLVRRFDQPQ+YKPFVSRC+VQG+LEIG
Sbjct  59   EYIRRHHRHELKDHQCSSTLVRHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVVQGNLEIG  118

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV+VKSGLPATTS ERLELLDDDEH+LS++I+GGDHRLRNY+SI+++HPEI+DGRPG
Sbjct  119  SLREVDVKSGLPATTSTERLELLDDDEHLLSIKIIGGDHRLRNYSSIISLHPEIVDGRPG  178

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  179  TVVIESFVV  187



>ref|XP_009368678.1| PREDICTED: abscisic acid receptor PYL8-like [Pyrus x bretschneideri]
Length=204

 Score =   232 bits (592),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +YIRRHH+H++ + QC+S LV+HI+APVHLVWSLVRRFDQPQ+YKPFVSRC+VQG+LEIG
Sbjct  31   DYIRRHHRHDLNDRQCTSTLVRHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVVQGNLEIG  90

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV+VKSGLPATTS ERLELLDDDEHILS++I+GGDHRLRNY+SI+++HPEIIDGRPG
Sbjct  91   SLREVDVKSGLPATTSTERLELLDDDEHILSIKIIGGDHRLRNYSSIISLHPEIIDGRPG  150

Query  549  TLVIESFVV  575
            TLVIESFVV
Sbjct  151  TLVIESFVV  159



>gb|KJB74714.1| hypothetical protein B456_012G003800 [Gossypium raimondii]
 gb|KJB74715.1| hypothetical protein B456_012G003800 [Gossypium raimondii]
Length=190

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            E++RRHH+HE  ENQCSS +VK I+APV LVWSLVRRFDQPQ+YKPFVSRC+ QG+LEIG
Sbjct  18   EFVRRHHRHETGENQCSSAVVKRIKAPVPLVWSLVRRFDQPQKYKPFVSRCVAQGNLEIG  77

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV+VKSGLPATTS ERLELLDDDEHILS+RI+GGDHRL+NY+SI+++HPEIIDGRPG
Sbjct  78   SLREVDVKSGLPATTSTERLELLDDDEHILSIRIIGGDHRLKNYSSIISLHPEIIDGRPG  137

Query  549  TLVIESFVV  575
            TLVIESFVV
Sbjct  138  TLVIESFVV  146



>gb|ACJ83958.1| unknown [Medicago truncatula]
Length=199

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 4/144 (3%)
 Frame = +3

Query  156  MNGDRRSDV----EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYK  323
            MNG   + V    E EYIRRHH  +  ENQCSS LVKHIRAPV LVWSLVRRFDQPQ+YK
Sbjct  4    MNGTENNGVFNSTEMEYIRRHHNQQPGENQCSSALVKHIRAPVPLVWSLVRRFDQPQKYK  63

Query  324  PFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYT  503
            PFVSRC+V+G+LEIGS+REV+VKSGLPATTS ERLE+LDD+EHILS+RI+GGDHRLRNY+
Sbjct  64   PFVSRCVVRGNLEIGSLREVDVKSGLPATTSTERLEVLDDNEHILSIRIIGGDHRLRNYS  123

Query  504  SIVTVHPEIIDGRPGTLVIESFVV  575
            SI+++HPEIIDGRPGTLVIESFVV
Sbjct  124  SIMSLHPEIIDGRPGTLVIESFVV  147



>gb|ACJ86004.1| unknown [Medicago truncatula]
 gb|AFK43446.1| unknown [Medicago truncatula]
Length=199

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 4/144 (3%)
 Frame = +3

Query  156  MNGDRRSDV----EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYK  323
            MNG   + V    E EYIRRHH  +  ENQCSS LVKHIRAPV LVWSLVRRFDQPQ+YK
Sbjct  4    MNGTENNGVFNSTEMEYIRRHHNQQPGENQCSSALVKHIRAPVPLVWSLVRRFDQPQKYK  63

Query  324  PFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYT  503
            PFVSRC+V+G+LEIGS+REV+VKSGLPATTS ERLE+LDD+EHILS+RI+GGDHRLRNY+
Sbjct  64   PFVSRCVVRGNLEIGSLREVDVKSGLPATTSTERLEVLDDNEHILSIRIIGGDHRLRNYS  123

Query  504  SIVTVHPEIIDGRPGTLVIESFVV  575
            SI+++HPEIIDGRPGTLVIESFVV
Sbjct  124  SIMSLHPEIIDGRPGTLVIESFVV  147



>ref|XP_009357323.1| PREDICTED: abscisic acid receptor PYL8-like [Pyrus x bretschneideri]
Length=201

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +YIRRHH+H++ + QC+S LV+HI+APVHLVWSLVRRFDQPQ+YKPFVSRC+VQG+LEIG
Sbjct  28   DYIRRHHRHDLNDRQCTSTLVRHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVVQGNLEIG  87

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV+VKSGLPATTS ERLELLDDDEHILS++I+GGDHRLRNY+SI+++HPEIIDGRPG
Sbjct  88   SLREVDVKSGLPATTSTERLELLDDDEHILSIKIIGGDHRLRNYSSIISLHPEIIDGRPG  147

Query  549  TLVIESFVV  575
            TLVIESFVV
Sbjct  148  TLVIESFVV  156



>ref|XP_003602205.1| Abscisic acid receptor PYL8 [Medicago truncatula]
 gb|AES72456.1| abscisic acid receptor PYL9-like protein [Medicago truncatula]
 gb|AFK47693.1| unknown [Medicago truncatula]
Length=199

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 4/144 (3%)
 Frame = +3

Query  156  MNGDRRSDV----EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYK  323
            MNG   + V    E EYIRRHH  +  ENQCSS LVKHIRAPV LVWSLVRRFDQPQ+YK
Sbjct  4    MNGTENNGVFNSTEMEYIRRHHNQQPGENQCSSALVKHIRAPVPLVWSLVRRFDQPQKYK  63

Query  324  PFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYT  503
            PFVSRC+V+G+LEIGS+REV+VKSGLPATTS ERLE+LDD+EHILS+RI+GGDHRLRNY+
Sbjct  64   PFVSRCVVRGNLEIGSLREVDVKSGLPATTSTERLEVLDDNEHILSIRIIGGDHRLRNYS  123

Query  504  SIVTVHPEIIDGRPGTLVIESFVV  575
            SI+++HPEIIDGRPGTLVIESFVV
Sbjct  124  SIMSLHPEIIDGRPGTLVIESFVV  147



>ref|XP_007218488.1| hypothetical protein PRUPE_ppa012114mg [Prunus persica]
 ref|XP_008233200.1| PREDICTED: abscisic acid receptor PYL9-like [Prunus mume]
 gb|EMJ19687.1| hypothetical protein PRUPE_ppa012114mg [Prunus persica]
Length=183

 Score =   230 bits (587),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E +YI+RHH+HE RE QC+S LV+HI+AP HLVWSLVRRFDQPQ+YKPFVSRC ++GDL
Sbjct  8    MEAQYIQRHHRHEPRETQCTSALVRHIKAPAHLVWSLVRRFDQPQKYKPFVSRCTMKGDL  67

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGSVREVNVKSGLPATTS ERLELLDDDEHIL ++IVGGDHRLRNY+SI+TVHPE+IDG
Sbjct  68   GIGSVREVNVKSGLPATTSTERLELLDDDEHILGIKIVGGDHRLRNYSSIITVHPEVIDG  127

Query  540  RPGTLVIESFVV  575
            R GTLVIESFVV
Sbjct  128  RLGTLVIESFVV  139



>ref|XP_007218467.1| hypothetical protein PRUPE_ppa011927mg [Prunus persica]
 gb|EMJ19666.1| hypothetical protein PRUPE_ppa011927mg [Prunus persica]
Length=191

 Score =   231 bits (588),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            EYIRRHHKH+ +++QC+S LV+HI+APVHLVWSLVRRFDQPQ+YKPFVSRC+VQG+LEIG
Sbjct  18   EYIRRHHKHDPKDHQCTSTLVRHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVVQGNLEIG  77

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV+VKSGLPATTS ERLELLDDDEHILS++I+GGDHRLRNY+SI+++HPEI DGRPG
Sbjct  78   SLREVDVKSGLPATTSTERLELLDDDEHILSIKIIGGDHRLRNYSSIISLHPEITDGRPG  137

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  138  TVVIESFVV  146



>gb|KHG04020.1| Abscisic acid receptor PYL8 -like protein [Gossypium arboreum]
 gb|KHG15235.1| Abscisic acid receptor PYL8 -like protein [Gossypium arboreum]
Length=190

 Score =   230 bits (586),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            EYIRRHH HE+ ENQCSS LVKHI+APV LVWSLVRRFDQPQ+YKPFVSRCI QG+LEIG
Sbjct  18   EYIRRHHLHEIGENQCSSTLVKHIKAPVPLVWSLVRRFDQPQKYKPFVSRCIAQGNLEIG  77

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV VKSGLPATTS ERLELLDD+EHILS+RIV GDHRL+NY+SI+++HPEII+GRPG
Sbjct  78   SLREVYVKSGLPATTSTERLELLDDNEHILSIRIVCGDHRLKNYSSIISLHPEIINGRPG  137

Query  549  TLVIESFVV  575
            TLVIESFVV
Sbjct  138  TLVIESFVV  146



>ref|XP_002318380.1| hypothetical protein POPTR_0012s01550g [Populus trichocarpa]
 ref|XP_011001856.1| PREDICTED: abscisic acid receptor PYL8-like [Populus euphratica]
 gb|EEE96600.1| hypothetical protein POPTR_0012s01550g [Populus trichocarpa]
Length=191

 Score =   230 bits (586),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 126/133 (95%), Gaps = 1/133 (1%)
 Frame = +3

Query  180  VEDEYIRRHHKH-EVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGD  356
            VE EYIRRHHKH ++ ++QCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPF+SRC+V G+
Sbjct  14   VESEYIRRHHKHGDLADHQCSSALVKHIKAPVHLVWSLVRRFDQPQKYKPFISRCVVLGN  73

Query  357  LEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID  536
            LEIGS+REV+V+SGLPATTS ERLELLDDDEHI S+RIVGGDHRL+NY+S++++HPEIID
Sbjct  74   LEIGSLREVDVRSGLPATTSTERLELLDDDEHIFSIRIVGGDHRLKNYSSVISLHPEIID  133

Query  537  GRPGTLVIESFVV  575
            GRPGTLVIESFVV
Sbjct  134  GRPGTLVIESFVV  146



>ref|XP_008376697.1| PREDICTED: abscisic acid receptor PYL8 [Malus domestica]
Length=204

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +YIRRHH+H++ ++QC+S LV++I+APVHLVWSLVRRFDQPQ+YKPFVSRC+VQG+LEIG
Sbjct  31   DYIRRHHRHDLNDHQCTSTLVRYIKAPVHLVWSLVRRFDQPQKYKPFVSRCVVQGNLEIG  90

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV+VKSGLPATTS ERLELLDD+EHILS++I+GGDHRLRNY+SI+++HPEIIDGRPG
Sbjct  91   SLREVBVKSGLPATTSTERLELLDDEEHILSIKIIGGDHRLRNYSSIISLHPEIIDGRPG  150

Query  549  TLVIESFVV  575
            TLVIESFVV
Sbjct  151  TLVIESFVV  159



>ref|XP_010556594.1| PREDICTED: abscisic acid receptor PYL9 [Tarenaya hassleriana]
Length=192

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+R HH H  R +QC+S LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRCIV GD EIG
Sbjct  18   QYVRMHHHHLCRNDQCTSALVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCIVNGDPEIG  77

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            SVREVNVKSGLPATTS ERLELLDDDEHIL ++IVGGDHRL+NY+S+VTVHPE+IDGRPG
Sbjct  78   SVREVNVKSGLPATTSTERLELLDDDEHILGIKIVGGDHRLKNYSSVVTVHPEMIDGRPG  137

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  138  TMVIESFVV  146



>ref|XP_006305674.1| hypothetical protein CARUB_v10010391mg [Capsella rubella]
 gb|EOA38572.1| hypothetical protein CARUB_v10010391mg [Capsella rubella]
Length=186

 Score =   229 bits (584),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = +3

Query  174  SDVED-EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQ  350
             DVE  +YIR HH+H  RENQC+S LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC V 
Sbjct  13   GDVETVQYIRTHHQHHCRENQCTSALVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCTVI  72

Query  351  GDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEI  530
            GD EIGS+REVNVKSGLPATTS ERLELLDDDEHIL +RI+GGDHRL+NY+SIVTVHPEI
Sbjct  73   GDPEIGSLREVNVKSGLPATTSTERLELLDDDEHILGIRIIGGDHRLKNYSSIVTVHPEI  132

Query  531  IDGRPGTLVIESFVV  575
            I+GR GT+VIESFVV
Sbjct  133  IEGRAGTMVIESFVV  147



>gb|KJB37343.1| hypothetical protein B456_006G200700 [Gossypium raimondii]
Length=167

 Score =   228 bits (580),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            S    EYI+RHH+HE  ENQCSS LVK I+AP+ LVWSLVRRFD+PQ+YKPFVSRC+  G
Sbjct  6    SAAATEYIKRHHRHEAGENQCSSALVKLIKAPLPLVWSLVRRFDEPQKYKPFVSRCVAPG  65

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            +LEIGS+REV+VKSGLPATTS ERLELLDD+EHILS+RI+GGDHRL+NY+SI++VHPEII
Sbjct  66   NLEIGSLREVDVKSGLPATTSTERLELLDDNEHILSIRIIGGDHRLQNYSSIISVHPEII  125

Query  534  DGRPGTLVIESFVV  575
            DGRPGTLVIESFVV
Sbjct  126  DGRPGTLVIESFVV  139



>gb|KJB39703.1| hypothetical protein B456_007G026100 [Gossypium raimondii]
Length=182

 Score =   228 bits (581),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 11/140 (8%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+R + VE+E+I+++HKH+V+ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  9    MNGNRFTKVEEEFIKKYHKHDVKENQCSSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVS  68

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC++QGDL+IGSVREVNVKSGLPATTS ERLE LDDDEHILSMRIVGGDHRL+       
Sbjct  69   RCVLQGDLQIGSVREVNVKSGLPATTSTERLEYLDDDEHILSMRIVGGDHRLK-------  121

Query  516  VHPEIIDGRPGTLVIESFVV  575
                +IDGRPGTLVIESFVV
Sbjct  122  ----VIDGRPGTLVIESFVV  137



>ref|XP_008465378.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis melo]
Length=184

 Score =   228 bits (580),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            S++E E IRRHH+HE  +NQCSS L+KHI+APV LVWSLVRRFDQPQ+YKPF+SRC+VQG
Sbjct  8    SNLERECIRRHHRHEPADNQCSSVLIKHIKAPVPLVWSLVRRFDQPQKYKPFISRCVVQG  67

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            +LEIGS+REV+VKSGLPATTS ERLELLDDD+HILS+RIVGGDHRLRNY+SI+++H EII
Sbjct  68   NLEIGSLREVDVKSGLPATTSTERLELLDDDKHILSIRIVGGDHRLRNYSSIISLHSEII  127

Query  534  DGRPGTLVIESFVV  575
            +GRPGTLV+ESFVV
Sbjct  128  EGRPGTLVVESFVV  141



>gb|KJB37344.1| hypothetical protein B456_006G200700 [Gossypium raimondii]
Length=190

 Score =   228 bits (581),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            S    EYI+RHH+HE  ENQCSS LVK I+AP+ LVWSLVRRFD+PQ+YKPFVSRC+  G
Sbjct  6    SAAATEYIKRHHRHEAGENQCSSALVKLIKAPLPLVWSLVRRFDEPQKYKPFVSRCVAPG  65

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            +LEIGS+REV+VKSGLPATTS ERLELLDD+EHILS+RI+GGDHRL+NY+SI++VHPEII
Sbjct  66   NLEIGSLREVDVKSGLPATTSTERLELLDDNEHILSIRIIGGDHRLQNYSSIISVHPEII  125

Query  534  DGRPGTLVIESFVV  575
            DGRPGTLVIESFVV
Sbjct  126  DGRPGTLVIESFVV  139



>ref|XP_010521388.1| PREDICTED: abscisic acid receptor PYL8 [Tarenaya hassleriana]
Length=190

 Score =   228 bits (580),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +3

Query  141  MTAGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRY  320
            M A        +  E EYIRRHH+HE  ENQ SS LVKHI+APVHLVWSLVRRFD+PQ+Y
Sbjct  1    MNANGTENVMAASPEREYIRRHHRHEPMENQSSSTLVKHIKAPVHLVWSLVRRFDKPQKY  60

Query  321  KPFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNY  500
            KPFVSRC+V+G+LEIG+VREV+VKSGLPAT S ERLE LDD+EHILS+RIVGGDHRL+NY
Sbjct  61   KPFVSRCVVKGNLEIGTVREVDVKSGLPATKSTERLEFLDDNEHILSIRIVGGDHRLKNY  120

Query  501  TSIVTVHPEIIDGRPGTLVIESFVV  575
            +S++++HPE I+GRPGTLVIESFVV
Sbjct  121  SSVISLHPETIEGRPGTLVIESFVV  145



>emb|CDP05086.1| unnamed protein product [Coffea canephora]
Length=187

 Score =   227 bits (579),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            S  E EYIR+HH H+  +NQCSS L+K I+APVHLVWSLVRRFDQPQ+YKPFVSRC+V+G
Sbjct  9    SGAEREYIRKHHSHQPADNQCSSILIKRIKAPVHLVWSLVRRFDQPQKYKPFVSRCVVRG  68

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            +LEIGS+REV+VKSGLPATTS ERLELLDD+EH+LS+R +GGDHRL+NY+SI++VHPE+I
Sbjct  69   NLEIGSLREVDVKSGLPATTSTERLELLDDEEHVLSVRFIGGDHRLKNYSSIISVHPEVI  128

Query  534  DGRPGTLVIESFVV  575
            +GRPGTLVIESFVV
Sbjct  129  EGRPGTLVIESFVV  142



>ref|XP_006418416.1| hypothetical protein EUTSA_v10008854mg [Eutrema salsugineum]
 gb|ESQ36769.1| hypothetical protein EUTSA_v10008854mg [Eutrema salsugineum]
Length=190

