BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J18

Length=523
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008357155.1|  PREDICTED: 5'-3' exoribonuclease 3-like            179   4e-54   
ref|XP_009783160.1|  PREDICTED: 5'-3' exoribonuclease 3-like            190   7e-54   Nicotiana sylvestris
ref|XP_004171370.1|  PREDICTED: 5'-3' exoribonuclease 3-like            184   7e-53   
ref|XP_009784696.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      188   2e-52   Nicotiana sylvestris
ref|XP_009591834.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    190   3e-52   Nicotiana tomentosiformis
ref|XP_009591840.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    190   3e-52   Nicotiana tomentosiformis
emb|CBI19841.3|  unnamed protein product                                187   5e-52   Vitis vinifera
gb|EYU38836.1|  hypothetical protein MIMGU_mgv1a0003452mg               184   9e-52   Erythranthe guttata [common monkey flower]
gb|AAM97049.1|  unknown protein                                         186   9e-52   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA54013.1|  TPA: hypothetical protein ZEAMMB73_402768              184   1e-51   
ref|XP_006390286.1|  hypothetical protein EUTSA_v10018062mg             187   2e-51   Eutrema salsugineum [saltwater cress]
ref|XP_009627640.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    187   2e-51   Nicotiana tomentosiformis
emb|CDY47507.1|  BnaAnng09050D                                          187   2e-51   Brassica napus [oilseed rape]
ref|XP_009106215.1|  PREDICTED: 5'-3' exoribonuclease 3                 187   2e-51   Brassica rapa
ref|XP_010536355.1|  PREDICTED: 5'-3' exoribonuclease 3                 187   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_006342572.1|  PREDICTED: 5'-3' exoribonuclease 3-like            187   3e-51   
ref|XP_002280236.2|  PREDICTED: 5'-3' exoribonuclease 3                 187   3e-51   Vitis vinifera
ref|XP_011083514.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X2      187   3e-51   Sesamum indicum [beniseed]
ref|XP_011083513.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      187   3e-51   Sesamum indicum [beniseed]
ref|XP_004238343.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      187   3e-51   Solanum lycopersicum
ref|XP_011083517.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X5      187   3e-51   Sesamum indicum [beniseed]
ref|XP_011083515.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X3      187   3e-51   Sesamum indicum [beniseed]
ref|XP_004252797.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    187   4e-51   Solanum lycopersicum
ref|XP_010314645.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    187   4e-51   Solanum lycopersicum
ref|XP_006342032.1|  PREDICTED: 5'-3' exoribonuclease 3-like            187   4e-51   Solanum tuberosum [potatoes]
ref|XP_008465736.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X2      187   4e-51   Cucumis melo [Oriental melon]
ref|XP_008465734.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      187   4e-51   Cucumis melo [Oriental melon]
gb|AAF87130.1|AC006434_26  F10A5.15                                     186   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416454.1|  PREDICTED: 5'-3' exoribonuclease 3                 186   5e-51   Camelina sativa [gold-of-pleasure]
ref|NP_565114.1|  5'-3' exoribonuclease 3                               186   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428590.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    186   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010471679.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    186   6e-51   Camelina sativa [gold-of-pleasure]
emb|CDY39046.1|  BnaA02g17350D                                          186   9e-51   Brassica napus [oilseed rape]
emb|CDY13548.1|  BnaC02g23590D                                          186   9e-51   Brassica napus [oilseed rape]
ref|XP_002457601.1|  hypothetical protein SORBIDRAFT_03g010040          186   9e-51   Sorghum bicolor [broomcorn]
ref|XP_009128117.1|  PREDICTED: 5'-3' exoribonuclease 3-like            186   1e-50   Brassica rapa
ref|XP_010533698.1|  PREDICTED: 5'-3' exoribonuclease 3-like            186   1e-50   Tarenaya hassleriana [spider flower]
gb|EMT31761.1|  5'-3' exoribonuclease 3                                 185   1e-50   
ref|XP_002306919.2|  EXORIBONUCLEASE 2 family protein                   185   1e-50   
ref|XP_002445167.1|  hypothetical protein SORBIDRAFT_07g005160          185   1e-50   
ref|XP_006645089.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    185   1e-50   Oryza brachyantha
gb|KFK41999.1|  hypothetical protein AALP_AA2G199000                    185   1e-50   Arabis alpina [alpine rockcress]
gb|KDO84810.1|  hypothetical protein CISIN_1g001209mg                   183   2e-50   Citrus sinensis [apfelsine]
ref|XP_003564736.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      185   2e-50   Brachypodium distachyon [annual false brome]
ref|XP_010061039.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      185   2e-50   Eucalyptus grandis [rose gum]
ref|XP_002510514.1|  5'->3' exoribonuclease, putative                   185   2e-50   Ricinus communis
ref|XP_008673878.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    184   2e-50   Zea mays [maize]
ref|XP_004972701.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    184   2e-50   
gb|EMS57631.1|  5'-3' exoribonuclease 3                                 184   2e-50   Triticum urartu
ref|XP_010539049.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    184   2e-50   Tarenaya hassleriana [spider flower]
gb|KDO84809.1|  hypothetical protein CISIN_1g001209mg                   183   2e-50   Citrus sinensis [apfelsine]
ref|XP_004143781.1|  PREDICTED: 5'-3' exoribonuclease 3-like            184   2e-50   Cucumis sativus [cucumbers]
ref|XP_010539048.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    184   2e-50   Tarenaya hassleriana [spider flower]
ref|XP_009412009.1|  PREDICTED: 5'-3' exoribonuclease 3                 184   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010909408.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    184   2e-50   Elaeis guineensis
ref|XP_004967800.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    184   2e-50   Setaria italica
ref|XP_004972700.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    184   2e-50   Setaria italica
gb|KGN51170.1|  hypothetical protein Csa_5G471090                       184   3e-50   Cucumis sativus [cucumbers]
ref|XP_010909409.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    184   3e-50   Elaeis guineensis
dbj|BAB86550.1|  putative 5-3 exoribonuclease                           184   3e-50   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76660.1|  hypothetical protein OsI_04616                          184   3e-50   Oryza sativa Indica Group [Indian rice]
gb|EEE55749.1|  hypothetical protein OsJ_04252                          184   3e-50   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044947.1|  Os01g0872700                                       184   3e-50   
