BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J20

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588403.1|  PREDICTED: endonuclease III homolog 1, chlor...    179   8e-51   Nicotiana tomentosiformis
ref|XP_009588404.1|  PREDICTED: endonuclease III homolog 1, chlor...    174   2e-49   Nicotiana tomentosiformis
ref|XP_009588402.1|  PREDICTED: endonuclease III homolog 1, chlor...    172   2e-48   Nicotiana tomentosiformis
ref|XP_004241397.1|  PREDICTED: endonuclease III homolog 1, chlor...    171   1e-47   Solanum lycopersicum
ref|XP_009781250.1|  PREDICTED: endonuclease III homolog 1, chlor...    169   5e-47   Nicotiana sylvestris
ref|XP_009781249.1|  PREDICTED: endonuclease III homolog 1, chlor...    165   1e-45   Nicotiana sylvestris
ref|XP_002264475.3|  PREDICTED: endonuclease III homolog 1, chlor...    153   4e-41   Vitis vinifera
emb|CBI36652.3|  unnamed protein product                                153   5e-41   Vitis vinifera
ref|XP_006347463.1|  PREDICTED: endonuclease III-like protein 1-like    153   1e-40   
ref|XP_006494172.1|  PREDICTED: endonuclease III-like protein 1-like    145   4e-38   
ref|XP_006443060.1|  hypothetical protein CICLE_v10020813mg             145   5e-38   Citrus clementina [clementine]
ref|XP_009344368.1|  PREDICTED: endonuclease III homolog 1, chlor...    139   8e-36   
ref|XP_008369130.1|  PREDICTED: endonuclease III homolog 1, chlor...    139   9e-36   Malus domestica [apple tree]
ref|XP_009363648.1|  PREDICTED: endonuclease III homolog 1, chlor...    139   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_007034068.1|  DNA glycosylase superfamily protein isoform 2      138   2e-35   
ref|XP_007034067.1|  DNA glycosylase superfamily protein isoform 1      137   4e-35   Theobroma cacao [chocolate]
emb|CDP20302.1|  unnamed protein product                                135   2e-34   Coffea canephora [robusta coffee]
gb|KDP42806.1|  hypothetical protein JCGZ_23748                         135   2e-34   Jatropha curcas
ref|XP_011026396.1|  PREDICTED: endonuclease III homolog 1, chlor...    132   2e-33   Populus euphratica
ref|XP_011026395.1|  PREDICTED: endonuclease III homolog 1, chlor...    132   3e-33   Populus euphratica
gb|KHG16754.1|  Endonuclease III-like protein 1                         130   1e-32   Gossypium arboreum [tree cotton]
gb|KJB71884.1|  hypothetical protein B456_011G146700                    129   4e-32   Gossypium raimondii
gb|KJB71882.1|  hypothetical protein B456_011G146700                    128   6e-32   Gossypium raimondii
gb|KJB71883.1|  hypothetical protein B456_011G146700                    128   7e-32   Gossypium raimondii
gb|KJB71881.1|  hypothetical protein B456_011G146700                    128   9e-32   Gossypium raimondii
gb|KJB71885.1|  hypothetical protein B456_011G146700                    128   1e-31   Gossypium raimondii
ref|XP_007034070.1|  DNA glycosylase superfamily protein isoform 4      127   1e-31   
ref|XP_011100484.1|  PREDICTED: endonuclease III homolog 1, chlor...    127   1e-31   Sesamum indicum [beniseed]
ref|XP_002534117.1|  endonuclease III, putative                         127   2e-31   
ref|XP_008222537.1|  PREDICTED: endonuclease III homolog 1, chlor...    127   2e-31   Prunus mume [ume]
ref|XP_007034069.1|  DNA glycosylase superfamily protein isoform 3      127   2e-31   Theobroma cacao [chocolate]
ref|XP_008799977.1|  PREDICTED: endonuclease III homolog 1, chlor...    124   2e-30   Phoenix dactylifera
ref|XP_008799985.1|  PREDICTED: endonuclease III homolog 1, chlor...    124   2e-30   
gb|EYU42853.1|  hypothetical protein MIMGU_mgv1a009936mg                123   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_010469713.1|  PREDICTED: endonuclease III homolog 1, chlor...    123   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010930206.1|  PREDICTED: LOW QUALITY PROTEIN: endonuclease...    123   5e-30   
gb|AAM61598.1|  putative endonuclease                                   122   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469712.1|  PREDICTED: endonuclease III homolog 1, chlor...    122   2e-29   Camelina sativa [gold-of-pleasure]
emb|CAC16135.1|  endonuclease III homologue                             121   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077988.1|  protein NTH1                                       121   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565725.1|  protein NTH1                                          121   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010558863.1|  PREDICTED: endonuclease III homolog 1, chlor...    121   3e-29   
ref|XP_002881177.1|  predicted protein                                  120   5e-29   Arabidopsis lyrata subsp. lyrata
gb|EYU42852.1|  hypothetical protein MIMGU_mgv1a009936mg                119   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_009416017.1|  PREDICTED: endonuclease III homolog 1, chlor...    119   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010672145.1|  PREDICTED: endonuclease III homolog 1, chlor...    119   3e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010069308.1|  PREDICTED: endonuclease III homolog 1, chlor...    118   4e-28   Eucalyptus grandis [rose gum]
ref|XP_006294450.1|  hypothetical protein CARUB_v10023463mg             118   5e-28   Capsella rubella
ref|XP_010650536.1|  PREDICTED: endonuclease III homolog 1, chlor...    116   5e-28   Vitis vinifera
ref|XP_010069309.1|  PREDICTED: endonuclease III homolog 1, chlor...    117   7e-28   Eucalyptus grandis [rose gum]
ref|XP_010414127.1|  PREDICTED: endonuclease III homolog 1, chlor...    116   1e-27   
ref|XP_004309826.1|  PREDICTED: endonuclease III homolog 1, chlor...    115   2e-27   Fragaria vesca subsp. vesca
ref|XP_007034071.1|  DNA glycosylase superfamily protein isoform 5      113   5e-27   
emb|CDX84784.1|  BnaA03g14460D                                          115   6e-27   
ref|XP_010414126.1|  PREDICTED: endonuclease III homolog 1, chlor...    114   8e-27   Camelina sativa [gold-of-pleasure]
ref|XP_007131959.1|  hypothetical protein PHAVU_011G055100g             111   1e-25   Phaseolus vulgaris [French bean]
ref|XP_003539044.2|  PREDICTED: endonuclease III-like protein 1-like    111   1e-25   Glycine max [soybeans]
ref|XP_009132788.1|  PREDICTED: endonuclease III homolog 1, chlor...    111   1e-25   Brassica rapa
ref|XP_010510195.1|  PREDICTED: endonuclease III homolog 1, chlor...    110   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007222713.1|  hypothetical protein PRUPE_ppa009900mg             109   2e-25   
ref|XP_009132790.1|  PREDICTED: endonuclease III homolog 1, chlor...    110   2e-25   Brassica rapa
ref|XP_007131960.1|  hypothetical protein PHAVU_011G055100g             110   2e-25   Phaseolus vulgaris [French bean]
ref|XP_002309812.1|  endonuclease-related family protein                110   3e-25   
ref|XP_009132789.1|  PREDICTED: endonuclease III homolog 1, chlor...    110   3e-25   Brassica rapa
gb|KEH30313.1|  EndoIII-related endonuclease                            110   3e-25   Medicago truncatula
gb|KJB71886.1|  hypothetical protein B456_011G146700                    109   3e-25   Gossypium raimondii
ref|XP_009132791.1|  PREDICTED: endonuclease III homolog 1, chlor...    110   4e-25   Brassica rapa
emb|CDY23941.1|  BnaC03g17500D                                          109   6e-25   Brassica napus [oilseed rape]
ref|XP_006410282.1|  hypothetical protein EUTSA_v10016815mg             109   7e-25   Eutrema salsugineum [saltwater cress]
ref|XP_009132787.1|  PREDICTED: endonuclease III homolog 1, chlor...    109   7e-25   
ref|XP_010510194.1|  PREDICTED: endonuclease III homolog 1, chlor...    108   8e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004507328.1|  PREDICTED: endonuclease III-like protein 1-like    108   1e-24   Cicer arietinum [garbanzo]
ref|XP_009629859.1|  PREDICTED: endonuclease III homolog 1, chlor...    107   1e-24   
ref|XP_009132785.1|  PREDICTED: endonuclease III homolog 1, chlor...    107   3e-24   Brassica rapa
ref|XP_009799825.1|  PREDICTED: endonuclease III homolog 1, chlor...    107   3e-24   Nicotiana sylvestris
ref|XP_009132786.1|  PREDICTED: endonuclease III homolog 1, chlor...    106   6e-24   Brassica rapa
ref|XP_009393784.1|  PREDICTED: endonuclease III homolog 2, chlor...    105   6e-24   
ref|XP_009393783.1|  PREDICTED: endonuclease III homolog 2, chlor...    105   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009799824.1|  PREDICTED: endonuclease III homolog 1, chlor...    104   2e-23   Nicotiana sylvestris
ref|XP_008453986.1|  PREDICTED: endonuclease III homolog 1, chlor...    104   2e-23   Cucumis melo [Oriental melon]
gb|KGN53073.1|  hypothetical protein Csa_4G015140                       103   7e-23   Cucumis sativus [cucumbers]
ref|XP_004152104.1|  PREDICTED: endonuclease III-like protein 1-like    103   9e-23   Cucumis sativus [cucumbers]
ref|XP_006845160.1|  hypothetical protein AMTR_s00005p00230200          102   1e-22   
ref|XP_002442817.1|  hypothetical protein SORBIDRAFT_08g003320          101   3e-22   Sorghum bicolor [broomcorn]
ref|NP_001176473.1|  Os11g0267300                                     98.6    6e-22   
ref|XP_009629860.1|  PREDICTED: endonuclease III homolog 1, chlor...  99.8    9e-22   Nicotiana tomentosiformis
ref|NP_563752.1|  endonuclease III 2                                  99.8    1e-21   Arabidopsis thaliana [mouse-ear cress]
gb|ACG42926.1|  endonuclease III-like protein 1                         100   1e-21   Zea mays [maize]
emb|CDY06185.1|  BnaA09g50180D                                          100   1e-21   
ref|NP_973767.1|  endonuclease III 2                                  99.8    2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAF29397.1|AC009999_17  Contains similarity to an endonuclease...  99.4    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889575.1|  hypothetical protein ARALYDRAFT_470604           99.0    3e-21   
ref|XP_009118569.1|  PREDICTED: endonuclease III homolog 2, chlor...  98.6    4e-21   Brassica rapa
ref|XP_004979149.1|  PREDICTED: endonuclease III-like protein 1-l...  98.2    5e-21   
ref|XP_004979150.1|  PREDICTED: endonuclease III-like protein 1-l...  97.8    6e-21   Setaria italica
gb|AAX96284.1|  endonuclease III homologue                            97.4    9e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010097514.1|  Histone-lysine N-methyltransferase ASHH3         99.4    9e-21   
gb|ABA92590.2|  Endonuclease III-like protein 1, putative, expressed  97.4    1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|ACF82727.1|  unknown                                               96.7    2e-20   Zea mays [maize]
ref|XP_006417973.1|  hypothetical protein EUTSA_v10007955mg           96.7    2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_008662471.1|  PREDICTED: endonuclease III homolog 1, chlor...  96.7    2e-20   
ref|XP_010475313.1|  PREDICTED: endonuclease III homolog 2, chlor...  96.3    2e-20   Camelina sativa [gold-of-pleasure]
gb|EMS45025.1|  Endonuclease III-like protein 1                       96.3    3e-20   Triticum urartu
ref|XP_010326700.1|  PREDICTED: endonuclease III homolog 1, chlor...  95.5    4e-20   Solanum lycopersicum
ref|XP_006662906.1|  PREDICTED: endonuclease III-like protein 1-l...  95.5    4e-20   Oryza brachyantha
ref|XP_006662905.1|  PREDICTED: endonuclease III-like protein 1-l...  95.5    5e-20   
ref|XP_010237763.1|  PREDICTED: endonuclease III homolog 1, chlor...  94.4    8e-20   
ref|XP_003577617.1|  PREDICTED: endonuclease III homolog 1, chlor...  94.4    1e-19   Brachypodium distachyon [annual false brome]
gb|AFW56064.1|  endonuclease III-like protein 1                       93.6    1e-19   
ref|XP_010475312.1|  PREDICTED: endonuclease III homolog 2, chlor...  94.0    2e-19   Camelina sativa [gold-of-pleasure]
emb|CDY10004.1|  BnaC08g44470D                                        93.2    2e-19   Brassica napus [oilseed rape]
gb|EMT20628.1|  Endonuclease III-like protein 1                       95.1    3e-19   
emb|CAN69482.1|  hypothetical protein VITISV_017352                   91.3    2e-18   Vitis vinifera
ref|XP_002966510.1|  hypothetical protein SELMODRAFT_85281            89.7    2e-18   
ref|XP_002982352.1|  hypothetical protein SELMODRAFT_116252           89.7    2e-18   
ref|XP_010475314.1|  PREDICTED: endonuclease III homolog 2, chlor...  89.7    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006304736.1|  hypothetical protein CARUB_v10012090mg           89.7    7e-18   
ref|XP_010485510.1|  PREDICTED: endonuclease III homolog 2, chlor...  89.0    8e-18   
gb|AFW56063.1|  hypothetical protein ZEAMMB73_227959                  88.2    1e-17   
ref|XP_009629861.1|  PREDICTED: endonuclease III homolog 1, chlor...  87.0    2e-17   
ref|XP_009629858.1|  PREDICTED: endonuclease III homolog 1, chlor...  87.0    3e-17   Nicotiana tomentosiformis
ref|XP_009629857.1|  PREDICTED: endonuclease III homolog 1, chlor...  86.7    5e-17   Nicotiana tomentosiformis
gb|KFK42927.1|  hypothetical protein AALP_AA1G056300                  84.7    2e-16   Arabis alpina [alpine rockcress]
gb|KFK42928.1|  hypothetical protein AALP_AA1G056300                  84.7    2e-16   Arabis alpina [alpine rockcress]
ref|XP_010457705.1|  PREDICTED: endonuclease III homolog 2, chlor...  82.8    7e-16   
gb|EPS69374.1|  hypothetical protein M569_05394                       78.6    1e-15   Genlisea aurea
ref|XP_009629862.1|  PREDICTED: endonuclease III homolog 2, chlor...  82.0    1e-15   Nicotiana tomentosiformis
ref|XP_009799827.1|  PREDICTED: endonuclease III homolog 2, chlor...  81.6    2e-15   Nicotiana sylvestris
ref|XP_010457704.1|  PREDICTED: endonuclease III homolog 2, chlor...  80.5    4e-15   
ref|XP_010457703.1|  PREDICTED: endonuclease III homolog 2, chlor...  80.9    4e-15   
ref|XP_006362162.1|  PREDICTED: uncharacterized protein LOC102583685  77.4    7e-15   
ref|XP_009799826.1|  PREDICTED: endonuclease III homolog 2, chlor...  78.2    3e-14   Nicotiana sylvestris
ref|XP_006443062.1|  hypothetical protein CICLE_v10020816mg           75.1    8e-13   
gb|KFK23912.1|  hypothetical protein AALP_AAs54029U000100             70.9    8e-13   Arabis alpina [alpine rockcress]
ref|XP_010097533.1|  Endonuclease III-like protein 1                  73.6    1e-12   
ref|XP_006494170.1|  PREDICTED: endonuclease III-like protein 1-l...  75.1    1e-12   Citrus sinensis [apfelsine]
ref|XP_006494171.1|  PREDICTED: endonuclease III-like protein 1-l...  74.7    1e-12   Citrus sinensis [apfelsine]
gb|KFK23488.1|  hypothetical protein AALP_AAs52541U000100             67.4    1e-11   Arabis alpina [alpine rockcress]
gb|EMT33112.1|  hypothetical protein F775_24738                       67.4    9e-11   
ref|XP_007034073.1|  Uncharacterized protein TCM_020122               62.8    3e-09   
gb|KIM49604.1|  hypothetical protein M413DRAFT_407778                 63.2    1e-08   Hebeloma cylindrosporum h7
ref|XP_001623365.1|  predicted protein                                61.6    1e-08   Nematostella vectensis
gb|EPZ33924.1|  DNA glycosylase domain-containing protein             60.8    3e-08   Rozella allomycis CSF55
gb|KDR13006.1|  Endonuclease III-like protein 1                       61.6    4e-08   Zootermopsis nevadensis
gb|KGB42329.1|  Endonuclease III-like protein 1                       59.3    6e-08   Schistosoma haematobium
ref|XP_006597237.1|  PREDICTED: endonuclease III-like protein 1-l...  57.4    1e-07   
ref|XP_002837551.1|  hypothetical protein                             60.1    2e-07   Tuber melanosporum Mel28
ref|XP_001949525.2|  PREDICTED: endonuclease III-like protein 1       59.3    2e-07   Acyrthosiphon pisum
ref|XP_006595057.1|  PREDICTED: endonuclease III-like protein 1-like  59.3    2e-07   Glycine max [soybeans]
gb|KHN30103.1|  Endonuclease III-like protein 1                       58.9    2e-07   Glycine soja [wild soybean]
ref|XP_007673604.1|  hypothetical protein BAUCODRAFT_31576            59.3    3e-07   Baudoinia panamericana UAMH 10762
emb|CDJ61103.1|  endonuclease III-like protein 1, putative            58.5    4e-07   Eimeria maxima
ref|XP_003744683.1|  PREDICTED: endonuclease III-like protein 1-like  58.2    5e-07   Galendromus occidentalis
gb|EIE81807.1|  hypothetical protein RO3G_06512                       58.2    5e-07   Rhizopus delemar RA 99-880
gb|ELU43797.1|  DNA-(apurinic or apyrimidinic site) lyase             58.2    6e-07   Rhizoctonia solani AG-1 IA
gb|EUC66053.1|  endonuclease III                                      58.2    7e-07   Rhizoctonia solani AG-3 Rhs1AP
dbj|GAM39966.1|  hypothetical protein TCE0_034f11941                  57.8    8e-07   Talaromyces cellulolyticus
emb|CDI81259.1|  endonuclease III-like protein 1, putative            57.8    9e-07   Eimeria acervulina
ref|XP_001866998.1|  endonuclease iii                                 57.4    1e-06   Culex quinquefasciatus
ref|XP_003124777.1|  PREDICTED: endonuclease III-like protein 1 i...  57.0    1e-06   Sus scrofa [pigs]
ref|XP_003762062.1|  PREDICTED: endonuclease III-like protein 1       57.0    1e-06   Sarcophilus harrisii
ref|XP_005655221.1|  PREDICTED: endonuclease III-like protein 1 i...  57.4    1e-06   
ref|XP_005145102.1|  PREDICTED: endonuclease III-like protein 1       57.0    1e-06   Melopsittacus undulatus
ref|XP_001845586.1|  endonuclease iii                                 57.0    1e-06   Culex quinquefasciatus
gb|KII71412.1|  Endonuclease III-like protein 1                       55.5    1e-06   Thelohanellus kitauei
gb|KDN40668.1|  hypothetical protein RSAG8_07997                      57.4    1e-06   Rhizoctonia solani AG-8 WAC10335
emb|CEL54581.1|  endonuclease III                                     57.0    2e-06   Rhizoctonia solani AG-1 IB
gb|ERG83109.1|  putative endonuclease iii-like protein                56.2    2e-06   
ref|XP_002429173.1|  endonuclease III, putative                       56.6    2e-06   Pediculus humanus corporis [human body lice]
emb|CAG06049.1|  unnamed protein product                              56.6    2e-06   Tetraodon nigroviridis
ref|XP_002401078.1|  endonuclease, putative                           56.6    2e-06   Ixodes scapularis [blacklegged tick]
emb|CCO30385.1|  endonuclease III                                     56.6    2e-06   Rhizoctonia solani AG-1 IB
gb|EFX86161.1|  hypothetical protein DAPPUDRAFT_193197                56.2    2e-06   Daphnia pulex
gb|KFV76348.1|  Endonuclease III-like 1                               55.5    2e-06   Struthio camelus australis
ref|XP_007784447.1|  hypothetical protein W97_08316                   56.6    2e-06   Coniosporium apollinis CBS 100218
ref|XP_010904324.1|  PREDICTED: endonuclease III-like protein 1       56.6    2e-06   Esox lucius
gb|KFO88086.1|  Endonuclease III-like 1                               54.7    2e-06   Buceros rhinoceros silvestris
gb|KHJ31327.1|  hypothetical protein EV44_g1288                       56.2    2e-06   Erysiphe necator
ref|XP_009664323.1|  PREDICTED: endonuclease III-like protein 1       55.5    3e-06   Struthio camelus australis
ref|XP_003597497.1|  Endonuclease III-like protein                    55.8    3e-06   Medicago truncatula
ref|XP_004604462.1|  PREDICTED: endonuclease III-like protein 1       55.8    3e-06   Sorex araneus [Eurasian shrew]
gb|EZF71272.1|  hypothetical protein H105_06477                       56.2    3e-06   Trichophyton soudanense CBS 452.61
gb|ETN86268.1|  hypothetical protein NECAME_16444                     54.3    3e-06   Necator americanus
gb|EZG03644.1|  hypothetical protein H106_06307                       56.2    3e-06   Trichophyton rubrum CBS 735.88
gb|KIM87339.1|  hypothetical protein PILCRDRAFT_272557                55.8    3e-06   Piloderma croceum F 1598
gb|EZF13042.1|  hypothetical protein H100_06473                       56.2    3e-06   Trichophyton rubrum MR850
gb|KFX41113.1|  Endonuclease III like                                 55.8    3e-06   Talaromyces marneffei PM1
ref|XP_003237103.1|  DNA base excision repair N-glycosylase           55.8    3e-06   Trichophyton rubrum CBS 118892
ref|XP_002143297.1|  DNA repair protein Ntg1, putative                55.8    3e-06   Talaromyces marneffei ATCC 18224
emb|CEG71713.1|  Putative Endonuclease III                            55.1    4e-06   Rhizopus microsporus
emb|CBY08920.1|  unnamed protein product                              55.5    4e-06   Oikopleura dioica
gb|KHN79451.1|  putative endonuclease III -like protein               55.1    4e-06   Toxocara canis
ref|XP_004995481.1|  hypothetical protein PTSG_12076                  55.8    4e-06   Salpingoeca rosetta
ref|XP_009007206.1|  PREDICTED: endonuclease III-like protein 1       55.1    4e-06   
gb|KDQ59784.1|  hypothetical protein JAAARDRAFT_126654                55.5    4e-06   Jaapia argillacea MUCL 33604
ref|XP_010131729.1|  PREDICTED: endonuclease III-like protein 1       54.3    4e-06   Buceros rhinoceros silvestris
gb|KFV07704.1|  Endonuclease III-like 1                               54.3    5e-06   Tauraco erythrolophus
emb|CCD75359.1|  putative endonuclease III                            54.7    5e-06   Schistosoma mansoni
emb|CEG80676.1|  Putative Endonuclease III                            55.1    6e-06   Rhizopus microsporus
ref|XP_011050321.1|  PREDICTED: endonuclease III-like protein 1       55.1    6e-06   Acromyrmex echinatior
ref|XP_007712442.1|  hypothetical protein COCCADRAFT_96578            55.1    6e-06   Bipolaris zeicola 26-R-13
ref|XP_008022280.1|  hypothetical protein SETTUDRAFT_167288           55.1    6e-06   Exserohilum turcica Et28A
ref|XP_009991212.1|  PREDICTED: endonuclease III-like protein 1       54.3    6e-06   Tauraco erythrolophus
gb|EUN32871.1|  hypothetical protein COCVIDRAFT_84101                 55.1    6e-06   Bipolaris victoriae FI3
ref|XP_002794167.1|  endonuclease III                                 55.1    6e-06   Paracoccidioides lutzii Pb01
emb|CDP91899.1|  Protein Bm5325, isoform d                            54.7    6e-06   
ref|XP_007640392.1|  PREDICTED: endonuclease III-like protein 1 i...  54.7    6e-06   Cricetulus griseus [Chinese hamsters]
ref|XP_005495856.1|  PREDICTED: endonuclease III-like protein 1       54.7    6e-06   Zonotrichia albicollis
ref|XP_006204338.1|  PREDICTED: endonuclease III-like protein 1       54.7    6e-06   Vicugna pacos
dbj|BAA22080.1|  endonuclease III homologue                           54.7    7e-06   Mus musculus [mouse]
emb|CEI97452.1|  Putative Endonuclease III                            54.7    7e-06   Rhizopus microsporus
emb|CEG71712.1|  Putative Endonuclease III                            54.7    7e-06   Rhizopus microsporus
gb|AAI45444.1|  Nthl1 protein                                         54.7    7e-06   Mus musculus [mouse]
ref|XP_003501551.1|  PREDICTED: endonuclease III-like protein 1 i...  54.7    7e-06   Cricetulus griseus [Chinese hamsters]
gb|EDL22346.1|  nth (endonuclease III)-like 1 (E.coli), isoform C...  54.7    7e-06   Mus musculus [mouse]
ref|XP_001897050.1|  Endonuclease III-like protein 1                  54.3    7e-06   Brugia malayi [agent of lymphatic filariasis]
ref|XP_006146455.1|  PREDICTED: endonuclease III-like protein 1       54.3    7e-06   
ref|XP_010990908.1|  PREDICTED: endonuclease III-like protein 1       54.3    8e-06   Camelus dromedarius [camel]
gb|EMD90605.1|  hypothetical protein COCHEDRAFT_1179590               54.7    8e-06   Bipolaris maydis C5
ref|XP_007705365.1|  hypothetical protein COCSADRAFT_203977           54.7    8e-06   Bipolaris sorokiniana ND90Pr
ref|XP_004750787.1|  PREDICTED: endonuclease III-like protein 1 i...  54.7    8e-06   
gb|KIJ63357.1|  hypothetical protein HYDPIDRAFT_134499                54.3    8e-06   Hydnomerulius pinastri MD-312
ref|XP_008408992.1|  PREDICTED: endonuclease III-like protein 1       54.7    8e-06   Poecilia reticulata
ref|XP_006957265.1|  DNA glycosylase                                  54.7    9e-06   Wallemia mellicola CBS 633.66
ref|XP_007640391.1|  PREDICTED: endonuclease III-like protein 1 i...  54.3    9e-06   
ref|XP_010758802.1|  hypothetical protein PADG_03264                  54.7    9e-06   Paracoccidioides brasiliensis Pb18
ref|XP_006893938.1|  PREDICTED: endonuclease III-like protein 1       54.3    9e-06   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007682471.1|  hypothetical protein COCMIDRAFT_80033            54.7    9e-06   Bipolaris oryzae ATCC 44560
ref|XP_002479601.1|  DNA repair protein Ntg1, putative                54.7    9e-06   Talaromyces stipitatus ATCC 10500
ref|XP_003842328.1|  similar to TPA: DNA repair protein Ntg1          54.7    9e-06   Leptosphaeria maculans JN3
gb|KIJ95139.1|  hypothetical protein K443DRAFT_683245                 54.7    9e-06   Laccaria amethystina LaAM-08-1
gb|KDO34426.1|  hypothetical protein SPRG_01561                       54.3    9e-06   Saprolegnia parasitica CBS 223.65
gb|EEH18244.1|  hypothetical protein PABG_00807                       54.7    9e-06   Paracoccidioides brasiliensis Pb03
gb|EFA08192.1|  hypothetical protein TcasGA2_TC005819                 54.3    9e-06   
ref|XP_007570289.1|  PREDICTED: endonuclease III-like protein 1       54.7    9e-06   Poecilia formosa
ref|XP_004750781.1|  PREDICTED: endonuclease III-like protein 1 i...  54.3    9e-06   
ref|XP_003172336.1|  DNA base excision repair N-glycosylase 1         54.7    9e-06   Nannizzia gypsea CBS 118893
ref|XP_006873933.1|  PREDICTED: endonuclease III-like protein 1       54.3    9e-06   Chrysochloris asiatica
ref|XP_010770720.1|  PREDICTED: endonuclease III-like protein 1       54.7    9e-06   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004750786.1|  PREDICTED: endonuclease III-like protein 1 i...  54.3    1e-05   
ref|XP_001833672.1|  DNA-(apurinic or apyrimidinic site) lyase        54.7    1e-05   Coprinopsis cinerea okayama7#130
ref|XP_968911.2|  PREDICTED: endonuclease III-like protein 1          54.3    1e-05   Tribolium castaneum [rust-red flour beetle]
ref|XP_003857329.1|  hypothetical protein MYCGRDRAFT_34626            54.3    1e-05   Zymoseptoria tritici IPO323
ref|XP_004486924.1|  PREDICTED: endonuclease III-like protein 1-like  54.3    1e-05   
gb|KFP55474.1|  Endonuclease III-like 1                               53.9    1e-05   Cathartes aura
gb|KER00405.1|  hypothetical protein AUEXF2481DRAFT_34603             54.3    1e-05   Aureobasidium subglaciale EXF-2481
ref|XP_004750784.1|  PREDICTED: endonuclease III-like protein 1 i...  54.3    1e-05   Mustela putorius furo [black ferret]
ref|XP_004750780.1|  PREDICTED: endonuclease III-like protein 1 i...  54.3    1e-05   
ref|XP_004750785.1|  PREDICTED: endonuclease III-like protein 1 i...  54.3    1e-05   Mustela putorius furo [black ferret]
ref|XP_004750779.1|  PREDICTED: endonuclease III-like protein 1 i...  54.3    1e-05   
dbj|GAN11273.1|  endonuclease III-like protein                        53.9    1e-05   Mucor ambiguus
gb|EJW78031.1|  hypothetical protein WUBG_11058                       53.5    1e-05   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_004628164.1|  PREDICTED: endonuclease III-like protein 1       53.9    1e-05   Octodon degus
ref|XP_004750783.1|  PREDICTED: endonuclease III-like protein 1 i...  53.9    1e-05   
ref|XP_004750782.1|  PREDICTED: endonuclease III-like protein 1 i...  53.9    1e-05   
ref|XP_005289232.1|  PREDICTED: endonuclease III-like protein 1       53.9    1e-05   
ref|XP_010189925.1|  PREDICTED: endonuclease III-like protein 1       53.1    1e-05   Mesitornis unicolor
gb|KFQ40272.1|  Endonuclease III-like 1                               53.1    1e-05   Mesitornis unicolor
ref|XP_005081668.1|  PREDICTED: endonuclease III-like protein 1       53.9    1e-05   Mesocricetus auratus [Syrian golden hamster]
ref|XP_007264376.1|  DNA glycosylase                                  53.5    1e-05   Fomitiporia mediterranea MF3/22
ref|XP_007453608.1|  PREDICTED: endonuclease III-like protein 1       53.9    1e-05   Lipotes vexillifer [baiji]
ref|XP_004652043.1|  PREDICTED: endonuclease III-like protein 1       53.5    1e-05   Jaculus jaculus
ref|XP_007181730.1|  PREDICTED: endonuclease III-like protein 1 i...  53.9    1e-05   Balaenoptera acutorostrata scammoni
ref|XP_007181729.1|  PREDICTED: endonuclease III-like protein 1 i...  53.9    1e-05   Balaenoptera acutorostrata scammoni
emb|CCM04574.1|  predicted protein                                    54.3    2e-05   Fibroporia radiculosa
gb|KFQ99943.1|  Endonuclease III-like 1                               53.5    2e-05   Nipponia nippon
ref|XP_005805175.1|  PREDICTED: endonuclease III-like protein 1-like  53.9    2e-05   
ref|XP_003928467.1|  PREDICTED: endonuclease III-like protein 1       53.5    2e-05   Saimiri boliviensis boliviensis
gb|EHH31321.1|  Endonuclease III-like protein 1                       53.5    2e-05   Macaca mulatta [rhesus macaque]
ref|XP_011148965.1|  PREDICTED: endonuclease III-like protein 1       53.5    2e-05   Harpegnathos saltator
ref|XP_007100136.1|  PREDICTED: endonuclease III-like protein 1       53.5    2e-05   Physeter catodon
ref|NP_001099198.1|  endonuclease III-like protein 1                  53.5    2e-05   Rattus norvegicus [brown rat]
ref|XP_008469381.1|  PREDICTED: endonuclease III-like protein 1       53.5    2e-05   Diaphorina citri
ref|XP_004270355.1|  PREDICTED: endonuclease III-like protein 1       53.5    2e-05   Orcinus orca [Orca]
gb|KFO77104.1|  Endonuclease III-like 1                               53.1    2e-05   Cuculus canorus
gb|KFO15147.1|  Endonuclease III-like 1                               53.1    2e-05   Balearica regulorum gibbericeps
ref|XP_006129340.1|  PREDICTED: endonuclease III-like protein 1 i...  52.8    2e-05   
ref|XP_008144627.1|  PREDICTED: endonuclease III-like protein 1       53.1    2e-05   Eptesicus fuscus
ref|XP_002844047.1|  DNA base excision repair N-glycosylase 1         53.5    2e-05   Microsporum canis CBS 113480
ref|XP_001648002.1|  AAEL003906-PA                                    53.5    2e-05   
ref|XP_010309371.1|  PREDICTED: endonuclease III-like protein 1       53.1    2e-05   
ref|XP_007509839.1|  predicted protein                                53.1    2e-05   
ref|XP_003055376.1|  predicted protein                                53.1    2e-05   
ref|XP_001965263.1|  GF24230                                          53.5    2e-05   
ref|XP_003661301.1|  hypothetical protein MYCTH_2300528               53.5    2e-05   
gb|KFP17369.1|  Endonuclease III-like 1                               52.8    3e-05   
gb|KFO34716.1|  Endonuclease III-like protein 1                       53.1    3e-05   
ref|XP_007980525.1|  PREDICTED: endonuclease III-like protein 1 i...  53.1    3e-05   
gb|EPQ64043.1|  DNA N-glycosylase                                     53.1    3e-05   
ref|XP_010618738.1|  PREDICTED: endonuclease III-like protein 1       53.1    3e-05   
ref|XP_010386161.1|  PREDICTED: endonuclease III-like protein 1 i...  53.1    3e-05   
ref|XP_006174118.1|  PREDICTED: endonuclease III-like protein 1       52.8    3e-05   
gb|AAW24987.1|  SJCHGC01733 protein                                   52.8    3e-05   
ref|XP_009560486.1|  PREDICTED: endonuclease III-like protein 1       52.8    3e-05   
gb|EOA94558.1|  Endonuclease III-like protein 1                       52.8    3e-05   
gb|KFM12475.1|  Endonuclease III-like 1                               52.8    3e-05   
ref|XP_005229194.1|  PREDICTED: endonuclease III-like protein 1       52.8    3e-05   
ref|XP_003972103.1|  PREDICTED: endonuclease III-like protein 1-like  53.1    3e-05   
gb|KFV16215.1|  Endonuclease III-like 1                               52.4    3e-05   
gb|EMC83166.1|  Endonuclease III-like protein 1                       52.8    3e-05   
ref|XP_009545770.1|  hypothetical protein HETIRDRAFT_26348            52.4    3e-05   
ref|XP_005444162.1|  PREDICTED: endonuclease III-like protein 1       52.8    3e-05   
ref|XP_007058657.1|  PREDICTED: endonuclease III-like protein 1       52.8    3e-05   
emb|CDS30683.1|  endonuclease III protein 1                           53.1    3e-05   
ref|XP_005029279.1|  PREDICTED: endonuclease III-like protein 1       52.4    3e-05   
ref|XP_005108653.1|  PREDICTED: endonuclease III-like protein 1-like  53.1    3e-05   
ref|XP_001082772.1|  PREDICTED: nth endonuclease III-like 1           52.8    3e-05   
ref|XP_009638730.1|  PREDICTED: endonuclease III-like protein 1       52.8    3e-05   
ref|XP_003916412.1|  PREDICTED: endonuclease III-like protein 1 i...  52.8    3e-05   
ref|XP_008278535.1|  PREDICTED: endonuclease III-like protein 1 i...  52.8    3e-05   
ref|XP_009327674.1|  PREDICTED: endonuclease III-like protein 1       52.8    3e-05   
ref|XP_010082876.1|  PREDICTED: endonuclease III-like protein 1       52.4    3e-05   
ref|XP_006129338.1|  PREDICTED: endonuclease III-like protein 1 i...  52.8    3e-05   
ref|XP_009529450.1|  hypothetical protein PHYSODRAFT_561415           52.4    4e-05   
ref|XP_011292354.1|  PREDICTED: endonuclease III-like protein 1       52.8    4e-05   
ref|XP_009284885.1|  PREDICTED: endonuclease III-like protein 1       52.4    4e-05   
ref|XP_005509166.1|  PREDICTED: endonuclease III-like protein 1       52.4    4e-05   
ref|XP_006741975.1|  PREDICTED: endonuclease III-like protein 1       52.8    4e-05   
ref|XP_005349217.1|  PREDICTED: endonuclease III-like protein 1       52.4    4e-05   
ref|XP_009466247.1|  PREDICTED: endonuclease III-like protein 1       52.4    4e-05   
ref|XP_008278534.1|  PREDICTED: endonuclease III-like protein 1 i...  52.8    4e-05   
ref|XP_004932575.1|  PREDICTED: probable endonuclease III homolog...  52.8    4e-05   
ref|XP_010568915.1|  PREDICTED: endonuclease III-like protein 1       52.4    4e-05   
ref|XP_009967742.1|  PREDICTED: LOW QUALITY PROTEIN: endonuclease...  52.4    4e-05   
gb|KFZ63856.1|  Endonuclease III-like 1                               52.0    4e-05   
gb|EHJ67214.1|  hypothetical protein KGM_13809                        52.8    4e-05   
ref|XP_007751151.1|  endonuclease III                                 52.4    4e-05   
ref|XP_004932576.1|  PREDICTED: probable endonuclease III homolog...  52.4    5e-05   
gb|KIW22269.1|  hypothetical protein PV07_12172                       52.4    5e-05   
ref|XP_011251981.1|  PREDICTED: endonuclease III-like protein 1       52.4    5e-05   
ref|XP_008854466.1|  PREDICTED: endonuclease III-like protein 1 i...  52.4    5e-05   
gb|EME50318.1|  hypothetical protein DOTSEDRAFT_68994                 52.4    5e-05   
sp|A7M7B9.1|NTH_CHICK  RecName: Full=Endonuclease III-like protei...  52.0    5e-05   
ref|NP_001073043.1|  endonuclease III-like protein 1                  52.0    5e-05   
dbj|GAA91863.1|  DNA repair protein                                   52.4    5e-05   
ref|XP_010948189.1|  PREDICTED: endonuclease III-like protein 1       52.0    5e-05   
ref|XP_004373229.1|  PREDICTED: endonuclease III-like protein 1       52.0    5e-05   
ref|XP_009193974.1|  PREDICTED: endonuclease III-like protein 1 i...  52.4    5e-05   
ref|XP_007855487.1|  dna-(apurinic or apyrimidinic site) lyase        52.4    5e-05   
ref|XP_008315486.1|  PREDICTED: endonuclease III-like protein 1 i...  52.0    6e-05   
ref|XP_010172010.1|  PREDICTED: endonuclease III-like protein 1       52.0    6e-05   
gb|KFW01507.1|  Endonuclease III-like 1                               52.0    6e-05   
gb|ELU08655.1|  hypothetical protein CAPTEDRAFT_25579                 51.6    6e-05   
gb|ETN65451.1|  endonuclease iii                                      52.4    6e-05   
ref|XP_008315484.1|  PREDICTED: endonuclease III-like protein 1 i...  52.0    6e-05   
ref|XP_008617130.1|  endonuclease III                                 52.0    6e-05   
ref|XP_008315487.1|  PREDICTED: endonuclease III-like protein 1 i...  52.0    6e-05   
ref|XP_008315488.1|  PREDICTED: endonuclease III-like protein 1 i...  52.0    6e-05   
ref|XP_003455844.1|  PREDICTED: endonuclease III-like protein 1-l...  52.0    6e-05   
gb|KEF55155.1|  hypothetical protein A1O9_08809                       52.0    6e-05   
ref|XP_005523149.1|  PREDICTED: endonuclease III-like protein 1       51.6    6e-05   
ref|XP_007765064.1|  DNA glycosylase                                  52.0    7e-05   
ref|XP_007919752.1|  hypothetical protein MYCFIDRAFT_26406            52.0    7e-05   
ref|XP_011477262.1|  PREDICTED: endonuclease III-like protein 1 i...  52.0    7e-05   
ref|XP_003269206.1|  PREDICTED: endonuclease III-like protein 1       51.6    7e-05   
ref|XP_010145958.1|  PREDICTED: endonuclease III-like protein 1       51.6    7e-05   
emb|CCU77215.1|  putative DNA base excision repair N-glycosylase 2    52.0    7e-05   
gb|KIW93677.1|  hypothetical protein Z519_06282                       52.0    7e-05   
gb|KIJ12533.1|  hypothetical protein PAXINDRAFT_82761                 52.0    7e-05   
ref|XP_004066205.1|  PREDICTED: endonuclease III-like protein 1 i...  52.0    7e-05   
emb|CAA70865.1|  endonuclease III homologue 1                         51.6    8e-05   
gb|AAC51136.1|  endonuclease III                                      51.6    8e-05   
gb|KFV61358.1|  Endonuclease III-like 1                               51.6    8e-05   
gb|AAH00391.2|  NTHL1 protein                                         51.6    8e-05   
ref|XP_007326303.1|  hypothetical protein AGABI1DRAFT_69456           51.6    8e-05   
gb|KFP82571.1|  Endonuclease III-like 1                               51.2    8e-05   
ref|XP_001915373.1|  PREDICTED: LOW QUALITY PROTEIN: endonuclease...  51.6    8e-05   
ref|XP_004057037.1|  PREDICTED: endonuclease III-like protein 1       51.6    8e-05   
gb|AAB41534.1|  endonuclease III homolog 1, hNTH1                     51.6    8e-05   
ref|XP_008315485.1|  PREDICTED: endonuclease III-like protein 1 i...  51.6    8e-05   
ref|NP_032769.2|  endonuclease III-like protein 1                     51.6    8e-05   
gb|ETL99217.1|  hypothetical protein, variant 2                       51.2    8e-05   
ref|XP_003807747.1|  PREDICTED: endonuclease III-like protein 1 i...  51.6    8e-05   
ref|XP_001940380.1|  DNA base excision repair N-glycosylase 2         51.6    8e-05   
ref|NP_002519.1|  endonuclease III-like protein 1                     51.6    9e-05   
gb|EPB92492.1|  endonuclease III                                      51.6    9e-05   
ref|XP_009428361.1|  PREDICTED: endonuclease III-like protein 1       51.2    9e-05   
emb|CDO71906.1|  hypothetical protein BN946_scf184940.g53             51.6    9e-05   
ref|XP_008901367.1|  hypothetical protein, variant 3                  51.2    9e-05   
ref|XP_005054320.1|  PREDICTED: endonuclease III-like protein 1       51.6    9e-05   
ref|XP_004438231.1|  PREDICTED: endonuclease III-like protein 1       51.2    1e-04   
emb|CEP17664.1|  hypothetical protein                                 51.6    1e-04   
ref|NP_001232362.1|  endonuclease III-like protein 1                  50.8    1e-04   
dbj|GAM87803.1|  hypothetical protein ANO11243_058310                 51.6    1e-04   
gb|EQL32016.1|  hypothetical protein BDFG_05738                       51.6    1e-04   
gb|EGE82551.1|  DNA repair protein Ntg1                               51.6    1e-04   
gb|ELK30095.1|  Endonuclease III-like protein 1                       51.2    1e-04   
ref|XP_006458690.1|  hypothetical protein AGABI2DRAFT_63644           51.2    1e-04   
gb|KIV84054.1|  hypothetical protein PV11_06028                       51.6    1e-04   
ref|XP_001800828.1|  hypothetical protein SNOG_10562                  51.6    1e-04   
gb|EEQ91205.1|  DNA repair protein Ntg1                               51.2    1e-04   
ref|XP_008541545.1|  PREDICTED: endonuclease III-like protein 1       51.2    1e-04   
ref|XP_002629455.1|  DNA repair protein Ntg1                          51.2    1e-04   
ref|XP_001878103.1|  predicted protein                                50.8    1e-04   
ref|XP_011184684.1|  PREDICTED: endonuclease III-like protein 1       51.2    1e-04   
ref|XP_005337859.1|  PREDICTED: endonuclease III-like protein 1       51.2    1e-04   
gb|KEQ73459.1|  DNA glycosylase                                       51.2    1e-04   
ref|XP_008901366.1|  hypothetical protein, variant 2                  51.2    1e-04   
ref|XP_009248595.1|  PREDICTED: endonuclease III-like protein 1 i...  51.2    1e-04   
gb|KIO05659.1|  hypothetical protein M404DRAFT_999775                 51.2    1e-04   
ref|XP_009075384.1|  PREDICTED: endonuclease III-like protein 1       50.8    1e-04   
ref|XP_003051196.1|  hypothetical protein NECHADRAFT_41785            51.2    1e-04   
ref|XP_002826033.1|  PREDICTED: endonuclease III-like protein 1 i...  51.2    1e-04   
ref|XP_005391523.1|  PREDICTED: endonuclease III-like protein 1 i...  51.2    1e-04   
gb|AEE62062.1|  unknown                                               50.4    1e-04   
gb|EGC41586.1|  endonuclease III                                      51.2    1e-04   
gb|EER45639.1|  endonuclease III                                      51.2    1e-04   
gb|KFW84521.1|  Endonuclease III-like 1                               50.8    1e-04   
gb|KIW74421.1|  hypothetical protein Z517_12361                       51.2    1e-04   
ref|XP_004403338.1|  PREDICTED: endonuclease III-like protein 1       50.8    1e-04   
ref|XP_006763974.1|  PREDICTED: LOW QUALITY PROTEIN: endonuclease...  50.8    1e-04   
gb|EGT56477.1|  CBN-NTH-1 protein                                     50.8    1e-04   
ref|XP_007725915.1|  endonuclease III                                 51.2    1e-04   
ref|XP_007870866.1|  DNA glycosylase                                  50.8    1e-04   
ref|XP_009248592.1|  PREDICTED: endonuclease III-like protein 1 i...  50.8    1e-04   
gb|KFH65189.1|  endonuclease III                                      51.2    1e-04   
gb|KIM83518.1|  hypothetical protein PILCRDRAFT_69283                 49.7    1e-04   
gb|EEH07488.1|  DNA base excision repair N-glycosylase 1, mitocho...  51.2    1e-04   
ref|XP_001537772.1|  conserved hypothetical protein                   51.2    1e-04   
gb|KFA75025.1|  hypothetical protein S40288_08821                     50.8    1e-04   
gb|KEY65210.1|  hypothetical protein S7711_09389                      50.8    1e-04   
ref|XP_010717829.1|  PREDICTED: endonuclease III-like protein 1       50.8    1e-04   
ref|XP_009248594.1|  PREDICTED: endonuclease III-like protein 1 i...  50.8    1e-04   
gb|KDQ27564.1|  hypothetical protein PLEOSDRAFT_1041835               50.8    1e-04   
ref|XP_004521324.1|  PREDICTED: endonuclease III-like protein 1-like  50.8    1e-04   
ref|XP_009823505.1|  hypothetical protein, variant 9                  50.8    1e-04   
gb|ETL99215.1|  hypothetical protein L917_03885                       50.8    2e-04   
ref|XP_853674.1|  PREDICTED: endonuclease III-like protein 1          50.8    2e-04   
ref|XP_003417819.1|  PREDICTED: endonuclease III-like protein 1 i...  50.8    2e-04   
gb|ERL94115.1|  hypothetical protein D910_11397                       50.8    2e-04   
dbj|GAD95303.1|  DNA repair protein, putative                         50.8    2e-04   
ref|XP_007937720.1|  PREDICTED: endonuclease III-like protein 1       50.8    2e-04   
ref|XP_010595720.1|  PREDICTED: endonuclease III-like protein 1 i...  50.8    2e-04   
gb|ENN76397.1|  hypothetical protein YQE_07058                        50.8    2e-04   
gb|ETL99216.1|  hypothetical protein, variant 1                       50.8    2e-04   
ref|XP_009823507.1|  hypothetical protein, variant 11                 50.4    2e-04   
ref|XP_001823231.2|  hypothetical protein AOR_1_1642114               51.2    2e-04   
ref|XP_004539098.1|  PREDICTED: endonuclease III-like protein 1-l...  50.8    2e-04   
gb|KIO05646.1|  hypothetical protein M404DRAFT_140602                 50.8    2e-04   
ref|XP_006100962.1|  PREDICTED: LOW QUALITY PROTEIN: endonuclease...  50.8    2e-04   
ref|XP_009895466.1|  PREDICTED: endonuclease III-like protein 1       50.4    2e-04   
ref|XP_005735920.1|  PREDICTED: endonuclease III-like protein 1-like  50.8    2e-04   
ref|XP_004706210.1|  PREDICTED: endonuclease III-like protein 1       50.4    2e-04   
gb|KIK47696.1|  hypothetical protein CY34DRAFT_798987                 50.8    2e-04   
ref|XP_006695604.1|  hypothetical protein CTHT_0052650                50.8    2e-04   
gb|ETP22609.1|  hypothetical protein F441_04118                       50.4    2e-04   
ref|XP_008901364.1|  hypothetical protein PPTG_08185                  50.4    2e-04   
ref|XP_002378583.1|  DNA repair protein Ntg1, putative                50.8    2e-04   
gb|ETI52795.1|  hypothetical protein, variant 3                       50.4    2e-04   
ref|XP_007738581.1|  endonuclease III                                 50.8    2e-04   
ref|NP_593210.1|  DNA endonuclease III                                50.8    2e-04   
ref|XP_009154065.1|  endonuclease III                                 50.8    2e-04   
gb|EIT80538.1|  endonuclease III                                      50.4    2e-04   
gb|ETP22610.1|  hypothetical protein, variant 1                       50.4    2e-04   
ref|XP_008901365.1|  hypothetical protein, variant 1                  50.4    2e-04   
ref|XP_005925197.1|  PREDICTED: endonuclease III-like protein 1-like  50.4    2e-04   
gb|KEQ62840.1|  DNA glycosylase                                       50.8    2e-04   
gb|EFB17708.1|  hypothetical protein PANDA_016228                     50.4    2e-04   
ref|XP_009823509.1|  hypothetical protein, variant 4                  50.4    2e-04   
ref|XP_008926466.1|  PREDICTED: endonuclease III-like protein 1       50.4    2e-04   
ref|XP_005869386.1|  PREDICTED: endonuclease III-like protein 1       50.4    2e-04   
gb|EKV19070.1|  DNA repair protein Ntg1, putative                     50.4    2e-04   
gb|KIW41638.1|  hypothetical protein PV06_07177                       50.4    2e-04   
gb|EPY88946.1|  endonuclease III-like protein 1                       50.1    2e-04   
gb|KIL96324.1|  hypothetical protein FAVG1_01068                      50.4    2e-04   
ref|XP_008579910.1|  PREDICTED: endonuclease III-like protein 1       50.4    2e-04   
gb|KIM61114.1|  hypothetical protein SCLCIDRAFT_122907                50.4    2e-04   
gb|KGO71196.1|  Helix-turn-helix, base-excision DNA repair, C-ter...  50.4    2e-04   
ref|XP_011375213.1|  PREDICTED: endonuclease III-like protein 1 i...  50.4    2e-04   
ref|XP_003015226.1|  hypothetical protein ARB_06349                   50.8    2e-04   
gb|ETI52794.1|  hypothetical protein, variant 2                       50.4    2e-04   
ref|XP_006790789.1|  PREDICTED: endonuclease III-like protein 1-l...  50.4    2e-04   
ref|XP_011375215.1|  PREDICTED: endonuclease III-like protein 1 i...  50.4    2e-04   
gb|KGO48651.1|  Endonuclease III, conserved site-2                    50.4    2e-04   
gb|KIW13903.1|  hypothetical protein PV08_06684                       50.4    2e-04   
ref|XP_009823504.1|  hypothetical protein, variant 8                  50.1    2e-04   
gb|KIY48169.1|  DNA glycosylase                                       50.1    2e-04   
ref|XP_011232235.1|  PREDICTED: endonuclease III-like protein 1 i...  50.4    2e-04   
ref|XP_011166946.1|  PREDICTED: endonuclease III-like protein 1       50.4    2e-04   
ref|XP_007980530.1|  PREDICTED: endonuclease III-like protein 1 i...  50.1    2e-04   
ref|XP_009823501.1|  hypothetical protein H257_01813                  50.4    2e-04   
ref|XP_009255066.1|  hypothetical protein FPSE_03672                  50.4    2e-04   
ref|XP_010386160.1|  PREDICTED: endonuclease III-like protein 1 i...  50.1    2e-04   
ref|XP_001742095.1|  hypothetical protein                             49.7    2e-04   
gb|EPS29660.1|  hypothetical protein PDE_04610                        50.4    2e-04   
gb|EGD95899.1|  DNA repair protein Ntg1                               50.4    2e-04   
ref|XP_808363.1|  endonuclease III                                    50.1    2e-04   
ref|XP_011375210.1|  PREDICTED: endonuclease III-like protein 1 i...  50.1    2e-04   
gb|EZF35633.1|  hypothetical protein H101_00836                       50.4    3e-04   
emb|CCW67020.1|  unnamed protein product                              50.1    3e-04   
gb|EGE01255.1|  DNA repair protein Ntg1                               50.4    3e-04   
gb|EHA22221.1|  hypothetical protein ASPNIDRAFT_50950                 50.4    3e-04   
ref|XP_011375212.1|  PREDICTED: endonuclease III-like protein 1 i...  50.1    3e-04   
ref|XP_011375211.1|  PREDICTED: endonuclease III-like protein 1 i...  50.1    3e-04   
gb|KDB23503.1|  hypothetical protein H109_04631                       50.4    3e-04   
gb|KFP56865.1|  Endonuclease III-like 1                               50.1    3e-04   
ref|XP_009823508.1|  hypothetical protein, variant 7                  50.1    3e-04   
emb|CAK32626.1|  unnamed protein product                              50.1    3e-04   
ref|XP_006942523.1|  PREDICTED: endonuclease III-like protein 1 i...  50.1    3e-04   
gb|KFA64969.1|  hypothetical protein S40285_03855                     50.1    3e-04   