 Score =   227 bits (579),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+R HH+H  RENQC+S LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC V GD EIG
Sbjct  22   QYVRTHHQHHCRENQCTSALVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIG  81

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDDDEHIL ++I+GGDHRL+NY+SIVTVHPEII+GR G
Sbjct  82   SLREVNVKSGLPATTSTERLELLDDDEHILGIKIIGGDHRLKNYSSIVTVHPEIIEGRAG  141

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  142  TMVIESFVV  150



>ref|XP_002864227.1| hypothetical protein ARALYDRAFT_918386 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40486.1| hypothetical protein ARALYDRAFT_918386 [Arabidopsis lyrata subsp. 
lyrata]
Length=193

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  165  DRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCI  344
            ++  ++E E+IRRHH HE+ ENQCSS LVKHI APVH+VWSLVRRFDQPQ+YKPF+SRC+
Sbjct  11   NQNPNLEREFIRRHHNHELVENQCSSTLVKHINAPVHIVWSLVRRFDQPQKYKPFISRCV  70

Query  345  VQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHP  524
            V+G++EIG+VREV+VKSGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY+SI+++HP
Sbjct  71   VKGNMEIGTVREVDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSIISLHP  130

Query  525  EIIDGRPGTLVIESFVV  575
            E I+GR GTLVIESFVV
Sbjct  131  ETIEGRIGTLVIESFVV  147



>ref|XP_002892069.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68328.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=190

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+R HH+H  RENQC+S LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC V GD EIG
Sbjct  19   QYVRTHHQHHCRENQCTSALVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIG  78

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDD+EHIL ++I+GGDHRL+NY+SIVTVHPEII+GR G
Sbjct  79   SLREVNVKSGLPATTSTERLELLDDEEHILGIKIIGGDHRLKNYSSIVTVHPEIIEGRAG  138

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  139  TMVIESFVV  147



>ref|XP_011005521.1| PREDICTED: abscisic acid receptor PYL8-like isoform X1 [Populus 
euphratica]
Length=191

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 125/133 (94%), Gaps = 1/133 (1%)
 Frame = +3

Query  180  VEDEYIRRHHKHE-VRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGD  356
            VE EYIRRHH H+ + ++QCSS LVKHI+APV LVWSLVRRFDQPQ+YKPF+SRC+V G+
Sbjct  14   VESEYIRRHHTHDDLADHQCSSALVKHIKAPVQLVWSLVRRFDQPQKYKPFISRCVVLGN  73

Query  357  LEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID  536
            LEIGS+REV+V+SGLPATTS ERLELLDDDEHILS+RIVGGDHRL+NY+SI+++HPEIID
Sbjct  74   LEIGSLREVDVRSGLPATTSTERLELLDDDEHILSIRIVGGDHRLKNYSSIISLHPEIID  133

Query  537  GRPGTLVIESFVV  575
            GRPGTLVIESFVV
Sbjct  134  GRPGTLVIESFVV  146



>emb|CAN82501.1| hypothetical protein VITISV_004915 [Vitis vinifera]
 emb|CBI40501.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   226 bits (575),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E + I RHH HE RENQCSS LV+H++AP +LVWSLVRRFDQPQ+YKPFVSRC+VQGDL
Sbjct  2    MEAQVICRHHAHEPRENQCSSVLVRHVKAPANLVWSLVRRFDQPQKYKPFVSRCVVQGDL  61

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGSVREVNVK+GLPATTS ERLEL DDDEH+L ++I+ GDHRLRNY+S++TVHPEIIDG
Sbjct  62   RIGSVREVNVKTGLPATTSTERLELFDDDEHVLGIKILDGDHRLRNYSSVITVHPEIIDG  121

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  122  RPGTLVIESFVV  133



>ref|XP_002321450.1| hypothetical protein POPTR_0015s02210g [Populus trichocarpa]
 gb|EEF05577.1| hypothetical protein POPTR_0015s02210g [Populus trichocarpa]
Length=191

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 125/133 (94%), Gaps = 1/133 (1%)
 Frame = +3

Query  180  VEDEYIRRHHKHE-VRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGD  356
            VE EYIRRHH H+ + ++QCSS LVKHI+APV LVWSLVRRFDQPQ+YKPF+SRC+V G+
Sbjct  14   VESEYIRRHHTHDDLADHQCSSALVKHIKAPVQLVWSLVRRFDQPQKYKPFISRCVVLGN  73

Query  357  LEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID  536
            LEIGS+REV+V+SGLPATTS ERLELLDDDEHILS+RIVGGDHRL+NY+SI+++HPEIID
Sbjct  74   LEIGSLREVDVRSGLPATTSTERLELLDDDEHILSIRIVGGDHRLKNYSSIISLHPEIID  133

Query  537  GRPGTLVIESFVV  575
            GRPGTLVIESFVV
Sbjct  134  GRPGTLVIESFVV  146



>ref|XP_010055027.1| PREDICTED: abscisic acid receptor PYL9-like [Eucalyptus grandis]
 gb|KCW71517.1| hypothetical protein EUGRSUZ_E00065 [Eucalyptus grandis]
Length=186

 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 128/141 (91%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNG-DRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MNG +    +E +YI+RHH+H+ R++QC+S L KHI+APV+LVWSLVRRFDQPQ+YKPF+
Sbjct  1    MNGREAVGTMEAQYIQRHHRHDPRDHQCTSALFKHIKAPVNLVWSLVRRFDQPQKYKPFI  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC ++G+L IGSVREVNVKSGLPATTS ERLELLDD+EHIL +RIVGGDHRLRNY+S++
Sbjct  61   SRCTMRGELGIGSVREVNVKSGLPATTSTERLELLDDEEHILGVRIVGGDHRLRNYSSVM  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGTLVIESFVV
Sbjct  121  TVHPEVIDGRPGTLVIESFVV  141



>ref|XP_002281200.1| PREDICTED: abscisic acid receptor PYL9 [Vitis vinifera]
Length=192

 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E + I RHH HE RENQCSS LV+H++AP +LVWSLVRRFDQPQ+YKPFVSRC+VQGDL
Sbjct  16   MEAQVICRHHAHEPRENQCSSVLVRHVKAPANLVWSLVRRFDQPQKYKPFVSRCVVQGDL  75

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGSVREVNVK+GLPATTS ERLEL DDDEH+L ++I+ GDHRLRNY+S++TVHPEIIDG
Sbjct  76   RIGSVREVNVKTGLPATTSTERLELFDDDEHVLGIKILDGDHRLRNYSSVITVHPEIIDG  135

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  136  RPGTLVIESFVV  147



>ref|NP_200128.1| regulatory component of ABA receptor 3 [Arabidopsis thaliana]
 sp|Q9FGM1.1|PYL8_ARATH RecName: Full=Abscisic acid receptor PYL8; AltName: Full=ABI1-binding 
protein 1; AltName: Full=PYR1-like protein 8; AltName: 
Full=Regulatory components of ABA receptor 3 [Arabidopsis 
thaliana]
 dbj|BAB08419.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO24544.1| At5g53160 [Arabidopsis thaliana]
 gb|AED96316.1| regulatory component of ABA receptor 3 [Arabidopsis thaliana]
Length=188

 Score =   226 bits (575),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  141  MTAGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRY  320
            M A  +      + E E+IRRHHKHE+ +NQCSS LVKHI APVH+VWSLVRRFDQPQ+Y
Sbjct  1    MEANGIENLTNPNQEREFIRRHHKHELVDNQCSSTLVKHINAPVHIVWSLVRRFDQPQKY  60

Query  321  KPFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNY  500
            KPF+SRC+V+G++EIG+VREV+VKSGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY
Sbjct  61   KPFISRCVVKGNMEIGTVREVDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNY  120

Query  501  TSIVTVHPEIIDGRPGTLVIESFVV  575
            +SI+++HPE I+GR GTLVIESFVV
Sbjct  121  SSIISLHPETIEGRIGTLVIESFVV  145



>dbj|BAF00266.1| hypothetical protein [Arabidopsis thaliana]
Length=188

 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  141  MTAGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRY  320
            M A         + E E+IRRHHKHE+ +NQCSS LVKHI APVH+VWSLVRRFDQPQ+Y
Sbjct  1    MEANGFENLTNPNQEREFIRRHHKHELVDNQCSSTLVKHINAPVHIVWSLVRRFDQPQKY  60

Query  321  KPFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNY  500
            KPF+SRC+V+G++EIG+VREV+VKSGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY
Sbjct  61   KPFISRCVVKGNMEIGTVREVDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNY  120

Query  501  TSIVTVHPEIIDGRPGTLVIESFVV  575
            +SI+++HPE I+GR GTLVIESFVV
Sbjct  121  SSIISLHPETIEGRIGTLVIESFVV  145



>dbj|BAF63139.1| hypothetical protein [Arabidopsis suecica]
Length=189

 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+R HH+H  RENQC+S LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC V GD EIG
Sbjct  18   QYVRTHHQHHCRENQCTSALVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIG  77

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDD+EHIL ++I+GGDHRL+NY+SIVT+HPEII+GR G
Sbjct  78   SLREVNVKSGLPATTSTERLELLDDEEHILGIKIIGGDHRLKNYSSIVTLHPEIIEGRAG  137

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  138  TMVIESFVV  146



>emb|CDY15183.1| BnaC05g00620D [Brassica napus]
Length=187

 Score =   225 bits (574),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+RRHH+H  RE+QC+S LVKHI+AP+HLVWS+VRRFD+PQ+YKPFVSRC V GD EIG
Sbjct  15   QYVRRHHQHSCREDQCTSALVKHIKAPLHLVWSVVRRFDEPQKYKPFVSRCTVIGDPEIG  74

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLD+DEHIL ++I+GGDHRL+NY+SIVTVHPEII+GRPG
Sbjct  75   SLREVNVKSGLPATTSTERLELLDEDEHILGIKIIGGDHRLKNYSSIVTVHPEIIEGRPG  134

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  135  TMVIESFVV  143



>ref|XP_010448063.1| PREDICTED: abscisic acid receptor PYL10-like [Camelina sativa]
Length=181

 Score =   225 bits (573),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 127/143 (89%), Gaps = 5/143 (3%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MMNGD   ++E EYI+RHH HE+ ENQCSS LVKHI AP+HLVWSLVRRFDQPQ+YKPF+
Sbjct  1    MMNGD---EIESEYIKRHHSHELLENQCSSTLVKHINAPLHLVWSLVRRFDQPQKYKPFI  57

Query  333  SRCIVQG-DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSI  509
            SRC+VQG  LEIG+VREV+V+SGLPAT S ERLE LDDD+HILS+RI+GGDHRL+NY+SI
Sbjct  58   SRCVVQGKKLEIGTVREVDVRSGLPATKSTERLEFLDDDQHILSVRILGGDHRLKNYSSI  117

Query  510  VTVHP-EIIDGRPGTLVIESFVV  575
            +++HP E I+GR GTLVIESFVV
Sbjct  118  ISLHPAETIEGRAGTLVIESFVV  140



>ref|XP_006655099.1| PREDICTED: abscisic acid receptor PYL8-like, partial [Oryza brachyantha]
Length=179

 Score =   225 bits (573),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            +  E E++RR H H   E+QCSS LVKHI+APVHLVWSLVR FDQPQRYKPFVSRC+V+G
Sbjct  1    AAAEAEHMRRLHSHAPGEHQCSSALVKHIKAPVHLVWSLVRSFDQPQRYKPFVSRCVVRG  60

Query  354  -DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEI  530
             DLEIGSVREVNVK+GLPATTS ERLELLDDDEHILS++ VGGDHRLRNY+SI+TVHPE 
Sbjct  61   GDLEIGSVREVNVKTGLPATTSTERLELLDDDEHILSVKFVGGDHRLRNYSSIITVHPES  120

Query  531  IDGRPGTLVIESFVV  575
            IDGRPGTLVIESFVV
Sbjct  121  IDGRPGTLVIESFVV  135



>ref|XP_004149459.1| PREDICTED: abscisic acid receptor PYL8-like isoform 1 [Cucumis 
sativus]
 ref|XP_004166501.1| PREDICTED: abscisic acid receptor PYL8-like isoform 1 [Cucumis 
sativus]
 gb|KGN57855.1| hypothetical protein Csa_3G354490 [Cucumis sativus]
Length=184

 Score =   225 bits (573),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            + +E E IRRHH+H+  +NQCSS L+KHI+APV LVWSLVRRFDQPQ+YKPF+SRC+VQG
Sbjct  8    TSLERECIRRHHRHDPADNQCSSVLIKHIKAPVPLVWSLVRRFDQPQKYKPFISRCVVQG  67

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            +LEIGS+REV+VKSGLPATTS ERLELLDDD+HILS+RIVGGDHRLRNY+SI+++H EII
Sbjct  68   NLEIGSLREVDVKSGLPATTSTERLELLDDDKHILSIRIVGGDHRLRNYSSIISLHSEII  127

Query  534  DGRPGTLVIESFVV  575
            +GRPGTLV+ESFVV
Sbjct  128  EGRPGTLVVESFVV  141



>ref|XP_009786413.1| PREDICTED: abscisic acid receptor PYL8-like [Nicotiana sylvestris]
Length=186

 Score =   225 bits (573),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            S VE EYI++HH H+  ENQC+S L+KHIRAP+ LVWSLVRRFDQP++YKPFVSRCI QG
Sbjct  8    SGVEKEYIKKHHSHDPAENQCTSLLIKHIRAPLPLVWSLVRRFDQPEKYKPFVSRCISQG  67

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            +LEIGS+REV+V+SGLPATTS ERLELL+D++HIL +RIVGGDHRLRNY+SI+++HPE+I
Sbjct  68   NLEIGSLREVDVRSGLPATTSTERLELLNDEDHILCVRIVGGDHRLRNYSSIISLHPEVI  127

Query  534  DGRPGTLVIESFVV  575
            DGRPGTLVIESFVV
Sbjct  128  DGRPGTLVIESFVV  141



>ref|NP_001284557.1| abscisic acid receptor PYL8-like [Solanum tuberosum]
 gb|AID52825.1| abscisic acid receptor PYL8 [Solanum tuberosum]
Length=186

 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E ++I R+H H+  ENQCSS LVKHI+APV +VWSLVRRFDQPQ+YKPF+SRC V+GDL
Sbjct  1    MEAQFIERYHSHQPSENQCSSSLVKHIKAPVDIVWSLVRRFDQPQKYKPFISRCTVKGDL  60

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGSVREVNVKSGLPATTS ERLELLDD+EHIL +RIVGGDHRL+NY+S++TVHP+ +DG
Sbjct  61   TIGSVREVNVKSGLPATTSTERLELLDDEEHILGIRIVGGDHRLKNYSSVITVHPKTLDG  120

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  121  RPGTLVIESFVV  132



>ref|XP_010474732.1| PREDICTED: abscisic acid receptor PYL9-like [Camelina sativa]
Length=183

 Score =   224 bits (572),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            EY+R  HKH  RENQC+S LVKHI+AP+HLVWSLVRRFDQPQ+YKPFVSRC V GD EIG
Sbjct  15   EYVRTQHKHHCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIG  74

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDD+EHIL +RI+GGDHRL+NY+SIVTVHPE+I+GR G
Sbjct  75   SLREVNVKSGLPATTSTERLELLDDEEHILGIRIIGGDHRLKNYSSIVTVHPEMIEGRAG  134

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  135  TMVIESFVV  143



>ref|XP_009380524.1| PREDICTED: abscisic acid receptor PYL8-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   225 bits (574),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E E +RR H+HE +ENQCSS +VKHI+APVHLVWSLVRRFDQP+RYKPFVSRCI+QGD 
Sbjct  29   MEAECVRRFHRHEPKENQCSSSVVKHIKAPVHLVWSLVRRFDQPERYKPFVSRCILQGDF  88

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             +G +REVN+KSGLPATTS ERLE LDD+EHILS++IVGGDHRL+NY+S+VT HPE+IDG
Sbjct  89   AVGCLREVNIKSGLPATTSTERLEQLDDNEHILSIKIVGGDHRLQNYSSVVTAHPEVIDG  148

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  149  RPGTLVIESFVV  160



>ref|XP_010438531.1| PREDICTED: abscisic acid receptor PYL10-like [Camelina sativa]
Length=181

 Score =   224 bits (572),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 127/143 (89%), Gaps = 5/143 (3%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MMNGD   ++E EYI+RHH HE+ ENQCSS LVKHI AP+HLVWSLVRRFDQPQ+YKPF+
Sbjct  1    MMNGD---EMESEYIKRHHSHELSENQCSSTLVKHINAPLHLVWSLVRRFDQPQKYKPFI  57

Query  333  SRCIVQG-DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSI  509
            SRC+VQG  LEIG+VREV+V+SGLPAT S ERLE LDDD+HILS+RI+GGDHRL+NY+SI
Sbjct  58   SRCVVQGKKLEIGTVREVDVRSGLPATKSTERLEFLDDDQHILSVRILGGDHRLKNYSSI  117

Query  510  VTVHP-EIIDGRPGTLVIESFVV  575
            +++HP E I+GR GTLVIESFVV
Sbjct  118  ISLHPAETIEGRAGTLVIESFVV  140



>gb|KJB52578.1| hypothetical protein B456_008G270200 [Gossypium raimondii]
Length=190

 Score =   224 bits (572),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            E+IRRHH HE+ ENQCSS L+KH++APV LVWSLVRRFDQPQ+YKPFVSRCI QG+LEIG
Sbjct  18   EHIRRHHLHEIGENQCSSTLIKHMKAPVPLVWSLVRRFDQPQKYKPFVSRCIAQGNLEIG  77

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV VKSGLPATTS ERLELLDD+EHILS+RIV GDHRL+NY+SI+++HPEII+GRPG
Sbjct  78   SLREVYVKSGLPATTSTERLELLDDNEHILSIRIVCGDHRLKNYSSIISLHPEIINGRPG  137