ref|XP_007160680.1|  hypothetical protein PHAVU_001G007900g             184   3e-50   Phaseolus vulgaris [French bean]
ref|XP_006300301.1|  hypothetical protein CARUB_v10019710mg             184   3e-50   Capsella rubella
ref|XP_010104435.1|  5'-3' exoribonuclease 3                            184   4e-50   
ref|XP_008677703.1|  PREDICTED: uncharacterized protein LOC100501...    184   4e-50   
gb|AFW61092.1|  hypothetical protein ZEAMMB73_651968                    184   4e-50   
ref|XP_009335203.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X2      184   5e-50   Pyrus x bretschneideri [bai li]
ref|XP_011045114.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-3' exorib...    184   5e-50   Populus euphratica
ref|XP_009335194.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      184   5e-50   Pyrus x bretschneideri [bai li]
ref|XP_007017771.1|  5'-3' exoribonuclease 3 isoform 1                  184   5e-50   
ref|XP_007017772.1|  5'-3' exoribonuclease 3 isoform 2                  184   5e-50   
ref|XP_008387954.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X2      183   6e-50   Malus domestica [apple tree]
gb|KDP36941.1|  hypothetical protein JCGZ_08232                         184   6e-50   Jatropha curcas
ref|XP_008387953.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      183   6e-50   Malus domestica [apple tree]
ref|XP_007225407.1|  hypothetical protein PRUPE_ppa000605mg             183   7e-50   Prunus persica
ref|XP_010255162.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      182   7e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010255163.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X2      182   7e-50   Nelumbo nucifera [Indian lotus]
ref|XP_006435154.1|  hypothetical protein CICLE_v10000087mg             183   8e-50   Citrus clementina [clementine]
ref|XP_006435155.1|  hypothetical protein CICLE_v10000087mg             183   8e-50   Citrus clementina [clementine]
ref|XP_008364939.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    183   8e-50   
gb|KDO84807.1|  hypothetical protein CISIN_1g001209mg                   183   8e-50   Citrus sinensis [apfelsine]
gb|KDO84806.1|  hypothetical protein CISIN_1g001209mg                   183   8e-50   Citrus sinensis [apfelsine]
ref|XP_011028986.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    183   8e-50   Populus euphratica
ref|XP_011028987.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    183   8e-50   Populus euphratica
gb|KJB59764.1|  hypothetical protein B456_009G270300                    183   9e-50   Gossypium raimondii
ref|XP_011028988.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    183   9e-50   Populus euphratica
gb|KDO84808.1|  hypothetical protein CISIN_1g001209mg                   183   9e-50   Citrus sinensis [apfelsine]
gb|KJB59762.1|  hypothetical protein B456_009G270300                    183   9e-50   Gossypium raimondii
gb|KJB59761.1|  hypothetical protein B456_009G270300                    183   1e-49   Gossypium raimondii
ref|XP_008364938.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    183   1e-49   
gb|KHG20595.1|  5'-3' exoribonuclease 3 -like protein                   183   1e-49   Gossypium arboreum [tree cotton]
ref|XP_006473637.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    183   1e-49   Citrus sinensis [apfelsine]
emb|CDP07414.1|  unnamed protein product                                183   1e-49   Coffea canephora [robusta coffee]
ref|XP_006473636.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    183   1e-49   Citrus sinensis [apfelsine]
gb|KJB59763.1|  hypothetical protein B456_009G270300                    182   1e-49   Gossypium raimondii
ref|XP_003549459.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    182   2e-49   Glycine max [soybeans]
ref|XP_006601346.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    182   2e-49   Glycine max [soybeans]
ref|XP_008221291.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X3      181   2e-49   
ref|XP_003545041.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    182   2e-49   Glycine max [soybeans]
ref|XP_008221289.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X2      182   2e-49   Prunus mume [ume]
ref|XP_007156369.1|  hypothetical protein PHAVU_003G280400g             182   2e-49   Phaseolus vulgaris [French bean]
ref|XP_006596562.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    182   2e-49   Glycine max [soybeans]
gb|KDP25015.1|  hypothetical protein JCGZ_23998                         182   2e-49   Jatropha curcas
gb|KHN39437.1|  5'-3' exoribonuclease 3                                 181   3e-49   Glycine soja [wild soybean]
ref|XP_010532420.1|  PREDICTED: 5'-3' exoribonuclease 3-like            181   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_008221288.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      181   3e-49   Prunus mume [ume]
ref|XP_011465800.1|  PREDICTED: 5'-3' exoribonuclease 3-like            179   5e-49   Fragaria vesca subsp. vesca
ref|XP_011459126.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X2      179   3e-48   Fragaria vesca subsp. vesca
ref|XP_004291380.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      179   3e-48   Fragaria vesca subsp. vesca
ref|XP_008808990.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      178   5e-48   Phoenix dactylifera
ref|XP_008808991.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X2      177   6e-48   Phoenix dactylifera
emb|CDX73185.1|  BnaC06g36330D                                          177   7e-48   
ref|XP_010244085.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    177   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010244084.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    177   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_004499238.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    177   1e-47   Cicer arietinum [garbanzo]
ref|XP_004499239.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    177   1e-47   Cicer arietinum [garbanzo]
ref|XP_005846916.1|  hypothetical protein CHLNCDRAFT_24310              165   3e-46   Chlorella variabilis
gb|KHG26578.1|  5'-3' exoribonuclease 3 -like protein                   173   3e-46   Gossypium arboreum [tree cotton]
gb|KIY97657.1|  5'-3' exoribonuclease 2                                 165   8e-46   Monoraphidium neglectum
dbj|BAB09325.1|  5'-3' exoribonuclease 2                                169   1e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAK32883.1|AF367296_1  AT5g42540/K16E1_1                             169   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279471.1|  hypothetical protein CARUB_v10025807mg             171   1e-45   Capsella rubella
ref|XP_010442174.1|  PREDICTED: 5'-3' exoribonuclease 2-like            171   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002865509.1|  hypothetical protein ARALYDRAFT_917497             171   2e-45   
ref|NP_199069.1|  5'-3' exoribonuclease 2                               170   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101845.1|  PREDICTED: 5'-3' exoribonuclease 2                 170   3e-45   Brassica rapa