>ref|XP_009588403.1| PREDICTED: endonuclease III homolog 1, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03183} 
isoform X2 [Nicotiana tomentosiformis]
Length=368

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  ELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMI  358
            ELRVF+RRKRVKK VE++A E+++ES  +K + LPDIEDFSY KD + SQSTP  +  + 
Sbjct  56   ELRVFVRRKRVKKTVEVIAKEVKEESSAQKFVKLPDIEDFSYLKDHMYSQSTPAKTVHLT  115

Query  359  GKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVS  538
            G++ LS   + V+PPPNWEKVLEGI KMRSSEDAPVDSMGCEKAGSSLP KERRFAVLVS
Sbjct  116  GEKSLSQLTRKVRPPPNWEKVLEGIRKMRSSEDAPVDSMGCEKAGSSLPAKERRFAVLVS  175

Query  539  SLLSS  553
            SLLSS
Sbjct  176  SLLSS  180



>ref|XP_009588404.1| PREDICTED: endonuclease III homolog 1, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03183} 
isoform X3 [Nicotiana tomentosiformis]
Length=322

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 108/135 (80%), Gaps = 10/135 (7%)
 Frame = +2

Query  179  ELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMI  358
            ELRVF+RRKRVKK VE++A E+++ES  +K + LPDIEDFSY KD + SQSTP  +  + 
Sbjct  56   ELRVFVRRKRVKKTVEVIAKEVKEESSAQKFVKLPDIEDFSYLKDHMYSQSTPAKTVHLT  115

Query  359  GKEVLS-LSQK---------TVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
            G++ LS L++K         +V+PPPNWEKVLEGI KMRSSEDAPVDSMGCEKAGSSLP 
Sbjct  116  GEKSLSQLTRKEIKSISLSDSVRPPPNWEKVLEGIRKMRSSEDAPVDSMGCEKAGSSLPA  175

Query  509  KERRFAVLVSSLLSS  553
            KERRFAVLVSSLLSS
Sbjct  176  KERRFAVLVSSLLSS  190



>ref|XP_009588402.1| PREDICTED: endonuclease III homolog 1, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03183} 
isoform X1 [Nicotiana tomentosiformis]
Length=378

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 108/135 (80%), Gaps = 10/135 (7%)
 Frame = +2

Query  179  ELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMI  358
            ELRVF+RRKRVKK VE++A E+++ES  +K + LPDIEDFSY KD + SQSTP  +  + 
Sbjct  56   ELRVFVRRKRVKKTVEVIAKEVKEESSAQKFVKLPDIEDFSYLKDHMYSQSTPAKTVHLT  115

Query  359  GKEVLS-LSQK---------TVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
            G++ LS L++K         +V+PPPNWEKVLEGI KMRSSEDAPVDSMGCEKAGSSLP 
Sbjct  116  GEKSLSQLTRKEIKSISLSDSVRPPPNWEKVLEGIRKMRSSEDAPVDSMGCEKAGSSLPA  175

Query  509  KERRFAVLVSSLLSS  553
            KERRFAVLVSSLLSS
Sbjct  176  KERRFAVLVSSLLSS  190



>ref|XP_004241397.1| PREDICTED: endonuclease III homolog 1, chloroplastic [Solanum 
lycopersicum]
Length=380

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 110/153 (72%), Gaps = 17/153 (11%)
 Frame = +2

Query  146  SQENPS-----GDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVL--GLPDIEDFSY  304
            SQ+NP      G S  ELRVFIRRKRVKK VE++A E+++ES  KKV+   LPDIEDFSY
Sbjct  40   SQKNPGCDGTGGSSVPELRVFIRRKRVKKTVEVIAKEVKEESSGKKVMLVRLPDIEDFSY  99

Query  305  RKDAINSQSTPVSSECMIGKEVLSLSQKT----------VQPPPNWEKVLEGIHKMRSSE  454
             KD  + QSTP  +  + G++ L    +T          +QPP NWEKVLEGI KMRS+E
Sbjct  100  SKDITHPQSTPSKTVRLTGEKTLPQLMQTEIKGFSLSDPLQPPSNWEKVLEGIRKMRSAE  159

Query  455  DAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            DAPVDSMGCEKAGSSLP KERRFAVLVSSLLSS
Sbjct  160  DAPVDSMGCEKAGSSLPAKERRFAVLVSSLLSS  192



>ref|XP_009781250.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X2 [Nicotiana sylvestris]
Length=369

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  ELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMI  358
            E RVF+R+KRVKK +E++  E+++ES  KK + LPDIEDFSY KD + SQSTP  +  + 
Sbjct  57   EFRVFVRKKRVKKTLEVMDKEVKEESSGKKFVKLPDIEDFSYVKDDMYSQSTPAETVHLT  116

Query  359  GKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVS  538
            G++ LS   + V+PP NWEKVLEGI KMRSSEDAPVDSMGCEKAGSSLP KERRFAVLVS
Sbjct  117  GEKALSQLTQKVRPPLNWEKVLEGIRKMRSSEDAPVDSMGCEKAGSSLPAKERRFAVLVS  176

Query  539  SLLSS  553
            SLLSS
Sbjct  177  SLLSS  181



>ref|XP_009781249.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X1 [Nicotiana sylvestris]
Length=379

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 105/135 (78%), Gaps = 10/135 (7%)
 Frame = +2

Query  179  ELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMI  358
            E RVF+R+KRVKK +E++  E+++ES  KK + LPDIEDFSY KD + SQSTP  +  + 
Sbjct  57   EFRVFVRKKRVKKTLEVMDKEVKEESSGKKFVKLPDIEDFSYVKDDMYSQSTPAETVHLT  116

Query  359  GKEVLS-LSQK---------TVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
            G++ LS L+QK         +V+PP NWEKVLEGI KMRSSEDAPVDSMGCEKAGSSLP 
Sbjct  117  GEKALSQLTQKEMKSVSFSDSVRPPLNWEKVLEGIRKMRSSEDAPVDSMGCEKAGSSLPA  176

Query  509  KERRFAVLVSSLLSS  553
            KERRFAVLVSSLLSS
Sbjct  177  KERRFAVLVSSLLSS  191



>ref|XP_002264475.3| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X1 [Vitis vinifera]
Length=376

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 100/138 (72%), Gaps = 3/138 (2%)
 Frame = +2