Query  549  TLVIESFVV  575
            TLVIESFVV
Sbjct  138  TLVIESFVV  146



>ref|XP_004231210.1| PREDICTED: abscisic acid receptor PYL8 [Solanum lycopersicum]
Length=186

 Score =   224 bits (571),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E ++I R+H H+  E+QCSS LVKHI+APV +VWSLVRRFDQPQ+YKPF+SRC V+GDL
Sbjct  1    MESQFIERYHSHQPSEHQCSSSLVKHIKAPVDIVWSLVRRFDQPQKYKPFISRCTVKGDL  60

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGSVREVNVKSGLPATTS ERLELLDD+EHIL +RIVGGDHRL+NY+S++TVHPE +DG
Sbjct  61   TIGSVREVNVKSGLPATTSTERLELLDDEEHILGIRIVGGDHRLKNYSSVITVHPETLDG  120

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  121  RPGTLVIESFVV  132



>ref|XP_006837452.1| hypothetical protein AMTR_s00107p00103680 [Amborella trichopoda]
 gb|ERN00306.1| hypothetical protein AMTR_s00107p00103680 [Amborella trichopoda]
Length=182

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCI-VQ  350
            SD E    +RHH+HE+ ENQC+S LVKHI+AP+ LVWSLVRRFDQPQ+YKPF+SRC+ V+
Sbjct  3    SDHEYTMKQRHHRHEIMENQCTSALVKHIKAPLQLVWSLVRRFDQPQKYKPFISRCVLVR  62

Query  351  GDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEI  530
            GDLEIGSVREVNV+SGLPATTS ERLELLDD+EHILS++IVGGDHRL+NY+S++T+HPEI
Sbjct  63   GDLEIGSVREVNVRSGLPATTSTERLELLDDNEHILSVKIVGGDHRLKNYSSLITLHPEI  122

Query  531  IDGRPGTLVIESFVV  575
            I+GRPGT+VIESFVV
Sbjct  123  IEGRPGTMVIESFVV  137



>ref|XP_011093668.1| PREDICTED: abscisic acid receptor PYL9 [Sesamum indicum]
Length=173

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E + +RRHH+H+  E QCSS +VKHI+APV +VWSLVRRFDQPQ+YKPF+SRC VQGDL
Sbjct  1    MEAQNMRRHHRHQASERQCSSTVVKHIKAPVDIVWSLVRRFDQPQKYKPFISRCTVQGDL  60

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            +IGSVREVNVKSGLPATTS ERLELLDD +HIL ++ VGGDHRL+NY+SI+TVHPEIIDG
Sbjct  61   KIGSVREVNVKSGLPATTSTERLELLDDQKHILGVKFVGGDHRLKNYSSIITVHPEIIDG  120

Query  540  RPGTLVIESFVV  575
            RPGTLV+ESFVV
Sbjct  121  RPGTLVVESFVV  132



>ref|NP_563626.1| regulatory component of ABA receptor 1 [Arabidopsis thaliana]
 sp|Q84MC7.1|PYL9_ARATH RecName: Full=Abscisic acid receptor PYL9; AltName: Full=ABI1-binding 
protein 4; AltName: Full=PYR1-like protein 9; AltName: 
Full=Regulatory components of ABA receptor 1 [Arabidopsis 
thaliana]
 gb|AAP21207.1| At1g01360 [Arabidopsis thaliana]
 dbj|BAE99614.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27277.1| regulatory component of ABA receptor 1 [Arabidopsis thaliana]
Length=187

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+R HH+H  RENQC+S LVKHI+AP+HLVWSLVRRFDQPQ+YKPFVSRC V GD EIG
Sbjct  19   QYVRTHHQHLCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIG  78

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDD+EHIL ++I+GGDHRL+NY+SI+TVHPEII+GR G
Sbjct  79   SLREVNVKSGLPATTSTERLELLDDEEHILGIKIIGGDHRLKNYSSILTVHPEIIEGRAG  138

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  139  TMVIESFVV  147



>ref|XP_006401738.1| hypothetical protein EUTSA_v10014777mg [Eutrema salsugineum]
 gb|ESQ43191.1| hypothetical protein EUTSA_v10014777mg [Eutrema salsugineum]
Length=187

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 124/132 (94%), Gaps = 1/132 (1%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            E EYIRRHHKHE+ ENQCSS LVKHI+APVH+VWSLVRRFDQPQ+YKPF+SRC+V+G++E
Sbjct  11   EREYIRRHHKHELVENQCSSTLVKHIKAPVHIVWSLVRRFDQPQKYKPFISRCVVKGNME  70

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID-G  539
            IG+VREV+VKSGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY+SI+++HPE I+ G
Sbjct  71   IGTVREVDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSIISLHPETIEGG  130

Query  540  RPGTLVIESFVV  575
            R GTLVIESFVV
Sbjct  131  RIGTLVIESFVV  142



>ref|XP_010480374.1| PREDICTED: abscisic acid receptor PYL9-like [Camelina sativa]
Length=183

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+R  HKH  RENQC+S LVKHI+AP+HLVWSLVRRFDQPQ+YKPFVSRC V GD EIG
Sbjct  15   QYVRTQHKHHCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIG  74

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDD+EHIL +RI+GGDHRL+NY+SIVTVHPE+I+GR G
Sbjct  75   SLREVNVKSGLPATTSTERLELLDDEEHILGIRIIGGDHRLKNYSSIVTVHPEMIEGRAG  134

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  135  TMVIESFVV  143



>ref|XP_004498400.1| PREDICTED: LOW QUALITY PROTEIN: abscisic acid receptor PYL8-like 
[Cicer arietinum]
Length=199

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 128/143 (90%), Gaps = 3/143 (2%)
 Frame = +3

Query  156  MNG---DRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKP  326
            MNG    R S++E EYIRRHH+H+   NQC S LVKHIRAP+  VWSLVRRFDQPQ+YKP
Sbjct  1    MNGIGSGRFSNMEMEYIRRHHRHQPGNNQCVSALVKHIRAPLPQVWSLVRRFDQPQKYKP  60

Query  327  FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            FVSRC+V+G+LEIGS+REV+VKSGLPATTS ERLELLDD++H+LS+RI+ GDHRLRNY+S
Sbjct  61   FVSRCVVKGNLEIGSLREVDVKSGLPATTSTERLELLDDNDHVLSIRIIDGDHRLRNYSS  120

Query  507  IVTVHPEIIDGRPGTLVIESFVV  575
            ++++HPEIIDGRPGTLVIESFVV
Sbjct  121  VMSLHPEIIDGRPGTLVIESFVV  143



>gb|EAZ22456.1| hypothetical protein OsJ_06125 [Oryza sativa Japonica Group]
Length=205

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 125/141 (89%), Gaps = 3/141 (2%)
 Frame = +3

Query  162  GDRRSDV---EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
             D R D+   E EY+RR H+HE R++QCSS + KHI+APVHLVWSLVRRFDQPQ +KPFV
Sbjct  20   ADERCDLRAAETEYVRRFHRHEPRDHQCSSAVAKHIKAPVHLVWSLVRRFDQPQLFKPFV  79

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC ++G++EIGSVREVNVKSGLPAT S ERLELLDD+EHILS+R VGGDHRL+NY+SI+
Sbjct  80   SRCEMKGNIEIGSVREVNVKSGLPATRSTERLELLDDNEHILSVRFVGGDHRLKNYSSIL  139

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGTLVIESFVV
Sbjct  140  TVHPEVIDGRPGTLVIESFVV  160



>gb|AAM65514.1| unknown [Arabidopsis thaliana]
Length=186

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+R HH+H  RENQC+S LVKHI+AP+HLVWSLVRRFDQPQ+YKPFVSRC V GD EIG
Sbjct  18   QYVRTHHQHLCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIG  77

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDD+EHIL ++I+GGDHRL+NY+SI+TVHPEII+GR G
Sbjct  78   SLREVNVKSGLPATTSTERLELLDDEEHILGIKIIGGDHRLKNYSSILTVHPEIIEGRAG  137

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  138  TMVIESFVV  146



>gb|AAF97339.1|AC023628_20 Unknown protein [Arabidopsis thaliana]
Length=186

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+R HH+H  RENQC+S LVKHI+AP+HLVWSLVRRFDQPQ+YKPFVSRC V GD EIG
Sbjct  18   QYVRTHHQHLCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIG  77

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDD+EHIL ++I+GGDHRL+NY+SI+TVHPEII+GR G
Sbjct  78   SLREVNVKSGLPATTSTERLELLDDEEHILGIKIIGGDHRLKNYSSILTVHPEIIEGRAG  137

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  138  TMVIESFVV  146



>ref|XP_009119689.1| PREDICTED: abscisic acid receptor PYL9 [Brassica rapa]
Length=186

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+RRHH+H  RE+QC+S LVKHI+AP+ LVWS+VRRFD+PQ+YKPFVSRC V GD EIG
Sbjct  15   QYVRRHHQHNCREDQCTSALVKHIKAPLRLVWSVVRRFDEPQKYKPFVSRCTVIGDPEIG  74

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDDDEHIL ++I+GGDHRL+NY+SIVTVHPEII+GRPG
Sbjct  75   SLREVNVKSGLPATTSTERLELLDDDEHILGIKIIGGDHRLKNYSSIVTVHPEIIEGRPG  134

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  135  TMVIESFVV  143



>ref|NP_001046464.1| Os02g0255500 [Oryza sativa Japonica Group]
 dbj|BAD29693.1| Bet v I allergen-like [Oryza sativa Japonica Group]
 dbj|BAD27946.1| Bet v I allergen-like [Oryza sativa Japonica Group]
 dbj|BAF08378.1| Os02g0255500 [Oryza sativa Japonica Group]
 gb|EAY85244.1| hypothetical protein OsI_06617 [Oryza sativa Indica Group]
 dbj|BAG96806.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86955.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBH19569.1| polyketide cyclase [Oryza sativa Indica Group]
 gb|AFV36782.1| ABA receptor RCAR3 [Oryza sativa]
 gb|AIU97953.1| ABA receptor 2 [Oryza sativa Indica Group]
Length=204

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 125/141 (89%), Gaps = 3/141 (2%)
 Frame = +3

Query  162  GDRRSDV---EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
             D R D+   E EY+RR H+HE R++QCSS + KHI+APVHLVWSLVRRFDQPQ +KPFV
Sbjct  20   ADERCDLRAAETEYVRRFHRHEPRDHQCSSAVAKHIKAPVHLVWSLVRRFDQPQLFKPFV  79

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC ++G++EIGSVREVNVKSGLPAT S ERLELLDD+EHILS+R VGGDHRL+NY+SI+
Sbjct  80   SRCEMKGNIEIGSVREVNVKSGLPATRSTERLELLDDNEHILSVRFVGGDHRLKNYSSIL  139

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGTLVIESFVV
Sbjct  140  TVHPEVIDGRPGTLVIESFVV  160



>ref|XP_009388710.1| PREDICTED: abscisic acid receptor PYL8-like [Musa acuminata subsp. 
malaccensis]
Length=228

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            V  EY+RR H HE  ENQCSS ++KHI+APVHLVWSLVRRFD+PQ+YKPFVSRCI QGDL
Sbjct  34   VAAEYMRRFHCHEPEENQCSSAILKHIKAPVHLVWSLVRRFDEPQKYKPFVSRCIAQGDL  93

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGS+REVNVKSGLPATTS ERLE LDD EHILS +IVGGDHRL+NY+SIV+ HPEIIDG
Sbjct  94   GIGSLREVNVKSGLPATTSTERLEHLDDSEHILSFKIVGGDHRLKNYSSIVSAHPEIIDG  153

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  154  RPGTLVIESFVV  165



>ref|XP_010457135.1| PREDICTED: abscisic acid receptor PYL9 [Camelina sativa]
Length=183

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+R  HKH  RENQC+S LVKHI+AP+HLVWSLVRRFDQPQ+YKPFVSRC V GD EIG
Sbjct  15   QYVRTQHKHHCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIG  74

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDD+EHIL +RI+GGDHRL+NY+SIVTVHPE+I+GR G
Sbjct  75   SLREVNVKSGLPATTSTERLELLDDEEHILGIRIIGGDHRLKNYSSIVTVHPEMIEGRAG  134

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  135  TMVIESFVV  143



>emb|CBH19550.1| polyketide cyclase [Oryza sativa Indica Group]
Length=190

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 124/141 (88%), Gaps = 3/141 (2%)
 Frame = +3

Query  162  GDRRSDV---EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
             D R D+   E EY+RR H+HE R++QCSS + KHI+APVHLVWSLVRRFDQPQ +KPFV
Sbjct  20   ADERCDLRAAETEYVRRFHRHEPRDHQCSSAVAKHIKAPVHLVWSLVRRFDQPQLFKPFV  79

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC ++G +EIGSVREVNVKSGLPAT S ERLELLDD+EHILS+R VGGDHRL+NY+SI+
Sbjct  80   SRCEMKGSIEIGSVREVNVKSGLPATRSTERLELLDDNEHILSVRFVGGDHRLKNYSSIL  139

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGTLVIESFVV
Sbjct  140  TVHPEVIDGRPGTLVIESFVV  160



>pdb|3OQU|A Chain A, Crystal Structure Of Native Abscisic Acid Receptor Pyl9 
With Aba
 pdb|3OQU|B Chain B, Crystal Structure Of Native Abscisic Acid Receptor Pyl9 
With Aba
Length=205

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+R HH+H  RENQC+S LVKHI+AP+HLVWSLVRRFDQPQ+YKPFVSRC V GD EIG
Sbjct  37   QYVRTHHQHLCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIG  96

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDD+EHIL ++I+GGDHRL+NY+SI+TVHPEII+GR G
Sbjct  97   SLREVNVKSGLPATTSTERLELLDDEEHILGIKIIGGDHRLKNYSSILTVHPEIIEGRAG  156

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  157  TMVIESFVV  165



>emb|CDX90028.1| BnaA10g00540D [Brassica napus]
Length=188

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+RRHH+H  RE+QC+S LVKHI+AP+ LVWS+VRRFD+PQ+YKPFVSRC V GD EIG
Sbjct  17   QYVRRHHQHNCREDQCTSALVKHIKAPLRLVWSVVRRFDEPQKYKPFVSRCTVIGDPEIG  76

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDDDEHIL ++I+GGDHRL+NY+SIVTVHPEII+GRPG
Sbjct  77   SLREVNVKSGLPATTSTERLELLDDDEHILGIKIIGGDHRLKNYSSIVTVHPEIIEGRPG  136

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  137  TMVIESFVV  145



>pdb|3W9R|A Chain A, Crystal Structure Of The High-affinity Abscisic Acid 
Receptor Pyl9/rcar9 Bound To Aba
Length=189

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+R HH+H  RENQC+S LVKHI+AP+HLVWSLVRRFDQPQ+YKPFVSRC V GD EIG
Sbjct  21   QYVRTHHQHLCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIG  80

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REVNVKSGLPATTS ERLELLDD+EHIL ++I+GGDHRL+NY+SI+TVHPEII+GR G
Sbjct  81   SLREVNVKSGLPATTSTERLELLDDEEHILGIKIIGGDHRLKNYSSILTVHPEIIEGRAG  140

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  141  TMVIESFVV  149



>gb|ACF86162.1| unknown [Zea mays]
 gb|ACG31407.1| AT-rich element binding factor 3 [Zea mays]
 gb|AFW71059.1| AT-rich element binding factor 3 [Zea mays]
 gb|AIG52084.1| pyrabactin resistance-like protein [Zea mays]
Length=212

 Score =   224 bits (570),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 125/141 (89%), Gaps = 3/141 (2%)
 Frame = +3

Query  162  GDRRSDV---EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
             D R D+   E +Y+RR H+HE RE+QCSS + KHI+APVHLVWSLVRRFDQPQ +KPFV
Sbjct  28   ADERCDLRAMETDYVRRFHRHEPREHQCSSAVAKHIKAPVHLVWSLVRRFDQPQLFKPFV  87

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC ++G++EIGSVREVNVKSGLPAT S ERLELLDD+EHILS+R VGGDHRL+NY+SI+
Sbjct  88   SRCEMKGNIEIGSVREVNVKSGLPATRSTERLELLDDNEHILSVRFVGGDHRLQNYSSIL  147

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGTLVIESFVV
Sbjct  148  TVHPEVIDGRPGTLVIESFVV  168



>ref|XP_006279661.1| hypothetical protein CARUB_v10026826mg, partial [Capsella rubella]
 gb|EOA12559.1| hypothetical protein CARUB_v10026826mg, partial [Capsella rubella]
Length=309

 Score =   227 bits (578),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +3

Query  150  GMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPF  329
             +MN    S  E E+IRRHHKHE+ +NQCSS LVKHI+APVH+VWSLVRRFDQPQ+YKPF
Sbjct  122  SLMNQTNLSQ-EREFIRRHHKHELLQNQCSSTLVKHIKAPVHIVWSLVRRFDQPQKYKPF  180

Query  330  VSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSI  509
            +SRC+V+G++EIG+VREV+VKSGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY+SI
Sbjct  181  ISRCVVKGNMEIGTVREVDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSI  240

Query  510  VTVHPEIIDGRPGTLVIESFVV  575
            +++HPE I+GR GTLVIESFVV
Sbjct  241  ISLHPENIEGRIGTLVIESFVV  262



>emb|CDX96197.1| BnaC02g14540D [Brassica napus]
Length=188

 Score =   223 bits (567),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 2/141 (1%)
 Frame = +3

Query  159  NGDRRSDVEDEYIRR-HHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            NG   +++E EYIRR HHKHE+ ENQCSS LVKHI+APVH+VWSLVRRFDQPQ+YKPF+S
Sbjct  5    NGMEMNNLEREYIRRQHHKHELVENQCSSTLVKHIQAPVHIVWSLVRRFDQPQKYKPFIS  64

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+V+GD+EIG+VREV+VKSGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY+SI++
Sbjct  65   RCVVKGDMEIGTVREVDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSIIS  124