ref|XP_010494189.1|  PREDICTED: 5'-3' exoribonuclease 2-like isof...    170   3e-45   Camelina sativa [gold-of-pleasure]
ref|NP_001190450.1|  5'-3' exoribonuclease 2                            170   3e-45   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93823.1|  5'-3' exoribonuclease 2                                170   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417024.1|  hypothetical protein EUTSA_v10009553mg             169   4e-45   
gb|KFK32919.1|  hypothetical protein AALP_AA6G306200                    169   4e-45   Arabis alpina [alpine rockcress]
ref|XP_010681159.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X2      170   4e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681153.1|  PREDICTED: 5'-3' exoribonuclease 3 isoform X1      170   4e-45   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB58125.1|  hypothetical protein B456_009G195600                    169   7e-45   Gossypium raimondii
gb|KJB58124.1|  hypothetical protein B456_009G195600                    169   9e-45   Gossypium raimondii
ref|XP_011011029.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    167   4e-44   Populus euphratica
ref|XP_011011028.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    167   4e-44   Populus euphratica
ref|XP_011011031.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    167   4e-44   Populus euphratica
ref|XP_011011030.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    167   4e-44   Populus euphratica
ref|XP_006375951.1|  hypothetical protein POPTR_0013s06720g             159   6e-44   
ref|XP_011396981.1|  5'-3' exoribonuclease 2                            165   9e-44   Auxenochlorella protothecoides
ref|XP_001418304.1|  predicted protein                                  162   5e-43   Ostreococcus lucimarinus CCE9901
gb|EJD76028.1|  hypothetical protein LOAG_16951                         151   7e-43   Loa loa
ref|XP_009602318.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    158   1e-42   Nicotiana tomentosiformis
ref|XP_010269902.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    162   2e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010269901.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    162   2e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010269899.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    162   2e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010269900.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    162   2e-42   Nelumbo nucifera [Indian lotus]
ref|NP_001170327.1|  uncharacterized protein LOC100384297               158   2e-42   
ref|XP_008797390.1|  PREDICTED: 5'-3' exoribonuclease 4-like            153   3e-42   Phoenix dactylifera
ref|XP_009602317.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    158   4e-42   Nicotiana tomentosiformis
ref|XP_002301985.1|  EXORIBONUCLEASE 2 family protein                   160   4e-42   
ref|XP_002301984.2|  hypothetical protein POPTR_0002s02570g             160   5e-42   
emb|CDP04956.1|  unnamed protein product                                151   6e-42   Coffea canephora [robusta coffee]
ref|XP_004172506.1|  PREDICTED: 5'-3' exoribonuclease 4-like            152   7e-42   
gb|AFW67375.1|  hypothetical protein ZEAMMB73_239358                    158   8e-42   
ref|XP_004981452.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    160   1e-41   Setaria italica
gb|KDO53276.1|  hypothetical protein CISIN_1g0021471mg                  155   1e-41   Citrus sinensis [apfelsine]
ref|XP_004981451.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    160   1e-41   Setaria italica
ref|XP_010919845.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-3' exorib...    159   2e-41   
ref|XP_008784687.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    159   2e-41   Phoenix dactylifera
ref|XP_008784686.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    159   2e-41   Phoenix dactylifera
emb|CDP08580.1|  unnamed protein product                                159   2e-41   Coffea canephora [robusta coffee]
ref|XP_002519992.1|  5'->3' exoribonuclease, putative                   160   2e-41   
ref|XP_010277307.1|  PREDICTED: 5'-3' exoribonuclease 4 isoform X1      159   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_009391174.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    158   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003080029.1|  putative 5-3 exoribonuclease (ISS)                 159   3e-41   Ostreococcus tauri
ref|XP_008644148.1|  PREDICTED: uncharacterized protein LOC100384...    158   3e-41   
dbj|BAJ85609.1|  predicted protein                                      158   4e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT08825.1|  5'-3' exoribonuclease 4                                 159   5e-41   
ref|XP_007147140.1|  hypothetical protein PHAVU_006G0992001g            153   5e-41   Phaseolus vulgaris [French bean]
gb|EYU37061.1|  hypothetical protein MIMGU_mgv1a002926mg                153   8e-41   Erythranthe guttata [common monkey flower]
ref|XP_010925975.1|  PREDICTED: 5'-3' exoribonuclease 4-like            153   8e-41   
ref|XP_009604765.1|  PREDICTED: 5'-3' exoribonuclease 4-like            152   1e-40   Nicotiana tomentosiformis
ref|XP_010228481.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-3' exorib...    157   1e-40   
ref|XP_006826276.1|  hypothetical protein AMTR_s00004p00046450          157   1e-40   Amborella trichopoda
gb|ACA05276.1|  putative ethylene insensitive 5/7                       155   1e-40   Solanum lycopersicum
ref|XP_008345760.1|  PREDICTED: 5'-3' exoribonuclease 4-like            151   1e-40   
ref|XP_003626391.1|  5'-3' exoribonuclease                              154   2e-40   
ref|XP_006392535.1|  hypothetical protein EUTSA_v10023239mg             156   2e-40   Eutrema salsugineum [saltwater cress]
ref|XP_011075832.1|  PREDICTED: 5'-3' exoribonuclease 3-like            155   2e-40   
ref|XP_004494674.1|  PREDICTED: 5'-3' exoribonuclease 4-like            156   2e-40   Cicer arietinum [garbanzo]
gb|ABF99327.1|  5'-3' exoribonuclease, putative, expressed              154   2e-40   Oryza sativa Japonica Group [Japonica rice]
gb|KJB45021.1|  hypothetical protein B456_007G285900                    155   3e-40   Gossypium raimondii
gb|EMS54431.1|  5'-3' exoribonuclease 4                                 156   3e-40   Triticum urartu
ref|XP_010511186.1|  PREDICTED: 5'-3' exoribonuclease 4                 155   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006433057.1|  hypothetical protein CICLE_v10000168mg             155   3e-40   Citrus clementina [clementine]
gb|AES82609.2|  5'-3' exoribonuclease                                   155   3e-40   Medicago truncatula
gb|ABF99328.1|  5'-3' exoribonuclease, putative, expressed              154   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003626390.1|  5'-3' exoribonuclease                              155   4e-40   Medicago truncatula