Query  149  QENPSGDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQ  328
            +E P+G S +E+RVF+R+KRVK AVE    EI+ E   +K+  LPDIE+F+YRK   ++ 
Sbjct  44   EETPNGVSGSEVRVFVRKKRVKMAVETPEKEIKAEPQQQKICELPDIEEFTYRKGKRSTH  103

Query  329  ---STPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSS  499
               S P S     G E+ S  +   + P NWEK+LEGI KMRSSEDAPVDSMGCEKAGSS
Sbjct  104  LRKSKPTSDVPPGGTEITSSIRPAAELPANWEKILEGIRKMRSSEDAPVDSMGCEKAGSS  163

Query  500  LPPKERRFAVLVSSLLSS  553
            LPP+ERRFAVLVSSLLSS
Sbjct  164  LPPRERRFAVLVSSLLSS  181



>emb|CBI36652.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 100/138 (72%), Gaps = 3/138 (2%)
 Frame = +2

Query  149  QENPSGDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQ  328
            +E P+G S +E+RVF+R+KRVK AVE    EI+ E   +K+  LPDIE+F+YRK   ++ 
Sbjct  44   EETPNGVSGSEVRVFVRKKRVKMAVETPEKEIKAEPQQQKICELPDIEEFTYRKGKRSTH  103

Query  329  ---STPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSS  499
               S P S     G E+ S  +   + P NWEK+LEGI KMRSSEDAPVDSMGCEKAGSS
Sbjct  104  LRKSKPTSDVPPGGTEITSSIRPAAELPANWEKILEGIRKMRSSEDAPVDSMGCEKAGSS  163

Query  500  LPPKERRFAVLVSSLLSS  553
            LPP+ERRFAVLVSSLLSS
Sbjct  164  LPPRERRFAVLVSSLLSS  181



>ref|XP_006347463.1| PREDICTED: endonuclease III-like protein 1-like [Solanum tuberosum]
Length=422

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 112/195 (57%), Gaps = 59/195 (30%)
 Frame = +2

Query  146  SQENPS-----GDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK  310
            SQ+NP      G S  ELRVFIRRKRVKK VEI+A E+++ES  KK++ LP+IEDFSY K
Sbjct  40   SQKNPGCDGSGGSSVPELRVFIRRKRVKKTVEIIAKEVKEESSGKKLVKLPEIEDFSYSK  99

Query  311  DAINSQ--------------------------------------------STPVSSECMI  358
            +A +SQ                                            + P  S  + 
Sbjct  100  EATHSQPKLCHKYKLSVTSAALLFYDPVHQHLDFPNFLVFHPCANHSLLCAAPSKSVRLT  159

Query  359  GKEVLSLSQKT----------VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
            G++ LS   +T          +QPP NWEKVLEGI KMRS+EDAPVDSMGCEKAGSSLP 
Sbjct  160  GEKALSQLTQTEIKGFSLSDPLQPPLNWEKVLEGIRKMRSAEDAPVDSMGCEKAGSSLPA  219

Query  509  KERRFAVLVSSLLSS  553
            KERRFAVLVSSLLSS
Sbjct  220  KERRFAVLVSSLLSS  234



>ref|XP_006494172.1| PREDICTED: endonuclease III-like protein 1-like [Citrus sinensis]
Length=357

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 8/133 (6%)
 Frame = +2

Query  179  ELRVFIRRKRVKKAVEIVANEIEKESP-NKKVLGLPDIEDFSYRKDAINSQSTPVSSEC-  352
            ELRVF+RRKR K A++I   E + E+P   K  GLPDIE+F+Y++   ++ S+ ++ +  
Sbjct  33   ELRVFVRRKRQKNALQISKEEPKNEAPIEHKSCGLPDIEEFAYKEANGSALSSKIAGKSK  92

Query  353  ------MIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKE  514
                  ++G EV SL++   +PP NWE+VLEGI KMR+SEDAPVDSMGCEKAGSSLPP+E
Sbjct  93   STQDMPVVGTEVASLNRMRGEPPANWERVLEGIRKMRTSEDAPVDSMGCEKAGSSLPPRE  152

Query  515  RRFAVLVSSLLSS  553
            RRFAVL+SSLLSS
Sbjct  153  RRFAVLISSLLSS  165



>ref|XP_006443060.1| hypothetical protein CICLE_v10020813mg [Citrus clementina]
 gb|ESR56300.1| hypothetical protein CICLE_v10020813mg [Citrus clementina]
Length=357

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 8/133 (6%)
 Frame = +2

Query  179  ELRVFIRRKRVKKAVEIVANEIEKESP-NKKVLGLPDIEDFSYRKDAINSQSTPVSSEC-  352
            ELRVF+RRKR K A++I   E + E+P   K  GLPDIE+F+Y++   ++ S+ ++ +  
Sbjct  33   ELRVFVRRKRQKNALQISKEEPKNEAPIEHKSCGLPDIEEFAYKEANGSALSSKIAGKSK  92

Query  353  ------MIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKE  514
                  ++G EV SL++   +PP NWE+VLEGI KMR+SEDAPVDSMGCEKAGSSLPP+E
Sbjct  93   STQDMPVVGTEVASLNRMRGEPPANWERVLEGIRKMRTSEDAPVDSMGCEKAGSSLPPRE  152

Query  515  RRFAVLVSSLLSS  553
            RRFAVL+SSLLSS
Sbjct  153  RRFAVLISSLLSS  165



>ref|XP_009344368.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=360

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 19/135 (14%)
 Frame = +2

Query  155  NPSGD--SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQ  328
            NP  +  SAAELRVF RRKRVK+  E+   ++E +   +K+  LPDIE+F+Y+K  +N+ 
Sbjct  48   NPGSENGSAAELRVFSRRKRVKRTEEVQKLQLEAKPIAQKLAVLPDIEEFAYKK--VNTS  105

Query  329  STPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
            +  +                T +PP NWEKVL+GI KMRSSEDAPVDSMGCEKAGSSLPP
Sbjct  106  TNSID---------------TGKPPANWEKVLDGIRKMRSSEDAPVDSMGCEKAGSSLPP  150

Query  509  KERRFAVLVSSLLSS  553
            KERRFAVLVSSLLSS
Sbjct  151  KERRFAVLVSSLLSS  165



>ref|XP_008369130.1| PREDICTED: endonuclease III homolog 1, chloroplastic [Malus domestica]
Length=360

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 19/135 (14%)
 Frame = +2

Query  155  NPSGD--SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQ  328
            NP  +  SAAELRVF RRKRVK+  E+   ++E +   +K+  LPDIE+F+Y+K  +N+ 
Sbjct  48   NPGSENGSAAELRVFSRRKRVKRTEEVQKLQLEAKPIAQKLAVLPDIEEFAYKK--VNTS  105

Query  329  STPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
            +  +                T +PP NWEKVL+GI KMRSSEDAPVDSMGCEKAGSSLPP
Sbjct  106  TNSID---------------TGKPPANWEKVLDGIRKMRSSEDAPVDSMGCEKAGSSLPP  150

Query  509  KERRFAVLVSSLLSS  553
            KERRFAVLVSSLLSS
Sbjct  151  KERRFAVLVSSLLSS  165



>ref|XP_009363648.1| PREDICTED: endonuclease III homolog 1, chloroplastic [Pyrus x 
bretschneideri]
Length=371

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 95/135 (70%), Gaps = 19/135 (14%)
 Frame = +2

Query  155  NPSGD--SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQ  328
            NP  +  SAAELRVF RRKRVK+  E+   ++E +   +K+  LPDIE+F+Y+K  +N+ 
Sbjct  59   NPGSENGSAAELRVFSRRKRVKRTEEVQKLQLEAKPIAQKLAVLPDIEEFAYKK--VNTS  116

Query  329  STPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
            +  +                T +PP NWEKVL+GI KMRSSEDAPVDSMGCEKAGSSLPP
Sbjct  117  TNSID---------------TGKPPANWEKVLDGIRKMRSSEDAPVDSMGCEKAGSSLPP  161

Query  509  KERRFAVLVSSLLSS  553
            KERRFAVLVSSLLSS
Sbjct  162  KERRFAVLVSSLLSS  176



>ref|XP_007034068.1| DNA glycosylase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY04994.1| DNA glycosylase superfamily protein isoform 2 [Theobroma cacao]
Length=359

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK---DAINSQSTPV  340
            S   +RVF R+KRVKK V++V    + E+   K+ GLPDIE+F+Y+K    +++ +S   
Sbjct  59   SVPAVRVFTRKKRVKKTVDVVQEIPKAENKGLKLCGLPDIEEFAYKKVDGPSLSGKSKST  118

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            S E  +G  + S        P NWEKVLEGI KMRS+EDAPVD+MGCEKAGS LPPKERR
Sbjct  119  SDEINVGTGIASPVGIGGNAPANWEKVLEGIRKMRSAEDAPVDTMGCEKAGSVLPPKERR  178

Query  521  FAVLVSSLLSS  553
            FAVL+SSLLSS
Sbjct  179  FAVLISSLLSS  189



>ref|XP_007034067.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04993.1| DNA glycosylase superfamily protein isoform 1 [Theobroma cacao]
Length=387

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK---DAINSQSTPV  340
            S   +RVF R+KRVKK V++V    + E+   K+ GLPDIE+F+Y+K    +++ +S   
Sbjct  59   SVPAVRVFTRKKRVKKTVDVVQEIPKAENKGLKLCGLPDIEEFAYKKVDGPSLSGKSKST  118

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            S E  +G  + S        P NWEKVLEGI KMRS+EDAPVD+MGCEKAGS LPPKERR
Sbjct  119  SDEINVGTGIASPVGIGGNAPANWEKVLEGIRKMRSAEDAPVDTMGCEKAGSVLPPKERR  178

Query  521  FAVLVSSLLSS  553
            FAVL+SSLLSS
Sbjct  179  FAVLISSLLSS  189



>emb|CDP20302.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 92/136 (68%), Gaps = 22/136 (16%)
 Frame = +2

Query  152  ENPSGDSAAELRVFIRRKRVKKAVEIV-ANEIEKESPNKKVL-GLPDIEDFSYRKDAINS  325
            E+ +G SAA +RVF+R+KR KK++EI    E++ E P ++ L   PDIEDF+Y K    S
Sbjct  52   ESCNGGSAANIRVFVRKKRAKKSLEISPKEEVKAEEPRQQQLCSPPDIEDFAYGKKCGYS  111

Query  326  QSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLP  505
             ST                    Q P NWEKVLEGI +MRSSEDAPVDSMGCEKAG+SLP
Sbjct  112  YST--------------------QAPENWEKVLEGIRRMRSSEDAPVDSMGCEKAGNSLP  151

Query  506  PKERRFAVLVSSLLSS  553
            PKERRFAVLVSSLLSS
Sbjct  152  PKERRFAVLVSSLLSS  167



>gb|KDP42806.1| hypothetical protein JCGZ_23748 [Jatropha curcas]
Length=359

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 11/142 (8%)
 Frame = +2

Query  155  NPSGDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSY---------R  307
             P  DS  E RVF+ +KR +KA+E+  +E++ E   +K+  LPDIEDF+Y         R
Sbjct  25   GPEEDSKPETRVFVTKKRTQKALEVAESELKVEPKKEKLSSLPDIEDFAYKKANGSMPLR  84

Query  308  KDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK  487
            K    +   PV +E  I   V+S   +  + P +W+ VLEGI KMRSSEDAPVD+MGCEK
Sbjct  85   KSNRTTDVLPVDTE--IASTVISTGTQKYEAPADWKIVLEGIRKMRSSEDAPVDTMGCEK  142

Query  488  AGSSLPPKERRFAVLVSSLLSS  553
            AGS LPPKERRFAVL SSLLSS
Sbjct  143  AGSFLPPKERRFAVLASSLLSS  164



>ref|XP_011026396.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X2 [Populus euphratica]
Length=364

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 91/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK---DAINSQSTPV  340
            S  E+RVF R+++VK  VE    E++ E   +K+  LPDIE+F+Y+K    A+ S+    
Sbjct  54   SVPEIRVFARKRKVKTTVEAAEKEVKVEPRKQKLSSLPDIEEFAYKKGNGSALISKLKST  113

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
             +   +  E  S  +   +PP NW+KVLEGIHKMRSSEDAPVD+MGCEKAG SLPP+ERR
Sbjct  114  ENVLPVDSEAASTIRSAGEPPLNWDKVLEGIHKMRSSEDAPVDTMGCEKAGISLPPEERR  173

Query  521  FAVLVSSLLSS  553
            FAVL S+LLSS
Sbjct  174  FAVLASALLSS  184



>ref|XP_011026395.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X1 [Populus euphratica]
Length=379

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 91/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK---DAINSQSTPV  340
            S  E+RVF R+++VK  VE    E++ E   +K+  LPDIE+F+Y+K    A+ S+    
Sbjct  54   SVPEIRVFARKRKVKTTVEAAEKEVKVEPRKQKLSSLPDIEEFAYKKGNGSALISKLKST  113

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
             +   +  E  S  +   +PP NW+KVLEGIHKMRSSEDAPVD+MGCEKAG SLPP+ERR
Sbjct  114  ENVLPVDSEAASTIRSAGEPPLNWDKVLEGIHKMRSSEDAPVDTMGCEKAGISLPPEERR  173

Query  521  FAVLVSSLLSS  553
            FAVL S+LLSS
Sbjct  174  FAVLASALLSS  184



>gb|KHG16754.1| Endonuclease III-like protein 1 [Gossypium arboreum]
Length=384

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK---DAINSQSTPV  340
            S  ++RVF R+KR+KK +++V    + E+ +     LPDIE+F+Y+K    A + +S   
Sbjct  60   SLPQVRVFTRKKRLKKTLDVVKENPKPENEDHNSCSLPDIEEFAYKKVDGPARSGKSKSA  119

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
              E  +G  + S      +PP NWEKVLEGI KMRS EDAPVD+MGCEKAGS LPPKERR
Sbjct  120  CDELNVGVGIASPIGVGGKPPANWEKVLEGIRKMRSLEDAPVDTMGCEKAGSVLPPKERR  179

Query  521  FAVLVSSLLSS  553
            FAVLVSSLLSS
Sbjct  180  FAVLVSSLLSS  190



>gb|KJB71884.1| hypothetical protein B456_011G146700 [Gossypium raimondii]
Length=356

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSE  349
            S  ++RVF R+KR+KK +++V    + E+ +     LPDIE+F+Y+K    ++S  + S 
Sbjct  60   SLPQVRVFTRKKRLKKTLDVVKENPKPENEDHNSCSLPDIEEFAYKKVDGPARSGKLKSA  119

Query  350  C---MIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            C    +G  + S      + P NWEKVLEGI KMRS EDAPVD+MGCEKAGS LPPKERR
Sbjct  120  CDELNVGVSIASPIGVGGKAPANWEKVLEGIRKMRSLEDAPVDTMGCEKAGSVLPPKERR  179

Query  521  FAVLVSSLLSS  553
            FAVLVSSLLSS
Sbjct  180  FAVLVSSLLSS  190



>gb|KJB71882.1| hypothetical protein B456_011G146700 [Gossypium raimondii]
Length=363

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSE  349
            S  ++RVF R+KR+KK +++V    + E+ +     LPDIE+F+Y+K    ++S  + S 
Sbjct  60   SLPQVRVFTRKKRLKKTLDVVKENPKPENEDHNSCSLPDIEEFAYKKVDGPARSGKLKSA  119

Query  350  C---MIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            C    +G  + S      + P NWEKVLEGI KMRS EDAPVD+MGCEKAGS LPPKERR
Sbjct  120  CDELNVGVSIASPIGVGGKAPANWEKVLEGIRKMRSLEDAPVDTMGCEKAGSVLPPKERR  179

Query  521  FAVLVSSLLSS  553
            FAVLVSSLLSS
Sbjct  180  FAVLVSSLLSS  190



>gb|KJB71883.1| hypothetical protein B456_011G146700 [Gossypium raimondii]
Length=357

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSE  349
            S  ++RVF R+KR+KK +++V    + E+ +     LPDIE+F+Y+K    ++S  + S 
Sbjct  60   SLPQVRVFTRKKRLKKTLDVVKENPKPENEDHNSCSLPDIEEFAYKKVDGPARSGKLKSA  119

Query  350  C---MIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            C    +G  + S      + P NWEKVLEGI KMRS EDAPVD+MGCEKAGS LPPKERR
Sbjct  120  CDELNVGVSIASPIGVGGKAPANWEKVLEGIRKMRSLEDAPVDTMGCEKAGSVLPPKERR  179

Query  521  FAVLVSSLLSS  553
            FAVLVSSLLSS
Sbjct  180  FAVLVSSLLSS  190



>gb|KJB71881.1| hypothetical protein B456_011G146700 [Gossypium raimondii]
Length=384

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSE  349
            S  ++RVF R+KR+KK +++V    + E+ +     LPDIE+F+Y+K    ++S  + S 
Sbjct  60   SLPQVRVFTRKKRLKKTLDVVKENPKPENEDHNSCSLPDIEEFAYKKVDGPARSGKLKSA  119

Query  350  C---MIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            C    +G  + S      + P NWEKVLEGI KMRS EDAPVD+MGCEKAGS LPPKERR
Sbjct  120  CDELNVGVSIASPIGVGGKAPANWEKVLEGIRKMRSLEDAPVDTMGCEKAGSVLPPKERR  179

Query  521  FAVLVSSLLSS  553
            FAVLVSSLLSS
Sbjct  180  FAVLVSSLLSS  190



>gb|KJB71885.1| hypothetical protein B456_011G146700 [Gossypium raimondii]
Length=387

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSE  349
            S  ++RVF R+KR+KK +++V    + E+ +     LPDIE+F+Y+K    ++S  + S 
Sbjct  60   SLPQVRVFTRKKRLKKTLDVVKENPKPENEDHNSCSLPDIEEFAYKKVDGPARSGKLKSA  119

Query  350  C---MIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            C    +G  + S      + P NWEKVLEGI KMRS EDAPVD+MGCEKAGS LPPKERR
Sbjct  120  CDELNVGVSIASPIGVGGKAPANWEKVLEGIRKMRSLEDAPVDTMGCEKAGSVLPPKERR  179

Query  521  FAVLVSSLLSS  553
            FAVLVSSLLSS
Sbjct  180  FAVLVSSLLSS  190



>ref|XP_007034070.1| DNA glycosylase superfamily protein isoform 4 [Theobroma cacao]
 gb|EOY04996.1| DNA glycosylase superfamily protein isoform 4 [Theobroma cacao]
Length=336

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 84/128 (66%), Gaps = 20/128 (16%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSE  349
            S   +RVF R+KRVKK V++V    + E+   K+ GLPDIE+F+Y+K         V   
Sbjct  59   SVPAVRVFTRKKRVKKTVDVVQEIPKAENKGLKLCGLPDIEEFAYKK---------VDGP  109

Query  350  CMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAV  529
             + G             P NWEKVLEGI KMRS+EDAPVD+MGCEKAGS LPPKERRFAV
Sbjct  110  SLSGNA-----------PANWEKVLEGIRKMRSAEDAPVDTMGCEKAGSVLPPKERRFAV  158

Query  530  LVSSLLSS  553
            L+SSLLSS
Sbjct  159  LISSLLSS  166



>ref|XP_011100484.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like [Sesamum 
indicum]
Length=359

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 103/186 (55%), Gaps = 25/186 (13%)
 Frame = +2

Query  11   MSLPLLKWTLSPLVAPAPCVPARIIFCSKMsrtprrtppsnpnpGSQENPSGDSAAE---  181
            +SLPLL+   + +   +P +     F    +               +ENP  ++A +   
Sbjct  2    LSLPLLRNISAIVHVTSPKITPSSSFIKMQTTRLSSAKGQTYPSDERENPGSETATDDCS  61

Query  182  --LRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECM  355
              +RVF+RRKR  K V     + + E  ++K   LP+IEDF+Y KD+    S P S+   
Sbjct  62   KKVRVFVRRKRATKTVLTTVEKGKHEILDQKPCSLPEIEDFAYGKDS----SFPPSTHT-  116

Query  356  IGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLV  535
                           P NWEKVLEGI  MRSSE+APVDSMGCEKAGSSLPPKERRFAVLV
Sbjct  117  ---------------PANWEKVLEGIRTMRSSENAPVDSMGCEKAGSSLPPKERRFAVLV  161

Query  536  SSLLSS  553
            SSLLSS
Sbjct  162  SSLLSS  167



>ref|XP_002534117.1| endonuclease III, putative [Ricinus communis]
 gb|EEF28268.1| endonuclease III, putative [Ricinus communis]
Length=357

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = +2

Query  185  RVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK---DAINSQSTPVSSECM  355
            RV++R+KR K+ +E+   E++ E+   K   LPDIEDFS++     A   +S P      
Sbjct  37   RVYVRKKRAKRTLEVAEKELKVETKEVKQSALPDIEDFSFKGTNGSAYLRKSKPSRDVLP  96

Query  356  IGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLV  535
            +  EV    + + +PP NWE VLEGI KMRSSEDAPVD+MGCEKAGS LP KERRFAVLV
Sbjct  97   VDNEVACTIRPSDEPPANWEIVLEGIRKMRSSEDAPVDTMGCEKAGSFLPSKERRFAVLV  156

Query  536  SSLLSS  553
            SSL+SS
Sbjct  157  SSLMSS  162



>ref|XP_008222537.1| PREDICTED: endonuclease III homolog 1, chloroplastic [Prunus 
mume]
Length=358

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 93/142 (65%), Gaps = 25/142 (18%)
 Frame = +2

Query  146  SQENPSGD-----SAAELRVFIRRKRVKKA-VEIVANEIEKESPNKKVLGLPDIEDFSYR  307
            S+ NP  +     SA ELRVF RRKR+KK  V+ +  E++  +P  K+   PDIE+F+Y 
Sbjct  41   SEPNPGSEGSNDVSAPELRVFTRRKRLKKTEVQKIHLEVKPHAP--KLAEPPDIEEFAYT  98

Query  308  KDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK  487
            K + ++ S                   T +PP NWEKVLEGI KMRSSE APVDSMGCEK
Sbjct  99   KVSASTNSI-----------------DTGKPPANWEKVLEGIRKMRSSEGAPVDSMGCEK  141

Query  488  AGSSLPPKERRFAVLVSSLLSS  553
            AGS+LPPKERRFAVLVSSLLSS
Sbjct  142  AGSALPPKERRFAVLVSSLLSS  163



>ref|XP_007034069.1| DNA glycosylase superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY04995.1| DNA glycosylase superfamily protein isoform 3 [Theobroma cacao]
Length=364

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 84/128 (66%), Gaps = 20/128 (16%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSE  349
            S   +RVF R+KRVKK V++V    + E+   K+ GLPDIE+F+Y+K         V   
Sbjct  59   SVPAVRVFTRKKRVKKTVDVVQEIPKAENKGLKLCGLPDIEEFAYKK---------VDGP  109

Query  350  CMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAV  529
             + G             P NWEKVLEGI KMRS+EDAPVD+MGCEKAGS LPPKERRFAV
Sbjct  110  SLSGNA-----------PANWEKVLEGIRKMRSAEDAPVDTMGCEKAGSVLPPKERRFAV  158

Query  530  LVSSLLSS  553
            L+SSLLSS
Sbjct  159  LISSLLSS  166



>ref|XP_008799977.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X1 [Phoenix dactylifera]
Length=390

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 94/140 (67%), Gaps = 8/140 (6%)
 Frame = +2

Query  155  NPSGDSAAEL--RVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQ  328
            NP  D  A L  R +  +KRVK+ +EI     E E+ ++K+  LPDIE+F+Y K      
Sbjct  46   NPGSDGIAGLGIRGYAGKKRVKRMIEINGENPEGEARDQKIDHLPDIEEFAYNKAKATKT  105

Query  329  STPV--SSECMIG---KEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG  493
            S+ V  +S   +G   +  LS+  K V+PP NWE+VLEGI KMRSSE+APVDS GCEKAG
Sbjct  106  SSKVKLASALPVGMDKRTDLSIVPK-VEPPTNWEEVLEGIKKMRSSEEAPVDSKGCEKAG  164

Query  494  SSLPPKERRFAVLVSSLLSS  553
              LPPKERRFAVLVSSLLSS
Sbjct  165  ILLPPKERRFAVLVSSLLSS  184



>ref|XP_008799985.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X2 [Phoenix dactylifera]
Length=379

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 94/140 (67%), Gaps = 8/140 (6%)
 Frame = +2

Query  155  NPSGDSAAEL--RVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQ  328
            NP  D  A L  R +  +KRVK+ +EI     E E+ ++K+  LPDIE+F+Y K      
Sbjct  46   NPGSDGIAGLGIRGYAGKKRVKRMIEINGENPEGEARDQKIDHLPDIEEFAYNKAKATKT  105

Query  329  STPV--SSECMIG---KEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG  493
            S+ V  +S   +G   +  LS+  K V+PP NWE+VLEGI KMRSSE+APVDS GCEKAG
Sbjct  106  SSKVKLASALPVGMDKRTDLSIVPK-VEPPTNWEEVLEGIKKMRSSEEAPVDSKGCEKAG  164

Query  494  SSLPPKERRFAVLVSSLLSS  553
              LPPKERRFAVLVSSLLSS
Sbjct  165  ILLPPKERRFAVLVSSLLSS  184



>gb|EYU42853.1| hypothetical protein MIMGU_mgv1a009936mg [Erythranthe guttata]
Length=319

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 87/135 (64%), Gaps = 21/135 (16%)
 Frame = +2

Query  152  ENPSGDSAAE-LRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQ  328
            E  S +SA + +RV+IR+KR  K V+ +  EI  E  ++K   LP+IEDF+Y        
Sbjct  54   ETASDESAQKSVRVYIRKKRSNKTVQPIVEEINPEIIDEKPCSLPEIEDFAYGN------  107

Query  329  STPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
                      G  V  L++     P NWEKVLEGI  MRSSEDAPVDSMGCEKAGSSLPP
Sbjct  108  ----------GNSVSRLTKL----PENWEKVLEGIRTMRSSEDAPVDSMGCEKAGSSLPP  153

Query  509  KERRFAVLVSSLLSS  553
            KERRFAVLVSSLLSS
Sbjct  154  KERRFAVLVSSLLSS  168



>ref|XP_010469713.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=374

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 95/146 (65%), Gaps = 22/146 (15%)
 Frame = +2

Query  146  SQENPSGDS---------AAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDF  298
            +Q++P  DS          +E RV+ R+KR+K+       E  +  P K++ GLPDIEDF
Sbjct  45   TQQHPLSDSKSEPANVVSGSETRVYTRKKRLKQ-------EPLEPLPGKQLCGLPDIEDF  97

Query  299  SYRKDAINSQSTPVSSECMIGKEVLSLSQKTV-QPPPNWEKVLEGIHKMRSSEDAPVDSM  475
            +Y+K+ I S S+  S E      +   S KTV  PP NW KVLEGI +MRSSEDAPVDSM
Sbjct  98   AYKKN-IASPSSRRSPE----TSITGTSVKTVGNPPENWVKVLEGIRQMRSSEDAPVDSM  152

Query  476  GCEKAGSSLPPKERRFAVLVSSLLSS  553
            GC+KAGS LPP ERRFAVL+ +LLSS
Sbjct  153  GCDKAGSFLPPTERRFAVLLGALLSS  178



>ref|XP_010930206.1| PREDICTED: LOW QUALITY PROTEIN: endonuclease III homolog 1, chloroplastic 
[Elaeis guineensis]
Length=390

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 93/143 (65%), Gaps = 8/143 (6%)
 Frame = +2

Query  146  SQENPSGDSAAE--LRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAI  319
            S+ NP  D  A   +  ++R+KRVK+ +EI     E E+ ++K+  LPDIE+F Y K   
Sbjct  43   SELNPGSDGIAGSGIHGYVRKKRVKRMIEISGENPEGEARDQKIDHLPDIEEFVYNKGKA  102

Query  320  NSQSTPV--SSECMIG---KEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCE  484
               S+ V  +S   +G   +  LS+  K V PP NWE+VLEGI KMR SE APVDS GCE
Sbjct  103  TKTSSKVKLASALPVGMDKRTDLSIVPK-VDPPTNWEEVLEGIKKMRCSEQAPVDSKGCE  161

Query  485  KAGSSLPPKERRFAVLVSSLLSS  553
            KAG  LPPKERRFAVLVSSLLSS
Sbjct  162  KAGILLPPKERRFAVLVSSLLSS  184



>gb|AAM61598.1| putative endonuclease [Arabidopsis thaliana]
Length=379

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = +2

Query  164  GDSAAELRVFIRRKRVKKA-VEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPV  340
            G S +E RV+ R+KR+K+   E +  +  K     K+ GLPDIEDF+Y+K  I S S+  
Sbjct  58   GASGSETRVYTRKKRLKQEPFEPLEKDSGKGVNTHKLCGLPDIEDFAYKK-TIGSPSSSR  116

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            S+E  I    ++  +    PP NW  VLEGI +MRSSEDAPVDSMGC+KAGS LPP ERR
Sbjct  117  STETSI---TVTSVKTAGNPPENWVGVLEGIRQMRSSEDAPVDSMGCDKAGSFLPPTERR  173

Query  521  FAVLVSSLLSS  553
            FAVL+ +LLSS
Sbjct  174  FAVLLGALLSS  184



>ref|XP_010469712.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=377

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 96/151 (64%), Gaps = 29/151 (19%)
 Frame = +2

Query  146  SQENPSGDS---------AAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDF  298
            +Q++P  DS          +E RV+ R+KR+K+       E  +  P K++ GLPDIEDF
Sbjct  45   TQQHPLSDSKSEPANVVSGSETRVYTRKKRLKQ-------EPLEPLPGKQLCGLPDIEDF  97

Query  299  SYRKD-----AINSQSTPVSSECMIGKEVLSLSQKTV-QPPPNWEKVLEGIHKMRSSEDA  460
            +Y+K+     +I +  +P +S       +   S KTV  PP NW KVLEGI +MRSSEDA
Sbjct  98   AYKKNIASPSSIYAGRSPETS-------ITGTSVKTVGNPPENWVKVLEGIRQMRSSEDA  150

Query  461  PVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            PVDSMGC+KAGS LPP ERRFAVL+ +LLSS
Sbjct  151  PVDSMGCDKAGSFLPPTERRFAVLLGALLSS  181