Query  516  VHPE-IIDGRPGTLVIESFVV  575
            +HPE I  GR GTLVIESFVV
Sbjct  125  LHPERIGGGRMGTLVIESFVV  145



>gb|KEH40405.1| abscisic acid receptor PYL9-like protein [Medicago truncatula]
Length=190

 Score =   223 bits (567),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +3

Query  150  GMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPF  329
            G  NG R S++E EYIRRHH+ +   NQC+S LVKHIRAPV  VWSLVRRFDQPQ+YKPF
Sbjct  5    GSGNG-RFSNMEMEYIRRHHRQQPGHNQCASALVKHIRAPVPQVWSLVRRFDQPQKYKPF  63

Query  330  VSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSI  509
            V RC+V+G+LEIGS+REV+VKSGLPATTS ERLE+LDD+EH+LS+RI+GGDHRL NY+S+
Sbjct  64   VRRCVVRGNLEIGSLREVDVKSGLPATTSTERLEVLDDNEHVLSIRIIGGDHRLTNYSSV  123

Query  510  VTVHPEIIDGRPGTLVIESFVV  575
            +++HPEIIDGRPGTLVIESFVV
Sbjct  124  MSLHPEIIDGRPGTLVIESFVV  145



>ref|XP_008437581.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis melo]
 ref|XP_008437582.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis melo]
Length=195

 Score =   223 bits (567),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
             E E IRR+H++E  ENQC+S LVK I+APV LVWSLVRRFDQPQRYKPFVSRC+++G+L
Sbjct  19   AEWELIRRYHRNEPAENQCTSRLVKRIKAPVPLVWSLVRRFDQPQRYKPFVSRCVLKGNL  78

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIG++REV+VKSGLPATTS ERLELLDDD HILSMRIVGGDHRL+NY+SI+++HPEIIDG
Sbjct  79   EIGTLREVDVKSGLPATTSTERLELLDDDNHILSMRIVGGDHRLKNYSSIISLHPEIIDG  138

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  139  RPGTLVIESFVV  150



>ref|XP_004145925.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis sativus]
 ref|XP_004169436.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis sativus]
 gb|KGN49876.1| hypothetical protein Csa_5G139540 [Cucumis sativus]
Length=195

 Score =   223 bits (567),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
             E E IRR+H++E  ENQC+S LVK I+APV LVWSLVRRFDQPQRYKPFVSRC+++G+L
Sbjct  19   AEWELIRRYHRNEPAENQCTSRLVKRIKAPVPLVWSLVRRFDQPQRYKPFVSRCVLKGNL  78

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIG++REV+VKSGLPATTS ERLELLDDD HILSMRIVGGDHRL+NY+SI+++HPEIIDG
Sbjct  79   EIGTLREVDVKSGLPATTSTERLELLDDDNHILSMRIVGGDHRLKNYSSIISLHPEIIDG  138

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  139  RPGTLVIESFVV  150



>ref|XP_006422129.1| hypothetical protein CICLE_v10005981mg [Citrus clementina]
 ref|XP_006490556.1| PREDICTED: abscisic acid receptor PYL8-like [Citrus sinensis]
 gb|ESR35369.1| hypothetical protein CICLE_v10005981mg [Citrus clementina]
 gb|KDO56108.1| hypothetical protein CISIN_1g029721mg [Citrus sinensis]
Length=189

 Score =   222 bits (566),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  159  NGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSR  338
            NG      E E+IRRHH H+V ++QCSS L KHIRAPVHLVWSLVRRFDQPQ+YKPFVSR
Sbjct  6    NGGINGGAESEHIRRHHIHDVADHQCSSVLKKHIRAPVHLVWSLVRRFDQPQKYKPFVSR  65

Query  339  CIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTV  518
            C+ QG+LEIGS+REV+VKSGLPATTS ERLELLDD+EH+L +RI+GGDHRL+NY+SI+++
Sbjct  66   CVAQGNLEIGSLREVDVKSGLPATTSTERLELLDDEEHVLRVRIIGGDHRLKNYSSIISL  125

Query  519  HPEIIDGRPGTLVIESFVV  575
            H EIIDGR GTLV+ESFVV
Sbjct  126  HSEIIDGRMGTLVLESFVV  144



>gb|KHN23391.1| Abscisic acid receptor PYL8 [Glycine soja]
Length=191

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            S  E EYIRRHH     +NQC+S LVKHIRAP+ LVWSLVRRFD+PQ+YKPFVSRC+V+G
Sbjct  5    SSREVEYIRRHHSKAAEDNQCASALVKHIRAPLPLVWSLVRRFDEPQKYKPFVSRCVVRG  64

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            +LEIGS+REV+VKSGLPATTS ERLE+LDD+ HILS+RI+GGDHRLRNY+SI+++HPEI+
Sbjct  65   NLEIGSLREVDVKSGLPATTSTERLEILDDNHHILSVRIIGGDHRLRNYSSIMSLHPEIV  124

Query  534  DGRPGTLVIESFVV  575
            DGRPGTLVIESFVV
Sbjct  125  DGRPGTLVIESFVV  138



>ref|XP_004951286.1| PREDICTED: abscisic acid receptor PYL8-like [Setaria italica]
Length=211

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 125/140 (89%), Gaps = 3/140 (2%)
 Frame = +3

Query  165  DRRSDV---EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            D R D+   E EY+RR H+HE R++QCSS + KHI+APVHLVWSLVRRFDQPQ +KPFVS
Sbjct  28   DERCDLRAMESEYVRRFHRHEPRDHQCSSAVAKHIKAPVHLVWSLVRRFDQPQLFKPFVS  87

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC ++G++EIGSVREVNVKSGLPAT S ERLELLDD+EHILS++ VGGDHRL+NY+SI+T
Sbjct  88   RCEMKGNIEIGSVREVNVKSGLPATRSTERLELLDDNEHILSVKFVGGDHRLQNYSSILT  147

Query  516  VHPEIIDGRPGTLVIESFVV  575
            VHPE+IDGRPGTLVIESFVV
Sbjct  148  VHPEVIDGRPGTLVIESFVV  167



>emb|CDY38728.1| BnaC03g15210D [Brassica napus]
Length=184

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            E EYIRRHHKH + ENQCSS LVKHI+APVH+VWSLVRRFDQPQ+YKPF+S+C+V+G++E
Sbjct  11   EREYIRRHHKHALLENQCSSTLVKHIQAPVHIVWSLVRRFDQPQKYKPFISKCVVKGNME  70

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID-G  539
            IG+VREV+VKSGLPAT S ERLELLD++EHILSMRIVGGDHRL+NY+S++++HPE I+ G
Sbjct  71   IGTVREVDVKSGLPATRSTERLELLDENEHILSMRIVGGDHRLKNYSSVISLHPETIEGG  130

Query  540  RPGTLVIESFVV  575
            R GTLVIESFVV
Sbjct  131  RIGTLVIESFVV  142



>ref|XP_009421249.1| PREDICTED: abscisic acid receptor PYL8-like [Musa acuminata subsp. 
malaccensis]
Length=211

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E EY+RR H HE  ENQCSS + KHI+APVHLVWSLVRRFDQPQ YKPFVSRCIVQG +
Sbjct  36   MEAEYVRRFHLHEPTENQCSSAVFKHIKAPVHLVWSLVRRFDQPQNYKPFVSRCIVQGGV  95

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             +GS+REVN+KSGLPATTS ERLE LDD+EHILS++IVGGDHRL+NY+SIVT HPE IDG
Sbjct  96   GVGSLREVNIKSGLPATTSFERLEHLDDNEHILSIKIVGGDHRLKNYSSIVTAHPETIDG  155

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  156  RPGTLVIESFVV  167



>ref|XP_010433291.1| PREDICTED: abscisic acid receptor PYL10-like [Camelina sativa]
Length=181

 Score =   221 bits (564),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 126/143 (88%), Gaps = 5/143 (3%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MMNGD   ++E EYI+RHH HE+  NQCSS LVKHI AP+HLVWSLVRRFDQPQ+YKPF+
Sbjct  1    MMNGD---EMESEYIKRHHSHELLGNQCSSTLVKHINAPLHLVWSLVRRFDQPQKYKPFI  57

Query  333  SRCIVQG-DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSI  509
            SRC+VQG  LEIG+VREV+V+SGLPAT S ERLE LDDD+HILS+RI+GGDHRL+NY+SI
Sbjct  58   SRCVVQGKKLEIGTVREVDVRSGLPATKSTERLEFLDDDQHILSVRILGGDHRLKNYSSI  117

Query  510  VTVHP-EIIDGRPGTLVIESFVV  575
            +++HP E I+GR GTLVIESFVV
Sbjct  118  ISLHPAETIEGRAGTLVIESFVV  140



>ref|XP_009413834.1| PREDICTED: abscisic acid receptor PYL8-like [Musa acuminata subsp. 
malaccensis]
Length=209

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E E IRR H+HE  ENQCSSC++KHI+APV LVWSLVRRFDQPQRYKPFVSRCIVQGD 
Sbjct  34   MEAECIRRFHRHEPMENQCSSCVLKHIKAPVQLVWSLVRRFDQPQRYKPFVSRCIVQGDF  93

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             +G +REVN+KSGLPATTS ERLE LDD+EHILS++IVGGDHRL+NY+S++T HPE+IDG
Sbjct  94   AVGCLREVNIKSGLPATTSTERLEQLDDNEHILSIKIVGGDHRLQNYSSVITAHPEMIDG  153

Query  540  RPGTLVIESFVV  575
              GTLVIESFVV
Sbjct  154  EEGTLVIESFVV  165



>gb|KFK26935.1| hypothetical protein AALP_AA8G312900 [Arabis alpina]
Length=184

 Score =   221 bits (564),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            E EYIR+HHKH++ ++QCSS LVKHI+APVH+VWSLVRRFDQPQ+YKPF+SRC+V+G++E
Sbjct  10   EREYIRKHHKHQLVDHQCSSTLVKHIKAPVHIVWSLVRRFDQPQKYKPFISRCVVKGNME  69

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGR  542
            IG+VREV+VKSGLPAT S ERLELLD++EHILS+RIVGGDHRL+NY+SI+++HPE I+GR
Sbjct  70   IGTVREVDVKSGLPATKSTERLELLDENEHILSIRIVGGDHRLKNYSSIISLHPETIEGR  129

Query  543  PGTLVIESFVV  575
             GTLVIESFVV
Sbjct  130  VGTLVIESFVV  140



>ref|NP_001236049.1| uncharacterized protein LOC100526923 [Glycine max]
 gb|ACU15944.1| unknown [Glycine max]
Length=191

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            S  E EYIRRHH     +NQC+S LVKHIRAP+ LVWSLVRRFD+PQ+YKPFVSRC+V+G
Sbjct  5    SSREVEYIRRHHSKAAEDNQCASALVKHIRAPLPLVWSLVRRFDEPQKYKPFVSRCVVRG  64

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            +LEIGS+REV+VKSGLPATTS ERLE+LDD+ HILS+RI+GGDHRLRNY+SI ++HPEI+
Sbjct  65   NLEIGSLREVDVKSGLPATTSTERLEILDDNHHILSVRIIGGDHRLRNYSSITSLHPEIV  124

Query  534  DGRPGTLVIESFVV  575
            DGRPGTLVIESFVV
Sbjct  125  DGRPGTLVIESFVV  138



>ref|XP_010095784.1| hypothetical protein L484_017591 [Morus notabilis]
 gb|EXB62204.1| hypothetical protein L484_017591 [Morus notabilis]
Length=202

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 124/154 (81%), Gaps = 16/154 (10%)
 Frame = +3

Query  162  GDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRC  341
            GD    +E +YIRRHH+H+ RENQC+S LVKHI+APV LVWSLVRRFDQPQ+YKPFVSRC
Sbjct  5    GDSYGAMEVQYIRRHHRHQTRENQCTSALVKHIKAPVQLVWSLVRRFDQPQKYKPFVSRC  64

Query  342  IVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLR---------  494
            IV+GDL IGSVREVNVKSGLPATTS ERLE LDD+EHIL ++IVGGDHRLR         
Sbjct  65   IVKGDLGIGSVREVNVKSGLPATTSTERLEFLDDEEHILGVKIVGGDHRLRLKAFQSCFS  124

Query  495  ------NYTSIVTVHPEII-DGRPGTLVIESFVV  575
                  NY+SI+TVHPE+  DGR GTLVIESFVV
Sbjct  125  MLHKLQNYSSIITVHPEVTEDGRSGTLVIESFVV  158



>ref|XP_010533591.1| PREDICTED: abscisic acid receptor PYL8-like [Tarenaya hassleriana]
 ref|XP_010533592.1| PREDICTED: abscisic acid receptor PYL8-like [Tarenaya hassleriana]
 ref|XP_010533593.1| PREDICTED: abscisic acid receptor PYL8-like [Tarenaya hassleriana]
Length=197

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +3

Query  132  CRRMTAGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQP  311
            C   TA  ++G   + +E+E+IRR+H HEV E+Q SS LVKHI+AP+ LVWSLVR FDQP
Sbjct  7    CTAKTA--VDGKGLTGIEEEFIRRYHAHEVMEHQGSSSLVKHIKAPLPLVWSLVRSFDQP  64

Query  312  QRYKPFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRL  491
            Q+YKPFVSRC+V+GDL +GSVREVNV+SGLPATTS ERLE LDD+EHI SMRIVGGDHRL
Sbjct  65   QKYKPFVSRCVVRGDLRVGSVREVNVRSGLPATTSTERLEHLDDEEHIFSMRIVGGDHRL  124

Query  492  RNYTSIVTVHPEIIDGRPGTLVIESFVV  575
            +NY S+V+VHPE+IDGR GTLVIESFVV
Sbjct  125  KNYYSVVSVHPEVIDGRLGTLVIESFVV  152



>emb|CDY04688.1| BnaC05g17260D [Brassica napus]
Length=186

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIG  368
            +Y+RRHH+H  RE+QC+S LVKHI+ PVHLVWS+VRRFD+PQ+YKPFVSRC V GD EIG
Sbjct  15   QYVRRHHQHNCREDQCTSALVKHIKVPVHLVWSVVRRFDEPQKYKPFVSRCTVIGDPEIG  74

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            S+REV+VKSGLPATTS ERLELLDD+EHI  ++I+GGDHRL+NY+SIVTVHPEII+GRPG
Sbjct  75   SLREVDVKSGLPATTSTERLELLDDNEHIFGIKIIGGDHRLKNYSSIVTVHPEIIEGRPG  134

Query  549  TLVIESFVV  575
            T+VIESFVV
Sbjct  135  TMVIESFVV  143



>ref|XP_009390679.1| PREDICTED: abscisic acid receptor PYL8-like [Musa acuminata subsp. 
malaccensis]
Length=206

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            VE +Y+R  H+HE  ENQCSS + KHI+APVHLVWSLVRRFDQPQ+YKPFVSRCIVQG +
Sbjct  31   VEVDYVRCFHRHEPSENQCSSAVSKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCIVQGGV  90

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             +GS+REVN+KSGLPATTS ERLE LDD+EHILS+RIVGGDHRL+NY+SI+T HPE IDG
Sbjct  91   GVGSLREVNIKSGLPATTSFERLEHLDDNEHILSIRIVGGDHRLKNYSSIITAHPETIDG  150

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  151  RPGTLVIESFVV  162



>pdb|3RT0|C Chain C, Crystal Structure Of Pyl10-Hab1 Complex In The Absence 
Of Abscisic Acid (Aba)
 pdb|3RT0|D Chain D, Crystal Structure Of Pyl10-Hab1 Complex In The Absence 
Of Abscisic Acid (Aba)
Length=183

 Score =   221 bits (562),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNGD    VE EYI++HH+HE+ E+QCSS LVKHI+AP+HLVWS+VRRFD+PQ+YKPF+S
Sbjct  1    MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFIS  60

Query  336  RCIVQG-DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            RC+VQG  LE+GSVREV++KSGLPAT S E LE+LDD+EHIL +RIVGGDHRL+NY+S +
Sbjct  61   RCVVQGKKLEVGSVREVDLKSGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTI  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            ++H E IDG+ GTL IESFVV
Sbjct  121  SLHSETIDGKTGTLAIESFVV  141



>ref|XP_009132498.1| PREDICTED: abscisic acid receptor PYL8 [Brassica rapa]
Length=184

 Score =   220 bits (561),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            E EYIRRHHKH + ENQC S LVKHI+APVH+VWSLVRRFDQPQ+YKPF+SRC+V+G++E
Sbjct  11   EREYIRRHHKHALLENQCRSTLVKHIQAPVHIVWSLVRRFDQPQKYKPFISRCVVKGNME  70

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID-G  539
            IG+VREV+VKSGLPAT S ERLELLD++EHILSMRIVGGDHRL+NY+S++++HPE I+ G
Sbjct  71   IGTVREVDVKSGLPATRSTERLELLDENEHILSMRIVGGDHRLKNYSSVISLHPETIEGG  130

Query  540  RPGTLVIESFVV  575
            R GTLVIESFVV
Sbjct  131  RIGTLVIESFVV  142



>ref|XP_008676769.1| PREDICTED: uncharacterized protein LOC100272864 isoform X1 [Zea 
mays]
 gb|ACF80077.1| unknown [Zea mays]
 gb|AFW65885.1| AT-rich element binding factor 3 [Zea mays]
 gb|AIG52081.1| pyrabactin resistance-like protein [Zea mays]
Length=217

 Score =   221 bits (564),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 124/141 (88%), Gaps = 3/141 (2%)
 Frame = +3

Query  162  GDRRSDV---EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
             D R D+   E +Y+RR H+HE R++QCSS + KHI+APVHLVWSLVRRFDQPQ +KPFV
Sbjct  33   ADERCDLRAMETDYVRRFHRHEPRDHQCSSAVAKHIKAPVHLVWSLVRRFDQPQLFKPFV  92

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC ++G++EIGSVREVNVKSGLPAT S ERLELLDDDE ILS+R VGGDHRL+NY+SI+
Sbjct  93   SRCEMKGNIEIGSVREVNVKSGLPATRSTERLELLDDDERILSVRFVGGDHRLQNYSSIL  152