ref|XP_003057885.1|  predicted protein                                  150   4e-40   Micromonas pusilla CCMP1545
ref|XP_006340038.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    155   4e-40   Solanum tuberosum [potatoes]
gb|EYC03740.1|  hypothetical protein Y032_0092g2598                     147   4e-40   Ancylostoma ceylanicum
ref|XP_002466304.1|  hypothetical protein SORBIDRAFT_01g005340          155   4e-40   Sorghum bicolor [broomcorn]
ref|NP_001233774.1|  ethylene insensitive 5/7                           155   4e-40   Solanum lycopersicum
ref|XP_003591033.1|  5'-3' exoribonuclease                              155   5e-40   
ref|XP_010776763.1|  PREDICTED: 5'-3' exoribonuclease 2-like            146   5e-40   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010246757.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    155   5e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010246750.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    155   5e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008797339.1|  PREDICTED: 5'-3' exoribonuclease 4-like            153   6e-40   
gb|EAY92163.1|  hypothetical protein OsI_13876                          154   8e-40   Oryza sativa Indica Group [Indian rice]
gb|EAZ28895.1|  hypothetical protein OsJ_12935                          154   8e-40   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051542.1|  Os03g0794800                                       154   8e-40   
gb|KFM64851.1|  5'-3' exoribonuclease 2                                 146   9e-40   Stegodyphus mimosarum
ref|XP_007030645.1|  Exoribonuclease 4 isoform 1                        154   9e-40   
ref|XP_010917731.1|  PREDICTED: 5'-3' exoribonuclease 4 isoform X3      154   9e-40   
ref|XP_002275560.2|  PREDICTED: 5'-3' exoribonuclease 3-like            153   1e-39   Vitis vinifera
ref|XP_010246744.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    154   1e-39   Nelumbo nucifera [Indian lotus]
ref|XP_007513000.1|  predicted protein                                  154   1e-39   Bathycoccus prasinos
ref|XP_006301240.1|  hypothetical protein CARUB_v10021640mg             154   1e-39   Capsella rubella
ref|XP_006382752.1|  5'-3' exoribonuclease family protein               154   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010754608.1|  PREDICTED: 5'-3' exoribonuclease 2                 151   1e-39   
ref|XP_010917728.1|  PREDICTED: 5'-3' exoribonuclease 4 isoform X1      154   1e-39   Elaeis guineensis
ref|XP_011091940.1|  PREDICTED: 5'-3' exoribonuclease 4                 154   1e-39   Sesamum indicum [beniseed]
ref|XP_011032477.1|  PREDICTED: 5'-3' exoribonuclease 4                 154   1e-39   Populus euphratica
ref|XP_010917730.1|  PREDICTED: 5'-3' exoribonuclease 4 isoform X2      153   1e-39   Elaeis guineensis
ref|XP_002512252.1|  5'->3' exoribonuclease, putative                   153   2e-39   Ricinus communis
gb|KDP23624.1|  hypothetical protein JCGZ_23457                         153   2e-39   Jatropha curcas
ref|XP_004302012.1|  PREDICTED: 5'-3' exoribonuclease 4                 153   3e-39   Fragaria vesca subsp. vesca
ref|XP_010090276.1|  5'-3' exoribonuclease 4                            153   3e-39   Morus notabilis
ref|XP_003521740.1|  PREDICTED: 5'-3' exoribonuclease 4-like            153   3e-39   Glycine max [soybeans]
ref|XP_010659929.1|  PREDICTED: 5'-3' exoribonuclease 4                 153   3e-39   Vitis vinifera
gb|EJW76545.1|  hypothetical protein WUBG_12547                         141   3e-39   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_010102036.1|  5'-3' exoribonuclease 3                            153   3e-39   Morus notabilis
ref|XP_006604839.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    151   4e-39   
dbj|BAE21766.1|  unnamed protein product                                148   4e-39   Mus musculus [mouse]
emb|CBI34215.3|  unnamed protein product                                153   4e-39   Vitis vinifera
ref|XP_009017020.1|  hypothetical protein HELRODRAFT_191587             149   4e-39   Helobdella robusta
ref|XP_009765212.1|  PREDICTED: 5'-3' exoribonuclease 4                 152   4e-39   Nicotiana sylvestris
gb|KGN60833.1|  hypothetical protein Csa_2G012150                       152   4e-39   Cucumis sativus [cucumbers]
ref|XP_006606481.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    152   4e-39   
gb|KHG14334.1|  5'-3' exoribonuclease 4 -like protein                   152   5e-39   Gossypium arboreum [tree cotton]
ref|XP_006606480.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    152   5e-39   Glycine max [soybeans]
ref|XP_006606479.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    152   5e-39   Glycine max [soybeans]
ref|XP_006604838.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    152   5e-39   
gb|AAH47182.1|  5'-3' exoribonuclease 2                                 149   5e-39   Danio rerio [leopard danio]
ref|XP_004139217.1|  PREDICTED: 5'-3' exoribonuclease 4-like            152   6e-39   
ref|XP_010528793.1|  PREDICTED: 5'-3' exoribonuclease 4                 152   6e-39   Tarenaya hassleriana [spider flower]
ref|XP_008455748.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-3' exorib...    152   6e-39   Cucumis melo [Oriental melon]
gb|AAD25627.1|AC005287_29  Dhm1- and Dhm2-like protein                  152   7e-39   Arabidopsis thaliana [mouse-ear cress]
gb|ADN33909.1|  5'-3' exoribonuclease                                   152   7e-39   Cucumis melo subsp. melo
ref|NP_175851.1|  5'-3' exoribonuclease 4                               152   7e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003146304.1|  hypothetical protein LOAG_10732                    150   7e-39   
ref|XP_006604837.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    152   7e-39   Glycine max [soybeans]
ref|XP_009398534.1|  PREDICTED: 5'-3' exoribonuclease 4 isoform X1      152   8e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398535.1|  PREDICTED: 5'-3' exoribonuclease 4 isoform X2      152   8e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFO29062.1|  5'-3' exoribonuclease 2                                 152   8e-39   Fukomys damarensis [Damara mole rat]
ref|NP_001091411.1|  5'-3' exoribonuclease 2                            148   8e-39   Xenopus laevis [clawed frog]
ref|XP_003554686.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    151   8e-39   Glycine max [soybeans]
gb|AAI10279.1|  XRN2 protein                                            147   8e-39   Bos taurus [bovine]
ref|XP_011003775.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    151   8e-39   Populus euphratica
ref|XP_011003776.1|  PREDICTED: 5'-3' exoribonuclease 4-like isof...    151   9e-39   Populus euphratica
ref|XP_006389319.1|  5'-3' exoribonuclease family protein               151   1e-38   
ref|XP_010470344.1|  PREDICTED: 5'-3' exoribonuclease 4-like            151   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010414888.1|  PREDICTED: 5'-3' exoribonuclease 4-like            151   1e-38   Camelina sativa [gold-of-pleasure]