>emb|CAC16135.1| endonuclease III homologue [Arabidopsis thaliana]
Length=354

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = +2

Query  164  GDSAAELRVFIRRKRVKKA-VEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPV  340
            G S +E RV+ R+KR+K+   E +     K     K+ GLPDIEDF+Y+K  I S S+  
Sbjct  33   GASGSETRVYTRKKRLKQEPFEPLEKYSGKGVNTHKLCGLPDIEDFAYKK-TIGSPSSSR  91

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            S+E  I    ++  +    PP NW +VLEGI +MRSSEDAPVDSMGC+KAGS LPP ERR
Sbjct  92   STETSI---TVTSVKTAGYPPENWVEVLEGIRQMRSSEDAPVDSMGCDKAGSFLPPTERR  148

Query  521  FAVLVSSLLSS  553
            FAVL+ +LLSS
Sbjct  149  FAVLLGALLSS  159



>ref|NP_001077988.1| protein NTH1 [Arabidopsis thaliana]
 gb|AAL36207.1| putative endonuclease [Arabidopsis thaliana]
 gb|AAM14168.1| putative endonuclease [Arabidopsis thaliana]
 gb|AEC08550.1| protein NTH1 [Arabidopsis thaliana]
Length=377

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = +2

Query  164  GDSAAELRVFIRRKRVKKA-VEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPV  340
            G S +E RV+ R+KR+K+   E +     K     K+ GLPDIEDF+Y+K  I S S+  
Sbjct  56   GASGSETRVYTRKKRLKQEPFEPLEKYSGKGVNTHKLCGLPDIEDFAYKK-TIGSPSSSR  114

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            S+E  I    ++  +    PP NW +VLEGI +MRSSEDAPVDSMGC+KAGS LPP ERR
Sbjct  115  STETSI---TVTSVKTAGYPPENWVEVLEGIRQMRSSEDAPVDSMGCDKAGSFLPPTERR  171

Query  521  FAVLVSSLLSS  553
            FAVL+ +LLSS
Sbjct  172  FAVLLGALLSS  182



>ref|NP_565725.1| protein NTH1 [Arabidopsis thaliana]
 sp|Q9SIC4.2|NTH1_ARATH RecName: Full=Endonuclease III homolog 1, chloroplastic; Short=AtNTH1; 
AltName: Full=Bifunctional DNA N-glycoslyase/DNA-(apurinic 
or apyrimidinic site) lyase 1; Short=DNA glycoslyase/AP 
lyase 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD26474.2| putative endonuclease [Arabidopsis thaliana]
 gb|AEC08549.1| protein NTH1 [Arabidopsis thaliana]
Length=379

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = +2

Query  164  GDSAAELRVFIRRKRVKKA-VEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPV  340
            G S +E RV+ R+KR+K+   E +     K     K+ GLPDIEDF+Y+K  I S S+  
Sbjct  58   GASGSETRVYTRKKRLKQEPFEPLEKYSGKGVNTHKLCGLPDIEDFAYKK-TIGSPSSSR  116

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            S+E  I    ++  +    PP NW +VLEGI +MRSSEDAPVDSMGC+KAGS LPP ERR
Sbjct  117  STETSI---TVTSVKTAGYPPENWVEVLEGIRQMRSSEDAPVDSMGCDKAGSFLPPTERR  173

Query  521  FAVLVSSLLSS  553
            FAVL+ +LLSS
Sbjct  174  FAVLLGALLSS  184



>ref|XP_010558863.1| PREDICTED: endonuclease III homolog 1, chloroplastic [Tarenaya 
hassleriana]
Length=356

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 91/139 (65%), Gaps = 6/139 (4%)
 Frame = +2

Query  155  NPSGDSAAELRVFIRRKRVKKA-VEIVANEI-EKESPNKKVLGLPDIEDFSYRKDAINSQ  328
            N S   A  +RV+ R+KR K+  +E V  E  E+    K++ GLPDIE+F+Y+K   +  
Sbjct  22   NLSSHEAPNIRVYARKKRPKQQPLEPVVKESGEQIHAQKEMCGLPDIEEFAYKKTNGSVS  81

Query  329  STPVSS----ECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS  496
            S  +      E M      S  +   QPP NWEKVLEGI KMRSSEDAPVDS+GCEKAGS
Sbjct  82   SGKLKPNPDIESMRSTTNKSSIRTAGQPPDNWEKVLEGICKMRSSEDAPVDSVGCEKAGS  141

Query  497  SLPPKERRFAVLVSSLLSS  553
             LPPKERRFAVL+SSLLSS
Sbjct  142  FLPPKERRFAVLISSLLSS  160



>ref|XP_002881177.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57436.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=354

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 91/133 (68%), Gaps = 6/133 (5%)
 Frame = +2

Query  161  SGDSAAELRVFIRRKRVKKAVE--IVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQST  334
            +G S +  RV+ R+KR+K+     +  N  +  + +K++ GLPDIEDF+Y+K  I S S+
Sbjct  31   NGASGSVTRVYTRKKRLKQEASEPLEINPGKGVNTHKQLRGLPDIEDFAYKK-TIGSPSS  89

Query  335  PVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKE  514
              S+E  I    ++  +    PP NW KVLEGI +MRSSEDAPVDSMGC+KAGS LPP E
Sbjct  90   RRSTETSI---TVTSVKTAGNPPENWVKVLEGIRQMRSSEDAPVDSMGCDKAGSFLPPTE  146

Query  515  RRFAVLVSSLLSS  553
            RRFAVL+ +LLSS
Sbjct  147  RRFAVLLGALLSS  159



>gb|EYU42852.1| hypothetical protein MIMGU_mgv1a009936mg [Erythranthe guttata]
Length=327

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 88/143 (62%), Gaps = 29/143 (20%)
 Frame = +2

Query  152  ENPSGDSAAE-LRVFIRRKRVKKAVEIVANEIEKESPNKKVLG--------LPDIEDFSY  304
            E  S +SA + +RV+IR+KR  K V+ +  EI  E  ++K L         LP+IEDF+Y
Sbjct  54   ETASDESAQKSVRVYIRKKRSNKTVQPIVEEINPEIIDEKQLSSYLTQPCSLPEIEDFAY  113

Query  305  RKDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCE  484
                              G  V  L++     P NWEKVLEGI  MRSSEDAPVDSMGCE
Sbjct  114  GN----------------GNSVSRLTKL----PENWEKVLEGIRTMRSSEDAPVDSMGCE  153

Query  485  KAGSSLPPKERRFAVLVSSLLSS  553
            KAGSSLPPKERRFAVLVSSLLSS
Sbjct  154  KAGSSLPPKERRFAVLVSSLLSS  176



>ref|XP_009416017.1| PREDICTED: endonuclease III homolog 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=389

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 85/132 (64%), Gaps = 4/132 (3%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSE  349
            S  E R + R+KR K+ +E+     ++ES +KKV G  DIEDF+Y K  +++ S  ++  
Sbjct  67   SDGEKRFYGRKKRAKRIIEVDGETAKEESADKKVSGPIDIEDFAYHKINLSATSNGINIS  126

Query  350  CMIGKEVLSLSQKTVQP----PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKER  517
                      +  +++     P NWE V +GI KMR +EDAPVD+MGCEKAG SLPPKER
Sbjct  127  ASFPTHKTKSTHLSIKSKANLPANWEAVFDGIRKMRLAEDAPVDTMGCEKAGLSLPPKER  186

Query  518  RFAVLVSSLLSS  553
            RFAVLVSSLLSS
Sbjct  187  RFAVLVSSLLSS  198



>ref|XP_010672145.1| PREDICTED: endonuclease III homolog 1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=415

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 98/161 (61%), Gaps = 36/161 (22%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPN-KKVLGLPDIEDFSYRKDAINS-------  325
            S +E +VF+R+KRVK+ V   + E E +S +  ++ GLPDIEDF+++K   +S       
Sbjct  59   SGSETQVFVRKKRVKREV---SEEQETDSSHGNRISGLPDIEDFTFQKGNPSSSTKGKSE  115

Query  326  --------------------QSTPVSSECMIGKEVLSLSQK-----TVQPPPNWEKVLEG  430
                                +S PVS    IG  V+S  ++     + +PP NW KVLEG
Sbjct  116  PVSPAHPIGAGVVSTMKHEGKSEPVSPAHPIGAGVVSTMKREGPFVSGEPPENWVKVLEG  175

Query  431  IHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            I  MRSSEDAPVDS+GCEKAGS+LPPKERRFAVL+ +LLSS
Sbjct  176  IRDMRSSEDAPVDSVGCEKAGSTLPPKERRFAVLIGTLLSS  216



>ref|XP_010069308.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=378

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 88/142 (62%), Gaps = 10/142 (7%)
 Frame = +2

Query  152  ENPSGDSAAELRVFIRRKRVKKAVEIVANE-----IEKESPNKKVLGLPDIEDFSYRK--  310
            E P G S   +RVF R+K  K++ E V  E     +E     K+   LPDIE+F+Y+   
Sbjct  55   EAPGGPSTPAVRVFARKK--KRSGEAVRAEQKQPKVEPLVSRKQPSELPDIEEFAYKNPN  112

Query  311  -DAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK  487
              A    S   S+  +    V S  +    PP NWEKVLEGI  MRSSEDAPVDSMGCEK
Sbjct  113  GSAFPGHSKQNSNVIVQVNGVASQVRPKGAPPSNWEKVLEGIRMMRSSEDAPVDSMGCEK  172

Query  488  AGSSLPPKERRFAVLVSSLLSS  553
            AGSSLPPKERRFAVLVSSLLSS
Sbjct  173  AGSSLPPKERRFAVLVSSLLSS  194



>ref|XP_006294450.1| hypothetical protein CARUB_v10023463mg [Capsella rubella]
 gb|EOA27348.1| hypothetical protein CARUB_v10023463mg [Capsella rubella]
Length=370

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 95/144 (66%), Gaps = 17/144 (12%)
 Frame = +2

Query  146  SQENPSGDS-------AAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSY  304
            +Q +P  DS        +E RV+ R+KR+K+      + +EK +P K++ GLPDIEDF+Y
Sbjct  43   TQLHPLSDSNSEPANVVSETRVYSRKKRLKQEP---LDPLEK-TPGKQLCGLPDIEDFAY  98

Query  305  RKDAINSQSTPVSSECMIGKEVLSLSQKTV-QPPPNWEKVLEGIHKMRSSEDAPVDSMGC  481
            +K+ I   S+  S E      +   S KTV  PP NW KVL GI +MRSSEDAPVDSMGC
Sbjct  99   KKN-IGCPSSRRSPE----TSITVTSVKTVGSPPENWVKVLVGIRQMRSSEDAPVDSMGC  153

Query  482  EKAGSSLPPKERRFAVLVSSLLSS  553
            +KAGS LPP ERRFAVL+ +LLSS
Sbjct  154  DKAGSFLPPTERRFAVLLGALLSS  177



>ref|XP_010650536.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X2 [Vitis vinifera]
Length=295

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +2

Query  266  KVLGLPDIEDFSYRKDAINSQ---STPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIH  436
            ++  LPDIE+F+YRK   ++    S P S     G E+ S  +   + P NWEK+LEGI 
Sbjct  2    QICELPDIEEFTYRKGKRSTHLRKSKPTSDVPPGGTEITSSIRPAAELPANWEKILEGIR  61

Query  437  KMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            KMRSSEDAPVDSMGCEKAGSSLPP+ERRFAVLVSSLLSS
Sbjct  62   KMRSSEDAPVDSMGCEKAGSSLPPRERRFAVLVSSLLSS  100



>ref|XP_010069309.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X2 [Eucalyptus grandis]
Length=377

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 90/143 (63%), Gaps = 13/143 (9%)
 Frame = +2

Query  152  ENPSGDSAAELRVFIRRKRVKKAVEIVANEIEKESP------NKKVLGLPDIEDFSYRK-  310
            E P G S   +RVF R+K  K++ E V    E++ P      ++K   LPDIE+F+Y+  
Sbjct  55   EAPGGPSTPAVRVFARKK--KRSGEAV--RAEQKQPKVEPLVSRKPSELPDIEEFAYKNP  110

Query  311  --DAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCE  484
               A    S   S+  +    V S  +    PP NWEKVLEGI  MRSSEDAPVDSMGCE
Sbjct  111  NGSAFPGHSKQNSNVIVQVNGVASQVRPKGAPPSNWEKVLEGIRMMRSSEDAPVDSMGCE  170

Query  485  KAGSSLPPKERRFAVLVSSLLSS  553
            KAGSSLPPKERRFAVLVSSLLSS
Sbjct  171  KAGSSLPPKERRFAVLVSSLLSS  193



>ref|XP_010414127.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=345

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 92/141 (65%), Gaps = 16/141 (11%)
 Frame = +2

Query  146  SQENPSGDS----AAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKD  313
            +Q++P  DS     +E RV    KR+K+       E  +  P K++ GLPDIEDF+Y+K+
Sbjct  20   TQQHPLSDSKSVSGSETRVCTPNKRLKQ-------EPLEPLPGKQLCGLPDIEDFAYKKN  72

Query  314  AINSQSTPVSSECMIGKEVLSLSQKTV-QPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA  490
             I S S+  S E  I       S KTV  PP NW +VLEGI +MRSSEDAPVDSMGC+KA
Sbjct  73   -IASPSSRRSPETSI---TAVTSVKTVGNPPDNWVEVLEGIRQMRSSEDAPVDSMGCDKA  128

Query  491  GSSLPPKERRFAVLVSSLLSS  553
            GS LPP ERRFAVL+ +LLSS
Sbjct  129  GSFLPPTERRFAVLLGALLSS  149



>ref|XP_004309826.1| PREDICTED: endonuclease III homolog 1, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=341

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 24/119 (20%)
 Frame = +2

Query  197  RRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVLS  376
            R K  ++ +EIVA       P++  L LPDIE+F+YR ++ +S ST       IGK    
Sbjct  53   RLKTTEQRLEIVAK------PHQMDL-LPDIEEFAYRNESSSSYSTD------IGK----  95

Query  377  LSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
                   PP +WEKVLEGI KMRS+EDAPVDSMGCEKAGS+LPPKERRFAVLVSSLLSS
Sbjct  96   -------PPAHWEKVLEGIRKMRSAEDAPVDSMGCEKAGSALPPKERRFAVLVSSLLSS  147



>ref|XP_007034071.1| DNA glycosylase superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY04997.1| DNA glycosylase superfamily protein isoform 5 [Theobroma cacao]
Length=259

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK---DAINSQSTPV  340
            S   +RVF R+KRVKK V++V    + E+   K+ GLPDIE+F+Y+K    +++ +S   
Sbjct  59   SVPAVRVFTRKKRVKKTVDVVQEIPKAENKGLKLCGLPDIEEFAYKKVDGPSLSGKSKST  118

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPK  511
            S E  +G  + S        P NWEKVLEGI KMRS+EDAPVD+MGCEKAGS LPPK
Sbjct  119  SDEINVGTGIASPVGIGGNAPANWEKVLEGIRKMRSAEDAPVDTMGCEKAGSVLPPK  175



>emb|CDX84784.1| BnaA03g14460D [Brassica napus]
Length=374

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 94/136 (69%), Gaps = 14/136 (10%)
 Frame = +2

Query  152  ENPSGDSAA-ELRVFIRRKRVKK-AVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINS  325
            E  +G S + E RV+ R+KR+K+ A+E     +EK+S   ++ GLPDIE+F+++K   N+
Sbjct  55   ETANGASGSLETRVYTRKKRLKQEALE----PLEKKS---QLCGLPDIEEFAFKK---NT  104

Query  326  QSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLP  505
            +S+  S+E  I   V S       PP NW +VLEGI +MRSS DAPVDSMGC+KAGS LP
Sbjct  105  RSSRRSTETNI--TVASAKTTAGNPPENWVEVLEGIRQMRSSGDAPVDSMGCDKAGSFLP  162

Query  506  PKERRFAVLVSSLLSS  553
            P ERRFAVL+ SLLSS
Sbjct  163  PSERRFAVLLGSLLSS  178



>ref|XP_010414126.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=373

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 90/141 (64%), Gaps = 13/141 (9%)
 Frame = +2

Query  146  SQENPSGDS----AAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKD  313
            +Q++P  DS     +E RV    KR+K+       E  +  P K++ GLPDIEDF+Y+K+
Sbjct  45   TQQHPLSDSKSVSGSETRVCTPNKRLKQ-------EPLEPLPGKQLCGLPDIEDFAYKKN  97

Query  314  AINSQSTPVSSECMIGKEVLSLSQKTV-QPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA  490
             I S S+  +            S KTV  PP NW +VLEGI +MRSSEDAPVDSMGC+KA
Sbjct  98   -IASPSSIFAGRSPETSITAVTSVKTVGNPPDNWVEVLEGIRQMRSSEDAPVDSMGCDKA  156

Query  491  GSSLPPKERRFAVLVSSLLSS  553
            GS LPP ERRFAVL+ +LLSS
Sbjct  157  GSFLPPTERRFAVLLGALLSS  177



>ref|XP_007131959.1| hypothetical protein PHAVU_011G055100g [Phaseolus vulgaris]
 gb|ESW03953.1| hypothetical protein PHAVU_011G055100g [Phaseolus vulgaris]
Length=359

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 89/144 (62%), Gaps = 23/144 (16%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANE-------IEKESPNKKVLGLPDIEDFSY--------  304
            S +++RVF+RR +  + + +   E        + + P  +  GLP+IEDF+Y        
Sbjct  26   SNSKVRVFVRRNKKPRKMAVKLEEEDHLPLTQDHKVPVTQKFGLPEIEDFAYCGGNELTR  85

Query  305  -RKDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGC  481
             RK  + S    V+SE       ++ ++   + P +WEKVLEGI KMRSS DAPVD+MGC
Sbjct  86   RRKSEMESDVASVASE-------VASTRPGGKSPAHWEKVLEGIRKMRSSADAPVDTMGC  138

Query  482  EKAGSSLPPKERRFAVLVSSLLSS  553
            EKAG +LPPKERRFAVLVSSLLSS
Sbjct  139  EKAGDTLPPKERRFAVLVSSLLSS  162



>ref|XP_003539044.2| PREDICTED: endonuclease III-like protein 1-like [Glycine max]
 gb|KHN06213.1| Endonuclease III-like protein 1 [Glycine soja]
Length=357

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 88/140 (63%), Gaps = 19/140 (14%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKES---PNKKVLGLPDIEDFSY---------RKD  313
            + +++RVF+RR +  + + +   + + +    P     GLP+IE+F+Y          K 
Sbjct  27   THSQVRVFMRRNKRPRNMALKLEQSDHQDLKVPVTHKFGLPEIEEFAYCGAKELTQCGKS  86

Query  314  AINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG  493
             + S + PV+SE       ++ ++ + + P  WEKVLEGI KMR S DAPVD+MGCEKAG
Sbjct  87   EMGSDAIPVASE-------VASTRSSGESPAQWEKVLEGIRKMRCSADAPVDTMGCEKAG  139

Query  494  SSLPPKERRFAVLVSSLLSS  553
             +LPPKERRFAVLVSSLLSS
Sbjct  140  ETLPPKERRFAVLVSSLLSS  159



>ref|XP_009132788.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X4 [Brassica rapa]
Length=376

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 11/124 (9%)
 Frame = +2

Query  188  VFIRRKRVKK-AVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTP-VSSECMIG  361
            V+ R+KR+K+ A+E     +EK+S   ++ GLPDIE+F+++K+  +S ST   S+E  I 
Sbjct  66   VYTRKKRLKQEALE----PLEKKS---QLCGLPDIEEFAFKKNTRSSTSTAGRSTETNI-  117

Query  362  KEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSS  541
              V S       PP NW +VLEGI +MRSS DAPVDSMGC+KAGS LPP ERRFAVL+ S
Sbjct  118  -TVASAKTTAGNPPENWVEVLEGIRQMRSSGDAPVDSMGCDKAGSFLPPSERRFAVLLGS  176

Query  542  LLSS  553
            LLSS
Sbjct  177  LLSS  180



>ref|XP_010510195.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=382

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 90/130 (69%), Gaps = 8/130 (6%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKA-VEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSS  346
            S +E RV+ R+KR+K+  +E +  +    + +K++ GLPDIEDF+Y+K+ + S S+  S 
Sbjct  63   SGSETRVYTRKKRLKQEPLEPLPRK--GVNTHKQLRGLPDIEDFAYKKN-VASPSSRRSP  119

Query  347  ECMIGKEVLSLSQKTV-QPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRF  523
            E  I       S KTV   P NW +VLEGI +MRS EDAPVDSMGC+KAGS LPP ERRF
Sbjct  120  ETSI---TAVTSVKTVGNSPDNWVEVLEGIRQMRSYEDAPVDSMGCDKAGSFLPPTERRF  176

Query  524  AVLVSSLLSS  553
            AVL+ +LLSS
Sbjct  177  AVLLGALLSS  186



>ref|XP_007222713.1| hypothetical protein PRUPE_ppa009900mg [Prunus persica]
 gb|EMJ23912.1| hypothetical protein PRUPE_ppa009900mg [Prunus persica]
Length=272

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 64/91 (70%), Gaps = 20/91 (22%)
 Frame = +2

Query  281  PDIEDFSYRKDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDA  460
            PDIE+F+Y K                    +S S  + +PP NWEKVLEGI KMRSSEDA
Sbjct  7    PDIEEFAYTK--------------------VSASTNSSKPPANWEKVLEGIRKMRSSEDA  46

Query  461  PVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            PVDSMGCEKAGS+LPPKERRFAVLVSSLLSS
Sbjct  47   PVDSMGCEKAGSALPPKERRFAVLVSSLLSS  77



>ref|XP_009132790.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X6 [Brassica rapa]
Length=372

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 87/123 (71%), Gaps = 13/123 (11%)
 Frame = +2

Query  188  VFIRRKRVKK-AVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGK  364
            V+ R+KR+K+ A+E     +EK+S   ++ GLPDIE+F+++K   N++S+  S+E  I  
Sbjct  66   VYTRKKRLKQEALE----PLEKKS---QLCGLPDIEEFAFKK---NTRSSRRSTETNI--  113

Query  365  EVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSL  544
             V S       PP NW +VLEGI +MRSS DAPVDSMGC+KAGS LPP ERRFAVL+ SL
Sbjct  114  TVASAKTTAGNPPENWVEVLEGIRQMRSSGDAPVDSMGCDKAGSFLPPSERRFAVLLGSL  173

Query  545  LSS  553
            LSS
Sbjct  174  LSS  176



>ref|XP_007131960.1| hypothetical protein PHAVU_011G055100g [Phaseolus vulgaris]
 gb|ESW03954.1| hypothetical protein PHAVU_011G055100g [Phaseolus vulgaris]
Length=408

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 90/144 (63%), Gaps = 23/144 (16%)
 Frame = +2

Query  170  SAAELRVFIRRKR--VKKAVEIVANEIEKESPNKKV-----LGLPDIEDFSY--------  304
            S ++ RVF+RR +   K AV++   +    + + KV      GLP+IEDF+Y        
Sbjct  75   SHSKARVFVRRNKNPRKMAVKLEEEDHLPSTQDHKVPVTQKFGLPEIEDFAYCGGNELTR  134

Query  305  -RKDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGC  481
             RK  + S    V+SE       ++ ++   + P +WEKVLEGI KMRSS DAPVD+MGC
Sbjct  135  RRKSEMESDVASVASE-------VASTRPGGKSPAHWEKVLEGIRKMRSSADAPVDTMGC  187

Query  482  EKAGSSLPPKERRFAVLVSSLLSS  553
            EKAG +LPPKERRFAVLVSSLLSS
Sbjct  188  EKAGDTLPPKERRFAVLVSSLLSS  211



>ref|XP_002309812.1| endonuclease-related family protein [Populus trichocarpa]
 gb|EEE90262.1| endonuclease-related family protein [Populus trichocarpa]
Length=362

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 79/121 (65%), Gaps = 3/121 (2%)
 Frame = +2

Query  155  NPSGDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKD---AINS  325
             P+  S  E+RVF+R+++VK  VE    E++ E   +K+  LPDIE+F+Y+K    A+  
Sbjct  49   GPNEVSVPEVRVFVRKRKVKTTVEAAEKEVKVEPRKQKLSALPDIEEFAYKKGNGPALIR  108

Query  326  QSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLP  505
            +     +   +  E  S  +   +PP NW+KVLEGIHKMRSSEDAPVD+MGCEKAG SLP
Sbjct  109  KLKSTENVLPVDSEAASTIRPAGEPPLNWDKVLEGIHKMRSSEDAPVDTMGCEKAGISLP  168

Query  506  P  508
            P
Sbjct  169  P  169



>ref|XP_009132789.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X5 [Brassica rapa]
Length=375

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 86/124 (69%), Gaps = 12/124 (10%)
 Frame = +2

Query  188  VFIRRKRVKK-AVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTP-VSSECMIG  361
            V+ R+KR+K+ A+E     +EK+S    + GLPDIE+F+++K+  +S ST   S+E  I 
Sbjct  66   VYTRKKRLKQEALE----PLEKKS----LCGLPDIEEFAFKKNTRSSTSTAGRSTETNI-  116

Query  362  KEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSS  541
              V S       PP NW +VLEGI +MRSS DAPVDSMGC+KAGS LPP ERRFAVL+ S
Sbjct  117  -TVASAKTTAGNPPENWVEVLEGIRQMRSSGDAPVDSMGCDKAGSFLPPSERRFAVLLGS  175

Query  542  LLSS  553
            LLSS
Sbjct  176  LLSS  179



>gb|KEH30313.1| EndoIII-related endonuclease [Medicago truncatula]
Length=381

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 90/150 (60%), Gaps = 26/150 (17%)
 Frame = +2

Query  161  SGDSAAE-LRVFIRRKRVKKAV---------EIVANEIEKESPNKKVLGLPDIEDFSYR-  307
            SG SA++ + V++RR +  K +         ++  N+    +   K  GLP+IEDF+Y+ 
Sbjct  42   SGASASQPVHVYVRRNKKAKGITTTTTTNMTKLQQNQHLPSTQTHKKFGLPEIEDFAYKG  101

Query  308  --------KDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAP  463
                    K  ++   TP   E       ++ +  +++ P +WE+ LEGI KMR S DAP
Sbjct  102  SNELTQCLKSEMSLDVTPTEIE-------VASTTHSIKSPAHWEETLEGIRKMRCSGDAP  154

Query  464  VDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            VD+MGCEKAGS+LPPKERRFAVLVSSLLSS
Sbjct  155  VDTMGCEKAGSTLPPKERRFAVLVSSLLSS  184



>gb|KJB71886.1| hypothetical protein B456_011G146700 [Gossypium raimondii]
Length=294

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 69/95 (73%), Gaps = 3/95 (3%)
 Frame = +2

Query  278  LPDIEDFSYRKDAINSQSTPVSSEC---MIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRS  448
            LPDIE+F+Y+K    ++S  + S C    +G  + S      + P NWEKVLEGI KMRS
Sbjct  6    LPDIEEFAYKKVDGPARSGKLKSACDELNVGVSIASPIGVGGKAPANWEKVLEGIRKMRS  65

Query  449  SEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
             EDAPVD+MGCEKAGS LPPKERRFAVLVSSLLSS
Sbjct  66   LEDAPVDTMGCEKAGSVLPPKERRFAVLVSSLLSS  100



>ref|XP_009132791.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X7 [Brassica rapa]
Length=371

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 86/123 (70%), Gaps = 14/123 (11%)
 Frame = +2

Query  188  VFIRRKRVKK-AVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGK  364
            V+ R+KR+K+ A+E     +EK+S    + GLPDIE+F+++K   N++S+  S+E  I  
Sbjct  66   VYTRKKRLKQEALE----PLEKKS----LCGLPDIEEFAFKK---NTRSSRRSTETNI--  112

Query  365  EVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSL  544
             V S       PP NW +VLEGI +MRSS DAPVDSMGC+KAGS LPP ERRFAVL+ SL
Sbjct  113  TVASAKTTAGNPPENWVEVLEGIRQMRSSGDAPVDSMGCDKAGSFLPPSERRFAVLLGSL  172

Query  545  LSS  553
            LSS
Sbjct  173  LSS  175



>emb|CDY23941.1| BnaC03g17500D [Brassica napus]
Length=389

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 98/147 (67%), Gaps = 19/147 (13%)
 Frame = +2

Query  152  ENPSGDS-AAELRVFIRRKRVKK-AVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINS  325
            E  +G S ++E  V+ R+KR+K+ A+E     +EK+S  +++ GLPDIE+F+++K+  +S
Sbjct  54   ETANGASGSSETLVYTRKKRLKQEALE----PLEKKS--QQLCGLPDIEEFAFKKNTRSS  107

Query  326  Q-STPVSSECMIGKEVLSLSQKTV----------QPPPNWEKVLEGIHKMRSSEDAPVDS  472
            + ST  ++  +       +S +T+           PP NW +VLEGI +MRSS DAPVDS
Sbjct  108  KRSTTETNISVASASTAGMSTETIITPTSTKTAGSPPENWVQVLEGIRQMRSSGDAPVDS  167

Query  473  MGCEKAGSSLPPKERRFAVLVSSLLSS  553
            MGC+KAGS LPP ERRFAVL+ SLLSS
Sbjct  168  MGCDKAGSFLPPLERRFAVLLGSLLSS  194



>ref|XP_006410282.1| hypothetical protein EUTSA_v10016815mg [Eutrema salsugineum]
 gb|ESQ51735.1| hypothetical protein EUTSA_v10016815mg [Eutrema salsugineum]
Length=373

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 85/131 (65%), Gaps = 10/131 (8%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKAVEIVANEIEKES---PNKKVLGLPDIEDFSYRKDAINSQSTPV  340
            S +E RV+ R+KR+K+        +EK+S     K++  LPDIE+F+Y+K+  +S S   
Sbjct  55   SGSETRVYTRKKRLKQEA---FQPLEKDSCINTQKQLCRLPDIEEFAYKKNTRSSSSRRS  111

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            +   +    V +        P NW KVLEGI +MRSSEDAPVDSMGC+KAGS LPP ERR
Sbjct  112  TETSITVTSVKTAGNA----PENWVKVLEGIRQMRSSEDAPVDSMGCDKAGSFLPPTERR  167