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGTLVIESFVV
Sbjct  153  TVHPEVIDGRPGTLVIESFVV  173



>ref|NP_194521.2| abscisic acid receptor PYL10 [Arabidopsis thaliana]
 sp|Q8H1R0.1|PYL10_ARATH RecName: Full=Abscisic acid receptor PYL10; AltName: Full=ABI1-binding 
protein 8; AltName: Full=PYR1-like protein 10; AltName: 
Full=Regulatory components of ABA receptor 4 [Arabidopsis 
thaliana]
 pdb|3RT2|A Chain A, Crystal Structure Of Apo-Pyl10
 gb|AAN13069.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85409.1| abscisic acid receptor PYL10 [Arabidopsis thaliana]
Length=183

 Score =   220 bits (560),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNGD    VE EYI++HH+HE+ E+QCSS LVKHI+AP+HLVWS+VRRFD+PQ+YKPF+S
Sbjct  1    MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFIS  60

Query  336  RCIVQG-DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            RC+VQG  LE+GSVREV++KSGLPAT S E LE+LDD+EHIL +RIVGGDHRL+NY+S +
Sbjct  61   RCVVQGKKLEVGSVREVDLKSGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTI  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            ++H E IDG+ GTL IESFVV
Sbjct  121  SLHSETIDGKTGTLAIESFVV  141



>pdb|3UQH|A Chain A, Crystal Strcuture Of Aba Receptor Pyl10 (Apo)
 pdb|3UQH|B Chain B, Crystal Strcuture Of Aba Receptor Pyl10 (Apo)
 pdb|3R6P|A Chain A, Crystal Structure Of Abscisic Acid-Bound Pyl10
Length=191

 Score =   220 bits (561),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNGD    VE EYI++HH+HE+ E+QCSS LVKHI+AP+HLVWS+VRRFD+PQ+YKPF+S
Sbjct  1    MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFIS  60

Query  336  RCIVQG-DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            RC+VQG  LE+GSVREV++KSGLPAT S E LE+LDD+EHIL +RIVGGDHRL+NY+S +
Sbjct  61   RCVVQGKKLEVGSVREVDLKSGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTI  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            ++H E IDG+ GTL IESFVV
Sbjct  121  SLHSETIDGKTGTLAIESFVV  141



>gb|EPS61080.1| hypothetical protein M569_13720, partial [Genlisea aurea]
Length=183

 Score =   220 bits (560),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG    D E+ + +++HKHEV ENQCSS LVKHIRAP+ +VWSLVRRFD+PQ YKPFVS
Sbjct  5    MNG--VGDQEEGFTQKYHKHEVGENQCSSSLVKHIRAPLPIVWSLVRRFDEPQSYKPFVS  62

Query  336  RCIVQG-DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
             C VQG DL IG+VREVNV SGLPATTSKERLE LDD+EHI SMRIVGGDHRL+NY+SIV
Sbjct  63   NCTVQGGDLRIGTVREVNVTSGLPATTSKERLERLDDEEHIFSMRIVGGDHRLKNYSSIV  122

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGR GT+VIESFVV
Sbjct  123  TVHPEVIDGRAGTMVIESFVV  143



>ref|XP_009127190.1| PREDICTED: abscisic acid receptor PYL8-like [Brassica rapa]
Length=188

 Score =   220 bits (560),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 128/141 (91%), Gaps = 2/141 (1%)
 Frame = +3

Query  159  NGDRRSDVEDEYIRR-HHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            +G   +++E EYIRR HHKHE+ ENQCSS LVKHI+APVH+VWSLVRRFDQPQ+YKPF+S
Sbjct  5    DGMEMNNLEREYIRRQHHKHELVENQCSSTLVKHIQAPVHIVWSLVRRFDQPQKYKPFIS  64

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVT  515
            RC+V+GD+EIG+VRE++VKSGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY+SI++
Sbjct  65   RCVVKGDMEIGTVREIDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSIIS  124

Query  516  VHPEIID-GRPGTLVIESFVV  575
            +HPE I+ GR GTLVIESF V
Sbjct  125  LHPERIEGGRMGTLVIESFAV  145



>ref|XP_009757093.1| PREDICTED: abscisic acid receptor PYL9-like [Nicotiana sylvestris]
Length=175

 Score =   219 bits (559),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E ++I R+H H+  ++QCSS +VKHI+APV +VWSLVRRFDQPQ+YKPFVSRC V+GDL
Sbjct  1    MEAQFIARYHSHQPSDHQCSSSIVKHIKAPVDIVWSLVRRFDQPQKYKPFVSRCTVKGDL  60

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGSVREVNVKSGLPATTS ERLELLDD+EHIL +RIVGGDHRL+NY+S++TVHPEI+DG
Sbjct  61   RIGSVREVNVKSGLPATTSTERLELLDDEEHILGIRIVGGDHRLKNYSSVITVHPEILDG  120

Query  540  RPGTLVIESFVV  575
             PGTLVIESF+V
Sbjct  121  TPGTLVIESFMV  132



>gb|ACG39386.1| AT-rich element binding factor 3 [Zea mays]
Length=217

 Score =   221 bits (562),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 124/141 (88%), Gaps = 3/141 (2%)
 Frame = +3

Query  162  GDRRSDV---EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
             D R D+   E +Y+RR H+HE R++QCSS + KHI+APVHLVWSLVRRFDQPQ +KPFV
Sbjct  33   ADERCDLRAMETDYVRRFHRHEPRDHQCSSAVAKHIKAPVHLVWSLVRRFDQPQLFKPFV  92

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC ++G++EIGSVREVNVKSGLPAT S ERLELLDDDE ILS+R VGGDHRL+NY+SI+
Sbjct  93   SRCEMKGNIEIGSVREVNVKSGLPATRSTERLELLDDDERILSVRFVGGDHRLQNYSSIL  152

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGTLVIESFVV
Sbjct  153  TVHPEVIDGRPGTLVIESFVV  173



>ref|XP_002451888.1| hypothetical protein SORBIDRAFT_04g009280 [Sorghum bicolor]
 gb|EES04864.1| hypothetical protein SORBIDRAFT_04g009280 [Sorghum bicolor]
Length=211

 Score =   221 bits (562),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E +Y+RR H+HE R++QCSS + KHI+APVHLVWSLVRRFDQPQ +KPFVSRC ++G++
Sbjct  36   METDYVRRFHRHEPRDHQCSSAVAKHIKAPVHLVWSLVRRFDQPQLFKPFVSRCEMKGNI  95

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGSVREVNVKSGLPAT S ERLELLDD+EHILS++ VGGDHRL+NY+SI+TVHPE+IDG
Sbjct  96   EIGSVREVNVKSGLPATRSTERLELLDDNEHILSVKFVGGDHRLQNYSSILTVHPEVIDG  155

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  156  RPGTLVIESFVV  167



>ref|XP_006647127.1| PREDICTED: abscisic acid receptor PYL8-like [Oryza brachyantha]
Length=203

 Score =   220 bits (561),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 124/141 (88%), Gaps = 3/141 (2%)
 Frame = +3

Query  162  GDRRSDV---EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
             D R D+   E EY+RR H+HE  ++QCSS + KHI+APVHLVWSLVRRFDQPQ +KPFV
Sbjct  19   ADERCDLRAAETEYVRRFHRHEPCDHQCSSAVAKHIKAPVHLVWSLVRRFDQPQLFKPFV  78

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC ++G++EIGSVREVNVKSGLPAT S ERLELLDD+EHILS+R VGGDHRL+NY+SI+
Sbjct  79   SRCEMKGNVEIGSVREVNVKSGLPATRSTERLELLDDNEHILSVRFVGGDHRLKNYSSIL  138

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGTLVIESFVV
Sbjct  139  TVHPEVIDGRPGTLVIESFVV  159



>ref|NP_001054923.1| Os05g0213500 [Oryza sativa Japonica Group]
 gb|AAT47101.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16837.1| Os05g0213500 [Oryza sativa Japonica Group]
 dbj|BAG89445.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78717.1| hypothetical protein OsI_18892 [Oryza sativa Indica Group]
 gb|AFV36781.1| cytosolic ABA receptor RCAR5 [Oryza sativa]
Length=209

 Score =   220 bits (561),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = +3

Query  192  YIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG-DLEIG  368
            ++RR H H   E+QCSS LVKHI+APVHLVWSLVR FDQPQRYKPFVSRC+V+G DLEIG
Sbjct  37   HMRRLHSHAPGEHQCSSALVKHIKAPVHLVWSLVRSFDQPQRYKPFVSRCVVRGGDLEIG  96

Query  369  SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPG  548
            SVREVNVK+GLPATTS ERLELLDDDEHILS++ VGGDHRLRNY+SIVTVHPE IDGRPG
Sbjct  97   SVREVNVKTGLPATTSTERLELLDDDEHILSVKFVGGDHRLRNYSSIVTVHPESIDGRPG  156

Query  549  TLVIESFVV  575
            TLVIESFVV
Sbjct  157  TLVIESFVV  165



>ref|XP_010413366.1| PREDICTED: abscisic acid receptor PYL9-like [Camelina sativa]
Length=190

 Score =   219 bits (559),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  195  IRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSV  374
            IR +H+H+ +ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC+++GD+ IGSV
Sbjct  24   IRLNHRHDPKENQCSSVLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVMKGDVGIGSV  83

Query  375  REVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTL  554
            REV+VKSGLPATTS ERLELLDDD+HIL ++I+GGDHRL+NY+S+VTVHPE+IDGR GT+
Sbjct  84   REVDVKSGLPATTSTERLELLDDDDHILGIKILGGDHRLKNYSSVVTVHPEVIDGRAGTM  143

Query  555  VIESFVV  575
            VIESFVV
Sbjct  144  VIESFVV  150



>gb|EMS52737.1| hypothetical protein TRIUR3_23584 [Triticum urartu]
Length=336

 Score =   224 bits (572),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG-D  356
             E +Y+RR H H   ENQC+S LVKHI+APVHLVWSLVR FDQPQRYKPFVSRC+V+G D
Sbjct  29   TEADYMRRLHGHAPGENQCTSALVKHIKAPVHLVWSLVRSFDQPQRYKPFVSRCVVRGGD  88

Query  357  LEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID  536
            LEIGSVREVNVK+GLPATTS ERLE LDDDEHILS++ VGGDHRLRNY+SI+TVHP+ ID
Sbjct  89   LEIGSVREVNVKTGLPATTSTERLEQLDDDEHILSVKFVGGDHRLRNYSSIITVHPQSID  148

Query  537  GRPGTLVIESFVV  575
            GRPGTLVIESFVV
Sbjct  149  GRPGTLVIESFVV  161



>gb|KDP28503.1| hypothetical protein JCGZ_14274 [Jatropha curcas]
Length=189

 Score =   219 bits (559),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 123/144 (85%), Gaps = 3/144 (2%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M  GD    VE +YIRRHH+H+ RENQC+S LVKH++APV+LVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNGGDAYGVVEAQYIRRHHRHQARENQCTSALVKHMKAPVNLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIG---SVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYT  503
            SRC+V G+       SVREVNVKSGLPATTS E LELLDD EHIL ++IVGGDHRLRNY+
Sbjct  61   SRCVVNGEGGGLGIGSVREVNVKSGLPATTSTEMLELLDDKEHILGIKIVGGDHRLRNYS  120

Query  504  SIVTVHPEIIDGRPGTLVIESFVV  575
            S++TVHPE+IDGRPGTLVIESF+V
Sbjct  121  SVMTVHPEVIDGRPGTLVIESFIV  144



>ref|XP_009599268.1| PREDICTED: abscisic acid receptor PYL9-like [Nicotiana tomentosiformis]
Length=186

 Score =   219 bits (559),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E ++I R+H H+  ++QCSS +VKHI+APV +VWSLVRRFDQPQ+YKPFVSRC V+GDL
Sbjct  1    MEAQFITRYHSHQPSDHQCSSSIVKHIKAPVDIVWSLVRRFDQPQKYKPFVSRCTVKGDL  60

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             IGSVREVNVKSGLPATTS ERLELLDD+EHIL +RIVGGDHRL+NY+S++TVHPEI+DG
Sbjct  61   RIGSVREVNVKSGLPATTSTERLELLDDEEHILGIRIVGGDHRLKNYSSVITVHPEILDG  120

Query  540  RPGTLVIESFVV  575
             PGTLVIESF+V
Sbjct  121  APGTLVIESFMV  132



>ref|XP_003572108.1| PREDICTED: abscisic acid receptor PYL8 [Brachypodium distachyon]
Length=210

 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 123/141 (87%), Gaps = 3/141 (2%)
 Frame = +3

Query  162  GDRRSDV---EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
             D R D+   E +Y+RR H HE R++QCSS + KHI+APVHLVWSLVRRFDQPQ +KPFV
Sbjct  26   ADERCDLRATESDYVRRFHPHEPRDHQCSSAVAKHIKAPVHLVWSLVRRFDQPQLFKPFV  85

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC ++G++EIGSVREVNVKSGLPAT S ERLELLDD EHILS++ VGGDHRL+NY+SI+
Sbjct  86   SRCEMKGNIEIGSVREVNVKSGLPATRSTERLELLDDTEHILSVKFVGGDHRLKNYSSIL  145

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGTLVIESFVV
Sbjct  146  TVHPEVIDGRPGTLVIESFVV  166



>ref|XP_011093045.1| PREDICTED: abscisic acid receptor PYL9-like [Sesamum indicum]
Length=174

 Score =   218 bits (556),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E +YI R+H+H+ ++NQCSS +VKHI+APV +VWSLVRRFDQPQ+YKPFVSRC VQGDL
Sbjct  1    MEAQYICRYHRHQPKDNQCSSSVVKHIKAPVDIVWSLVRRFDQPQKYKPFVSRCTVQGDL  60

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            +IGSVREVNVK+GLPATTS E LELLDD EHIL ++ VGGDHRL+NY+SI TVHPEII+G
Sbjct  61   KIGSVREVNVKTGLPATTSTEMLELLDDQEHILGVKFVGGDHRLKNYSSITTVHPEIING  120

Query  540  RPGTLVIESFVV  575
            RP TLVIESFVV
Sbjct  121  RPVTLVIESFVV  132



>ref|XP_006402457.1| hypothetical protein EUTSA_v10006254mg [Eutrema salsugineum]
 gb|ESQ43910.1| hypothetical protein EUTSA_v10006254mg [Eutrema salsugineum]
Length=189

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +3

Query  195  IRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSV  374
            +R +H+H+ +ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC++ GD  IGSV
Sbjct  24   VRLNHRHDPKENQCSSVLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVMNGDFGIGSV  83

Query  375  REVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTL  554
            REV+VKSGLPATTS ERLE LDD+EHIL ++IVGGDHRL+NY+S+VTVHPEIIDGR GT+
Sbjct  84   REVDVKSGLPATTSTERLEQLDDNEHILGIKIVGGDHRLKNYSSVVTVHPEIIDGRAGTM  143

Query  555  VIESFVV  575
            VIESFVV
Sbjct  144  VIESFVV  150



>emb|CDY49462.1| BnaA10g06520D [Brassica napus]
Length=184

 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 126/139 (91%), Gaps = 2/139 (1%)
 Frame = +3

Query  165  DRRSDVEDEYIRRHHKHEV-RENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRC  341
            D   + E EYIRRHHKHE+ RENQCS+ LVKHI APVH+VWSLVRRFD+PQ+YKPF+SRC
Sbjct  3    DNNGNQEREYIRRHHKHELERENQCSTTLVKHINAPVHIVWSLVRRFDEPQKYKPFISRC  62

Query  342  IVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVH  521
            +V+G++EIG+VREV+V+SGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY+SI+++H
Sbjct  63   VVKGNMEIGTVREVDVRSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSIISLH  122

Query  522  PEIID-GRPGTLVIESFVV  575
            PE I+ GR GTLVIESFVV
Sbjct  123  PETIEGGRIGTLVIESFVV  141



>ref|XP_009388314.1| PREDICTED: abscisic acid receptor PYL8-like [Musa acuminata subsp. 
malaccensis]
Length=209

 Score =   219 bits (557),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            V  E++R  H+HE  ENQCSS +V+HIRAPVHLVWSLVR+FD+PQ+YKPFVSRCI QGDL
Sbjct  34   VAAEHVRAFHRHEPEENQCSSAVVRHIRAPVHLVWSLVRKFDEPQKYKPFVSRCIAQGDL  93

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             +G +REVNVKSGLPATTS ERLE LDD EHILS +IVGGDHRL+NY+SIVT HPE IDG
Sbjct  94   GVGRLREVNVKSGLPATTSTERLEHLDDTEHILSFKIVGGDHRLKNYSSIVTAHPETIDG  153

Query  540  RPGTLVIESFVV  575
            +PGTLVIESFVV
Sbjct  154  KPGTLVIESFVV  165



>ref|XP_010537116.1| PREDICTED: abscisic acid receptor PYL8-like isoform X3 [Tarenaya 
hassleriana]
Length=153

 Score =   217 bits (552),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            E EYIRRHH+HE +ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPF+SRC+V+G+LE
Sbjct  15   ESEYIRRHHRHEPKENQCSSTLVKHIKAPVHLVWSLVRRFDQPQKYKPFISRCVVKGNLE  74

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGR  542
            IG+VREV+VKSGLPAT S ERLELLDD++HILS+RIVGGDHRL+NY+SI+++HPE IDGR
Sbjct  75   IGTVREVDVKSGLPATKSTERLELLDDNDHILSIRIVGGDHRLKNYSSIISLHPETIDGR  134

Query  543  P  545
            P
Sbjct  135  P  135



>ref|XP_010668998.1| PREDICTED: abscisic acid receptor PYL9-like [Beta vulgaris subsp. 
vulgaris]
Length=168

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E  YI RHH H++  NQCSS L  HI+AP  LVWSLVRRFDQPQ+YKPFVSRCIV GDL
Sbjct  1    MESVYISRHHNHKIGANQCSSALTHHIKAPADLVWSLVRRFDQPQKYKPFVSRCIVSGDL  60