gb|KFK35629.1|  hypothetical protein AALP_AA4G015900                    151   1e-38   Arabis alpina [alpine rockcress]
gb|KJB80927.1|  hypothetical protein B456_013G121900                    151   1e-38   Gossypium raimondii
ref|XP_002129696.2|  PREDICTED: 5'-3' exoribonuclease 2                 150   1e-38   Ciona intestinalis [sea vase]
ref|XP_007421459.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      150   1e-38   Python bivittatus
ref|XP_006626263.1|  PREDICTED: 5'-3' exoribonuclease 2-like            150   1e-38   
ref|XP_008370675.1|  PREDICTED: 5'-3' exoribonuclease 4-like            150   2e-38   
ref|XP_007208373.1|  hypothetical protein PRUPE_ppa000881mg             150   2e-38   Prunus persica
gb|ETE62477.1|  5'-3' exoribonuclease 2                                 150   2e-38   Ophiophagus hannah
ref|XP_008218188.1|  PREDICTED: 5'-3' exoribonuclease 4                 150   2e-38   Prunus mume [ume]
gb|ETN69421.1|  5'-3' exoribonuclease 2 family protein                  150   2e-38   Necator americanus
ref|XP_004061937.1|  PREDICTED: 5'-3' exoribonuclease 2                 150   2e-38   
ref|XP_007421458.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      150   2e-38   Python bivittatus
ref|XP_003220116.1|  PREDICTED: 5'-3' exoribonuclease 2                 150   3e-38   Anolis carolinensis [Carolina anole]
ref|XP_004754179.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      150   3e-38   
ref|XP_009113432.1|  PREDICTED: 5'-3' exoribonuclease 4                 150   3e-38   Brassica rapa
ref|XP_007255509.1|  PREDICTED: 5'-3' exoribonuclease 2                 150   3e-38   Astyanax mexicanus [blind cave fish]
ref|XP_005287542.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      150   3e-38   Chrysemys picta bellii
emb|CDY42353.1|  BnaA09g15880D                                          150   3e-38   Brassica napus [oilseed rape]
ref|XP_007670702.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      150   3e-38   
ref|XP_004754180.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      150   3e-38   Mustela putorius furo [black ferret]
ref|XP_001505862.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      150   3e-38   
ref|XP_005381009.1|  PREDICTED: 5'-3' exoribonuclease 2                 150   4e-38   
ref|XP_005089229.1|  PREDICTED: 5'-3' exoribonuclease 2-like            149   4e-38   
ref|XP_008579788.1|  PREDICTED: 5'-3' exoribonuclease 2                 149   4e-38   
ref|XP_001373979.1|  PREDICTED: 5'-3' exoribonuclease 2                 149   4e-38   
ref|XP_004614470.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      149   5e-38   
ref|XP_005141329.1|  PREDICTED: 5'-3' exoribonuclease 2                 149   5e-38   
gb|KFP86359.1|  5'-3' exoribonuclease 2                                 149   5e-38   
ref|XP_005061789.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      149   5e-38   
ref|XP_009865126.1|  PREDICTED: 5'-3' exoribonuclease 2                 149   6e-38   
ref|XP_008290107.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X3      149   6e-38   
ref|XP_008290106.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      149   6e-38   
ref|XP_008290105.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      149   6e-38   
ref|XP_011237821.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      148   6e-38   
ref|XP_004909939.1|  PREDICTED: 5'-3' exoribonuclease 2                 149   6e-38   
gb|KFP05594.1|  5'-3' exoribonuclease 2                                 149   6e-38   
ref|NP_001001944.2|  5'-3' exoribonuclease 2                            149   6e-38   
ref|XP_008498185.1|  PREDICTED: 5'-3' exoribonuclease 2                 149   7e-38   
ref|XP_010573209.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      149   7e-38   
ref|XP_005160932.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      149   7e-38   
ref|XP_006277412.1|  PREDICTED: 5'-3' exoribonuclease 2                 149   7e-38   
ref|XP_514546.2|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1         149   7e-38   
ref|XP_004635642.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      149   7e-38   
ref|XP_003905183.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X4      149   7e-38   
ref|XP_002939479.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      149   7e-38   
ref|XP_006015484.1|  PREDICTED: 5'-3' exoribonuclease 2                 149   7e-38   
ref|NP_001126942.1|  5'-3' exoribonuclease 2                            149   7e-38   
ref|NP_036387.2|  5'-3' exoribonuclease 2                               149   8e-38   
gb|KFV70897.1|  5'-3' exoribonuclease 2                                 149   8e-38   
ref|XP_004310827.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   8e-38   
ref|XP_003268293.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform 1       149   8e-38   
dbj|BAG50941.1|  unnamed protein product                                149   8e-38   
ref|XP_010881049.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      149   8e-38   
gb|EHH19964.1|  5'-3' exoribonuclease 2                                 149   8e-38   
ref|XP_001094734.2|  PREDICTED: 5'-3' exoribonuclease 2 isoform 2       149   8e-38   
ref|XP_003933201.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      149   8e-38   
ref|XP_002747533.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      149   8e-38   
emb|CDJ90100.1|  Putative 5-3 exonuclease domain containing protein     149   8e-38   
ref|XP_005525544.1|  PREDICTED: 5'-3' exoribonuclease 2                 149   8e-38   
ref|XP_009214903.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X3      149   8e-38   
ref|XP_006062876.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      149   9e-38   
ref|XP_010881050.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      149   9e-38   
ref|XP_003798517.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform 1       149   9e-38   
ref|XP_009214901.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      149   9e-38   
ref|XP_009903519.1|  PREDICTED: 5'-3' exoribonuclease 2                 149   9e-38   
emb|CDX95202.1|  BnaC09g16680D                                          148   9e-38   
ref|XP_009214902.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      149   1e-37   
gb|EPS72691.1|  hypothetical protein M569_02065                         148   1e-37   
ref|XP_005486835.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
ref|XP_004270469.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform 1       148   1e-37   
ref|XP_007454593.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_007123054.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      148   1e-37   
dbj|BAA07524.1|  Dhm1 protein                                           148   1e-37   
ref|XP_009091990.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
ref|XP_006984543.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
ref|XP_007948551.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_004697859.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_007123053.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_003476505.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