Query  521  FAVLVSSLLSS  553
            FAVL+ +LLSS
Sbjct  168  FAVLLGALLSS  178



>ref|XP_009132787.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X3 [Brassica rapa]
Length=386

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 98/147 (67%), Gaps = 21/147 (14%)
 Frame = +2

Query  155  NP-SGDS-AAELRVFIRRKRVKK-AVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINS  325
            NP SG S ++E  V+ R+KR+K+ A+E     +EK+S   ++ GLPDIE+F+++K+  +S
Sbjct  51   NPASGASGSSETLVYTRKKRLKQEALE----PLEKKS---QLCGLPDIEEFAFKKNTRSS  103

Query  326  Q-----STPVSSECMIGK----EVLSLSQKTV--QPPPNWEKVLEGIHKMRSSEDAPVDS  472
            +     +  V+S    G+     +   S KT    PP NW +VLEGI +MRSS DAPVDS
Sbjct  104  KRSTETNITVASASTAGRSTETNITVASAKTTAGNPPENWVEVLEGIRQMRSSGDAPVDS  163

Query  473  MGCEKAGSSLPPKERRFAVLVSSLLSS  553
            MGC+KAGS LPP ERRFAVL+ SLLSS
Sbjct  164  MGCDKAGSFLPPSERRFAVLLGSLLSS  190



>ref|XP_010510194.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=385

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 91/135 (67%), Gaps = 15/135 (11%)
 Frame = +2

Query  170  SAAELRVFIRRKRVKKA-VEIVANEIEKESPNKKVLGLPDIEDFSYRKD-----AINSQS  331
            S +E RV+ R+KR+K+  +E +  +    + +K++ GLPDIEDF+Y+K+     +I +  
Sbjct  63   SGSETRVYTRKKRLKQEPLEPLPRK--GVNTHKQLRGLPDIEDFAYKKNVASPSSIFAGR  120

Query  332  TPVSSECMIGKEVLSLSQKTV-QPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
            +P +S   +       S KTV   P NW +VLEGI +MRS EDAPVDSMGC+KAGS LPP
Sbjct  121  SPETSITAV------TSVKTVGNSPDNWVEVLEGIRQMRSYEDAPVDSMGCDKAGSFLPP  174

Query  509  KERRFAVLVSSLLSS  553
             ERRFAVL+ +LLSS
Sbjct  175  TERRFAVLLGALLSS  189



>ref|XP_004507328.1| PREDICTED: endonuclease III-like protein 1-like [Cicer arietinum]
Length=387

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 7/104 (7%)
 Frame = +2

Query  260  NKKVLGLPDIEDFSYR--KDAINSQSTPVSSECMIG----KEVLSLSQKTVQPPPNWEKV  421
            +KK  GLP+IEDF+YR   +    + + +SS+ ++      EV S + ++ + P +WE+ 
Sbjct  88   HKKFGGLPEIEDFAYRGPNELTQFRKSEISSDVIVKPAEESEVASAAHRS-ESPADWEET  146

Query  422  LEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            LEGI KMR S DAPVD+MGCEKAGS+LPPKERRFAVLVSSLLSS
Sbjct  147  LEGIRKMRCSADAPVDTMGCEKAGSTLPPKERRFAVLVSSLLSS  190



>ref|XP_009629859.1| PREDICTED: endonuclease III homolog 1, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03183}-like 
isoform X3 [Nicotiana tomentosiformis]
Length=316

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 21/130 (16%)
 Frame = +2

Query  167  DSAAELRVFIRRKRVKKA-VEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVS  343
            +S +E+   + + RVKK  VE++  E++ ESP++K L  P+IEDF+ +   INSQS    
Sbjct  12   NSGSEVVGVVPKNRVKKRRVEMIVKEVKTESPDQKFLRHPEIEDFANKSSNINSQS----  67

Query  344  SECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRF  523
                            +QPP NWE+V+EGI KMRSSE APVDS+  ++  +SL PKERRF
Sbjct  68   ----------------IQPPANWERVIEGIRKMRSSEHAPVDSIDPDEGVTSLQPKERRF  111

Query  524  AVLVSSLLSS  553
            AVL+ SLLSS
Sbjct  112  AVLIGSLLSS  121



>ref|XP_009132785.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X1 [Brassica rapa]
Length=388

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 90/134 (67%), Gaps = 19/134 (14%)
 Frame = +2

Query  188  VFIRRKRVKK-AVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQ-----STPVSSE  349
            V+ R+KR+K+ A+E     +EK+S   ++ GLPDIE+F+++K+  +S+     +  V+S 
Sbjct  66   VYTRKKRLKQEALE----PLEKKS---QLCGLPDIEEFAFKKNTRSSKRSTETNITVASA  118

Query  350  CMIGK----EVLSLSQKTV--QPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPK  511
               G+     +   S KT    PP NW +VLEGI +MRSS DAPVDSMGC+KAGS LPP 
Sbjct  119  STAGRSTETNITVASAKTTAGNPPENWVEVLEGIRQMRSSGDAPVDSMGCDKAGSFLPPS  178

Query  512  ERRFAVLVSSLLSS  553
            ERRFAVL+ SLLSS
Sbjct  179  ERRFAVLLGSLLSS  192



>ref|XP_009799825.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X2 [Nicotiana sylvestris]
Length=345

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 99/182 (54%), Gaps = 33/182 (18%)
 Frame = +2

Query  11   MSLPLLKWTLSPLVAPAPCVPARIIFCSKMsrtprrtppsnpnpGSQENPSGDSAAELRV  190
            MSL LL+ T  P +  A  +P +  F S       R                DS +E+  
Sbjct  1    MSLSLLRHT--PYLTSAVPLPIQYFFISLTKMPKTRLSTMRQ----------DSGSEVGG  48

Query  191  FIRRKRVKK-AVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKE  367
             + + RV+K +VE++A E++ ESP++K L  P+IEDF+     I SQS            
Sbjct  49   VVPKNRVRKRSVEMIAKEVKTESPDQKFLRHPEIEDFANNSGNIYSQS------------  96

Query  368  VLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLL  547
                    +QPP NWE+V+EGI +MRSSE APVDS+  ++  +SL PKERRFAVLV SLL
Sbjct  97   --------IQPPANWERVIEGIRRMRSSEHAPVDSIDPDEGVTSLQPKERRFAVLVGSLL  148

Query  548  SS  553
            SS
Sbjct  149  SS  150



>ref|XP_009132786.1| PREDICTED: endonuclease III homolog 1, chloroplastic isoform 
X2 [Brassica rapa]
Length=387

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 89/134 (66%), Gaps = 20/134 (15%)
 Frame = +2

Query  188  VFIRRKRVKK-AVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQ-----STPVSSE  349
            V+ R+KR+K+ A+E     +EK+S    + GLPDIE+F+++K+  +S+     +  V+S 
Sbjct  66   VYTRKKRLKQEALE----PLEKKS----LCGLPDIEEFAFKKNTRSSKRSTETNITVASA  117

Query  350  CMIGK----EVLSLSQKTV--QPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPK  511
               G+     +   S KT    PP NW +VLEGI +MRSS DAPVDSMGC+KAGS LPP 
Sbjct  118  STAGRSTETNITVASAKTTAGNPPENWVEVLEGIRQMRSSGDAPVDSMGCDKAGSFLPPS  177

Query  512  ERRFAVLVSSLLSS  553
            ERRFAVL+ SLLSS
Sbjct  178  ERRFAVLLGSLLSS  191



>ref|XP_009393784.1| PREDICTED: endonuclease III homolog 2, chloroplastic-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=292

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 88/138 (64%), Gaps = 4/138 (3%)
 Frame = +2

Query  152  ENPSGDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQS  331
            E P G S  E R  +R+KRVK+ VEI     ++E+ ++KV  L DIEDF+Y K  +++ S
Sbjct  56   ECPGGVSDREKRAHLRKKRVKRIVEIDEKRAKEEAADRKVCDLIDIEDFAYDKVNLSAIS  115

Query  332  TPVSSECMIGKEVLSLSQKTVQP----PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSS  499
              V+ +          +  T +P    P NWE+VL+GI KMR ++ APV++M  EK+ S 
Sbjct  116  NDVNLDSSFPASKRKSTHLTDEPKADAPANWEEVLDGIRKMRFADGAPVETMRHEKSASL  175

Query  500  LPPKERRFAVLVSSLLSS  553
            +PPKE+RFAVL+SSLLSS
Sbjct  176  VPPKEQRFAVLISSLLSS  193



>ref|XP_009393783.1| PREDICTED: endonuclease III homolog 2, chloroplastic-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=384

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 88/138 (64%), Gaps = 4/138 (3%)
 Frame = +2

Query  152  ENPSGDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQS  331
            E P G S  E R  +R+KRVK+ VEI     ++E+ ++KV  L DIEDF+Y K  +++ S
Sbjct  56   ECPGGVSDREKRAHLRKKRVKRIVEIDEKRAKEEAADRKVCDLIDIEDFAYDKVNLSAIS  115

Query  332  TPVSSECMIGKEVLSLSQKTVQP----PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSS  499
              V+ +          +  T +P    P NWE+VL+GI KMR ++ APV++M  EK+ S 
Sbjct  116  NDVNLDSSFPASKRKSTHLTDEPKADAPANWEEVLDGIRKMRFADGAPVETMRHEKSASL  175

Query  500  LPPKERRFAVLVSSLLSS  553
            +PPKE+RFAVL+SSLLSS
Sbjct  176  VPPKEQRFAVLISSLLSS  193



>ref|XP_009799824.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X1 [Nicotiana sylvestris]
Length=353

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 101/182 (55%), Gaps = 25/182 (14%)
 Frame = +2

Query  11   MSLPLLKWTLSPLVAPAPCVPARIIFCSKMsrtprrtppsnpnpGSQENPSGDSAAELRV  190
            MSL LL+ T  P +  A  +P +  F S       R      + G+ +       +E+  
Sbjct  1    MSLSLLRHT--PYLTSAVPLPIQYFFISLTKMPKTRLSTMRQDSGAPKFQL--KCSEVGG  56

Query  191  FIRRKRVKK-AVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKE  367
             + + RV+K +VE++A E++ ESP++K L  P+IEDF+     I SQS            
Sbjct  57   VVPKNRVRKRSVEMIAKEVKTESPDQKFLRHPEIEDFANNSGNIYSQS------------  104

Query  368  VLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLL  547
                    +QPP NWE+V+EGI +MRSSE APVDS+  ++  +SL PKERRFAVLV SLL
Sbjct  105  --------IQPPANWERVIEGIRRMRSSEHAPVDSIDPDEGVTSLQPKERRFAVLVGSLL  156

Query  548  SS  553
            SS
Sbjct  157  SS  158



>ref|XP_008453986.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like [Cucumis 
melo]
Length=386

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 90/149 (60%), Gaps = 28/149 (19%)
 Frame = +2

Query  161  SGDSAAELRVFIRRKRVKKAVEIVANEIEKESP-NKKVLGLPDIEDFSYR--KDAINSQ-  328
            +G S  E RVF+RR RVKK  E   +  E E   + K    P+IEDF+++  KD+  S+ 
Sbjct  53   NGVSEPETRVFVRR-RVKKIAESQDSGFEVEPKIDTKRSCPPNIEDFAFKRTKDSPGSRE  111

Query  329  --------------STPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPV  466
                          STP + +   G+          +PP NWEKVL+GI +MRSSE+APV
Sbjct  112  SKPPPDLLLNGIEGSTPTTHKGNAGRG---------KPPENWEKVLKGIREMRSSEEAPV  162

Query  467  DSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            D+MGC +AGS+LPPKERRFAVL SSLLSS
Sbjct  163  DTMGCGRAGSTLPPKERRFAVLASSLLSS  191



>gb|KGN53073.1| hypothetical protein Csa_4G015140 [Cucumis sativus]
Length=358

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 88/145 (61%), Gaps = 10/145 (7%)
 Frame = +2

Query  146  SQENPSGDSAAELRVFIRRKRVKKAVEIVANEIEKESP-NKKVLGLPDIEDFSYRKDAIN  322
            S ++ +G S  E RVF+RR RVKK  E   +  E E   + K    P+IEDF++++   +
Sbjct  48   SVKSSNGVSEPETRVFVRR-RVKKIAESQDSGFEVEPKIDTKRSCPPNIEDFAFKRTKDS  106

Query  323  SQSTPVSSECMIGKEVLSLSQKTVQ--------PPPNWEKVLEGIHKMRSSEDAPVDSMG  478
              S  +     +    +  S  T          PP NWEKVL+GI +MRSSE+APVD+MG
Sbjct  107  PGSRKLKPPLDLLLNGIEDSNPTTHKGKAERGKPPVNWEKVLKGIREMRSSEEAPVDTMG  166

Query  479  CEKAGSSLPPKERRFAVLVSSLLSS  553
            C +AGS+LPPKERRFAVL SSLLSS
Sbjct  167  CGRAGSTLPPKERRFAVLASSLLSS  191



>ref|XP_004152104.1| PREDICTED: endonuclease III-like protein 1-like [Cucumis sativus]
 ref|XP_004167541.1| PREDICTED: endonuclease III-like protein 1-like [Cucumis sativus]
Length=386

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 85/140 (61%), Gaps = 10/140 (7%)
 Frame = +2

Query  161  SGDSAAELRVFIRRKRVKKAVEIVANEIEKESP-NKKVLGLPDIEDFSYRKDAINSQSTP  337
            +G S  E RVF+RR RVKK  E   +  E E   + K    P+IEDF++++   +  S  
Sbjct  53   NGVSEPETRVFVRR-RVKKIAESQDSGFEVEPKIDTKRSCPPNIEDFAFKRTKDSPGSRK  111

Query  338  VSSECMIGKEVLSLSQKTVQ--------PPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG  493
            +     +    +  S  T          PP NWEKVL+GI +MRSSE+APVD+MGC +AG
Sbjct  112  LKPPLDLLLNGIEDSNPTTHKGKAERGKPPVNWEKVLKGIREMRSSEEAPVDTMGCGRAG  171

Query  494  SSLPPKERRFAVLVSSLLSS  553
            S+LPPKERRFAVL SSLLSS
Sbjct  172  STLPPKERRFAVLASSLLSS  191



>ref|XP_006845160.1| hypothetical protein AMTR_s00005p00230200 [Amborella trichopoda]
 gb|ERN06835.1| hypothetical protein AMTR_s00005p00230200 [Amborella trichopoda]
Length=354

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 28/144 (19%)
 Frame = +2

Query  188  VFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK---------------DAIN  322
            V++R+KR+K   EI  N   +         LPDIEDFSY K               D ++
Sbjct  29   VYVRKKRLKSTTEITPNSKTEHG------SLPDIEDFSYGKIEATFGQKRGKLEASDHLS  82

Query  323  S---QSTPVSSECMIGKEVLSLSQK----TVQPPPNWEKVLEGIHKMRSSEDAPVDSMGC  481
            S   +   ++ + M  + ++S+  K    TV+PP NWE+VL+GI  MR +++APVDS+GC
Sbjct  83   SAGKKKHTLTLQRMGAESIVSIKPKDICKTVEPPVNWEEVLKGIRDMRVAKEAPVDSVGC  142

Query  482  EKAGSSLPPKERRFAVLVSSLLSS  553
             +AGS LPPKERRF+VLV SLLSS
Sbjct  143  GRAGSFLPPKERRFSVLVGSLLSS  166



>ref|XP_002442817.1| hypothetical protein SORBIDRAFT_08g003320 [Sorghum bicolor]
 gb|EES16655.1| hypothetical protein SORBIDRAFT_08g003320 [Sorghum bicolor]
Length=367

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 77/122 (63%), Gaps = 8/122 (7%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVLGL-PDIEDFSYRK-DAINSQSTPVSSECMIGKE  367
            ++RKRVK+ +E+          +KK  G+ PDIEDF Y K   + + S   +S   + K+
Sbjct  60   VKRKRVKRELELNGEH------HKKQFGVVPDIEDFRYEKAKTLTASSKATASSVKVEKK  113

Query  368  VLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLL  547
            V   S   V  P NWE VL GI  MR S +APVD+ GCEKAGS LPPKERRFAVL+S+++
Sbjct  114  VRVSSVIKVGAPDNWEAVLGGIKSMRLSGEAPVDTKGCEKAGSLLPPKERRFAVLISTMM  173

Query  548  SS  553
            SS
Sbjct  174  SS  175



>ref|NP_001176473.1| Os11g0267300 [Oryza sativa Japonica Group]
 dbj|BAH95201.1| Os11g0267300 [Oryza sativa Japonica Group]
Length=199

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 76/120 (63%), Gaps = 13/120 (11%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVL  373
            +R K VK+ +E+    I+KE     V  +PDIEDF Y K      ++P  S   + K+V 
Sbjct  64   MRSKNVKRVLEVTGENIKKE-----VDIVPDIEDFRYGK------ASP--SLVRLEKKVR  110

Query  374  SLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
              S   V  P NWE +L+GI  MR S +APVD+ GCEKAGS LPPKERRFAVL+S+++SS
Sbjct  111  VSSAIKVGAPENWEAILKGIKNMRLSGEAPVDTKGCEKAGSLLPPKERRFAVLISTMMSS  170



>ref|XP_009629860.1| PREDICTED: endonuclease III homolog 1, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03183}-like 
isoform X4 [Nicotiana tomentosiformis]
Length=284

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 20/109 (18%)
 Frame = +2

Query  227  IVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVLSLSQKTVQPPP  406
            ++  E++ ESP++K L  P+IEDF+ +   INSQS                    +QPP 
Sbjct  1    MIVKEVKTESPDQKFLRHPEIEDFANKSSNINSQS--------------------IQPPA  40

Query  407  NWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            NWE+V+EGI KMRSSE APVDS+  ++  +SL PKERRFAVL+ SLLSS
Sbjct  41   NWERVIEGIRKMRSSEHAPVDSIDPDEGVTSLQPKERRFAVLIGSLLSS  89



>ref|NP_563752.1| endonuclease III 2 [Arabidopsis thaliana]
 gb|AAK95254.1|AF410268_1 At1g05900/T20M3_15 [Arabidopsis thaliana]
 gb|AAN28799.1| At1g05900/T20M3_15 [Arabidopsis thaliana]
 gb|AEE27915.1| endonuclease III [Arabidopsis thaliana]
Length=314

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 87/144 (60%), Gaps = 8/144 (6%)
 Frame = +2

Query  146  SQENPSGDSAAELRVFIRRKRVKKA-VEIVANEIEKESPNKK-VLGLPDIEDFSYRKDAI  319
            + E   G S +E RV +R+KR+K+  +E V     +E+  +K + GLPDIED  Y+K   
Sbjct  48   NSEAAHGASESETRVSLRKKRIKQDDLEPVKKCSARETKARKDMCGLPDIEDSPYKKTNG  107

Query  320  NSQSTPVSSECMIGKEVLSLSQKTVQ------PPPNWEKVLEGIHKMRSSEDAPVDSMGC  481
             + S        I     S S  +++      PP NWEKVLEGI KM+ SE+APV+++ C
Sbjct  108  TASSRTRKLNSYIKSTEASPSASSIKTAGLGIPPENWEKVLEGIRKMKPSEEAPVNAVEC  167

Query  482  EKAGSSLPPKERRFAVLVSSLLSS  553
            ++ GS LPPKERRF VL+ +LLSS
Sbjct  168  DRTGSFLPPKERRFYVLIGTLLSS  191



>gb|ACG42926.1| endonuclease III-like protein 1 [Zea mays]
Length=364

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 77/126 (61%), Gaps = 9/126 (7%)
 Frame = +2

Query  179  ELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK-DAINSQSTPVSSECM  355
            E  V ++R+RV + +E+     +K+        +PDIEDF Y K   + S S   +S   
Sbjct  55   EATVSVKRRRVNRELEVNGQHHKKQ--------VPDIEDFIYEKAKTLTSSSKATTSLVK  106

Query  356  IGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLV  535
            + K+V   S   V  P NWE VL GI  MR S +APVD+ GCEKAGS LPPKERRFAVL+
Sbjct  107  VEKKVGVSSVIKVGAPDNWEAVLGGIKSMRLSGEAPVDTKGCEKAGSLLPPKERRFAVLI  166

Query  536  SSLLSS  553
            S+++SS
Sbjct  167  STMMSS  172



>emb|CDY06185.1| BnaA09g50180D [Brassica napus]
Length=376

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 87/135 (64%), Gaps = 11/135 (8%)
 Frame = +2

Query  164  GDSAAELRVF-IRRKRVKKAVEIVANEIEKESPNKKVLG-LPDIEDFSYRKDAINSQSTP  337
            G S +E RV  +RRKR+K+ V      ++  S +K++ G LPDIED SY+K  ++ + + 
Sbjct  53   GASGSETRVSPLRRKRLKQEV------LDSSSSHKEMCGVLPDIEDLSYKKTNVSPRESK  106

Query  338  VSSECMIGKEVLSLS---QKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
            ++S     +   S S   +   +PP NWEKVLEGI KMRS E+A VD + C++ GS LPP
Sbjct  107  LNSYVKSTEASTSASSSIRTAGKPPENWEKVLEGIRKMRSPEEATVDPVNCDRTGSFLPP  166

Query  509  KERRFAVLVSSLLSS  553
            KERRF VL+ +LLSS
Sbjct  167  KERRFYVLIGTLLSS  181



>ref|NP_973767.1| endonuclease III 2 [Arabidopsis thaliana]
 sp|B9DFZ0.1|NTH2_ARATH RecName: Full=Endonuclease III homolog 2, chloroplastic; Short=AtNTH2; 
AltName: Full=Bifunctional DNA N-glycoslyase/DNA-(apurinic 
or apyrimidinic site) lyase 2; Short=DNA glycoslyase/AP 
lyase 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAH19657.1| AT1G05900 [Arabidopsis thaliana]
 gb|AEE27916.1| endonuclease III [Arabidopsis thaliana]
Length=386

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 86/142 (61%), Gaps = 8/142 (6%)
 Frame = +2

Query  152  ENPSGDSAAELRVFIRRKRVKKA-VEIVANEIEKESPNKK-VLGLPDIEDFSYRKDAINS  325
            E   G S +E RV +R+KR+K+  +E V     +E+  +K + GLPDIED  Y+K    +
Sbjct  50   EAAHGASESETRVSLRKKRIKQDDLEPVKKCSARETKARKDMCGLPDIEDSPYKKTNGTA  109

Query  326  QSTPVSSECMIGKEVLSLSQKTVQ------PPPNWEKVLEGIHKMRSSEDAPVDSMGCEK  487
             S        I     S S  +++      PP NWEKVLEGI KM+ SE+APV+++ C++
Sbjct  110  SSRTRKLNSYIKSTEASPSASSIKTAGLGIPPENWEKVLEGIRKMKPSEEAPVNAVECDR  169

Query  488  AGSSLPPKERRFAVLVSSLLSS  553
             GS LPPKERRF VL+ +LLSS
Sbjct  170  TGSFLPPKERRFYVLIGTLLSS  191



>gb|AAF29397.1|AC009999_17 Contains similarity to an endonuclease III homolog from Homo 
sapiens gb|U81285, and contains an Endonuclease III PF|00730 
domain [Arabidopsis thaliana]
Length=402

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 86/142 (61%), Gaps = 8/142 (6%)
 Frame = +2

Query  152  ENPSGDSAAELRVFIRRKRVKKA-VEIVANEIEKESPNKK-VLGLPDIEDFSYRKDAINS  325
            E   G S +E RV +R+KR+K+  +E V     +E+  +K + GLPDIED  Y+K    +
Sbjct  50   EAAHGASESETRVSLRKKRIKQDDLEPVKKCSARETKARKDMCGLPDIEDSPYKKTNGTA  109

Query  326  QSTPVSSECMIGKEVLSLSQKTVQ------PPPNWEKVLEGIHKMRSSEDAPVDSMGCEK  487
             S        I     S S  +++      PP NWEKVLEGI KM+ SE+APV+++ C++
Sbjct  110  SSRTRKLNSYIKSTEASPSASSIKTAGLGIPPENWEKVLEGIRKMKPSEEAPVNAVECDR  169

Query  488  AGSSLPPKERRFAVLVSSLLSS  553
             GS LPPKERRF VL+ +LLSS
Sbjct  170  TGSFLPPKERRFYVLIGTLLSS  191



>ref|XP_002889575.1| hypothetical protein ARALYDRAFT_470604 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65834.1| hypothetical protein ARALYDRAFT_470604 [Arabidopsis lyrata subsp. 
lyrata]
Length=384

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = +2

Query  164  GDSAAELRVFIRRKRVKKAVEIVANEIEKESPN--KKVLGLPDIEDFSYRKDAINSQSTP  337
            G S +E RV +R+KR+K+       +      N  K++ GLPDIE+  Y+K   ++ S  
Sbjct  57   GTSESETRVSLRKKRLKQEDLEPVQQCSSRGINARKEMCGLPDIEESPYKKTNGSASSRT  116

Query  338  VSSECMIGKEVLSLSQKTVQ-PPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKE  514
                  I     S S KT   PP NW+KVLEGI KM+SSE+AP +++ C++ GS LPPKE
Sbjct  117  SKINSFIKSTEASTSIKTAGIPPENWKKVLEGIQKMKSSEEAPANAVECDRTGSFLPPKE  176

Query  515  RRFAVLVSSLLSS  553
            RRF VL+ +LLSS
Sbjct  177  RRFYVLIGTLLSS  189



>ref|XP_009118569.1| PREDICTED: endonuclease III homolog 2, chloroplastic [Brassica 
rapa]
Length=376

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 87/135 (64%), Gaps = 11/135 (8%)
 Frame = +2

Query  164  GDSAAELRVF-IRRKRVKKAVEIVANEIEKESPNKKVLG-LPDIEDFSYRKDAINSQSTP  337
            G S +E RV  +RRKR+K+ V      ++  S +K++ G LPDIED SY+K  ++ +++ 
Sbjct  53   GASGSETRVSPLRRKRLKQEV------LDSSSSHKEMCGVLPDIEDLSYKKTNVSPRTSK  106

Query  338  VSSECMIGKEVLSLS---QKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
            ++S     +   S S   +   +PP NWEKVLEGI KM S E+A VD + C++ GS LPP
Sbjct  107  LNSYVKSTEASTSASSSIRTAGKPPENWEKVLEGIRKMSSPEEATVDPVNCDRTGSFLPP  166

Query  509  KERRFAVLVSSLLSS  553
            KERRF VL+ +LLSS
Sbjct  167  KERRFYVLIGTLLSS  181



>ref|XP_004979149.1| PREDICTED: endonuclease III-like protein 1-like isoform X1 [Setaria 
italica]
Length=368

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 77/124 (62%), Gaps = 9/124 (7%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAIN---SQSTP-VSSECMIG  361
            ++RKRVK+ +E        E P K+   +PDIEDF Y K   +   S++TP +     + 
Sbjct  58   VKRKRVKQELEE-----NGEHPKKQAGIVPDIEDFRYDKTKASTSSSKATPALDKNIKVE  112

Query  362  KEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSS  541
            K+V   S   V  P NWE VL GI  MR S  APVD+ GCEKAGS LPPKERRFAVL+S+
Sbjct  113  KKVRVSSVIKVGAPENWEAVLGGIKNMRLSGQAPVDTKGCEKAGSLLPPKERRFAVLIST  172

Query  542  LLSS  553
            ++SS
Sbjct  173  MMSS  176



>ref|XP_004979150.1| PREDICTED: endonuclease III-like protein 1-like isoform X2 [Setaria 
italica]
Length=358

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 73/120 (61%), Gaps = 11/120 (9%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVL  373
            ++RKRVK+ +E        E P K+   +PDIEDF Y K   ++ S  V       K+V 
Sbjct  58   VKRKRVKQELEE-----NGEHPKKQAGIVPDIEDFRYDKTKASTSSIKVE------KKVR  106

Query  374  SLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
              S   V  P NWE VL GI  MR S  APVD+ GCEKAGS LPPKERRFAVL+S+++SS
Sbjct  107  VSSVIKVGAPENWEAVLGGIKNMRLSGQAPVDTKGCEKAGSLLPPKERRFAVLISTMMSS  166



>gb|AAX96284.1| endonuclease III homologue [Oryza sativa Japonica Group]
 gb|AAX96333.1| endonuclease III homologue [Oryza sativa Japonica Group]
 gb|EEC67986.1| hypothetical protein OsI_35754 [Oryza sativa Indica Group]
 gb|EEE51951.1| hypothetical protein OsJ_33589 [Oryza sativa Japonica Group]
Length=373

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 76/120 (63%), Gaps = 13/120 (11%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVL  373
            +R K VK+ +E+    I+KE     V  +PDIEDF Y K      ++P  S   + K+V 
Sbjct  64   MRSKNVKRVLEVTGENIKKE-----VDIVPDIEDFRYGK------ASP--SLVRLEKKVR  110

Query  374  SLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
              S   V  P NWE +L+GI  MR S +APVD+ GCEKAGS LPPKERRFAVL+S+++SS
Sbjct  111  VSSAIKVGAPENWEAILKGIKNMRLSGEAPVDTKGCEKAGSLLPPKERRFAVLISTMMSS  170



>ref|XP_010097514.1| Histone-lysine N-methyltransferase ASHH3 [Morus notabilis]
 gb|EXB68705.1| Histone-lysine N-methyltransferase ASHH3 [Morus notabilis]
Length=535

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 83/134 (62%), Gaps = 11/134 (8%)
 Frame = +2

Query  152  ENPSGDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQS  331
            E+ +G S  ELRVF R+KR+K+ ++  A  +EK S       LPDIE+F+Y+K + ++ S
Sbjct  217  ESSNGVSVPELRVFSRKKRLKETIQ--AKPLEKSSV------LPDIEEFAYKKASGSASS  268

Query  332  TP---VSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSL  502
                 VS   +   EV  L +   +PP NWEKVLEGI KMRSSEDAPVD+MGCEKAG  L
Sbjct  269  KKSQDVSDVFVAEAEVSPLVRPRDEPPANWEKVLEGIRKMRSSEDAPVDTMGCEKAGILL  328

Query  503  PPKERRFAVLVSSL  544
            PPK   +      L
Sbjct  329  PPKAGEYTFTFVYL  342



>gb|ABA92590.2| Endonuclease III-like protein 1, putative, expressed [Oryza sativa 
Japonica Group]
Length=362