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            +IGS+REVNV+SGLPATTS ERLELLDDDEHILS+RIV GDHRLRNY+SI++VHPEI +G
Sbjct  61   KIGSLREVNVRSGLPATTSTERLELLDDDEHILSVRIVDGDHRLRNYSSIISVHPEINNG  120

Query  540  RPGTLVIESFVV  575
            + GTLVIESFVV
Sbjct  121  KLGTLVIESFVV  132



>emb|CBH19551.1| polyketide cyclase [Oryza sativa Indica Group]
Length=219

 Score =   219 bits (557),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 124/141 (88%), Gaps = 3/141 (2%)
 Frame = +3

Query  162  GDRRSDV---EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
             D R D+   E EY+RR H+HE R++Q SS + KHI+APVHLVWSLVRRFDQPQ +KPFV
Sbjct  20   ADERCDLRAAETEYVRRFHRHEPRDHQRSSAVAKHIKAPVHLVWSLVRRFDQPQLFKPFV  79

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC ++G++EIGSVREVNVKSGLPAT S ERLELLDD+EHILS+R VGGDHRL+NY+SI+
Sbjct  80   SRCEMKGNIEIGSVREVNVKSGLPATRSTERLELLDDNEHILSVRFVGGDHRLKNYSSIL  139

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHPE+IDGRPGTLVIESFVV
Sbjct  140  TVHPEVIDGRPGTLVIESFVV  160



>ref|XP_010512532.1| PREDICTED: abscisic acid receptor PYL9-like [Camelina sativa]
Length=189

 Score =   218 bits (555),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  195  IRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSV  374
            IR +H+H+ +ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC+++GD+ IGSV
Sbjct  23   IRLNHRHDPKENQCSSVLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVMKGDVGIGSV  82

Query  375  REVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTL  554
            REV+VKSGLPATTS ERLELL+DD+HIL ++I+GGDHRL+NY+S+VTVHPE+IDGR GT+
Sbjct  83   REVDVKSGLPATTSTERLELLNDDDHILGIKILGGDHRLKNYSSVVTVHPEVIDGRAGTM  142

Query  555  VIESFVV  575
            VIESFVV
Sbjct  143  VIESFVV  149



>ref|XP_010469112.1| PREDICTED: abscisic acid receptor PYL9-like [Camelina sativa]
Length=190

 Score =   218 bits (554),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  195  IRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSV  374
            IR +H+H+ +ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC+++GD+ IGSV
Sbjct  24   IRLNHRHDPKENQCSSVLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVMKGDVGIGSV  83

Query  375  REVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTL  554
            REV+VKSGLPATTS ERLEL DDD+HIL ++I+GGDHRL+NY+S+VTVHPE+IDGR GT+
Sbjct  84   REVDVKSGLPATTSTERLELFDDDDHILGIKILGGDHRLKNYSSVVTVHPEVIDGRAGTM  143

Query  555  VIESFVV  575
            VIESFVV
Sbjct  144  VIESFVV  150



>ref|XP_009119857.1| PREDICTED: abscisic acid receptor PYL8-like [Brassica rapa]
Length=184

 Score =   217 bits (553),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 126/139 (91%), Gaps = 2/139 (1%)
 Frame = +3

Query  165  DRRSDVEDEYIRRHHKHEV-RENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRC  341
            D   + E EY+RRHHKHE+ RENQCS+ LVKHI APVH+VWSLVRRFD+PQ+YKPF+SRC
Sbjct  3    DNNGNQEREYLRRHHKHELERENQCSTTLVKHINAPVHIVWSLVRRFDEPQKYKPFISRC  62

Query  342  IVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVH  521
            +V+G++EIG+VREV+V+SGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY+SI+++H
Sbjct  63   VVKGNMEIGTVREVDVRSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSIISLH  122

Query  522  PEIID-GRPGTLVIESFVV  575
            PE I+ GR GTLVIESFVV
Sbjct  123  PETIEGGRIGTLVIESFVV  141



>gb|KCW71518.1| hypothetical protein EUGRSUZ_E00065 [Eucalyptus grandis]
Length=141

 Score =   215 bits (548),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = +3

Query  156  MNG-DRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MNG +    +E +YI+RHH+H+ R++QC+S L KHI+APV+LVWSLVRRFDQPQ+YKPF+
Sbjct  1    MNGREAVGTMEAQYIQRHHRHDPRDHQCTSALFKHIKAPVNLVWSLVRRFDQPQKYKPFI  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC ++G+L IGSVREVNVKSGLPATTS ERLELLDD+EHIL +RIVGGDHRLRNY+S++
Sbjct  61   SRCTMRGELGIGSVREVNVKSGLPATTSTERLELLDDEEHILGVRIVGGDHRLRNYSSVM  120

Query  513  TVHPEIIDGRPGTLV  557
            TVHPE+IDGRPGTLV
Sbjct  121  TVHPEVIDGRPGTLV  135



>ref|XP_010537114.1| PREDICTED: abscisic acid receptor PYL8-like isoform X1 [Tarenaya 
hassleriana]
Length=209

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            E EYIRRHH+HE +ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPF+SRC+V+G+LE
Sbjct  15   ESEYIRRHHRHEPKENQCSSTLVKHIKAPVHLVWSLVRRFDQPQKYKPFISRCVVKGNLE  74

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGR  542
            IG+VREV+VKSGLPAT S ERLELLDD++HILS+RIVGGDHRL+NY+SI+++HPE IDGR
Sbjct  75   IGTVREVDVKSGLPATKSTERLELLDDNDHILSIRIVGGDHRLKNYSSIISLHPETIDGR  134

Query  543  P  545
            P
Sbjct  135  P  135



>emb|CDY25052.1| BnaC06g17940D [Brassica napus]
Length=187

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  195  IRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSV  374
            IR +H+H+ +ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC+++GD+ IG V
Sbjct  22   IRLNHRHDPKENQCSSVLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVMKGDVCIGCV  81

Query  375  REVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTL  554
            REV+V+SGLPATTS ERLE LDD+EHIL +RI+GGDHRL+NY+S+VTVHPEIIDGR GT+
Sbjct  82   REVDVRSGLPATTSTERLEFLDDNEHILGIRILGGDHRLKNYSSVVTVHPEIIDGRAGTM  141

Query  555  VIESFVV  575
            VIESFVV
Sbjct  142  VIESFVV  148



>gb|ACH63237.1| pathogen-induced protein-like protein [Rheum australe]
Length=186

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNGD     E+E+++R+H+H + ++QCSS LV+HI AP+HLVWSLVR FDQPQ+YKPFVS
Sbjct  1    MNGDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVRSFDQPQKYKPFVS  60

Query  336  RCIVQG-DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            RC+VQG DLEIGSVREV+VKSGLPATTS E LELLDD EH+L ++ VGGDHRL+NY+SIV
Sbjct  61   RCVVQGGDLEIGSVREVDVKSGLPATTSMEELELLDDKEHVLRVKFVGGDHRLKNYSSIV  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            ++HPEII GR GT+VIESF+V
Sbjct  121  SLHPEIIGGRSGTMVIESFIV  141



>emb|CDY61488.1| BnaCnng37890D [Brassica napus]
Length=184

 Score =   215 bits (548),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 124/133 (93%), Gaps = 2/133 (2%)
 Frame = +3

Query  183  EDEYIRRHHKHEV-RENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            E EYIRRHHKHE+ RENQCS+ LVKHI APVH+VWSLVRRFD+PQ+YKPF+SRC+V+G++
Sbjct  9    EREYIRRHHKHELERENQCSTTLVKHINAPVHIVWSLVRRFDEPQKYKPFISRCVVKGNM  68

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID-  536
            EIG+VREV+V+SGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY+S++++HPE I+ 
Sbjct  69   EIGTVREVDVRSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSVISLHPETIEG  128

Query  537  GRPGTLVIESFVV  575
            GR GTL+IESFVV
Sbjct  129  GRIGTLLIESFVV  141



>ref|XP_008461524.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis melo]
Length=181

 Score =   215 bits (548),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 120/133 (90%), Gaps = 1/133 (1%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGD-  356
            +E +YI+RHH H    +QCSS + KHI+APVHLVWSLVR FD+PQRYKPFVSRC+V+G+ 
Sbjct  1    MESQYIQRHHNHNPTHDQCSSAIFKHIKAPVHLVWSLVRSFDRPQRYKPFVSRCVVRGNS  60

Query  357  LEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID  536
            L IGS+REV+VKSGLPATTS ERLELLDD+EHIL ++IVGGDHRLRNY+SI+TVHPE+ID
Sbjct  61   LGIGSLREVDVKSGLPATTSTERLELLDDEEHILGVKIVGGDHRLRNYSSIITVHPEVID  120

Query  537  GRPGTLVIESFVV  575
            GRPGTLV+ESF+V
Sbjct  121  GRPGTLVVESFIV  133



>ref|XP_003568737.1| PREDICTED: abscisic acid receptor PYL8 [Brachypodium distachyon]
Length=210

 Score =   216 bits (549),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 119/130 (92%), Gaps = 1/130 (1%)
 Frame = +3

Query  189  EYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG-DLEI  365
            +++RR H H + E+QCSS L+KHI+APVHLVWSLVR FDQPQRYKPFVSRC+V+G DLEI
Sbjct  37   DHMRRLHSHALGEHQCSSTLLKHIKAPVHLVWSLVRSFDQPQRYKPFVSRCVVRGGDLEI  96

Query  366  GSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRP  545
            GS+REVNVK+GLPATTS ERLE LDD+EHILS++ VGGDHRLRNY+SI+TVHPE IDGRP
Sbjct  97   GSLREVNVKTGLPATTSTERLEQLDDEEHILSVKFVGGDHRLRNYSSIITVHPESIDGRP  156

Query  546  GTLVIESFVV  575
            GTLVIESFVV
Sbjct  157  GTLVIESFVV  166



>emb|CDY64350.1| BnaA03g12450D [Brassica napus]
Length=183

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 122/132 (92%), Gaps = 2/132 (2%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            E EYIRRHHKH + ENQCSS LVKHI+APVH+VWSLVRRFDQPQ+YKPF+SRC+V+G++E
Sbjct  11   EREYIRRHHKHALLENQCSSTLVKHIQAPVHIVWSLVRRFDQPQKYKPFISRCVVKGNME  70

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID-G  539
            IG+VREV+VKSGLPAT S ERLELLD++EHILS +IVGGDHRL+NY+S++++HPE I+ G
Sbjct  71   IGTVREVDVKSGLPATRSTERLELLDENEHILS-KIVGGDHRLKNYSSVISLHPETIEGG  129

Query  540  RPGTLVIESFVV  575
            R GTLVIESFVV
Sbjct  130  RIGTLVIESFVV  141



>ref|XP_004139662.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis sativus]
 ref|XP_004170333.1| PREDICTED: abscisic acid receptor PYL8-like [Cucumis sativus]
 gb|KGN44534.1| hypothetical protein Csa_7G327730 [Cucumis sativus]
Length=181

 Score =   214 bits (545),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGD-  356
            ++ +YI+RHH H    NQCSS + KHI+APVHLVWSLVR FD+PQRYKPFVSRC+V+G+ 
Sbjct  1    MDSQYIQRHHNHNPTHNQCSSAIFKHIKAPVHLVWSLVRSFDRPQRYKPFVSRCVVRGNS  60

Query  357  LEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID  536
            L IGS+REV+VKSGLPATTS ERLELLDD+EHIL ++IVGGDHRLRNY+SI+TVHPE ID
Sbjct  61   LGIGSLREVDVKSGLPATTSTERLELLDDEEHILGVKIVGGDHRLRNYSSIITVHPEAID  120

Query  537  GRPGTLVIESFVV  575
            GRPGTLV+ESF+V
Sbjct  121  GRPGTLVVESFIV  133



>gb|EEE62745.1| hypothetical protein OsJ_17548 [Oryza sativa Japonica Group]
Length=196

 Score =   214 bits (546),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = +3

Query  225  ENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG-DLEIGSVREVNVKSGL  401
            E+QCSS LVKHI+APVHLVWSLVR FDQPQRYKPFVSRC+V+G DLEIGSVREVNVK+GL
Sbjct  35   EHQCSSALVKHIKAPVHLVWSLVRSFDQPQRYKPFVSRCVVRGGDLEIGSVREVNVKTGL  94

Query  402  PATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTLVIESFVV  575
            PATTS ERLELLDDDEHILS++ VGGDHRLRNY+SIVTVHPE IDGRPGTLVIESFVV
Sbjct  95   PATTSTERLELLDDDEHILSVKFVGGDHRLRNYSSIVTVHPESIDGRPGTLVIESFVV  152



>ref|XP_002869531.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45790.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   214 bits (544),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+    VE E I+RHH+HE+ ENQCSS LVKHI+AP+HLVWSLVRRFD+PQ+YKPF+S
Sbjct  1    MNGEETKKVESENIKRHHRHELVENQCSSTLVKHIKAPLHLVWSLVRRFDEPQKYKPFIS  60

Query  336  RCIVQG-DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            RC+V+G  LEIG++REV++KSGLPAT S E LE LDD+EHIL +RIVGGDHRL+NY+S +
Sbjct  61   RCVVEGKKLEIGTIREVDLKSGLPATKSTEILEFLDDNEHILGIRIVGGDHRLKNYSSTI  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            ++H E I GR GTLVIESFVV
Sbjct  121  SLHSETIRGRIGTLVIESFVV  141



>emb|CDY70517.1| BnaCnng68710D [Brassica napus]
Length=185

 Score =   214 bits (544),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKH-EVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPF  329
            MMN D   +VE EYI+ HH H E+ E+ CSS LVKHI+AP+HLVWSLVRRFDQPQ+YKPF
Sbjct  1    MMNADETKNVESEYIKMHHAHGELLESHCSSTLVKHIKAPLHLVWSLVRRFDQPQKYKPF  60

Query  330  VSRCIVQ-GDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            +S C+V+   LEIGSVREV+V+SGLPAT S E LE LDD++H+LS+RIVGGDHRL+NY+S
Sbjct  61   ISGCVVKDKKLEIGSVREVDVRSGLPATKSTEILEFLDDNQHVLSIRIVGGDHRLKNYSS  120

Query  507  IVTVHPEIIDGRPGTLVIESFVV  575
            ++++HPE I+GR GTLVIESFVV
Sbjct  121  VISLHPETIEGRAGTLVIESFVV  143



>ref|XP_006288718.1| hypothetical protein CARUB_v10002029mg [Capsella rubella]
 gb|EOA21616.1| hypothetical protein CARUB_v10002029mg [Capsella rubella]
Length=192

 Score =   214 bits (545),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            S V  + +R HH+H  RE+QC+S LVK+I+APVHLVWSLVRRFDQPQ+YKPF+SRC V G
Sbjct  14   SLVTAQSLRLHHRHNCREDQCTSVLVKYIKAPVHLVWSLVRRFDQPQKYKPFISRCTVHG  73

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            D EIGS+REV+V+SGLPATTS ERLE LDD+EHIL + I+GGDHRL+NY+SIVTVHPE+I
Sbjct  74   DPEIGSLREVDVRSGLPATTSTERLEQLDDEEHILGINIIGGDHRLKNYSSIVTVHPEMI  133

Query  534  DGRPGTLVIESFVV  575
            DG PGT+VIESFVV
Sbjct  134  DGTPGTMVIESFVV  147



>ref|XP_004960624.1| PREDICTED: abscisic acid receptor PYL8-like [Setaria italica]
Length=205

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 122/144 (85%), Gaps = 5/144 (3%)
 Frame = +3

Query  147  AGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKP  326
            A + NG   +D    ++RR H+H   ++QC+S LVKHI+APVHLVW LVR FDQPQRYKP
Sbjct  22   AAVANGGGEAD----HVRRLHRHAPADHQCTSTLVKHIKAPVHLVWELVRSFDQPQRYKP  77

Query  327  FVSRCIVQGD-LEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYT  503
            FVSRC+V+GD LEIGS+REVNVK+GLPATTS ERLE LDDDEHIL ++ VGGDHRL+NY+
Sbjct  78   FVSRCVVRGDQLEIGSLREVNVKTGLPATTSTERLEQLDDDEHILGVKFVGGDHRLQNYS  137

Query  504  SIVTVHPEIIDGRPGTLVIESFVV  575
            SI+TVHPE IDGRPGTLVIESFVV
Sbjct  138  SIITVHPESIDGRPGTLVIESFVV  161



>emb|CDY27022.1| BnaA02g10420D [Brassica napus]
Length=188

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = +3

Query  198  RRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSVR  377
            R+HHKHE+ ENQCSS LVKHI+APVH+VWSLVRRFDQPQ+YKPF+SRC+V+GD+EIG+VR
Sbjct  19   RQHHKHELVENQCSSTLVKHIQAPVHIVWSLVRRFDQPQKYKPFISRCVVKGDMEIGTVR  78

Query  378  EVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID-GRPGTL  554
            E++VKSGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY+SI+++HPE I+ GR GTL
Sbjct  79   EIDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSIISLHPERIEGGRMGTL  138

Query  555  VIESFVV  575
            VIESF V
Sbjct  139  VIESFAV  145



>ref|XP_006396310.1| hypothetical protein EUTSA_v10028988mg [Eutrema salsugineum]
 dbj|BAJ34300.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ37763.1| hypothetical protein EUTSA_v10028988mg [Eutrema salsugineum]
Length=192

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            V   Y + HH+H   ENQC+S LVK+I+APVHLVWSLVRRFDQPQ+YKPF+SRC V GD 
Sbjct  16   VTARYAQLHHRHHCSENQCTSVLVKYIKAPVHLVWSLVRRFDQPQKYKPFISRCTVNGDP  75

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGS+REVNVKSGLPATTS ERLE LDDDEHIL + I+GGDHRLR Y+SI+TVHPE+IDG
Sbjct  76   EIGSLREVNVKSGLPATTSTERLEQLDDDEHILGINIIGGDHRLRKYSSILTVHPEMIDG  135

Query  540  RPGTLVIESFVV  575
            R  T+VIESFVV
Sbjct  136  RSATMVIESFVV  147



>ref|XP_009134503.1| PREDICTED: abscisic acid receptor PYL7-like [Brassica rapa]
Length=193