emb|CDQ02791.1|  Protein Bm13934, isoform a                             147   1e-37   
gb|EFB14963.1|  hypothetical protein PANDA_012248                       148   1e-37   
ref|XP_004447816.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
gb|EHB18833.1|  5'-3' exoribonuclease 2                                 148   1e-37   
gb|EDL28516.1|  5'-3' exoribonuclease 2, isoform CRA_d                  148   1e-37   
emb|CBJ33698.1|  putative 5\'-3\' exoribonuclease (XRN3)                147   1e-37   
gb|EDL28513.1|  5'-3' exoribonuclease 2, isoform CRA_a                  148   1e-37   
ref|XP_004417185.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform 1       148   1e-37   
ref|XP_006770941.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
ref|XP_006860712.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_002923152.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
gb|ELK24810.1|  5'-3' exoribonuclease 2                                 148   1e-37   
ref|XP_010632508.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_008537069.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
ref|XP_002710988.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_006921609.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
ref|XP_005334667.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
ref|XP_007578512.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X3      148   1e-37   
ref|XP_006097595.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
ref|XP_010809536.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_003411764.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
ref|XP_008839491.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
dbj|BAC27318.1|  unnamed protein product                                148   1e-37   
ref|XP_008254552.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      148   1e-37   
ref|XP_008139355.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_004585703.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_007525482.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
dbj|BAE40020.1|  unnamed protein product                                148   1e-37   
ref|XP_008062737.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
ref|XP_005815715.1|  PREDICTED: 5'-3' exoribonuclease 2-like            147   1e-37   
ref|XP_011279284.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   1e-37   
ref|NP_036047.2|  5'-3' exoribonuclease 2                               148   1e-37   
ref|XP_005929989.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-3' exorib...    148   1e-37   
ref|XP_534324.2|  PREDICTED: 5'-3' exoribonuclease 2 isoform 2          148   1e-37   
ref|XP_005072623.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_008395179.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X4      148   1e-37   
ref|XP_005672806.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_008839499.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      148   1e-37   
emb|CAN59715.1|  hypothetical protein VITISV_006076                     148   1e-37   
ref|XP_006895715.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|XP_004687194.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   1e-37   
ref|NP_001179401.1|  5'-3' exoribonuclease 2                            148   1e-37   
ref|XP_007144805.1|  hypothetical protein PHAVU_007G185300g             148   1e-37   
ref|XP_006235218.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   2e-37   
gb|EDL95119.1|  5'-3' exoribonuclease 2 (predicted), isoform CRA_b      148   2e-37   
ref|XP_005365546.1|  PREDICTED: 5'-3' exoribonuclease 2                 148   2e-37   
ref|XP_008395177.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      148   2e-37   
ref|XP_007578510.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   2e-37   
ref|XP_008395176.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   2e-37   
ref|XP_004668797.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      148   2e-37   
ref|XP_006793554.1|  PREDICTED: 5'-3' exoribonuclease 2-like            148   2e-37   
ref|XP_005732784.1|  PREDICTED: 5'-3' exoribonuclease 2-like            148   2e-37   
ref|XP_007578511.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      148   2e-37   
ref|XP_008395178.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X3      147   2e-37   
ref|XP_008311830.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-3' exorib...    147   2e-37   
gb|ESA02001.1|  hypothetical protein GLOINDRAFT_254833                  141   2e-37   
gb|EYC03742.1|  hypothetical protein Y032_0092g2598                     147   2e-37   
emb|CDQ02790.1|  Protein Bm13934, isoform d                             147   2e-37   
ref|XP_004083793.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      147   2e-37   
emb|CDQ68545.1|  unnamed protein product                                147   2e-37   
ref|XP_009772135.1|  PREDICTED: 5'-3' exoribonuclease 3-like            135   2e-37   
emb|CDQ59224.1|  unnamed protein product                                147   2e-37   
ref|XP_004561180.1|  PREDICTED: 5'-3' exoribonuclease 2-like            147   2e-37   
ref|XP_011490208.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      147   2e-37   
ref|XP_005452477.1|  PREDICTED: 5'-3' exoribonuclease 2                 147   3e-37   
ref|XP_004376479.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform 1       147   3e-37   
ref|XP_010674889.1|  PREDICTED: 5'-3' exoribonuclease 4 isoform X1      147   3e-37   
gb|KIH67513.1|  phage uncharacterized protein                           147   3e-37   
ref|XP_010025063.1|  PREDICTED: 5'-3' exoribonuclease 4 isoform X1      147   3e-37   
gb|AAD55138.1|AF064257_1  Dhm1-like protein                             147   3e-37   
ref|XP_010025064.1|  PREDICTED: 5'-3' exoribonuclease 4 isoform X2      147   3e-37   
emb|CAG01470.1|  unnamed protein product                                146   3e-37   
ref|XP_001901438.1|  5'-3' exoribonuclease 2                            147   3e-37   
gb|KDR24133.1|  5'-3' exoribonuclease 2-like protein                    147   4e-37   
ref|XP_010025065.1|  PREDICTED: 5'-3' exoribonuclease 4 isoform X3      147   4e-37   
gb|KHN80502.1|  5'-3' exoribonuclease 2 -like protein                   144   4e-37   
ref|XP_010704682.1|  PREDICTED: 5'-3' exoribonuclease 2                 147   4e-37   
ref|XP_011311873.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         146   5e-37   
ref|NP_001026204.1|  5'-3' exoribonuclease 2                            146   5e-37   
sp|Q60SG7.2|XRN2_CAEBR  RecName: Full=5'-3' exoribonuclease 2 hom...    146   6e-37   
ref|XP_002631701.1|  C. briggsae CBR-XRN-2 protein                      146   6e-37   
ref|XP_008388648.1|  PREDICTED: 5'-3' exoribonuclease 4-like            146   8e-37   
ref|XP_007208727.1|  hypothetical protein PRUPE_ppa026356m1g            138   8e-37   
emb|CDY22389.1|  BnaA06g37110D                                          146   8e-37   
ref|XP_003759325.1|  PREDICTED: 5'-3' exoribonuclease 2-like            134   8e-37   