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 76/120 (63%), Gaps = 13/120 (11%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVL  373
            +R K VK+ +E+    I+KE     V  +PDIEDF Y K      ++P  S   + K+V 
Sbjct  64   MRSKNVKRVLEVTGENIKKE-----VDIVPDIEDFRYGK------ASP--SLVRLEKKVR  110

Query  374  SLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
              S   V  P NWE +L+GI  MR S +APVD+ GCEKAGS LPPKERRFAVL+S+++SS
Sbjct  111  VSSAIKVGAPENWEAILKGIKNMRLSGEAPVDTKGCEKAGSLLPPKERRFAVLISTMMSS  170



>gb|ACF82727.1| unknown [Zea mays]
Length=352

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 80/130 (62%), Gaps = 13/130 (10%)
 Frame = +2

Query  179  ELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK-DAINSQSTPVSSECM  355
            E  V ++R+RVK+ +E+     +K+        +PDIEDF Y K   + S S   +S   
Sbjct  39   EATVSVKRRRVKRELEVNGQHHKKQ--------VPDIEDFIYEKAKTLTSSSKATTSLVK  90

Query  356  IGKEV-LSLSQKT---VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRF  523
            + K+V +S   K    V  P NWE VL GI  MR S +APVD+ GCEKAGS LPPKERRF
Sbjct  91   VEKKVGVSSVIKVICAVGAPDNWEAVLGGIKSMRLSGEAPVDTKGCEKAGSLLPPKERRF  150

Query  524  AVLVSSLLSS  553
            AVL+S+++SS
Sbjct  151  AVLISTMMSS  160



>ref|XP_006417973.1| hypothetical protein EUTSA_v10007955mg [Eutrema salsugineum]
 gb|ESQ36326.1| hypothetical protein EUTSA_v10007955mg [Eutrema salsugineum]
Length=374

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 83/144 (58%), Gaps = 17/144 (12%)
 Frame = +2

Query  152  ENPSGDSAAELRVF-IRRKRVKKAVEIVANEIEKESPNKK-VLGLPDIEDFSYRKDAINS  325
            E  +  S +E RV  +R+KR+K+        +E    N + V GLPDIE+ SY+K    +
Sbjct  42   EAANATSDSESRVSSLRKKRLKQED---LQPVENRGINARDVCGLPDIEELSYKK----T  94

Query  326  QSTPVSSECMIGKEVLSLSQKTV--------QPPPNWEKVLEGIHKMRSSEDAPVDSMGC  481
              +P S    +   V S    T         +PP NWE+VLEGI KMRSSE+A VD + C
Sbjct  95   NGSPSSGTSKLNSHVNSAETSTAASLIKTAGRPPENWEQVLEGIQKMRSSEEATVDPVNC  154

Query  482  EKAGSSLPPKERRFAVLVSSLLSS  553
            ++ GS LPPKERRF VL+ +LLSS
Sbjct  155  DRTGSFLPPKERRFYVLIGTLLSS  178



>ref|XP_008662471.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like [Zea 
mays]
Length=368

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 80/130 (62%), Gaps = 13/130 (10%)
 Frame = +2

Query  179  ELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK-DAINSQSTPVSSECM  355
            E  V ++R+RVK+ +E+     +K+        +PDIEDF Y K   + S S   +S   
Sbjct  55   EATVSVKRRRVKRELEVNGQHHKKQ--------VPDIEDFIYEKAKTLTSSSKATTSLVK  106

Query  356  IGKEV-LSLSQKT---VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRF  523
            + K+V +S   K    V  P NWE VL GI  MR S +APVD+ GCEKAGS LPPKERRF
Sbjct  107  VEKKVGVSSVIKVICAVGAPDNWEAVLGGIKSMRLSGEAPVDTKGCEKAGSLLPPKERRF  166

Query  524  AVLVSSLLSS  553
            AVL+S+++SS
Sbjct  167  AVLISTMMSS  176



>ref|XP_010475313.1| PREDICTED: endonuclease III homolog 2, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=370

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 87/141 (62%), Gaps = 11/141 (8%)
 Frame = +2

Query  155  NP-SGDSAAELRVFIRRKRVKKAVEIVANEIEKES------PNKKVLGLPDIEDFSYRK-  310
            NP S DS + LR   R+KR+K   ++  + +EKES        K    LPDIED  Y+K 
Sbjct  38   NPRSDDSTSGLRASSRKKRLK---QVDLDPLEKESTRGINSARKDTFALPDIEDSPYKKT  94

Query  311  DAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA  490
            +   S  T   +  +   E  + ++ + +PP +WEKV+EGI KM+SSE+APVD++  ++ 
Sbjct  95   NGSASSRTSKLNSYIKSTEASTSAEISGKPPDHWEKVIEGIRKMKSSEEAPVDTVERDRT  154

Query  491  GSSLPPKERRFAVLVSSLLSS  553
            GS LPPKERRF VL+ +LLSS
Sbjct  155  GSFLPPKERRFYVLIGTLLSS  175



>gb|EMS45025.1| Endonuclease III-like protein 1 [Triticum urartu]
Length=413

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 20/133 (15%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSY----RKDAINSQSTPVSSE----  349
            + RKR+   +E+       E P K+V  +PD++DF Y     K A++++  P SS     
Sbjct  136  VERKRLNHVLEV-----NDEHP-KQVGAVPDMDDFRYVKTEAKTAVSTKRVPASSNKNSS  189

Query  350  -----CMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKE  514
                  ++  E L+LS +    P NWE VLEGI  +R S  APVD+ GCEKAGS LPPKE
Sbjct  190  PGVNFALMSYEKLTLS-RLQSAPENWEAVLEGIKNIRLSGQAPVDTKGCEKAGSLLPPKE  248

Query  515  RRFAVLVSSLLSS  553
            RRFAVL+S+++SS
Sbjct  249  RRFAVLISTMMSS  261



>ref|XP_010326700.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like [Solanum 
lycopersicum]
Length=340

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 22/114 (19%)
 Frame = +2

Query  212  KKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVLSLSQKT  391
            K+ VE++A E++ ESP+KK L  P+IEDF+   D + S+S                    
Sbjct  54   KRRVEMIAKEVKIESPDKKFLRHPEIEDFA--SDNVYSES--------------------  91

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            +QPP NWE+++EGI  MR SE APVDS+  ++  +SL PKERRFAVLV SLLSS
Sbjct  92   IQPPANWERIMEGIRSMRLSEHAPVDSIDPDEGVTSLQPKERRFAVLVGSLLSS  145



>ref|XP_006662906.1| PREDICTED: endonuclease III-like protein 1-like isoform X2 [Oryza 
brachyantha]
Length=350

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 77/120 (64%), Gaps = 13/120 (11%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVL  373
            ++RK VK+ +E+      +E+  KKV  +PDIEDF Y K      ++P  S   + K+V 
Sbjct  60   VKRKNVKRVLEVT-----EENLKKKVGIVPDIEDFRYGK------ASP--SLVRLEKKVR  106

Query  374  SLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
              S      P NWE +L+GI  MR S +APVD+ GCEKAGS LPPKERRFAVLVS+++SS
Sbjct  107  VSSVIKAGAPENWEAILKGIKNMRLSGEAPVDTKGCEKAGSLLPPKERRFAVLVSTMMSS  166



>ref|XP_006662905.1| PREDICTED: endonuclease III-like protein 1-like isoform X1 [Oryza 
brachyantha]
Length=358

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 77/120 (64%), Gaps = 13/120 (11%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVL  373
            ++RK VK+ +E+      +E+  KKV  +PDIEDF Y K      ++P  S   + K+V 
Sbjct  60   VKRKNVKRVLEVT-----EENLKKKVGIVPDIEDFRYGK------ASP--SLVRLEKKVR  106

Query  374  SLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
              S      P NWE +L+GI  MR S +APVD+ GCEKAGS LPPKERRFAVLVS+++SS
Sbjct  107  VSSVIKAGAPENWEAILKGIKNMRLSGEAPVDTKGCEKAGSLLPPKERRFAVLVSTMMSS  166



>ref|XP_010237763.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X2 [Brachypodium distachyon]
Length=315

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 79/124 (64%), Gaps = 10/124 (8%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK----DAINSQSTPVSSECMIG  361
            ++RK++ + +E+       E P K+V  +PDIEDF Y K     +I++   P SS   + 
Sbjct  4    MKRKKLSRVLEL-----NGEHPKKEVDIVPDIEDFRYDKIKAEASISTDGVPASS-IRLE  57

Query  362  KEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSS  541
            K+V   S   V  P NWE VL GI  MR S +APVD+ GCEKAGS LPPKERRFAVL+S+
Sbjct  58   KKVKVSSVLKVVAPENWEAVLGGIKSMRLSGEAPVDTKGCEKAGSLLPPKERRFAVLIST  117

Query  542  LLSS  553
            ++SS
Sbjct  118  MMSS  121



>ref|XP_003577617.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010237762.1| PREDICTED: endonuclease III homolog 1, chloroplastic-like isoform 
X1 [Brachypodium distachyon]
Length=370

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 79/124 (64%), Gaps = 10/124 (8%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK----DAINSQSTPVSSECMIG  361
            ++RK++ + +E+       E P K+V  +PDIEDF Y K     +I++   P SS   + 
Sbjct  59   MKRKKLSRVLEL-----NGEHPKKEVDIVPDIEDFRYDKIKAEASISTDGVPASS-IRLE  112

Query  362  KEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSS  541
            K+V   S   V  P NWE VL GI  MR S +APVD+ GCEKAGS LPPKERRFAVL+S+
Sbjct  113  KKVKVSSVLKVVAPENWEAVLGGIKSMRLSGEAPVDTKGCEKAGSLLPPKERRFAVLIST  172

Query  542  LLSS  553
            ++SS
Sbjct  173  MMSS  176



>gb|AFW56064.1| endonuclease III-like protein 1 [Zea mays]
Length=287

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +2

Query  272  LGLPDIEDFSYRK-DAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRS  448
            + +PDIEDF Y K   + S S   +S   + K+V   S   V  P NWE VL GI  MR 
Sbjct  1    MQVPDIEDFIYEKAKTLTSSSKATTSLVKVEKKVGVSSVIKVGAPDNWEAVLGGIKSMRL  60

Query  449  SEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            S +APVD+ GCEKAGS LPPKERRFAVL+S+++SS
Sbjct  61   SGEAPVDTKGCEKAGSLLPPKERRFAVLISTMMSS  95



>ref|XP_010475312.1| PREDICTED: endonuclease III homolog 2, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=372

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 90/143 (63%), Gaps = 13/143 (9%)
 Frame = +2

Query  155  NP-SGDSAAELRVFIRRKRVKKAVEIVANEIEKESPN-----KKVL---GLPDIEDFSYR  307
            NP S DS + LR   R+KR+K   ++  + +EKES       +KV+    LPDIED  Y+
Sbjct  38   NPRSDDSTSGLRASSRKKRLK---QVDLDPLEKESTRGINSARKVIDTFALPDIEDSPYK  94

Query  308  K-DAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCE  484
            K +   S  T   +  +   E  + ++ + +PP +WEKV+EGI KM+SSE+APVD++  +
Sbjct  95   KTNGSASSRTSKLNSYIKSTEASTSAEISGKPPDHWEKVIEGIRKMKSSEEAPVDTVERD  154

Query  485  KAGSSLPPKERRFAVLVSSLLSS  553
            + GS LPPKERRF VL+ +LLSS
Sbjct  155  RTGSFLPPKERRFYVLIGTLLSS  177



>emb|CDY10004.1| BnaC08g44470D [Brassica napus]
Length=349

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 74/122 (61%), Gaps = 26/122 (21%)
 Frame = +2

Query  194  IRRKRVKKAV-EIVANEIEKESPNKKVLG-LPDIEDFSYRKDAINSQSTPVSSECMIGKE  367
            +RRKR+K+ V E VA +    S +K++ G LPDIED SY+K  ++               
Sbjct  57   LRRKRLKQEVLEPVAKD--SSSSHKELCGVLPDIEDLSYKKTNLSPS-------------  101

Query  368  VLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLL  547
                     +PP NWEKVLEGI KMRS E+A VD + C++ GS LPPKERRF VL+ +LL
Sbjct  102  ---------RPPENWEKVLEGIRKMRSPEEATVDPVNCDRTGSFLPPKERRFYVLIGTLL  152

Query  548  SS  553
            SS
Sbjct  153  SS  154



>gb|EMT20628.1| Endonuclease III-like protein 1 [Aegilops tauschii]
Length=553

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 80/135 (59%), Gaps = 16/135 (12%)
 Frame = +2

Query  194  IRRKRVKKAVEIVANEIEKESPNKKVL------GLPDIEDFSYRKD----AINSQSTPVS  343
            + RKR+ + +E V  E  KE P KK         +PDI+DF Y K     +++++  P S
Sbjct  268  VERKRLNRVLE-VKEEHPKEVPLKKTFTHMQVGAVPDIDDFRYVKTEARTSVSTKRVPAS  326

Query  344  SE-----CMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
            S        + K++   S   V+ P NWE VL GI  +R S  APVD+ GCEKAGS LPP
Sbjct  327  SNKNSSPVRLEKKIRVSSVVKVEAPENWEAVLAGIKNIRLSGQAPVDTKGCEKAGSLLPP  386

Query  509  KERRFAVLVSSLLSS  553
            KERRFAVL+S+++SS
Sbjct  387  KERRFAVLISTMMSS  401



>emb|CAN69482.1| hypothetical protein VITISV_017352 [Vitis vinifera]
Length=377

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 75/133 (56%), Gaps = 26/133 (20%)
 Frame = +2

Query  143  GSQENPSGDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAIN  322
              +E P+G S +E+RVF+R+KRVK AVE    EI+ E   +K+  LPDIE+F+YRK   +
Sbjct  42   AHEEXPNGVSGSEVRVFVRKKRVKMAVETPEKEIKAEPQQQKICELPDIEEFTYRKGKRS  101

Query  323  SQ---STPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG  493
            +    S P S     G E+ S    +++PP                 DAPVDSMGCEKAG
Sbjct  102  THLRKSKPTSDVPPGGTEITS----SIRPP-----------------DAPVDSMGCEKAG  140

Query  494  SSLPPKERRFAVL  532
            SSLPP  RR   L
Sbjct  141  SSLPP--RRLHTL  151



>ref|XP_002966510.1| hypothetical protein SELMODRAFT_85281, partial [Selaginella moellendorffii]
 gb|EFJ32537.1| hypothetical protein SELMODRAFT_85281, partial [Selaginella moellendorffii]
Length=240

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            PP W++VLEGI KMR+SEDAPVDSMGCEKAG SLPPKERR AVL+S+LLSS
Sbjct  3    PPKWKEVLEGIRKMRASEDAPVDSMGCEKAGISLPPKERRVAVLISALLSS  53



>ref|XP_002982352.1| hypothetical protein SELMODRAFT_116252, partial [Selaginella 
moellendorffii]
 gb|EFJ16597.1| hypothetical protein SELMODRAFT_116252, partial [Selaginella 
moellendorffii]
Length=240

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            PP W++VLEGI KMR+SEDAPVDSMGCEKAG SLPPKERR AVL+S+LLSS
Sbjct  3    PPKWKEVLEGIRKMRASEDAPVDSMGCEKAGISLPPKERRVAVLISALLSS  53



>ref|XP_010475314.1| PREDICTED: endonuclease III homolog 2, chloroplastic-like isoform 
X3 [Camelina sativa]
Length=351

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 79/135 (59%), Gaps = 18/135 (13%)
 Frame = +2

Query  155  NP-SGDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRK-DAINSQ  328
            NP S DS + LR   R+KR+K+                    LPDIED  Y+K +   S 
Sbjct  38   NPRSDDSTSGLRASSRKKRLKQ----------------DTFALPDIEDSPYKKTNGSASS  81

Query  329  STPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
             T   +  +   E  + ++ + +PP +WEKV+EGI KM+SSE+APVD++  ++ GS LPP
Sbjct  82   RTSKLNSYIKSTEASTSAEISGKPPDHWEKVIEGIRKMKSSEEAPVDTVERDRTGSFLPP  141

Query  509  KERRFAVLVSSLLSS  553
            KERRF VL+ +LLSS
Sbjct  142  KERRFYVLIGTLLSS  156



>ref|XP_006304736.1| hypothetical protein CARUB_v10012090mg, partial [Capsella rubella]
 gb|EOA37634.1| hypothetical protein CARUB_v10012090mg, partial [Capsella rubella]
Length=397

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 80/132 (61%), Gaps = 6/132 (5%)
 Frame = +2

Query  176  AELRVFIRRKRVKKAVEIVANEIEKESPN--KKVLGLPDIEDFSYR-KDAINSQSTPVSS  346
            +E R+ +R+KR+K+      +E      N  K++L LPDIE+  Y+      S  T   +
Sbjct  71   SETRLSLRKKRLKQEDLEPLDEDSTRGINSRKEMLALPDIEESPYKSTSGFASSRTSKLN  130

Query  347  ECMIGKEVLSLSQ--KTVQ-PPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKER  517
             C+   E  + +   KT    P NWEKV+EGI KM SSE+APVD++ C++ GS LPPKER
Sbjct  131  SCIKSTEASASASSVKTAGIAPDNWEKVIEGIRKMTSSEEAPVDNLECDRTGSFLPPKER  190

Query  518  RFAVLVSSLLSS  553
            RF VL+ +LLSS
Sbjct  191  RFYVLIGTLLSS  202



>ref|XP_010485510.1| PREDICTED: endonuclease III homolog 2, chloroplastic-like [Camelina 
sativa]
Length=348

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 90/142 (63%), Gaps = 15/142 (11%)
 Frame = +2

Query  155  NP-SGDSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLG--LPDIEDFSYRKDAINS  325
            NP S DS + LR   R+KR+KK  ++    +EK+   +KV+G  LPDIED  Y+K   N 
Sbjct  18   NPRSDDSTSGLRASSRKKRLKKQEDL--EPLEKDF--RKVIGTSLPDIEDTPYKK--TNG  71

Query  326  QSTPVSSEC--MIGKEVLSLSQKTVQ----PPPNWEKVLEGIHKMRSSEDAPVDSMGCEK  487
             ++ ++S+    I     S S  +++    PP +WEKV+EGI KM SSE APVD++  ++
Sbjct  72   YASFLTSKLNSYIKSTEASTSASSIKASGKPPDDWEKVIEGIRKMTSSEVAPVDTVERDR  131

Query  488  AGSSLPPKERRFAVLVSSLLSS  553
             GS LPPKERRF VL+ +LLSS
Sbjct  132  TGSFLPPKERRFYVLIGTLLSS  153



>gb|AFW56063.1| hypothetical protein ZEAMMB73_227959 [Zea mays]
Length=291

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = +2

Query  272  LGLPDIEDFSYRK-DAINSQSTPVSSECMIGKEV-LSLSQKT---VQPPPNWEKVLEGIH  436
            + +PDIEDF Y K   + S S   +S   + K+V +S   K    V  P NWE VL GI 
Sbjct  1    MQVPDIEDFIYEKAKTLTSSSKATTSLVKVEKKVGVSSVIKVICAVGAPDNWEAVLGGIK  60

Query  437  KMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
             MR S +APVD+ GCEKAGS LPPKERRFAVL+S+++SS
Sbjct  61   SMRLSGEAPVDTKGCEKAGSLLPPKERRFAVLISTMMSS  99



>ref|XP_009629861.1| PREDICTED: endonuclease III homolog 1, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03183}-like 
isoform X5 [Nicotiana tomentosiformis]
Length=268

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 20/91 (22%)
 Frame = +2

Query  281  PDIEDFSYRKDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDA  460
            P+IEDF+ +   INSQS                    +QPP NWE+V+EGI KMRSSE A
Sbjct  3    PEIEDFANKSSNINSQS--------------------IQPPANWERVIEGIRKMRSSEHA  42

Query  461  PVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            PVDS+  ++  +SL PKERRFAVL+ SLLSS
Sbjct  43   PVDSIDPDEGVTSLQPKERRFAVLIGSLLSS  73



>ref|XP_009629858.1| PREDICTED: endonuclease III homolog 1, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03183}-like 
isoform X2 [Nicotiana tomentosiformis]
Length=338

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 60/96 (63%), Gaps = 20/96 (21%)
 Frame = +2

Query  266  KVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMR  445
            + L  P+IEDF+ +   INSQS                    +QPP NWE+V+EGI KMR
Sbjct  68   QFLRHPEIEDFANKSSNINSQS--------------------IQPPANWERVIEGIRKMR  107

Query  446  SSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            SSE APVDS+  ++  +SL PKERRFAVL+ SLLSS
Sbjct  108  SSEHAPVDSIDPDEGVTSLQPKERRFAVLIGSLLSS  143



>ref|XP_009629857.1| PREDICTED: endonuclease III homolog 1, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03183}-like 
isoform X1 [Nicotiana tomentosiformis]
Length=346

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 59/94 (63%), Gaps = 20/94 (21%)
 Frame = +2

Query  272  LGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSS  451
            L  P+IEDF+ +   INSQS                    +QPP NWE+V+EGI KMRSS
Sbjct  78   LRHPEIEDFANKSSNINSQS--------------------IQPPANWERVIEGIRKMRSS  117

Query  452  EDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            E APVDS+  ++  +SL PKERRFAVL+ SLLSS
Sbjct  118  EHAPVDSIDPDEGVTSLQPKERRFAVLIGSLLSS  151



>gb|KFK42927.1| hypothetical protein AALP_AA1G056300 [Arabis alpina]
Length=341

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 77/139 (55%), Gaps = 33/139 (24%)
 Frame = +2

Query  152  ENPSGDSAAELRVFIRRKRVK----KAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAI  319
            E  +G S +E RV +R+KR+K    K VEI  +     +  K++ GL DIE+ SY     
Sbjct  36   EVANGASESENRVSLRKKRLKQEALKHVEI--DPSRGINTQKEMCGLADIEECSY-----  88

Query  320  NSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPV-DSMGCEKAGS  496
                                  KT   P NWEKVLEGI KM+S E+APV D++ C++ GS
Sbjct  89   ---------------------NKTNGFPENWEKVLEGIRKMKSLEEAPVDDTIECDRTGS  127

Query  497  SLPPKERRFAVLVSSLLSS  553
             LPPKERRF VL+ +LLSS
Sbjct  128  FLPPKERRFYVLIGTLLSS  146



>gb|KFK42928.1| hypothetical protein AALP_AA1G056300 [Arabis alpina]
Length=340

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 76/136 (56%), Gaps = 33/136 (24%)
 Frame = +2

Query  161  SGDSAAELRVFIRRKRVK----KAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQ  328
            +G S +E RV +R+KR+K    K VEI  +     +  K++ GL DIE+ SY        
Sbjct  38   NGASESENRVSLRKKRLKQEALKHVEI--DPSRGINTQKEMCGLADIEECSY--------  87

Query  329  STPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPV-DSMGCEKAGSSLP  505
                               KT   P NWEKVLEGI KM+S E+APV D++ C++ GS LP
Sbjct  88   ------------------NKTNGFPENWEKVLEGIRKMKSLEEAPVDDTIECDRTGSFLP  129

Query  506  PKERRFAVLVSSLLSS  553
            PKERRF VL+ +LLSS
Sbjct  130  PKERRFYVLIGTLLSS  145



>ref|XP_010457705.1| PREDICTED: endonuclease III homolog 2, chloroplastic-like isoform 
X3 [Camelina sativa]
Length=282

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 79/145 (54%), Gaps = 15/145 (10%)
 Frame = +2

Query  155  NP-SGDSAAELRVFIRRKRVKKAVEIVANEIEKESPN------KKVLGLPDIEDFSYRKD  313
            NP S DS + LR   R+KR+K   E     +EK+S        K    LPDIED  Y K 
Sbjct  18   NPRSDDSTSGLRASSRKKRLK---EEDLEPLEKDSTRGINSARKDTFALPDIEDSPYNKT  74

Query  314  AINSQSTPVSSECMIGKEVLSLSQKTV-----QPPPNWEKVLEGIHKMRSSEDAPVDSMG  478
               S S+  S      K   + +  +      +PP +WEKV+E I KM SSE+APVD + 
Sbjct  75   NDGSASSRTSILNSYIKSTEASTSSSSIKTSGKPPDDWEKVIEAIRKMTSSEEAPVDIVE  134

Query  479  CEKAGSSLPPKERRFAVLVSSLLSS  553
             ++ GS LPPKERRF VL+ +LLSS
Sbjct  135  RDRTGSFLPPKERRFYVLIGTLLSS  159



>gb|EPS69374.1| hypothetical protein M569_05394, partial [Genlisea aurea]
Length=71

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 49/88 (56%), Gaps = 19/88 (22%)
 Frame = +2

Query  260  NKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHK  439
             +  L LP IEDF++  D                      S  +++PP +WEK LEGI  
Sbjct  3    TQHSLALPAIEDFAFGADN-------------------HFSGLSMKPPADWEKALEGIRN  43

Query  440  MRSSEDAPVDSMGCEKAGSSLPPKERRF  523
            MR +EDAPVDSMGCEKAGSSLPPK   F
Sbjct  44   MRFTEDAPVDSMGCEKAGSSLPPKVAAF  71



>ref|XP_009629862.1| PREDICTED: endonuclease III homolog 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03183}-like 
isoform X6 [Nicotiana tomentosiformis]
Length=262

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  374  SLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            ++ Q +VQPP NWE+V+EGI KMRSSE APVDS+  ++  +SL PKERRFAVL+ SLLSS
Sbjct  8    TIRQNSVQPPANWERVIEGIRKMRSSEHAPVDSIDPDEGVTSLQPKERRFAVLIGSLLSS  67



>ref|XP_009799827.1| PREDICTED: endonuclease III homolog 2, chloroplastic-like isoform 
X4 [Nicotiana sylvestris]
Length=291

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  374  SLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            ++ Q +VQPP NWE+V+EGI +MRSSE APVDS+  ++  +SL PKERRFAVLV SLLSS
Sbjct  37   TMRQDSVQPPANWERVIEGIRRMRSSEHAPVDSIDPDEGVTSLQPKERRFAVLVGSLLSS  96



>ref|XP_010457704.1| PREDICTED: endonuclease III homolog 2, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=284

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 82/147 (56%), Gaps = 17/147 (12%)
 Frame = +2

Query  155  NP-SGDSAAELRVFIRRKRVKKAVEIVANEIEKESPN-----KKVL---GLPDIEDFSYR  307
            NP S DS + LR   R+KR+K   E     +EK+S       +KV+    LPDIED  Y 
Sbjct  18   NPRSDDSTSGLRASSRKKRLK---EEDLEPLEKDSTRGINSARKVIDTFALPDIEDSPYN  74

Query  308  KDAINSQSTPVSSECMIGKEVLSLSQKTV-----QPPPNWEKVLEGIHKMRSSEDAPVDS  472
            K    S S+  S      K   + +  +      +PP +WEKV+E I KM SSE+APVD 
Sbjct  75   KTNDGSASSRTSILNSYIKSTEASTSSSSIKTSGKPPDDWEKVIEAIRKMTSSEEAPVDI  134

Query  473  MGCEKAGSSLPPKERRFAVLVSSLLSS  553
            +  ++ GS LPPKERRF VL+ +LLSS
Sbjct  135  VERDRTGSFLPPKERRFYVLIGTLLSS  161



>ref|XP_010457703.1| PREDICTED: endonuclease III homolog 2, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=318

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 82/147 (56%), Gaps = 17/147 (12%)
 Frame = +2

Query  155  NP-SGDSAAELRVFIRRKRVKKAVEIVANEIEKESPN-----KKVL---GLPDIEDFSYR  307
            NP S DS + LR   R+KR+K   E     +EK+S       +KV+    LPDIED  Y 
Sbjct  18   NPRSDDSTSGLRASSRKKRLK---EEDLEPLEKDSTRGINSARKVIDTFALPDIEDSPYN  74

Query  308  KDAINSQSTPVSSECMIGKEVLSLSQKTV-----QPPPNWEKVLEGIHKMRSSEDAPVDS  472
            K    S S+  S      K   + +  +      +PP +WEKV+E I KM SSE+APVD 
Sbjct  75   KTNDGSASSRTSILNSYIKSTEASTSSSSIKTSGKPPDDWEKVIEAIRKMTSSEEAPVDI  134

Query  473  MGCEKAGSSLPPKERRFAVLVSSLLSS  553
            +  ++ GS LPPKERRF VL+ +LLSS
Sbjct  135  VERDRTGSFLPPKERRFYVLIGTLLSS  161



>ref|XP_006362162.1| PREDICTED: uncharacterized protein LOC102583685 [Solanum tuberosum]
Length=114

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 20/100 (20%)
 Frame = +2

Query  212  KKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVLSLSQKT  391
            K+ VE++A E++ ESP +K L  P+IEDF+ + D + SQS                    
Sbjct  28   KRRVEMIAKEVKTESPQEKFLRHPEIEDFANKSDNVYSQS--------------------  67

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPK  511
            +QPP NWE+V+EGI  MR SE APVDS+  ++  +SL PK
Sbjct  68   IQPPANWERVIEGIRSMRLSEHAPVDSIDPDEGVTSLQPK  107



>ref|XP_009799826.1| PREDICTED: endonuclease III homolog 2, chloroplastic-like isoform 
X3 [Nicotiana sylvestris]
Length=299

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  383  QKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            Q  +QPP NWE+V+EGI +MRSSE APVDS+  ++  +SL PKERRFAVLV SLLSS
Sbjct  48   QLKLQPPANWERVIEGIRRMRSSEHAPVDSIDPDEGVTSLQPKERRFAVLVGSLLSS  104



>ref|XP_006443062.1| hypothetical protein CICLE_v10020816mg [Citrus clementina]
 gb|ESR56302.1| hypothetical protein CICLE_v10020816mg [Citrus clementina]
Length=357

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 68/121 (56%), Gaps = 27/121 (22%)
 Frame = +2

Query  167  DSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSS  346
            + A E RV   RKR K     ++ E E ++P+    GLPDIE+ SY K    +  + VSS
Sbjct  37   NPAPEPRVSAGRKRQKNNALKISKE-ETKNPS----GLPDIEELSYNK----ANGSAVSS  87