 Score =   213 bits (543),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            V  +Y R HH+H  RENQC+S LVK+I+APVHLVWSLVRRFD+PQ+YKPFVSRC VQG  
Sbjct  16   VTAQYARLHHRHHCRENQCTSVLVKYIKAPVHLVWSLVRRFDEPQKYKPFVSRCTVQGHP  75

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGS+REVNVKSGLPATTS ERLE LDD+E IL + I+GGDHRL+NY+SI+TVHPE+I+G
Sbjct  76   EIGSLREVNVKSGLPATTSTERLEQLDDNERILGINIIGGDHRLKNYSSILTVHPEMIEG  135

Query  540  RPGTLVIESFVV  575
            R GT+VIESFVV
Sbjct  136  RAGTMVIESFVV  147



>emb|CDX74368.1| BnaA03g26790D [Brassica napus]
Length=193

 Score =   213 bits (542),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            V  +Y R HH+H  RENQC+S LVK+I+APVHLVWSLVRRFD+PQ+YKPFVSRC VQG  
Sbjct  16   VTAQYARLHHRHHCRENQCTSFLVKYIKAPVHLVWSLVRRFDEPQKYKPFVSRCTVQGHP  75

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGS+REVNVKSGLPATTS ERLE LDD+E IL + I+GGDHRL+NY+SI+TVHPE+I+G
Sbjct  76   EIGSLREVNVKSGLPATTSTERLEQLDDNERILGINIIGGDHRLKNYSSILTVHPEMIEG  135

Query  540  RPGTLVIESFVV  575
            R GT+VIESFVV
Sbjct  136  RAGTMVIESFVV  147



>emb|CAB36761.1| putative protein [Arabidopsis thaliana]
 emb|CAB79594.1| putative protein [Arabidopsis thaliana]
Length=192

 Score =   213 bits (541),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 123/150 (82%), Gaps = 10/150 (7%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNGD    VE EYI++HH+HE+ E+QCSS LVKHI+AP+HLVWS+VRRFD+PQ+YKPF+S
Sbjct  1    MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFIS  60

Query  336  RCIVQG-DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLR------  494
            RC+VQG  LE+GSVREV++KSGLPAT S E LE+LDD+EHIL +RIVGGDHRL+      
Sbjct  61   RCVVQGKKLEVGSVREVDLKSGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKSLICYL  120

Query  495  ---NYTSIVTVHPEIIDGRPGTLVIESFVV  575
               NY+S +++H E IDG+ GTL IESFVV
Sbjct  121  SNQNYSSTISLHSETIDGKTGTLAIESFVV  150



>ref|NP_001266502.1| CAPIP1 [Zea mays]
 gb|ACG34726.1| CAPIP1 [Zea mays]
Length=197

 Score =   213 bits (541),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGD-L  359
            E EY+RR H+H   E+QC+S LVKHI+APVHLVW LVRRFDQPQRYKPFV  C+V+GD L
Sbjct  22   EAEYVRRMHRHAPTEHQCTSTLVKHIKAPVHLVWQLVRRFDQPQRYKPFVRNCVVRGDQL  81

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            E+GS+R+VNVK+GLPATTS ERLE LDDD HIL ++ VGGDHRL+NY+SI+TVHPE IDG
Sbjct  82   EVGSLRDVNVKTGLPATTSTERLEQLDDDLHILGVKFVGGDHRLQNYSSIITVHPESIDG  141

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  142  RPGTLVIESFVV  153



>ref|XP_008654596.1| PREDICTED: uncharacterized protein LOC100273694 isoform X1 [Zea 
mays]
 gb|ACG26022.1| CAPIP1 [Zea mays]
 gb|ACR37935.1| unknown [Zea mays]
 gb|AFW82110.1| CAPIP1 [Zea mays]
 gb|AIG52082.1| pyrabactin resistance-like protein [Zea mays]
Length=197

 Score =   212 bits (540),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGD-L  359
            E EY+RR H+H   E+QC+S LVKHI+APVHLVW LVRRFDQPQRYKPFV  C+V+GD L
Sbjct  22   EAEYVRRMHRHAPTEHQCTSTLVKHIKAPVHLVWELVRRFDQPQRYKPFVRNCVVRGDQL  81

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            E+GS+R+VNVK+GLPATTS ERLE LDDD HIL ++ VGGDHRL+NY+SI+TVHPE IDG
Sbjct  82   EVGSLRDVNVKTGLPATTSTERLEQLDDDLHILGVKFVGGDHRLQNYSSIITVHPESIDG  141

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  142  RPGTLVIESFVV  153



>ref|XP_008437914.1| PREDICTED: abscisic acid receptor PYL9 [Cucumis melo]
Length=185

 Score =   212 bits (539),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = +3

Query  156  MNGDRRSDV-EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MN D    V E +YIRRHH+H    NQC+S + K++RAPV LVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNDDDACGVMEAQYIRRHHRHHPNHNQCTSAVFKNVRAPVPLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC+V+GDL IGSVREVNVKSGLPATTS ERLELLDD+EHIL +RIVGGDHRL+NY+SI+
Sbjct  61   SRCVVKGDLGIGSVREVNVKSGLPATTSTERLELLDDEEHILGIRIVGGDHRLKNYSSIM  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHP++IDGRPGTLVIESFVV
Sbjct  121  TVHPKVIDGRPGTLVIESFVV  141



>ref|XP_002875002.1| hypothetical protein ARALYDRAFT_912134 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51261.1| hypothetical protein ARALYDRAFT_912134 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   213 bits (541),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 120/145 (83%), Gaps = 4/145 (3%)
 Frame = +3

Query  153  MMNGDRR----SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRY  320
            M  GD R    + V  + +R HH+H   +NQC+S LVK+I+APVHLVWSLVRRFDQPQ+Y
Sbjct  3    MTGGDDREMYGALVTAQSLRLHHRHHCSDNQCTSVLVKYIKAPVHLVWSLVRRFDQPQKY  62

Query  321  KPFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNY  500
            KPF+SRC V GD EIG +R+VNVKSGLPATTS ERLE LDD+EHIL + I+GGDHRL+NY
Sbjct  63   KPFISRCTVNGDPEIGCLRQVNVKSGLPATTSTERLEQLDDEEHILGINIIGGDHRLKNY  122

Query  501  TSIVTVHPEIIDGRPGTLVIESFVV  575
            +SI+TVHPE+IDGR GT+VIESFVV
Sbjct  123  SSILTVHPEMIDGRSGTMVIESFVV  147



>gb|KFK30677.1| hypothetical protein AALP_AA6G013900 [Arabis alpina]
Length=191

 Score =   212 bits (539),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +3

Query  195  IRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSV  374
            +R HH+H  R+NQC+S LVK+I+APVHLVWSLVRRFDQPQ+YKPF+SRC V GD EIGS+
Sbjct  20   LRLHHRHHCRDNQCTSVLVKYIKAPVHLVWSLVRRFDQPQKYKPFISRCTVYGDPEIGSL  79

Query  375  REVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTL  554
            REVNV+SGLPATTS ERLE LDD EHIL + I+GGDHRLRNY+SI+TVHPE+I+GR GT+
Sbjct  80   REVNVRSGLPATTSTERLEQLDDKEHILGINIIGGDHRLRNYSSILTVHPEMIEGRSGTM  139

Query  555  VIESFVV  575
            VIESFVV
Sbjct  140  VIESFVV  146



>gb|ABK23752.1| unknown [Picea sitchensis]
Length=196

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            E E + RHH+HE++ NQCSS LVKHIRAPVHLVWS+VR FDQPQ+YKPFV  C V+G + 
Sbjct  21   ESELVCRHHRHELQGNQCSSFLVKHIRAPVHLVWSIVRTFDQPQKYKPFVHSCSVRGGIT  80

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGR  542
            +GS+R VNVKSGLPAT S+ERLE+LDD+EH+ S++I+GGDHRL+NY+SI+TVHPEIIDGR
Sbjct  81   VGSIRNVNVKSGLPATASEERLEILDDNEHVFSIKILGGDHRLQNYSSIITVHPEIIDGR  140

Query  543  PGTLVIESFVV  575
            PGTLVIES+VV
Sbjct  141  PGTLVIESYVV  151



>ref|XP_004133818.1| PREDICTED: abscisic acid receptor PYL9-like [Cucumis sativus]
 ref|XP_004155161.1| PREDICTED: abscisic acid receptor PYL9-like [Cucumis sativus]
 gb|KGN56434.1| hypothetical protein Csa_3G119670 [Cucumis sativus]
Length=185

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            M + D    +E +YIRRHH+H    NQC+S + K++RAPV LVWSLVRRFDQPQ+YKPFV
Sbjct  1    MNDDDACGLMEAQYIRRHHRHHPNHNQCTSAVFKNVRAPVPLVWSLVRRFDQPQKYKPFV  60

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIV  512
            SRC+V+GDL IGSVREVNVKSGLPATTS ERLELLDD+EHIL +RIVGGDHRL+NY+SI+
Sbjct  61   SRCVVKGDLGIGSVREVNVKSGLPATTSTERLELLDDEEHILGIRIVGGDHRLKNYSSIM  120

Query  513  TVHPEIIDGRPGTLVIESFVV  575
            TVHP++IDGRPGTLVIESFVV
Sbjct  121  TVHPKVIDGRPGTLVIESFVV  141



>emb|CDX89219.1| BnaA01g16740D [Brassica napus]
Length=185

 Score =   211 bits (537),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKH-EVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPF  329
            MMN D   +VE +YI+ HH H E+ E+QCSS LVKHI+AP+HLVWSLVRRFDQPQ+YKPF
Sbjct  1    MMNADETKNVESDYIKMHHMHGELLESQCSSTLVKHIKAPLHLVWSLVRRFDQPQKYKPF  60

Query  330  VSRCIVQ-GDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            +S C+V+   LEIGSVREV+V+SGLPAT S E LE LDD++H+LS+RIVGGDHRL+NY+S
Sbjct  61   ISGCVVKDKKLEIGSVREVDVRSGLPATKSTEILEFLDDNQHVLSIRIVGGDHRLKNYSS  120

Query  507  IVTVHPEIIDGRPGTLVIESFVV  575
            ++++HPE I+ + GTLVIESFVV
Sbjct  121  VISLHPETIEAKAGTLVIESFVV  143



>ref|XP_010422757.1| PREDICTED: abscisic acid receptor PYL7-like [Camelina sativa]
Length=193

 Score =   211 bits (536),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            V  + +R HH+H  RE+QC+S LVK+I+APVHLVWSLVRRFDQPQ+YKPF+SRC V GD 
Sbjct  17   VTAQSLRLHHRHHCREDQCTSVLVKYIKAPVHLVWSLVRRFDQPQKYKPFISRCTVHGDP  76

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGS+REV+V+SGLPATTS ERLE LDD+EHIL + I+GGDHRL+NY+SI+TVHP++IDG
Sbjct  77   EIGSLREVDVRSGLPATTSTERLEQLDDEEHILGINIIGGDHRLKNYSSILTVHPQMIDG  136

Query  540  RPGTLVIESFVV  575
            R GT+VIESFVV
Sbjct  137  RSGTMVIESFVV  148



>ref|XP_010559125.1| PREDICTED: abscisic acid receptor PYL9-like [Tarenaya hassleriana]
 ref|XP_010559126.1| PREDICTED: abscisic acid receptor PYL9-like [Tarenaya hassleriana]
Length=184

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            +D++    R +HKH+ RE+QCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRC+++G
Sbjct  6    TDMQMLCARMYHKHQPREHQCSSALVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVMKG  65

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            D+ IGSVREV+VKSGLPATTS ERLELLDD++HIL +RIVGGDHRL+NY+SIVTVHPEII
Sbjct  66   DVGIGSVREVDVKSGLPATTSTERLELLDDNQHILRIRIVGGDHRLKNYSSIVTVHPEII  125

Query  534  DGRPGT  551
            DGRPGT
Sbjct  126  DGRPGT  131



>ref|XP_002439456.1| hypothetical protein SORBIDRAFT_09g006700 [Sorghum bicolor]
 gb|EES17886.1| hypothetical protein SORBIDRAFT_09g006700 [Sorghum bicolor]
Length=197

 Score =   211 bits (536),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGD-L  359
            E EY+RR H+H   E+QC+S LVKHI+APVHLVW LVR FDQPQRYKPFV  C+V+GD L
Sbjct  22   ETEYVRRLHRHAPAEHQCTSTLVKHIKAPVHLVWELVRSFDQPQRYKPFVRNCVVRGDQL  81

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            E+GSVR+VNVK+GLPATTS ERLE LDDD HIL ++ VGGDHRL+NY+SI+TVHPE IDG
Sbjct  82   EVGSVRDVNVKTGLPATTSTERLEQLDDDLHILGVKFVGGDHRLQNYSSIITVHPESIDG  141

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  142  RPGTLVIESFVV  153



>ref|XP_002878400.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54659.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=179

 Score =   210 bits (534),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  207  HKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSVREVN  386
            H+H+ +ENQCSS LVKHI+APVHLVWSLVRRFDQP +YKPFVSRC+++GD+ IG VREV+
Sbjct  18   HRHDSKENQCSSVLVKHIQAPVHLVWSLVRRFDQPHKYKPFVSRCVMKGDVGIGCVREVD  77

Query  387  VKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTLVIES  566
            VKSGLPATTS ERLELLDD +HIL ++I+GGDHRL+NY+S+VTVHPEIIDGR GT+VIES
Sbjct  78   VKSGLPATTSTERLELLDDTDHILGIKILGGDHRLKNYSSVVTVHPEIIDGRAGTMVIES  137

Query  567  FVV  575
            FVV
Sbjct  138  FVV  140



>ref|XP_010427934.1| PREDICTED: abscisic acid receptor PYL7 [Camelina sativa]
Length=193

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            V  + +R HH+H  RE+QC+S LVK+I+APVHLVWSLVRRFDQPQ+YKPF+SRC V GD 
Sbjct  17   VTAQSLRLHHRHHCREDQCTSVLVKYIKAPVHLVWSLVRRFDQPQKYKPFISRCTVHGDP  76

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGS+REV+V+SGLPATTS ERLE LDD+EHIL + I+GGDHRL+NY+SI+TVHP++IDG
Sbjct  77   EIGSLREVDVRSGLPATTSTERLEQLDDEEHILGINIIGGDHRLKNYSSILTVHPQMIDG  136

Query  540  RPGTLVIESFVV  575
            R GT+VIESFVV
Sbjct  137  RSGTMVIESFVV  148



>ref|XP_009389976.1| PREDICTED: abscisic acid receptor PYL8-like [Musa acuminata subsp. 
malaccensis]
Length=211

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E EY+R  H+H   ENQCSS + KHI+APVH VWSLVRRFDQPQ+YKPFVSRCIVQ   
Sbjct  36   LEAEYVRSFHRHVPNENQCSSAIFKHIKAPVHHVWSLVRRFDQPQKYKPFVSRCIVQDGT  95

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
             +GS+REVN+KSGLPATTS ERLE LDDDE +LS+RIVGGDHRL+NY+SI+T HPE IDG
Sbjct  96   GVGSLREVNIKSGLPATTSFERLEHLDDDERVLSIRIVGGDHRLKNYSSIITAHPETIDG  155

Query  540  RPGTLVIESFVV  575
            RP TLVIESFVV
Sbjct  156  RPATLVIESFVV  167



>emb|CDY53905.1| BnaA07g38130D [Brassica napus]
Length=187

 Score =   210 bits (534),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  195  IRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSV  374
            IR +H+H+ +ENQCSS LVKHI+APVHLVWSLVRRFDQPQ YKPFVSRC+++GD+ IG V
Sbjct  22   IRLNHRHDPKENQCSSVLVKHIKAPVHLVWSLVRRFDQPQIYKPFVSRCVMKGDVGIGCV  81

Query  375  REVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTL  554
            REVNV+SGLPATTS ERLE  DD+EHIL ++I+GGDHRL+NY+S+VTVHPEI+D + GT+
Sbjct  82   REVNVRSGLPATTSTERLEFFDDNEHILGIKILGGDHRLKNYSSVVTVHPEILDEKAGTM  141

Query  555  VIESFVV  575
            VIESFVV
Sbjct  142  VIESFVV  148



>gb|AAM65054.1| unknown [Arabidopsis thaliana]
Length=209

 Score =   210 bits (535),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            V  + +R  H H  RENQC+S LVK+I+APVHLVWSLVRRFDQPQ+YKPF+SRC V GD 
Sbjct  16   VTAQSLRLRHLHHCRENQCTSVLVKYIQAPVHLVWSLVRRFDQPQKYKPFISRCTVNGDP  75

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIG +REVNVKSGLPATTS ERLE LDD+EHIL + I+GGDHRL+NY+SI+TVHPE+IDG
Sbjct  76   EIGCLREVNVKSGLPATTSTERLEQLDDEEHILGINIIGGDHRLKNYSSILTVHPEMIDG  135

Query  540  RPGTLVIESFVV  575
            R GT+V+ESFVV
Sbjct  136  RSGTMVMESFVV  147



>ref|NP_001140969.1| CAPIP1 [Zea mays]
 gb|ACF85073.1| unknown [Zea mays]
 gb|ACG37471.1| CAPIP1 [Zea mays]
 gb|AFW77409.1| CAPIP1 [Zea mays]
Length=197

 Score =   210 bits (534),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGD-L  359
            E EY+RR H+H   E+QC+S LVKHI+APVHLVW LVR FDQPQRYKPFV  C+V+GD L
Sbjct  22   ETEYVRRLHRHAPAEHQCTSTLVKHIKAPVHLVWELVRSFDQPQRYKPFVRNCVVRGDQL  81

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            E+GS+R+VNVK+GLPATTS ERLE LDDD HIL ++ VGGDHRL+NY+SI+TVHPE IDG
Sbjct  82   EVGSLRDVNVKTGLPATTSTERLEQLDDDLHILGVKFVGGDHRLQNYSSIITVHPESIDG  141