ref|XP_009364546.1|  PREDICTED: 5'-3' exoribonuclease 4 isoform X1      146   9e-37   
ref|XP_010651920.1|  PREDICTED: 5'-3' exoribonuclease 3-like            145   9e-37   
ref|XP_010096460.1|  5'-3' exoribonuclease 4                            146   1e-36   
ref|XP_006623437.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         145   1e-36   
ref|NP_496958.2|  Protein XRN-2                                         145   1e-36   
ref|XP_003696690.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         145   1e-36   
ref|XP_392371.3|  PREDICTED: 5'-3' exoribonuclease 2 homolog            145   1e-36   
dbj|GAA49686.1|  5'-3' exoribonuclease 2                                139   1e-36   
ref|XP_010931149.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-3' exorib...    145   1e-36   
ref|NP_001279467.1|  5'-3' exoribonuclease 2                            145   1e-36   
ref|XP_007896537.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X2      145   2e-36   
ref|XP_008246158.1|  PREDICTED: 5'-3' exoribonuclease 3-like            137   2e-36   
ref|XP_795068.3|  PREDICTED: 5'-3' exoribonuclease 2 isoform 2          145   2e-36   
gb|EFN70493.1|  5'-3' exoribonuclease 2-like protein                    142   2e-36   
ref|XP_003728421.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform 1       145   2e-36   
emb|CEG71901.1|  hypothetical protein RMATCC62417_07551                 144   2e-36   
ref|XP_003489200.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         144   2e-36   
emb|CEI91124.1|  hypothetical protein RMCBS344292_05424                 144   2e-36   
ref|XP_008558084.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         144   2e-36   
emb|CBI28264.3|  unnamed protein product                                142   2e-36   
gb|EHB09477.1|  5'-3' exoribonuclease 2                                 135   3e-36   
gb|EGT40802.1|  hypothetical protein CAEBREN_29959                      144   3e-36   
ref|XP_008552198.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         144   3e-36   
emb|CEI90488.1|  hypothetical protein RMCBS344292_04813                 144   3e-36   
ref|XP_011349523.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog i...    144   3e-36   
gb|EFX85144.1|  hypothetical protein DAPPUDRAFT_194028                  144   3e-36   
ref|XP_011349524.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog i...    144   4e-36   
ref|XP_003386373.1|  PREDICTED: 5'-3' exoribonuclease 2-like            144   4e-36   
ref|XP_011349526.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog i...    144   4e-36   
ref|XP_003113732.1|  CRE-XRN-2 protein                                  144   4e-36   
ref|XP_011505747.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         144   4e-36   
ref|XP_011349525.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog i...    144   4e-36   
gb|EMT04727.1|  5'-3' exoribonuclease 3                                 144   4e-36   
ref|XP_008468375.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         144   5e-36   
gb|AAQ13577.1|AF152169_1  DHP protein                                   144   5e-36   
gb|EGI61520.1|  5'-3' exoribonuclease 2-like protein                    143   5e-36   
ref|XP_011349522.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog i...    144   5e-36   
ref|XP_002169407.2|  PREDICTED: LOW QUALITY PROTEIN: 5'-3' exorib...    144   5e-36   
gb|ERG79053.1|  5 -3 exoribonuclease 2-like protein                     143   5e-36   
ref|XP_003971477.1|  PREDICTED: 5'-3' exoribonuclease 2-like            144   5e-36   
ref|XP_011061071.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         144   5e-36   
emb|CEF68632.1|  5'-3' exoribonuclease 2 homolog                        143   5e-36   
gb|EPB81078.1|  hypothetical protein HMPREF1544_12221                   143   6e-36   
ref|XP_011469632.1|  PREDICTED: 5'-3' exoribonuclease 3-like isof...    143   6e-36   
ref|XP_003395847.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         143   6e-36   
emb|CCD60472.1|  5'-3' exoribonuclease, putative                        143   7e-36   
ref|XP_003702682.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         143   8e-36   
ref|XP_011253087.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         142   9e-36   
gb|KGB39210.1|  5'-3' exoribonuclease 2-like protein                    143   9e-36   
gb|EFZ21920.1|  hypothetical protein SINV_00544                         142   1e-35   
ref|XP_011451792.1|  PREDICTED: 5'-3' exoribonuclease 2-like isof...    142   1e-35   
ref|XP_011451785.1|  PREDICTED: 5'-3' exoribonuclease 2-like isof...    142   1e-35   
ref|XP_001651597.1|  AAEL015316-PA                                      134   1e-35   
gb|EKC34564.1|  5'-3' exoribonuclease 2                                 142   1e-35   
ref|XP_005061788.1|  PREDICTED: 5'-3' exoribonuclease 2 isoform X1      142   1e-35   
gb|EFN83355.1|  5'-3' exoribonuclease 2-like protein                    142   2e-35   
ref|XP_011172786.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         142   2e-35   
ref|XP_003363975.2|  PREDICTED: 5'-3' exoribonuclease 2 isoform 2       142   2e-35   
emb|CEF68627.1|  5'-3' exoribonuclease 2 homolog                        142   2e-35   
ref|XP_011141155.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         142   2e-35   
gb|EIE82069.1|  hypothetical protein RO3G_06774                         142   2e-35   
ref|XP_008195661.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         141   3e-35   
ref|XP_003240404.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         141   3e-35   
ref|XP_003373500.1|  5'-3' exoribonuclease 2                            140   4e-35   
gb|EFA06899.1|  hypothetical protein TcasGA2_TC009846                   141   4e-35   
ref|XP_003738141.1|  PREDICTED: 5'-3' exoribonuclease 2 homolog         141   4e-35   
gb|EXX73899.1|  Rat1p                                                   141   4e-35   
ref|XP_002523870.1|  5'->3' exoribonuclease, putative                   141   4e-35   
ref|XP_002199834.1|  PREDICTED: 5'-3' exoribonuclease 2                 140   5e-35   
gb|EWM27232.1|  5 -3 exoribonuclease 2                                  141   6e-35   
gb|ERL89121.1|  hypothetical protein D910_06497                         140   7e-35   
ref|XP_002426492.1|  5'-3' exoribonuclease, putative                    140   8e-35   
gb|KJB83658.1|  hypothetical protein B456_013G257000                    140   9e-35   
ref|XP_004925723.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-3' exorib...    140   1e-34   
gb|ENN81000.1|  hypothetical protein YQE_02584                          139   1e-34   
ref|XP_003297277.1|  hypothetical protein PTT_07622                     139   1e-34   
emb|CBY24162.1|  unnamed protein product                                139   1e-34   
emb|CBY35616.1|  unnamed protein product                                139   1e-34   
gb|KIK44443.1|  hypothetical protein CY34DRAFT_623553                   131   2e-34   