Query  347  ECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFA  526
            E                PP NWEKVLEGI KM++ E  PV S+G ++  SSLPPKERRFA
Sbjct  88   E----------------PPANWEKVLEGIRKMKTLE--PVYSLGVDETDSSLPPKERRFA  129

Query  527  V  529
            V
Sbjct  130  V  130



>gb|KFK23912.1| hypothetical protein AALP_AAs54029U000100, partial [Arabis alpina]
Length=63

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  395  QPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
             PP NWE+VLEGI +MRSSEDAPVDSMGC+KAGS LPP
Sbjct  24   NPPENWEEVLEGIRQMRSSEDAPVDSMGCDKAGSFLPP  61



>ref|XP_010097533.1| Endonuclease III-like protein 1 [Morus notabilis]
 gb|EXB68724.1| Endonuclease III-like protein 1 [Morus notabilis]
Length=267

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  383  QKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPK  511
            Q   +PP NWEKVLEGI KMRSSEDAPVD+MGCEKAG  LPPK
Sbjct  41   QNPDEPPANWEKVLEGIRKMRSSEDAPVDTMGCEKAGILLPPK  83



>ref|XP_006494170.1| PREDICTED: endonuclease III-like protein 1-like isoform X1 [Citrus 
sinensis]
Length=421

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +2

Query  167  DSAAELRVFIRRKRVKK-AVEIVANEIEKESP-NKKVLGLPDIEDFSYRKDAINSQSTPV  340
            + A E RV   RKR K  A++I   E +   P   K  GLPDIE+ SY K    +  + V
Sbjct  94   NPAPEPRVSAGRKRQKNNALKISKEETKNVLPFEHKPSGLPDIEELSYNK----ANGSAV  149

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERR  520
            SSE                PP NWEKVLEGI KM++ E  PV S+G ++  SSLPPKERR
Sbjct  150  SSE----------------PPANWEKVLEGIRKMKTLE--PVYSLGVDETDSSLPPKERR  191

Query  521  FAV  529
            FAV
Sbjct  192  FAV  194



>ref|XP_006494171.1| PREDICTED: endonuclease III-like protein 1-like isoform X2 [Citrus 
sinensis]
Length=414

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 68/121 (56%), Gaps = 27/121 (22%)
 Frame = +2

Query  167  DSAAELRVFIRRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSS  346
            + A E RV   RKR K     ++ E E ++P+    GLPDIE+ SY K    +  + VSS
Sbjct  94   NPAPEPRVSAGRKRQKNNALKISKE-ETKNPS----GLPDIEELSYNK----ANGSAVSS  144

Query  347  ECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFA  526
            E                PP NWEKVLEGI KM++ E  PV S+G ++  SSLPPKERRFA
Sbjct  145  E----------------PPANWEKVLEGIRKMKTLE--PVYSLGVDETDSSLPPKERRFA  186

Query  527  V  529
            V
Sbjct  187  V  187



>gb|KFK23488.1| hypothetical protein AALP_AAs52541U000100, partial [Arabis alpina]
Length=65

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  395  QPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP  508
             PP NW +VLEGI +MRSSEDAPVDSMGC+KAG+ LPP
Sbjct  26   NPPENWVQVLEGIRQMRSSEDAPVDSMGCDKAGNFLPP  63



>gb|EMT33112.1| hypothetical protein F775_24738 [Aegilops tauschii]
Length=212

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  407  NWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            NWE VL GI  +R S  APVD+ G EKAGS LPPKERRF VL+S+++SS
Sbjct  61   NWEAVLGGIKNIRLSGQAPVDTKGREKAGSLLPPKERRFIVLISTMMSS  109



>ref|XP_007034073.1| Uncharacterized protein TCM_020122 [Theobroma cacao]
 gb|EOY04999.1| Uncharacterized protein TCM_020122 [Theobroma cacao]
Length=163

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +2

Query  416  KVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVS  538
            KVLEGI K+RS+EDAPVD+MGCEKAGS LPPK  RF   +S
Sbjct  7    KVLEGIRKIRSAEDAPVDTMGCEKAGSVLPPK--RFGGYLS  45



>gb|KIM49604.1| hypothetical protein M413DRAFT_407778 [Hebeloma cylindrosporum 
h7]
Length=374

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 4/81 (5%)
 Frame = +2

Query  323  SQSTPVSSECMIGKEVLSLSQKTVQP---PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG  493
            S STP   E    K+V ++ Q   +P   PPNW +  E I KMRS   APVD+MGC++A 
Sbjct  80   SSSTPQKREANAPKKVKAIRQVLDRPHAAPPNWRETYETIKKMRSRFVAPVDTMGCQQAQ  139

Query  494  -SSLPPKERRFAVLVSSLLSS  553
                 PK RR+A LVS +LSS
Sbjct  140  VKETDPKNRRYATLVSLMLSS  160



>ref|XP_001623365.1| predicted protein [Nematostella vectensis]
 gb|EDO31265.1| predicted protein, partial [Nematostella vectensis]
Length=239

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            PPNW + LE I +MR+S DAPVDS GCE+ A +S  P+  R+ VLVS +LSS
Sbjct  3    PPNWRQQLENIRQMRASRDAPVDSQGCERTADTSTTPQVYRYQVLVSLMLSS  54



>gb|EPZ33924.1| DNA glycosylase domain-containing protein [Rozella allomycis 
CSF55]
Length=243

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  383  QKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            +KT+ PP +W+  L  + KMR S +APVDS+GCE+ A  SL PK  RF  LVS +LSS
Sbjct  4    KKTILPPKDWKDTLTLLEKMRESRNAPVDSLGCERLADKSLSPKIFRFQTLVSLMLSS  61



>gb|KDR13006.1| Endonuclease III-like protein 1 [Zootermopsis nevadensis]
Length=330

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +2

Query  380  SQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            S+K    P NW +V+  I +MR   DAPVD+MGC+K A  S PPKE R+  LVS +LSS
Sbjct  95   SKKLKWEPDNWREVINNIREMRRQRDAPVDTMGCDKCADESAPPKETRYHSLVSLMLSS  153



>gb|KGB42329.1| Endonuclease III-like protein 1, partial [Schistosoma haematobium]
Length=213

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            PPNW   L  I KMR S DAPVDSMGCE+ A  +  PK  R  VL+S +LSS
Sbjct  30   PPNWRAQLSNIRKMRESRDAPVDSMGCERLADETEHPKTFRLQVLISLMLSS  81



>ref|XP_006597237.1| PREDICTED: endonuclease III-like protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006597238.1| PREDICTED: endonuclease III-like protein 1-like isoform X2 [Glycine 
max]
Length=123

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 5/57 (9%)
 Frame = +2

Query  389  TVQPPPNWEKVLEGIHKMRSSED--APVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            T + P +WE VL+GI +MRSS D   PV     EKA  ++P KERRF VL SSLLSS
Sbjct  9    TSEAPAHWEMVLQGIRQMRSSADEHQPV---AREKAADTVPSKERRFVVLASSLLSS  62



>ref|XP_002837551.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81742.1| unnamed protein product [Tuber melanosporum]
Length=459

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  359  GKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLV  535
            GK+V       V+ P NWE+V E + +MR    APVD+MGCE+ G  +  PK RRF  L+
Sbjct  144  GKKVKDEEHVKVEAPENWEEVYEKLREMRKKVKAPVDTMGCERLGDKAATPKLRRFHTLI  203

Query  536  SSLLSS  553
            S +LSS
Sbjct  204  SLMLSS  209



>ref|XP_001949525.2| PREDICTED: endonuclease III-like protein 1 [Acyrthosiphon pisum]
Length=280

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            PPNWEK L+ I KMR    APVD+MGC++A   + PP+  R+ VL+S +LSS
Sbjct  50   PPNWEKTLDNIRKMRKDIVAPVDNMGCDQAADLNEPPEVVRYHVLISLMLSS  101



>ref|XP_006595057.1| PREDICTED: endonuclease III-like protein 1-like [Glycine max]
Length=304

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 5/61 (8%)
 Frame = +2

Query  377  LSQKTVQPPPNWEKVLEGIHKMRSSED--APVDSMGCEKAGSSLPPKERRFAVLVSSLLS  550
            L Q + + P +W+ VL+GI +MRSS D   PV     EKA  ++PPKERRFAVL SSLLS
Sbjct  52   LPQISSEAPAHWKMVLQGIRQMRSSADEHQPVSR---EKAADTVPPKERRFAVLTSSLLS  108

Query  551  S  553
            S
Sbjct  109  S  109



>gb|KHN30103.1| Endonuclease III-like protein 1 [Glycine soja]
Length=304

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 5/61 (8%)
 Frame = +2

Query  377  LSQKTVQPPPNWEKVLEGIHKMRSSED--APVDSMGCEKAGSSLPPKERRFAVLVSSLLS  550
            L Q + + P +W+ VL+GI +MRSS D   PV     EKA  ++PPKERRFAVL SSLLS
Sbjct  52   LPQISSEAPAHWKMVLQGIRQMRSSADEHQPVAR---EKAADTVPPKERRFAVLTSSLLS  108

Query  551  S  553
            S
Sbjct  109  S  109



>ref|XP_007673604.1| hypothetical protein BAUCODRAFT_31576 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC99234.1| hypothetical protein BAUCODRAFT_31576 [Baudoinia compniacensis 
UAMH 10762]
Length=437

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            V+PPPNWE+V +    MR    APVD+MGCE  A    PP++RR   LVS +LSS
Sbjct  143  VEPPPNWERVYDVTAAMRKRVLAPVDTMGCESLAEDHKPPRDRRLQTLVSLMLSS  197



>emb|CDJ61103.1| endonuclease III-like protein 1, putative [Eimeria maxima]
Length=426

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  389  TVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            T  PP N++KV E I KMR   DAPVDSMG E A +    KERRFAVLV+ +LSS
Sbjct  201  TKPPPANFDKVWEAICKMREKRDAPVDSMGVE-AQTGKDEKERRFAVLVAVMLSS  254



>ref|XP_003744683.1| PREDICTED: endonuclease III-like protein 1-like [Metaseiulus 
occidentalis]
Length=340

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +2

Query  377  LSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            +S+K    P NW ++LEG+ KMR  +DAP D MGC   +G    PK +RF +L+S LLSS
Sbjct  75   VSKKLKWEPKNWFQILEGVRKMREKKDAPCDIMGCHMVSGEKADPKLQRFQILISLLLSS  134



>gb|EIE81807.1| hypothetical protein RO3G_06512 [Rhizopus delemar RA 99-880]
Length=322

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            PPNWE V   +   R  E+APVD+MGCE+ A ++ PPK +RF  LV+ +LS+
Sbjct  54   PPNWEIVYNKLEAFRDIEEAPVDTMGCERLAQTTAPPKIQRFQTLVALMLSA  105



>gb|ELU43797.1| DNA-(apurinic or apyrimidinic site) lyase [Rhizoctonia solani 
AG-1 IA]
Length=340

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP-KERRFAVLVSSLLSS  553
            PPNWEK    I  MRS  DAPVD+MGC K+ + + P K++RF  LVS +LSS
Sbjct  148  PPNWEKQYSLIEDMRSRIDAPVDTMGCAKSMTGVGPLKDQRFGALVSLMLSS  199



>gb|EUC66053.1| endonuclease III [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP50925.1| endonuclease III [Rhizoctonia solani 123E]
Length=419

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP-KERRFAVLVSSLLSS  553
            PPNWEK    I +MR++ +APVD+MGC KA + + P K++RF  LVS +LSS
Sbjct  129  PPNWEKQYTLIEEMRATIEAPVDTMGCAKAMTGVGPLKDQRFGALVSLMLSS  180



>dbj|GAM39966.1| hypothetical protein TCE0_034f11941 [Talaromyces cellulolyticus]
Length=421

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSE-DAPVDSMGC-EKAGSSLPPKERRFAVLVSSLLSS  553
            VQPP NWE + + + KMR++   APVD+MGC E    + PPKE+RF  LV+ +LSS
Sbjct  134  VQPPSNWETMYDIVKKMRAANPTAPVDTMGCAELHWRTSPPKEQRFHTLVALMLSS  189



>emb|CDI81259.1| endonuclease III-like protein 1, putative [Eimeria acervulina]
Length=565

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  389  TVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            T  PP N++KV E I KMR   DAPVDSMG E A +    KERRFAVLV+ +LSS
Sbjct  332  TKPPPENFDKVWEAICKMREKRDAPVDSMGVE-AQTGKDEKERRFAVLVAVMLSS  385



>ref|XP_001866998.1| endonuclease iii [Culex quinquefasciatus]
 gb|EDS44288.1| endonuclease iii [Culex quinquefasciatus]
Length=361

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 42/76 (55%), Gaps = 13/76 (17%)
 Frame = +2

Query  332  TPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCE--KAGSSLP  505
            TP+  E + G E           P NW  +LE I +MR    APVDSMGC+  +   ++P
Sbjct  107  TPIKEEWVEGWE-----------PVNWRPMLENIRRMRLERPAPVDSMGCDQFRDDVTVP  155

Query  506  PKERRFAVLVSSLLSS  553
            PK RRF  LVS +LSS
Sbjct  156  PKTRRFHTLVSLMLSS  171



>ref|XP_003124777.1| PREDICTED: endonuclease III-like protein 1 isoform X1 [Sus scrofa]
Length=312

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            PP+W K LE I  MRS  DAPVD +G E     S PPK RR+ VL+S +LSS
Sbjct  89   PPDWRKQLENIRAMRSGRDAPVDQLGAEHCYDPSAPPKVRRYQVLLSLMLSS  140



>ref|XP_003762062.1| PREDICTED: endonuclease III-like protein 1 [Sarcophilus harrisii]
Length=297

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  374  SLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLS  550
            + S+K+   PPNW   LE I +MR SEDAPVD MG E     + PP+  R+ VL+S +LS
Sbjct  65   TTSKKSKWEPPNWNLQLENIREMRKSEDAPVDHMGAEHCYDQNAPPEVMRYQVLLSLMLS  124

Query  551  S  553
            S
Sbjct  125  S  125



>ref|XP_005655221.1| PREDICTED: endonuclease III-like protein 1 isoform X2 [Sus scrofa]
Length=344

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            PP+W K LE I  MRS  DAPVD +G E     S PPK RR+ VL+S +LSS
Sbjct  89   PPDWRKQLENIRAMRSGRDAPVDQLGAEHCYDPSAPPKVRRYQVLLSLMLSS  140



>ref|XP_005145102.1| PREDICTED: endonuclease III-like protein 1 [Melopsittacus undulatus]
Length=288

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +2

Query  332  TPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPP  508
             P++ EC   ++ LS  Q+    P +W + LE I +MR S DAPVD MG EK   SS PP
Sbjct  43   VPIAYECG-DEQGLSEPQRPRWEPKDWRQQLERIREMRRSRDAPVDGMGVEKCYDSSAPP  101

Query  509  KERRFAVLVSSLLSS  553
            +  R+ VL+S +LSS
Sbjct  102  QVMRYQVLLSLMLSS  116



>ref|XP_001845586.1| endonuclease iii [Culex quinquefasciatus]
 gb|EDS40881.1| endonuclease iii [Culex quinquefasciatus]
Length=363

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 42/76 (55%), Gaps = 13/76 (17%)
 Frame = +2

Query  332  TPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCE--KAGSSLP  505
            TP+  E + G E           P NW  +LE I +MR    APVDSMGC+  +   ++P
Sbjct  109  TPIKEEWVEGWE-----------PVNWRPMLENIRRMRLERPAPVDSMGCDQFRDDVTVP  157

Query  506  PKERRFAVLVSSLLSS  553
            PK RRF  LVS +LSS
Sbjct  158  PKTRRFHTLVSLMLSS  173



>gb|KII71412.1| Endonuclease III-like protein 1 [Thelohanellus kitauei]
Length=197

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  377  LSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            +S K   PP NW+ +LE I  MR  +DAPVD  GC K A  +   K +RF VL+S LLSS
Sbjct  1    MSLKRFTPPENWKDMLEKIGVMRIKKDAPVDFAGCHKCADQNADEKSQRFQVLISLLLSS  60



>gb|KDN40668.1| hypothetical protein RSAG8_07997, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=468

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP-KERRFAVLVSSLLSS  553
            PPNWEK    I +MR++ DAPVD+MGC K+ +   P K++RF  LVS +LSS
Sbjct  147  PPNWEKQYALIEEMRANIDAPVDTMGCAKSMTGHGPLKDQRFGTLVSLMLSS  198



>emb|CEL54581.1| endonuclease III [Rhizoctonia solani AG-1 IB]
Length=452

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP-KERRFAVLVSSLLSS  553
            PPNWEK    I  MRS  DAPVD+MGC KA S +   K++RF  LVS +LSS
Sbjct  148  PPNWEKQYSLIEDMRSRIDAPVDTMGCAKAMSGVGSLKDQRFGALVSLMLSS  199



>gb|ERG83109.1| putative endonuclease iii-like protein [Ascaris suum]
Length=266

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = +2

Query  404  PNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLP-PKERRFAVLVSSLLSS  553
            P WE+ LE + +MR S+DAPVD+MGC   G  L  P+  RF +LVS +LSS
Sbjct  43   PLWERHLERLQQMRESKDAPVDTMGCHMLGDVLASPQVYRFQILVSLMLSS  93



>ref|XP_002429173.1| endonuclease III, putative [Pediculus humanus corporis]
 gb|EEB16435.1| endonuclease III, putative [Pediculus humanus corporis]
Length=292

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            P NWEK L  I +MR  + APVD+MGC+K   S   PK +RF  LVS +LSS
Sbjct  66   PNNWEKTLMNIREMRKDKSAPVDTMGCDKCLDSECEPKVKRFHALVSLMLSS  117



>emb|CAG06049.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=293

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            PP+WEK L  I  MRSS DAPVD+MG +K   S  P + +RF VLVS +LSS
Sbjct  28   PPDWEKQLGYIRAMRSSRDAPVDNMGADKCYDSDAPAQVKRFQVLVSLMLSS  79



>ref|XP_002401078.1| endonuclease, putative [Ixodes scapularis]
 gb|EEC13864.1| endonuclease, putative [Ixodes scapularis]
Length=326

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            P NWE+VL  I +MR   +APVD+MGC+K    +LP K  R+ +LVS +LSS
Sbjct  95   PDNWEQVLSNIRQMRQEREAPVDTMGCDKCPDQTLPEKLVRYQLLVSLMLSS  146



>emb|CCO30385.1| endonuclease III [Rhizoctonia solani AG-1 IB]
Length=442

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPP-KERRFAVLVSSLLSS  553
            PPNWEK    I  MRS  DAPVD+MGC KA S +   K++RF  LVS +LSS
Sbjct  148  PPNWEKQYSLIEDMRSRIDAPVDTMGCAKAMSGVGSLKDQRFGALVSLMLSS  199



>gb|EFX86161.1| hypothetical protein DAPPUDRAFT_193197 [Daphnia pulex]
Length=306

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            P NWE VL  I  MR+ +DAPVD MG E+ A S+  P+ +RF VLVS +LSS
Sbjct  80   PENWEAVLNNIQIMRAEKDAPVDQMGAEQCADSASSPEVKRFQVLVSLMLSS  131



>gb|KFV76348.1| Endonuclease III-like 1, partial [Struthio camelus australis]
Length=227

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            P NW + LE I +MRSS DAPVD MG +K   SS PP+  R+ VL+S +LSS
Sbjct  5    PRNWRQQLERIREMRSSRDAPVDHMGVDKCYDSSAPPQVMRYQVLLSLMLSS  56



>ref|XP_007784447.1| hypothetical protein W97_08316 [Coniosporium apollinis CBS 100218]
 gb|EON69130.1| hypothetical protein W97_08316 [Coniosporium apollinis CBS 100218]
Length=444

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            V+PPPNWE+V     +MRS   APVD+MGCE  A     P+++RF  L+S +LSS
Sbjct  149  VEPPPNWEEVYNLTKEMRSKVLAPVDTMGCESLAEGYRSPRDQRFQTLISLMLSS  203



>ref|XP_010904324.1| PREDICTED: endonuclease III-like protein 1 [Esox lucius]
Length=416

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            PP+W K L  + +MRS  DAPVD MG EK   +  PP+ RR+ VLVS +LSS
Sbjct  139  PPDWRKQLHHMRQMRSGRDAPVDVMGAEKCYDTDAPPEVRRYQVLVSLMLSS  190



>gb|KFO88086.1| Endonuclease III-like 1, partial [Buceros rhinoceros silvestris]
Length=182

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = +2

Query  326  QSTPVSSECMIG---KEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-G  493
            +S  ++ EC  G   ++  S  Q+    P +W + LE I +MR S DAPVD MG EK   
Sbjct  7    KSVAIAYECGQGDGAEQGTSEPQRPRWEPRDWRQQLERIREMRRSRDAPVDEMGVEKCYD  66

Query  494  SSLPPKERRFAVLVSSLLSS  553
            SS PP+  R+ VL+S +LSS
Sbjct  67   SSAPPQVMRYQVLLSLMLSS  86



>gb|KHJ31327.1| hypothetical protein EV44_g1288 [Erysiphe necator]
Length=376

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 4/58 (7%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRS---SEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            VQPP NW++V E + +MR+   S++A VDSMGCE+ A ++  P+E+R   L+S +LSS
Sbjct  112  VQPPSNWKEVYETMKEMRTKGISQNAAVDSMGCERIAEANASPREKRLHTLISLMLSS  169



>ref|XP_009664323.1| PREDICTED: endonuclease III-like protein 1, partial [Struthio 
camelus australis]
Length=249

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            P NW + LE I +MRSS DAPVD MG +K   SS PP+  R+ VL+S +LSS
Sbjct  26   PRNWRQQLERIREMRSSRDAPVDHMGVDKCYDSSAPPQVMRYQVLLSLMLSS  77



>ref|XP_003597497.1| Endonuclease III-like protein [Medicago truncatula]
 gb|AES67748.1| EndoIII-related endonuclease [Medicago truncatula]
Length=331

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 48/99 (48%), Gaps = 16/99 (16%)
 Frame = +2

Query  257  PNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIH  436
            P K +L + D + F           T +      G   L    +T + P NWE VLEGI 
Sbjct  51   PKKHLLQIQDQKKFGL---------TEIEGSAYTGTNGLG---QTNESPANWENVLEGIR  98

Query  437  KMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            KM  S    +D+ G  +     PPK+RRFAVL SSLLSS
Sbjct  99   KMMYS----IDTTGDREDADIHPPKDRRFAVLASSLLSS  133



>ref|XP_004604462.1| PREDICTED: endonuclease III-like protein 1 [Sorex araneus]
Length=275

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +2

Query  290  EDFSYRKDAINSQS-TPVSSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPV  466
            E  S RK    +Q+  PV+ E   G+   ++       PP+W + L  I  MRS  DAPV
Sbjct  14   ESHSPRKRPRKAQTPVPVAYEAAEGESGAAVEPLQGWEPPHWRQQLANIRSMRSGRDAPV  73

Query  467  DSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            D +G E     S+PP+ RR+ VL+S +LSS
Sbjct  74   DQLGVEHCHDLSVPPEVRRYQVLLSLMLSS  103



>gb|EZF71272.1| hypothetical protein H105_06477 [Trichophyton soudanense CBS 
452.61]
Length=469

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 63/128 (49%), Gaps = 10/128 (8%)
 Frame = +2

Query  197  RRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDF----SYRKDAINSQSTPVSSECMIGK  364
            RR+ VK+  E V  E E  S         DIED       RK A       V +E  I K
Sbjct  69   RRRAVKREEEPVKKE-EDASSGLSSPPTTDIEDLLTATRKRKRAATRAGRAVKAEDSIVK  127

Query  365  EVLSLSQK---TVQPPPNWEKVLEGIHKMRSSE-DAPVDSMGC-EKAGSSLPPKERRFAV  529
             V S+  +    ++ PPNW+ V E + +MR     APVD+MGC E    S  P++RRF  
Sbjct  128  TVKSVKDEPGIDIKGPPNWQAVYETVKRMRERNPTAPVDTMGCSELYWRSSSPRDRRFHT  187

Query  530  LVSSLLSS  553
            L++ +LSS
Sbjct  188  LIALMLSS  195



>gb|ETN86268.1| hypothetical protein NECAME_16444 [Necator americanus]
Length=169

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +2

Query  359  GKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSL-PPKERRFAVLV  535
            GK++ + ++KT      W+  LE I +MR S DAPVD+MGC K    L  P+  RF VL+
Sbjct  7    GKKLTAAAKKTCDIEDLWKLQLEKITEMRKSGDAPVDTMGCHKLADPLAAPETFRFQVLL  66

Query  536  SSLLSS  553
            + +LSS
Sbjct  67   ALMLSS  72



>gb|EZG03644.1| hypothetical protein H106_06307 [Trichophyton rubrum CBS 735.88]
Length=469

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 63/128 (49%), Gaps = 10/128 (8%)
 Frame = +2

Query  197  RRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDF----SYRKDAINSQSTPVSSECMIGK  364
            RR+ VK+  E V  E E  S         DIED       RK A       V +E  I K
Sbjct  69   RRRAVKREEEPVKKE-EDASSGLSSPPTTDIEDLLTATRKRKRAATRAGRAVKAEDSIVK  127

Query  365  EVLSLSQK---TVQPPPNWEKVLEGIHKMRSSE-DAPVDSMGC-EKAGSSLPPKERRFAV  529
             V S+  +    ++ PPNW+ V E + +MR     APVD+MGC E    S  P++RRF  
Sbjct  128  TVKSVKDEPGIDIKGPPNWQAVYETVKRMRERNPTAPVDTMGCSELYWRSSSPRDRRFHT  187

Query  530  LVSSLLSS  553
            L++ +LSS
Sbjct  188  LIALMLSS  195



>gb|KIM87339.1| hypothetical protein PILCRDRAFT_272557 [Piloderma croceum F 1598]
Length=369

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = +2

Query  386  KTVQP-PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG-SSLPPKERRFAVLVSSLLSS  553
            KT  P PP W  V + I +MRS   APVD+MGC++A    + PK +RFA LVS +LSS
Sbjct  95   KTPHPAPPRWRDVYDAIKEMRSHTIAPVDTMGCDQAQLKEVEPKNQRFATLVSLMLSS  152



>gb|EZF13042.1| hypothetical protein H100_06473 [Trichophyton rubrum MR850]
 gb|EZF39432.1| hypothetical protein H102_06439 [Trichophyton rubrum CBS 100081]
 gb|EZF50028.1| hypothetical protein H103_06466 [Trichophyton rubrum CBS 288.86]
 gb|EZF60662.1| hypothetical protein H104_06450 [Trichophyton rubrum CBS 289.86]
 gb|EZF82010.1| hypothetical protein H110_06461 [Trichophyton rubrum MR1448]
 gb|EZF92677.1| hypothetical protein H113_06511 [Trichophyton rubrum MR1459]
 gb|EZG14211.1| hypothetical protein H107_06610 [Trichophyton rubrum CBS 202.88]
 gb|KDB31156.1| hypothetical protein H112_06458 [Trichophyton rubrum D6]
 gb|EGD85554.2| hypothetical protein TERG_01825 [Trichophyton rubrum CBS 118892]
Length=469

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 63/128 (49%), Gaps = 10/128 (8%)
 Frame = +2

Query  197  RRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDF----SYRKDAINSQSTPVSSECMIGK  364
            RR+ VK+  E V  E E  S         DIED       RK A       V +E  I K
Sbjct  69   RRRAVKREEEPVKKE-EDASSGLSSPPTTDIEDLLTATRKRKRAATRAGRAVKAEDSIVK  127

Query  365  EVLSLSQK---TVQPPPNWEKVLEGIHKMRSSE-DAPVDSMGC-EKAGSSLPPKERRFAV  529
             V S+  +    ++ PPNW+ V E + +MR     APVD+MGC E    S  P++RRF  
Sbjct  128  TVKSVKDEPGIDIKGPPNWQAVYETVKRMRERNPTAPVDTMGCSELYWRSSSPRDRRFHT  187

Query  530  LVSSLLSS  553
            L++ +LSS
Sbjct  188  LIALMLSS  195



>gb|KFX41113.1| Endonuclease III like [Talaromyces marneffei PM1]
Length=418

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSE-DAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            +QPP NWE + + + KMR++   APVD+MGC      + PPKE+RF  LV+ +LSS
Sbjct  132  IQPPSNWETMYDIVKKMRAANPTAPVDTMGCANLHWRTSPPKEQRFHTLVALMLSS  187



>ref|XP_003237103.1| DNA base excision repair N-glycosylase [Trichophyton rubrum CBS 
118892]
Length=460

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 63/128 (49%), Gaps = 10/128 (8%)
 Frame = +2

Query  197  RRKRVKKAVEIVANEIEKESPNKKVLGLPDIEDF----SYRKDAINSQSTPVSSECMIGK  364
            RR+ VK+  E V  E E  S         DIED       RK A       V +E  I K
Sbjct  60   RRRAVKREEEPVKKE-EDASSGLSSPPTTDIEDLLTATRKRKRAATRAGRAVKAEDSIVK  118

Query  365  EVLSLSQK---TVQPPPNWEKVLEGIHKMRSSE-DAPVDSMGC-EKAGSSLPPKERRFAV  529
             V S+  +    ++ PPNW+ V E + +MR     APVD+MGC E    S  P++RRF  
Sbjct  119  TVKSVKDEPGIDIKGPPNWQAVYETVKRMRERNPTAPVDTMGCSELYWRSSSPRDRRFHT  178

Query  530  LVSSLLSS  553
            L++ +LSS
Sbjct  179  LIALMLSS  186



>ref|XP_002143297.1| DNA repair protein Ntg1, putative [Talaromyces marneffei ATCC 
18224]
 gb|EEA26782.1| DNA repair protein Ntg1, putative [Talaromyces marneffei ATCC 
18224]
Length=418

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSE-DAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            +QPP NWE + + + KMR++   APVD+MGC      + PPKE+RF  LV+ +LSS
Sbjct  132  IQPPSNWETMYDIVKKMRAANPTAPVDTMGCANLHWRTSPPKEQRFHTLVALMLSS  187



>emb|CEG71713.1| Putative Endonuclease III [Rhizopus microsporus]
Length=247

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  389  TVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            T  PP NWE V   +   R  E+APVD+MGCE+ A ++  PK +RF  L++ +LSS
Sbjct  49   TSTPPSNWEIVYNKLEAFRDIEEAPVDTMGCERLAEATASPKVQRFQTLIALMLSS  104