Query  540  RPGTLVIESFVV  575
            RPGTLVIESFVV
Sbjct  142  RPGTLVIESFVV  153



>ref|NP_567208.1| abscisic acid receptor PYL7 [Arabidopsis thaliana]
 sp|Q1ECF1.1|PYL7_ARATH RecName: Full=Abscisic acid receptor PYL7; AltName: Full=ABI1-binding 
protein 7; AltName: Full=PYR1-like protein 7; AltName: 
Full=Regulatory components of ABA receptor 2 [Arabidopsis 
thaliana]
 gb|ABF83673.1| At4g01026 [Arabidopsis thaliana]
 gb|AEE81969.1| abscisic acid receptor PYL7 [Arabidopsis thaliana]
Length=211

 Score =   210 bits (534),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            V  + +R  H H  RENQC+S LVK+I+APVHLVWSLVRRFDQPQ+YKPF+SRC V GD 
Sbjct  18   VTAQSLRLRHLHHCRENQCTSVLVKYIQAPVHLVWSLVRRFDQPQKYKPFISRCTVNGDP  77

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIG +REVNVKSGLPATTS ERLE LDD+EHIL + I+GGDHRL+NY+SI+TVHPE+IDG
Sbjct  78   EIGCLREVNVKSGLPATTSTERLEQLDDEEHILGINIIGGDHRLKNYSSILTVHPEMIDG  137

Query  540  RPGTLVIESFVV  575
            R GT+V+ESFVV
Sbjct  138  RSGTMVMESFVV  149



>ref|XP_009104333.1| PREDICTED: abscisic acid receptor PYL9-like [Brassica rapa]
Length=187

 Score =   209 bits (532),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  195  IRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSV  374
            IR +H+H+ +ENQCSS LVK+I+APVHLVWSLVRRFDQPQ YKPFVSRC+++GD+ IG V
Sbjct  22   IRLNHRHDPKENQCSSVLVKYIKAPVHLVWSLVRRFDQPQIYKPFVSRCVMKGDVGIGCV  81

Query  375  REVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTL  554
            REVNV+SGLPATTS ERLE  DD+EHIL ++I+GGDHRL+NY+S+VTVHPEIID + GT+
Sbjct  82   REVNVRSGLPATTSTERLEFFDDNEHILGIKILGGDHRLKNYSSVVTVHPEIIDEKAGTM  141

Query  555  VIESFVV  575
            VIESFVV
Sbjct  142  VIESFVV  148



>ref|XP_009144044.1| PREDICTED: abscisic acid receptor PYL10-like [Brassica rapa]
Length=222

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 122/143 (85%), Gaps = 2/143 (1%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKH-EVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPF  329
            MMN D   +VE +YI+ HH H E+ E+QCSS LVKHI+AP+HLVWSLVRRFDQPQ+YKPF
Sbjct  38   MMNADETKNVESDYIKMHHMHGELLESQCSSTLVKHIKAPLHLVWSLVRRFDQPQKYKPF  97

Query  330  VSRCIVQ-GDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            +S C+V+   LEIGSVREV+V+SGLPAT S E LE LDD++H+LS+RIVGGDHRL+NY+S
Sbjct  98   ISGCVVKDKKLEIGSVREVDVRSGLPATKSTEILEFLDDNQHVLSIRIVGGDHRLKNYSS  157

Query  507  IVTVHPEIIDGRPGTLVIESFVV  575
            ++++HPE I+ + GTLVIESFVV
Sbjct  158  VISLHPETIEAKAGTLVIESFVV  180



>ref|XP_010456196.1| PREDICTED: abscisic acid receptor PYL7-like [Camelina sativa]
Length=193

 Score =   209 bits (532),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 122/146 (84%), Gaps = 5/146 (3%)
 Frame = +3

Query  153  MMNGDRRSD-----VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQR  317
            ++ GD  S+     V  + +R HH+H  RE+QC+S LVK+I+APVHLVWSLVRRFDQPQ+
Sbjct  3    IIGGDDDSEMYGALVTAQSLRLHHRHHCREDQCTSILVKYIKAPVHLVWSLVRRFDQPQK  62

Query  318  YKPFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRN  497
            YKPF+SRC V GD EIGS+REV+V+SGLPATTS ERLE LDD EHIL + I+GGDHRL+N
Sbjct  63   YKPFISRCTVHGDPEIGSLREVDVRSGLPATTSTERLEQLDDKEHILGINIIGGDHRLKN  122

Query  498  YTSIVTVHPEIIDGRPGTLVIESFVV  575
            Y+SI+TVHP++IDGR GT+VIESFVV
Sbjct  123  YSSILTVHPQMIDGRSGTMVIESFVV  148



>gb|AFK34655.1| unknown [Lotus japonicus]
Length=222

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  174  SDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQG  353
            S +E EYIRRHH+H+  ENQC+S +VKHIRAPV  VWSLVRRFDQPQ+YKPFVSRCIV+G
Sbjct  94   SSLEMEYIRRHHRHQPGENQCASAVVKHIRAPVPQVWSLVRRFDQPQKYKPFVSRCIVRG  153

Query  354  DLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEII  533
            +LEIGS+REV+VKSGLPATTS ERLELLDDDEHILS+RI+GGDHRLRNY+SI+++HPEII
Sbjct  154  NLEIGSLREVDVKSGLPATTSTERLELLDDDEHILSIRIIGGDHRLRNYSSILSLHPEII  213

Query  534  DGR  542
            DG+
Sbjct  214  DGK  216



>emb|CDP08696.1| unnamed protein product [Coffea canephora]
Length=180

 Score =   207 bits (528),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +3

Query  198  RRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSVR  377
            R    H+  E+ CSS +VKHIRAPV +VWSLVRRFDQPQRYKPFVS CIV GDL+IGSVR
Sbjct  12   RMQGSHQPTEHPCSSSVVKHIRAPVDIVWSLVRRFDQPQRYKPFVSTCIVNGDLKIGSVR  71

Query  378  EVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTLV  557
            EVNV+SGLPATTS ERLELLDD++HIL ++IVGGDHRL+NY+SI+TVHPEIIDGRPGT+V
Sbjct  72   EVNVRSGLPATTSTERLELLDDEKHILGIKIVGGDHRLKNYSSILTVHPEIIDGRPGTVV  131

Query  558  IESFVV  575
             ESFVV
Sbjct  132  TESFVV  137



>gb|KJB39704.1| hypothetical protein B456_007G026100 [Gossypium raimondii]
Length=134

 Score =   206 bits (523),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  156  MNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVS  335
            MNG+R + VE+E+I+++HKH+V+ENQCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVS
Sbjct  9    MNGNRFTKVEEEFIKKYHKHDVKENQCSSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVS  68

Query  336  RCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRN  497
            RC++QGDL+IGSVREVNVKSGLPATTS ERLE LDDDEHILSMRIVGGDHRL++
Sbjct  69   RCVLQGDLQIGSVREVNVKSGLPATTSTERLEYLDDDEHILSMRIVGGDHRLKS  122



>ref|XP_010445584.1| PREDICTED: abscisic acid receptor PYL8 [Camelina sativa]
Length=201

 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 123/149 (83%), Gaps = 7/149 (5%)
 Frame = +3

Query  150  GMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPF  329
             ++N +     E E+IRRHH+HE+  NQCSS LVKHI APVH+VWSLVRRFDQPQ+YKPF
Sbjct  8    SLVNPNLSQSQEREFIRRHHQHELLHNQCSSTLVKHINAPVHIVWSLVRRFDQPQKYKPF  67

Query  330  VSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSI  509
            +SRC+V+G++EIG+VREV+VKSGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY+SI
Sbjct  68   ISRCVVKGNMEIGTVREVDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSI  127

Query  510  VTVHPEII-------DGRPGTLVIESFVV  575
            +++HPE I           GTLVIESFVV
Sbjct  128  ISLHPETIGGGGGGGGRTGGTLVIESFVV  156



>ref|XP_010442871.1| PREDICTED: abscisic acid receptor PYL8-like [Camelina sativa]
Length=201

 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 124/149 (83%), Gaps = 7/149 (5%)
 Frame = +3

Query  150  GMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPF  329
             ++N +     E E+IRRHH+HE+ +NQCSS LV+HI APVH+VWSLVRRFDQPQ+YKPF
Sbjct  8    SLVNPNLSQSQEREFIRRHHQHELLQNQCSSTLVQHINAPVHIVWSLVRRFDQPQKYKPF  67

Query  330  VSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSI  509
            +SRC+V+G++EIG+VREV+VKSGLPAT S ERLELLDD+EHILS+RIVGGDHRL+NY+SI
Sbjct  68   ISRCVVKGNMEIGTVREVDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSI  127

Query  510  VTVHPEII-------DGRPGTLVIESFVV  575
            +++HPE I           GTLVIESFVV
Sbjct  128  ISLHPETIGGGGGGGRTTGGTLVIESFVV  156



>emb|CDX91871.1| BnaC03g31730D [Brassica napus]
Length=193

 Score =   207 bits (526),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            V  +Y R HH+    ENQC+S LVK+I+APVHLVWSLVRRFDQPQ+YKPFVSRC V G  
Sbjct  16   VTAQYARLHHRQHCGENQCTSVLVKYIKAPVHLVWSLVRRFDQPQKYKPFVSRCTVHGHP  75

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDG  539
            EIGS+REVNVKSGLPATTS ERLE LDD+E IL + I+GGDHRL+NY+SI+TVHPE+I+G
Sbjct  76   EIGSLREVNVKSGLPATTSTERLEQLDDNERILGINIIGGDHRLKNYSSILTVHPEMIEG  135

Query  540  RPGTLVIESFVV  575
            R GT+VIESFVV
Sbjct  136  RAGTMVIESFVV  147



>ref|XP_011462052.1| PREDICTED: abscisic acid receptor PYL8-like [Fragaria vesca subsp. 
vesca]
Length=244

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  222  RENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSVREVNVKSGL  401
            ++ QCSS LV+HI+APVHLVWSLVRRFDQPQ+YKPFVSRC+V G+LEIGS+REV+VKSGL
Sbjct  82   KDYQCSSTLVRHIKAPVHLVWSLVRRFDQPQKYKPFVSRCVVLGNLEIGSLREVDVKSGL  141

Query  402  PATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTLVIESFVV  575
            PATTS ERLELLDDDEH+LS+RI+GGDHRL NY+SI+++HPEI+DG+P TLVIESFVV
Sbjct  142  PATTSTERLELLDDDEHLLSIRIIGGDHRLMNYSSIISLHPEIVDGKPETLVIESFVV  199



>gb|ACL54318.1| unknown [Zea mays]
 gb|AFW82108.1| hypothetical protein ZEAMMB73_305823 [Zea mays]
Length=169

 Score =   201 bits (512),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +3

Query  207  HKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGD-LEIGSVREV  383
            H+H   E+QC+S LVKHI+APVHLVW LVRRFDQPQRYKPFV  C+V+GD LE+GS+R+V
Sbjct  2    HRHAPTEHQCTSTLVKHIKAPVHLVWELVRRFDQPQRYKPFVRNCVVRGDQLEVGSLRDV  61

Query  384  NVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTLVIE  563
            NVK+GLPATTS ERLE LDDD HIL ++ VGGDHRL+NY+SI+TVHPE IDGRPGTLVIE
Sbjct  62   NVKTGLPATTSTERLEQLDDDLHILGVKFVGGDHRLQNYSSIITVHPESIDGRPGTLVIE  121

Query  564  SFVV  575
            SFVV
Sbjct  122  SFVV  125



>ref|XP_010692257.1| PREDICTED: abscisic acid receptor PYL8-like [Beta vulgaris subsp. 
vulgaris]
Length=181

 Score =   199 bits (507),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +3

Query  180  VEDEYIRRHHKH-EVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGD  356
            +E E+I ++HK  +V  NQCSS L K I+AP+ +VWSLVR FDQPQ+YKPFVS C +  D
Sbjct  1    MEGEFISKYHKQLDVGANQCSSTLTKRIKAPIDIVWSLVRSFDQPQKYKPFVSECTLTED  60

Query  357  LEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIID  536
             ++G++REVNV+SGLPATTS ERLELLDD+EHI S+RI+GGDHRLRNY+S +T HPE ID
Sbjct  61   FKVGTLREVNVRSGLPATTSTERLELLDDEEHIFSVRIMGGDHRLRNYSSKITAHPETID  120

Query  537  GRPGTLVIESFVV  575
            GRPGTL+IESF+V
Sbjct  121  GRPGTLLIESFIV  133



>gb|KDO76507.1| hypothetical protein CISIN_1g028067mg [Citrus sinensis]
Length=153

 Score =   191 bits (485),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  279  VWSLVRRFDQPQRYKPFVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHIL  458
            VWSLVRRFDQPQ+YKPFVSRCIVQGDL+IGSVREVNVKSGLPATTS ERLELLDD+EHI 
Sbjct  10   VWSLVRRFDQPQKYKPFVSRCIVQGDLQIGSVREVNVKSGLPATTSTERLELLDDEEHIF  69

Query  459  SMRIVGGDHRLRNYTSIVTVHPEIIDGRPGTLVIESFVV  575
             MRIVGGDHRL+NY+SIVTVHPE+IDGRPGTLVIESFVV
Sbjct  70   GMRIVGGDHRLKNYSSIVTVHPEVIDGRPGTLVIESFVV  108



>ref|XP_002982856.1| hypothetical protein SELMODRAFT_117026 [Selaginella moellendorffii]
 ref|XP_002990956.1| hypothetical protein SELMODRAFT_161269 [Selaginella moellendorffii]
 gb|EFJ08000.1| hypothetical protein SELMODRAFT_161269 [Selaginella moellendorffii]
 gb|EFJ16101.1| hypothetical protein SELMODRAFT_117026 [Selaginella moellendorffii]
Length=188

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  183  EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDLE  362
            E+E+I R+HKHE++E QC S L+K I APV LVWSLVRRFDQPQ YK F+  C V GD +
Sbjct  9    EEEHIWRYHKHEMQEYQCGSILIKRINAPVQLVWSLVRRFDQPQGYKRFIQSCTVNGDGK  68

Query  363  IGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTSIVTVHPEIIDGR  542
            +GS+R VNV +GLPAT+S ERLE+LD++EHI S RI+GGDHRL+NY SI+T+H E+I+GR
Sbjct  69   VGSIRNVNVVTGLPATSSTERLEILDEEEHIFSYRILGGDHRLKNYWSIITLHSEMINGR  128

Query  543  PGTLVIESFVV  575
            PGTL IES+VV
Sbjct  129  PGTLAIESYVV  139



>ref|XP_006439366.1| hypothetical protein CICLE_v10022206mg [Citrus clementina]
 gb|ESR52606.1| hypothetical protein CICLE_v10022206mg [Citrus clementina]
Length=168

 Score =   191 bits (485),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +3

Query  180  VEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFVSRCIVQGDL  359
            +E++YI+RHHKH+V ++QCSS LVKHI+APVHLVWSLVRRFDQPQ+YKPFVSRCIVQGDL
Sbjct  21   IEEDYIKRHHKHDVHDHQCSSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCIVQGDL  80

Query  360  EIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLR  494
            +IGSVREVNVKSGLPATTS ERLELLDD+EHI  MRIVGGDHRL+
Sbjct  81   QIGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLK  125



>ref|XP_010314502.1| PREDICTED: abscisic acid receptor PYL8-like isoform X2 [Solanum 
lycopersicum]
Length=118

 Score =   187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 103/118 (87%), Gaps = 5/118 (4%)
 Frame = +3

Query  153  MMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPFV  332
            MMN     ++EDEYIRRHH+H +  NQCSS LVK IRAPV+LVWSLVRRFDQPQRYKPFV
Sbjct  1    MMN-----NMEDEYIRRHHRHVLDHNQCSSSLVKRIRAPVNLVWSLVRRFDQPQRYKPFV  55

Query  333  SRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            SRC+VQGDLEIGSVREVNV+SGLPATTSKERLELLDD+EHI  ++IVGGDHRL+   S
Sbjct  56   SRCVVQGDLEIGSVREVNVRSGLPATTSKERLELLDDEEHIFGVKIVGGDHRLQKKRS  113



>ref|XP_010925746.1| PREDICTED: abscisic acid receptor PYL8-like isoform X2 [Elaeis 
guineensis]
Length=203

 Score =   189 bits (481),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +3

Query  147  AGMMNGDRRSDVEDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKP  326
            A  MN +    VE EY+RR H+HE+RENQCSS L KHI+APVHLVWSLVRRFDQPQ+YKP
Sbjct  20   ADEMNSNGCCGVESEYVRRLHRHELRENQCSSTLFKHIKAPVHLVWSLVRRFDQPQKYKP  79

Query  327  FVSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLRNYTS  506
            FVSRC++QGDL IGSVREVNVKSGLPATTS ERLE LDD+EHILS++IVGGDHRL++  S
Sbjct  80   FVSRCVMQGDLGIGSVREVNVKSGLPATTSTERLEFLDDNEHILSIKIVGGDHRLKS-NS  138

Query  507  IVTVHPEIID  536
               VH  +I+
Sbjct  139  RCLVHLFMIE  148



>gb|KCW78164.1| hypothetical protein EUGRSUZ_D02364 [Eucalyptus grandis]
Length=136

 Score =   186 bits (473),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +3

Query  153  MMNGDRRSDV-EDEYIRRHHKHEVRENQCSSCLVKHIRAPVHLVWSLVRRFDQPQRYKPF  329
            M  GD  S + E EYIRRHHKHE  E QC+S ++K I+APVHLVWSLVRRFDQPQ+YKPF
Sbjct  1    MNGGDAVSGIMEAEYIRRHHKHEAGERQCTSAVIKRIKAPVHLVWSLVRRFDQPQKYKPF  60

Query  330  VSRCIVQGDLEIGSVREVNVKSGLPATTSKERLELLDDDEHILSMRIVGGDHRLR  494
            VSRCI++GDL IGSVREVNVKSGLPATTS ERLELLDD+EHIL +RIVGGDHRL+
Sbjct  61   VSRCIMKGDLGIGSVREVNVKSGLPATTSTERLELLDDEEHILGIRIVGGDHRLK  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985