>emb|CBY08920.1| unnamed protein product [Oikopleura dioica]
Length=303

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGC-EKAGSSLPPKERRFAVLVSSLLSS  553
            P NWE +   I +MRS  DAPVD+MGC E       P E+RF +L+S L+SS
Sbjct  72   PDNWETLYRNIQEMRSKADAPVDTMGCTELYSGQATPVEKRFQILISLLMSS  123



>gb|KHN79451.1| putative endonuclease III -like protein [Toxocara canis]
Length=265

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +2

Query  404  PNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLP-PKERRFAVLVSSLLSS  553
            P W++ LE +  MRS +DAPVD+MGC   G  L  PK  RF +LVS +LSS
Sbjct  42   PMWKRHLENLELMRSPKDAPVDTMGCHMLGDVLASPKVYRFQILVSLMLSS  92



>ref|XP_004995481.1| hypothetical protein PTSG_12076 [Salpingoeca rosetta]
 gb|EGD83117.1| hypothetical protein PTSG_12076 [Salpingoeca rosetta]
Length=504

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +2

Query  395  QPPPNWEKVLEGIHKMRSSEDAPVDSMGCE-KAGSSLPPKERRFAVLVSSLLSS  553
            + PPNWE V   I  MRS  DAPVD+MGCE  A  S     +RF +LV+ +LSS
Sbjct  157  RAPPNWETVYNNIKTMRSKRDAPVDTMGCEVLADPSADGPTQRFHILVALMLSS  210



>ref|XP_009007206.1| PREDICTED: endonuclease III-like protein 1 [Callithrix jacchus]
Length=262

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            V  P NW++ L  I  MRS +DAPVD +G E    SS PPK RR+ VL+S +LSS
Sbjct  88   VWEPQNWQQQLANIRAMRSKKDAPVDHLGAEHCYDSSAPPKVRRYQVLLSLMLSS  142



>gb|KDQ59784.1| hypothetical protein JAAARDRAFT_126654 [Jaapia argillacea MUCL 
33604]
Length=387

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            PP W++  + I +MRS   APVD+MGC++A    + PK RRFA LVS +LSS
Sbjct  108  PPRWKETYDTIKEMRSHIVAPVDTMGCDQAQNKEVDPKNRRFATLVSLMLSS  159



>ref|XP_010131729.1| PREDICTED: endonuclease III-like protein 1, partial [Buceros 
rhinoceros silvestris]
Length=207

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 4/80 (5%)
 Frame = +2

Query  326  QSTPVSSECMIG---KEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-G  493
            +S  ++ EC  G   ++  S  Q+    P +W + LE I +MR S DAPVD MG EK   
Sbjct  17   KSVAIAYECGQGDGAEQGTSEPQRPRWEPRDWRQQLERIREMRRSRDAPVDEMGVEKCYD  76

Query  494  SSLPPKERRFAVLVSSLLSS  553
            SS PP+  R+ VL+S +LSS
Sbjct  77   SSAPPQVMRYQVLLSLMLSS  96



>gb|KFV07704.1| Endonuclease III-like 1, partial [Tauraco erythrolophus]
Length=227

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            P NW++ LE I +MR   DAPVD MG EK   SS PP+  R+ VL+S +LSS
Sbjct  5    PRNWQQQLERIREMRKKRDAPVDEMGVEKCYDSSAPPQVMRYQVLLSLMLSS  56



>emb|CCD75359.1| putative endonuclease III [Schistosoma mansoni]
Length=260

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            P NW   L  I KMR S DAPVDSMGCE+ A  +  PK  R  VL+S +LSS
Sbjct  30   PLNWRVQLSNIRKMRESRDAPVDSMGCERLADETEHPKTFRLQVLISLMLSS  81



>emb|CEG80676.1| Putative Endonuclease III [Rhizopus microsporus]
Length=322

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  389  TVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            T  PP NWE V   +   R  E+APVD+MGCE+ A ++  PK +RF  L++ +LSS
Sbjct  49   TSTPPSNWEIVYNKLEAFRDIEEAPVDTMGCERLAEATASPKVQRFQTLIALMLSS  104



>ref|XP_011050321.1| PREDICTED: endonuclease III-like protein 1 [Acromyrmex echinatior]
 gb|EGI68191.1| Endonuclease III-like protein 1 [Acromyrmex echinatior]
Length=341

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 65/129 (50%), Gaps = 15/129 (12%)
 Frame = +2

Query  194  IRRKRVKKAVEI-VANEIEKESPNKKVLGLPDIEDFSYRKDAINSQSTPVSSECMIGKEV  370
            + R   KK + I + +EIE E+  K+ L   +  + S     I ++      EC I  E 
Sbjct  42   LARTSTKKHIPIKIKHEIENETDVKETLIKSEDVELSTGIQDIKTE------ECEIKNEN  95

Query  371  --LSLSQKTVQP-----PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFA  526
              L L+ K V+      PP+WE +LE I +MR SE APVD+MGC K       P   R+ 
Sbjct  96   VELKLNPKNVKDKKQWMPPDWEIILENIKEMRKSETAPVDTMGCHKCTDPDASPVVSRYQ  155

Query  527  VLVSSLLSS  553
             LV+ +LSS
Sbjct  156  SLVALMLSS  164



>ref|XP_007712442.1| hypothetical protein COCCADRAFT_96578 [Bipolaris zeicola 26-R-13]
 gb|EUC33229.1| hypothetical protein COCCADRAFT_96578 [Bipolaris zeicola 26-R-13]
Length=420

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            ++PP NWE++     +MR+   APVD+MGCE  A  S  P+++RF  L++ +LSS
Sbjct  129  IEPPANWEEIYALTREMRNENAAPVDTMGCESLADRSRTPRDQRFQTLIALMLSS  183



>ref|XP_008022280.1| hypothetical protein SETTUDRAFT_167288 [Setosphaeria turcica 
Et28A]
 gb|EOA90435.1| hypothetical protein SETTUDRAFT_167288 [Setosphaeria turcica 
Et28A]
Length=508

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            ++PP NWE++     +MR+   APVD+MGCE  A   + P+++RF  LV+ +LSS
Sbjct  126  IEPPANWEEIYALTREMRNENVAPVDTMGCESLADRKMTPRDQRFQTLVALMLSS  180



>ref|XP_009991212.1| PREDICTED: endonuclease III-like protein 1, partial [Tauraco 
erythrolophus]
Length=236

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            P NW++ LE I +MR   DAPVD MG EK   SS PP+  R+ VL+S +LSS
Sbjct  13   PRNWQQQLERIREMRKKRDAPVDEMGVEKCYDSSAPPQVMRYQVLLSLMLSS  64



>gb|EUN32871.1| hypothetical protein COCVIDRAFT_84101 [Bipolaris victoriae FI3]
Length=420

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            ++PP NWE++     +MR+   APVD+MGCE  A  S  P+++RF  L++ +LSS
Sbjct  129  IEPPANWEEIYALTREMRNENAAPVDTMGCESLADRSRTPRDQRFQTLIALMLSS  183



>ref|XP_002794167.1| endonuclease III [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH41839.1| endonuclease III [Paracoccidioides sp. 'lutzii' Pb01]
Length=474

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSE-DAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            V+PP NWEK+ E + +MR     APVD+MGC +    S  P++RRF +L++ +LSS
Sbjct  158  VEPPSNWEKIYETVKEMRRKNPTAPVDTMGCSQLYWRSSSPRDRRFHILIALMLSS  213



>emb|CDP91899.1| Protein Bm5325, isoform d [Brugia malayi]
Length=283

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +2

Query  404  PNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLP-PKERRFAVLVSSLLSS  553
            P W K LE I +MRS++DAPVDSMGC     +L  PK  RF  L+S +LSS
Sbjct  52   PLWMKHLENIKQMRSNKDAPVDSMGCHMLADALAEPKVFRFQTLLSLMLSS  102



>ref|XP_007640392.1| PREDICTED: endonuclease III-like protein 1 isoform X3 [Cricetulus 
griseus]
 ref|XP_007606635.1| PREDICTED: endonuclease III-like protein 1 isoform X3 [Cricetulus 
griseus]
Length=295

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            V  P NW++ L  I  MRS +DAPVD +G E    +S PPK RR+ +L+S +LSS
Sbjct  74   VWEPQNWQQQLANIQIMRSKKDAPVDQLGAEHCYDTSAPPKVRRYQILLSLMLSS  128



>ref|XP_005495856.1| PREDICTED: endonuclease III-like protein 1 [Zonotrichia albicollis]
Length=279

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            PP W + L+ I +MRSS DAPVD MG  +   +S PP+ RR+ VL++ +LSS
Sbjct  56   PPRWREQLQRIRQMRSSRDAPVDEMGVHRCYDTSAPPEVRRYQVLLALMLSS  107



>ref|XP_006204338.1| PREDICTED: endonuclease III-like protein 1 [Vicugna pacos]
Length=310

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  341  SSECMIGKEVLSLSQKTVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKER  517
            +SE   G+E   L Q     P +W++ LE I  MRS +DAPVD +G E     S PPK R
Sbjct  68   ASEGETGEEAEHL-QAPGWEPRDWQRQLENIRTMRSGKDAPVDQLGAEHCYDLSAPPKVR  126

Query  518  RFAVLVSSLLSS  553
            R+ VL+S +LSS
Sbjct  127  RYQVLLSLMLSS  138



>dbj|BAA22080.1| endonuclease III homologue [Mus musculus]
 emb|CAA70866.1| endonuclease III homologue 1 [Mus musculus]
 dbj|BAA28846.1| homologue of endonuclease III [Mus musculus]
 emb|CAB65239.1| Endonuclease III homologue 1 [Mus musculus]
 gb|EDL22347.1| nth (endonuclease III)-like 1 (E.coli), isoform CRA_b [Mus musculus]
 gb|AAI38853.1| Nth (endonuclease III)-like 1 (E.coli) [Mus musculus]
 gb|AAI38856.1| Nth (endonuclease III)-like 1 (E.coli) [Mus musculus]
Length=300

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            V  P NW++ L  I  MRS +DAPVD +G E    +S PPK RR+ VL+S +LSS
Sbjct  74   VWEPQNWQQQLANIRIMRSKKDAPVDQLGAEHCYDASAPPKVRRYQVLLSLMLSS  128



>emb|CEI97452.1| Putative Endonuclease III [Rhizopus microsporus]
Length=321

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  389  TVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            T  PP NWE V   +   R  E+APVD+MGCE+ A ++  PK +RF  L++ +LSS
Sbjct  49   TSTPPSNWEIVYNKLEAFRDIEEAPVDTMGCERLAEATASPKVQRFQTLIALMLSS  104



>emb|CEG71712.1| Putative Endonuclease III [Rhizopus microsporus]
Length=321

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  389  TVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            T  PP NWE V   +   R  E+APVD+MGCE+ A ++  PK +RF  L++ +LSS
Sbjct  49   TSTPPSNWEIVYNKLEAFRDIEEAPVDTMGCERLAEATASPKVQRFQTLIALMLSS  104



>gb|AAI45444.1| Nthl1 protein, partial [Mus musculus]
Length=280

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            V  P NW++ L  I  MRS +DAPVD +G E    +S PPK RR+ VL+S +LSS
Sbjct  54   VWEPQNWQQQLANIRIMRSKKDAPVDQLGAEHCYDASAPPKVRRYQVLLSLMLSS  108



>ref|XP_003501551.1| PREDICTED: endonuclease III-like protein 1 isoform X1 [Cricetulus 
griseus]
 ref|XP_007606633.1| PREDICTED: endonuclease III-like protein 1 isoform X1 [Cricetulus 
griseus]
 gb|EGW04446.1| Endonuclease III-like protein 1 [Cricetulus griseus]
 gb|ERE68737.1| endonuclease III-like protein 1 [Cricetulus griseus]
Length=300

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            V  P NW++ L  I  MRS +DAPVD +G E    +S PPK RR+ +L+S +LSS
Sbjct  74   VWEPQNWQQQLANIQIMRSKKDAPVDQLGAEHCYDTSAPPKVRRYQILLSLMLSS  128



>gb|EDL22346.1| nth (endonuclease III)-like 1 (E.coli), isoform CRA_a [Mus musculus]
Length=277

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            V  P NW++ L  I  MRS +DAPVD +G E    +S PPK RR+ VL+S +LSS
Sbjct  51   VWEPQNWQQQLANIRIMRSKKDAPVDQLGAEHCYDASAPPKVRRYQVLLSLMLSS  105



>ref|XP_001897050.1| Endonuclease III-like protein 1 [Brugia malayi]
Length=261

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = +2

Query  404  PNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLP-PKERRFAVLVSSLLSS  553
            P W K LE I +MRS++DAPVDSMGC     +L  PK  RF  L+S +LSS
Sbjct  38   PLWMKHLENIKQMRSNKDAPVDSMGCHMLADALAEPKVFRFQTLLSLMLSS  88



>ref|XP_006146455.1| PREDICTED: endonuclease III-like protein 1 [Tupaia chinensis]
 gb|ELW67811.1| Endonuclease III-like protein 1 [Tupaia chinensis]
Length=258

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            V  P NW++ L  I  MRS +DAPVD +G E     S PPK RR+ VL+S +LSS
Sbjct  32   VWEPQNWQQQLANIRAMRSKKDAPVDQLGAEHCYDPSAPPKVRRYQVLLSLMLSS  86



>ref|XP_010990908.1| PREDICTED: endonuclease III-like protein 1, partial [Camelus 
dromedarius]
Length=287

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            P +W++ LE I  MRS +DAPVD +G E     S PPK RR+ VL+S +LSS
Sbjct  89   PRDWQQQLENIRTMRSGKDAPVDQLGAEHCYDLSAPPKVRRYQVLLSLMLSS  140



>gb|EMD90605.1| hypothetical protein COCHEDRAFT_1179590 [Bipolaris maydis C5]
 gb|ENI09184.1| hypothetical protein COCC4DRAFT_186646 [Bipolaris maydis ATCC 
48331]
Length=420

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            ++PP NWE++     +MR+   APVD+MGCE  A  S  P+++RF  L++ +LSS
Sbjct  129  IEPPANWEEIYALTREMRNENAAPVDTMGCESLADRSQTPRDQRFQTLIALMLSS  183



>ref|XP_007705365.1| hypothetical protein COCSADRAFT_203977 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD58895.1| hypothetical protein COCSADRAFT_203977 [Bipolaris sorokiniana 
ND90Pr]
Length=419

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            ++PP NWE++     +MR+   APVD+MGCE  A  S  P+++RF  L++ +LSS
Sbjct  129  IEPPANWEEIYALTREMRNENAAPVDTMGCESLADRSRTPRDQRFQTLIALMLSS  183



>ref|XP_004750787.1| PREDICTED: endonuclease III-like protein 1 isoform X9 [Mustela 
putorius furo]
 ref|XP_004820981.1| PREDICTED: endonuclease III-like protein 1 isoform X9 [Mustela 
putorius furo]
Length=309

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            PP+W++ L  I  MRS +DAPVD +G E     S PPK RR+ VL+S +LSS
Sbjct  83   PPDWQQQLVNIRTMRSGKDAPVDQLGAEHCYDPSAPPKVRRYQVLLSLMLSS  134



>gb|KIJ63357.1| hypothetical protein HYDPIDRAFT_134499 [Hydnomerulius pinastri 
MD-312]
Length=306

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +2

Query  398  PPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG-SSLPPKERRFAVLVSSLLSS  553
            PP  W++  + I KMRS   APVD+MGC++A      PK +RFA LVS +LSS
Sbjct  33   PPTRWKETYDAIKKMRSRITAPVDTMGCDQAQLKEQDPKNQRFATLVSLMLSS  85



>ref|XP_008408992.1| PREDICTED: endonuclease III-like protein 1 [Poecilia reticulata]
 ref|XP_008409000.1| PREDICTED: endonuclease III-like protein 1 [Poecilia reticulata]
Length=405

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKE-RRFAVLVSSLLSS  553
            PP+W K L  I +MRS  DAPVD+MG EK   +  P   RRF VLVS +LSS
Sbjct  138  PPDWTKQLGFIREMRSGRDAPVDNMGAEKCYDTQAPAHVRRFQVLVSLMLSS  189



>ref|XP_006957265.1| DNA glycosylase [Wallemia sebi CBS 633.66]
 gb|EIM22596.1| DNA glycosylase [Wallemia sebi CBS 633.66]
Length=331

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +2

Query  395  QPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            + P NWE V + I +MRS++ APVD++GCE+A + +L  + +R+ +LVS +LSS
Sbjct  63   EAPENWETVYDLIKEMRSTQLAPVDTLGCERAPTENLDARTKRYQILVSLMLSS  116



>ref|XP_007640391.1| PREDICTED: endonuclease III-like protein 1 isoform X2 [Cricetulus 
griseus]
 ref|XP_007606634.1| PREDICTED: endonuclease III-like protein 1 isoform X2 [Cricetulus 
griseus]
Length=296

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            V  P NW++ L  I  MRS +DAPVD +G E    +S PPK RR+ +L+S +LSS
Sbjct  74   VWEPQNWQQQLANIQIMRSKKDAPVDQLGAEHCYDTSAPPKVRRYQILLSLMLSS  128



>ref|XP_010758802.1| hypothetical protein PADG_03264 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH47166.1| hypothetical protein PADG_03264 [Paracoccidioides brasiliensis 
Pb18]
Length=474

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSE-DAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            V+PP NWEK+ + + +MR     APVD+MGC +    S  P+ERRF +L++ +LSS
Sbjct  158  VEPPLNWEKIYDTVKEMRRKNPTAPVDTMGCSQLYWRSSSPRERRFHILIALMLSS  213



>ref|XP_006893938.1| PREDICTED: endonuclease III-like protein 1 [Elephantulus edwardii]
Length=297

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            P +W+K LE I  MRS +DAPVD +G E    SS PPK +R+ +L+S +LSS
Sbjct  74   PQDWQKQLENIRTMRSRKDAPVDRLGAEHCYDSSAPPKVQRYQILLSLMLSS  125



>ref|XP_007682471.1| hypothetical protein COCMIDRAFT_80033 [Bipolaris oryzae ATCC 
44560]
 gb|EUC51181.1| hypothetical protein COCMIDRAFT_80033 [Bipolaris oryzae ATCC 
44560]
Length=422

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            ++PP NWE++     +MR+   APVD+MGCE  A  S  P+++RF  L++ +LSS
Sbjct  131  IEPPANWEEIYALTREMRNENPAPVDTMGCESLADRSRTPRDQRFQTLIALMLSS  185



>ref|XP_002479601.1| DNA repair protein Ntg1, putative [Talaromyces stipitatus ATCC 
10500]
 gb|EED19167.1| DNA repair protein Ntg1, putative [Talaromyces stipitatus ATCC 
10500]
Length=448

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSE-DAPVDSMGC-EKAGSSLPPKERRFAVLVSSLLSS  553
            +QPP NWE +   + KMR+    APVD+MGC E    S PPK++RF  LV+ +LSS
Sbjct  131  MQPPSNWETMYNIVKKMRAENPTAPVDTMGCAELHWRSSPPKDQRFQTLVALMLSS  186



>ref|XP_003842328.1| similar to TPA: DNA repair protein Ntg1 [Leptosphaeria maculans 
JN3]
 emb|CBX98849.1| similar to TPA: DNA repair protein Ntg1 [Leptosphaeria maculans 
JN3]
Length=423

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            V+PP NWE++     +MR    APVD+MGCE  A  +  P++RRF  L++ +LSS
Sbjct  131  VEPPSNWEEIYALTREMRHENIAPVDTMGCESLAEKNRSPRDRRFQTLIALMLSS  185



>gb|KIJ95139.1| hypothetical protein K443DRAFT_683245 [Laccaria amethystina LaAM-08-1]
Length=366

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 13/123 (11%)
 Frame = +2

Query  224  EIVANEIE-------KESPNKKVLGLPDIEDFSYRKDA----INSQSTPVSSECMIGKEV  370
            EI A EIE       +    +K+  LPD+EDF   +D     ++   +   ++  +  + 
Sbjct  29   EIKAEEIEEPLRRSKRVKVEQKLDILPDLEDFKLVQDTPKKTVSISKSSSPAKSPVKAKP  88

Query  371  LSLSQKTVQP-PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG-SSLPPKERRFAVLVSSL  544
            +  + KT  P P  W++  + I +MRS   APVD+MGC++A      PK +RFA LVS +
Sbjct  89   IPQALKTPHPEPARWKETYDTIKEMRSKIVAPVDTMGCDQAQFKESDPKSQRFATLVSLM  148

Query  545  LSS  553
            LSS
Sbjct  149  LSS  151



>gb|KDO34426.1| hypothetical protein SPRG_01561 [Saprolegnia parasitica CBS 223.65]
Length=267

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            P NWE+V +GI  MR+   A VD+ GCE     SL P  RRF VLV+S+LSS
Sbjct  35   PANWEQVWDGITFMRAERTAAVDNQGCESFNDPSLAPPLRRFHVLVASMLSS  86



>gb|EEH18244.1| hypothetical protein PABG_00807 [Paracoccidioides brasiliensis 
Pb03]
Length=474

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSE-DAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            V+PP NWEK+ + + +MR     APVD+MGC +    S  P+ERRF +L++ +LSS
Sbjct  158  VEPPLNWEKIYDTVKEMRRKNPTAPVDTMGCSQLYWRSSSPRERRFHILIALMLSS  213



>gb|EFA08192.1| hypothetical protein TcasGA2_TC005819 [Tribolium castaneum]
Length=266

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG-SSLPPKERRFAVLVSSLLSS  553
            PP+WEK L  I +MR + DAPVDSMGC K    S  P+  R+  L++ +LSS
Sbjct  39   PPDWEKTLTNIREMRKNYDAPVDSMGCHKCTEESATPEVFRYQALLALMLSS  90



>ref|XP_007570289.1| PREDICTED: endonuclease III-like protein 1 [Poecilia formosa]
Length=404

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKE-RRFAVLVSSLLSS  553
            PP+W K L  I +MRS  DAPVD+MG EK   +  P   RRF VLVS +LSS
Sbjct  137  PPDWTKQLGFIREMRSGRDAPVDNMGAEKCYDTQAPAHVRRFQVLVSLMLSS  188



>ref|XP_004750781.1| PREDICTED: endonuclease III-like protein 1 isoform X3 [Mustela 
putorius furo]
 ref|XP_004820975.1| PREDICTED: endonuclease III-like protein 1 isoform X3 [Mustela 
putorius furo]
Length=360

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            PP+W++ L  I  MRS +DAPVD +G E     S PPK RR+ VL+S +LSS
Sbjct  111  PPDWQQQLVNIRTMRSGKDAPVDQLGAEHCYDPSAPPKVRRYQVLLSLMLSS  162



>ref|XP_003172336.1| DNA base excision repair N-glycosylase 1 [Microsporum gypseum 
CBS 118893]
 gb|EFR01925.1| DNA base excision repair N-glycosylase 1 [Microsporum gypseum 
CBS 118893]
Length=417

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 12/126 (10%)
 Frame = +2

Query  212  KKAVEIVANEIEKESPNKKVLGLP---DIEDF----SYRKDAINSQSTPVSSECMIGKEV  370
            ++AV+  A  ++KE      L  P   DIED       RK A       V +E      +
Sbjct  21   RQAVKTEAEAVKKEEDASSGLSSPPTTDIEDLLTATRKRKRAATRTRKAVKAEDGDAGRM  80

Query  371  LSLSQK---TVQPPPNWEKVLEGIHKMRSSE-DAPVDSMGC-EKAGSSLPPKERRFAVLV  535
              +  +    ++ PPNW+ + E + +MR     APVD+MGC E    S PP++RRF  L+
Sbjct  81   KGVKDEPGDDIKGPPNWQAIYETVKQMRERNPTAPVDTMGCAELYWQSSPPRDRRFHTLI  140

Query  536  SSLLSS  553
            + +LSS
Sbjct  141  ALMLSS  146



>ref|XP_006873933.1| PREDICTED: endonuclease III-like protein 1 [Chrysochloris asiatica]
Length=315

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            P +W + LE I  MRS +DAPVD +G E    S  PPK RRF VL+S +LSS
Sbjct  92   PRDWRQQLENIRAMRSRKDAPVDQLGVEHCYDSGAPPKVRRFQVLLSLMLSS  143



>ref|XP_010770720.1| PREDICTED: endonuclease III-like protein 1 [Notothenia coriiceps]
Length=403

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            PP+W+K L  I +MRSS DAPVD+MG EK   S      RRF VLVS +LSS
Sbjct  119  PPDWKKQLGYIREMRSSRDAPVDNMGAEKTYDSDATAHVRRFQVLVSLMLSS  170



>ref|XP_004750786.1| PREDICTED: endonuclease III-like protein 1 isoform X8 [Mustela 
putorius furo]
 ref|XP_004820980.1| PREDICTED: endonuclease III-like protein 1 isoform X8 [Mustela 
putorius furo]
Length=314

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            PP+W++ L  I  MRS +DAPVD +G E     S PPK RR+ VL+S +LSS
Sbjct  111  PPDWQQQLVNIRTMRSGKDAPVDQLGAEHCYDPSAPPKVRRYQVLLSLMLSS  162



>ref|XP_001833672.1| DNA-(apurinic or apyrimidinic site) lyase [Coprinopsis cinerea 
okayama7#130]
 gb|EAU88217.1| DNA-(apurinic or apyrimidinic site) lyase [Coprinopsis cinerea 
okayama7#130]
Length=450

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG-SSLPPKERRFAVLVSSLLSS  553
            P NW++V + I KMR S  APVD+MGC +A      PK +RFA LVS +LSS
Sbjct  152  PDNWKEVYDSIKKMRESIVAPVDTMGCAQAQYKETDPKNQRFATLVSLMLSS  203



>ref|XP_968911.2| PREDICTED: endonuclease III-like protein 1 [Tribolium castaneum]
Length=319

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAG-SSLPPKERRFAVLVSSLLSS  553
            PP+WEK L  I +MR + DAPVDSMGC K    S  P+  R+  L++ +LSS
Sbjct  92   PPDWEKTLTNIREMRKNYDAPVDSMGCHKCTEESATPEVFRYQALLALMLSS  143



>ref|XP_003857329.1| hypothetical protein MYCGRDRAFT_34626 [Zymoseptoria tritici IPO323]
 gb|EGP92305.1| hypothetical protein MYCGRDRAFT_34626 [Zymoseptoria tritici IPO323]
Length=407

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  392  VQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            + PPP+WE +   I  MRS   APVDSMGCE  A  +  P +RR   L++ +LSS
Sbjct  115  IHPPPDWETIWSHIATMRSLNPAPVDSMGCENLAEETRSPLDRRLQTLIALMLSS  169



>ref|XP_004486924.1| PREDICTED: endonuclease III-like protein 1-like [Cicer arietinum]
Length=319

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGSSLPPKERRFAVLVSSLLSS  553
            P NWE VLEGI KMR S+    ++ G  +    LP KERRFAVL SSLLSS
Sbjct  74   PANWENVLEGIRKMRCSD---AEATGDREDDDILPLKERRFAVLASSLLSS  121



>gb|KFP55474.1| Endonuclease III-like 1, partial [Cathartes aura]
Length=257

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKA-GSSLPPKERRFAVLVSSLLSS  553
            P +W + LE I +MRS+ DAPVD MG EK   SS PP+  R+ VL+S +LSS
Sbjct  35   PRDWRQQLERIREMRSNRDAPVDEMGVEKCYDSSAPPQVMRYQVLLSLMLSS  86



>gb|KER00405.1| hypothetical protein AUEXF2481DRAFT_34603 [Aureobasidium subglaciale 
EXF-2481]
Length=409

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  389  TVQPPPNWEKVLEGIHKMRSSEDAPVDSMGCEK-AGSSLPPKERRFAVLVSSLLSS  553
            TV+PPPNWE++     +MR    APVD+MGCE  A  S  P +RR   LV+ +LSS
Sbjct  118  TVEPPPNWEQMYSITAEMRKKVVAPVDTMGCESLAEESRSPIDRRLQTLVALMLSS  173



>ref|XP_004750784.1| PREDICTED: endonuclease III-like protein 1 isoform X6 [Mustela 
putorius furo]
 ref|XP_004820978.1| PREDICTED: endonuclease III-like protein 1 isoform X6 [Mustela 
putorius furo]
Length=330

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            PP+W++ L  I  MRS +DAPVD +G E     S PPK RR+ VL+S +LSS
Sbjct  56   PPDWQQQLVNIRTMRSGKDAPVDQLGAEHCYDPSAPPKVRRYQVLLSLMLSS  107



>ref|XP_004750780.1| PREDICTED: endonuclease III-like protein 1 isoform X2 [Mustela 
putorius furo]
 ref|XP_004820974.1| PREDICTED: endonuclease III-like protein 1 isoform X2 [Mustela 
putorius furo]
Length=362

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            PP+W++ L  I  MRS +DAPVD +G E     S PPK RR+ VL+S +LSS
Sbjct  111  PPDWQQQLVNIRTMRSGKDAPVDQLGAEHCYDPSAPPKVRRYQVLLSLMLSS  162



>ref|XP_004750785.1| PREDICTED: endonuclease III-like protein 1 isoform X7 [Mustela 
putorius furo]
 ref|XP_004820979.1| PREDICTED: endonuclease III-like protein 1 isoform X7 [Mustela 
putorius furo]
Length=320

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            PP+W++ L  I  MRS +DAPVD +G E     S PPK RR+ VL+S +LSS
Sbjct  46   PPDWQQQLVNIRTMRSGKDAPVDQLGAEHCYDPSAPPKVRRYQVLLSLMLSS  97



>ref|XP_004750779.1| PREDICTED: endonuclease III-like protein 1 isoform X1 [Mustela 
putorius furo]
 ref|XP_004820973.1| PREDICTED: endonuclease III-like protein 1 isoform X1 [Mustela 
putorius furo]
Length=385

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  401  PPNWEKVLEGIHKMRSSEDAPVDSMGCEKAGS-SLPPKERRFAVLVSSLLSS  553
            PP+W++ L  I  MRS +DAPVD +G E     S PPK RR+ VL+S +LSS
Sbjct  111  PPDWQQQLVNIRTMRSGKDAPVDQLGAEHCYDPSAPPKVRRYQVLLSLMLSS  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760