>ref|XP_008357155.1| PREDICTED: 5'-3' exoribonuclease 3-like [Malus domestica]
Length=137

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +V+VDV+EEE VVI+ V IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVIVDVVEEEPVVIDDVSIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_009783160.1| PREDICTED: 5'-3' exoribonuclease 3-like, partial [Nicotiana sylvestris]
Length=539

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKYSMV+VDVIEEEA VIEG+K+PVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYSMVIVDVIEEEAAVIEGIKVPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF CMFDYIDRLF MVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFHCMFDYIDRLFSMVRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_004171370.1| PREDICTED: 5'-3' exoribonuclease 3-like [Cucumis sativus]
Length=373

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE VVI+G+ IPVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVVIDGIAIPVDTSKPNPNKLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFSEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_009784696.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Nicotiana sylvestris]
Length=784

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MV+VDVIEEEAVVIEGVKIPVDTSKPNPN IE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYQMVIVDVIEEEAVVIEGVKIPVDTSKPNPNKIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFSMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_009591834.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1111

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKYSMV+VDVIEEEA VIEG+K+PVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYSMVIVDVIEEEAAVIEGIKVPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFHCMFDYIDRLFSMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_009591840.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1107

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKYSMV+VDVIEEEA VIEG+K+PVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYSMVIVDVIEEEAAVIEGIKVPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFHCMFDYIDRLFSMVRPRKLLYMAIDGVAPRAKMNQ  113



>emb|CBI19841.3| unnamed protein product [Vitis vinifera]
Length=870

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE V I+G+ IPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVEIDGISIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|EYU38836.1| hypothetical protein MIMGU_mgv1a0003452mg, partial [Erythranthe 
guttata]
Length=565

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V IEGVKIPVDTSKPNPN IE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVDIEGVKIPVDTSKPNPNKIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP TF+EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPATFDEVFQCIFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|AAM97049.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15494.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   186 bits (473),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWLAEKY ++V DVIEEE V IEG+KIPVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLAEKYPLLVADVIEEEPVEIEGIKIPVDTSKPNPNNLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>tpg|DAA54013.1| TPA: hypothetical protein ZEAMMB73_402768 [Zea mays]
Length=591

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V IEGVK+PVDTSKPNPN++EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIEGVKVPVDTSKPNPNSLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPR+LLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFGEVFQCMFDYIDRLFVMVRPRRLLYMAIDGVAPRAKMNQ  113



>ref|XP_006390286.1| hypothetical protein EUTSA_v10018062mg [Eutrema salsugineum]
 gb|ESQ27572.1| hypothetical protein EUTSA_v10018062mg [Eutrema salsugineum]
Length=1023

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY M+V DV+EEE V IEGVKIPVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMIVADVVEEEPVEIEGVKIPVDTSKPNPNNLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_009627640.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1083

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MV+VDVIEEEAVVIEGVKIPVDTSKPNPN IE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYQMVIVDVIEEEAVVIEGVKIPVDTSKPNPNKIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFSMVRPRKLLYMAIDGVAPRAKMNQ  113



>emb|CDY47507.1| BnaAnng09050D [Brassica napus]
Length=1014

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++V DV+EEEAV IEG+KIPVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVSDVVEEEAVEIEGIKIPVDTSKPNPNNLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_009106215.1| PREDICTED: 5'-3' exoribonuclease 3 [Brassica rapa]
Length=1015

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++V DV+EEEAV IEG+KIPVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVSDVVEEEAVEIEGIKIPVDTSKPNPNNLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010536355.1| PREDICTED: 5'-3' exoribonuclease 3 [Tarenaya hassleriana]
Length=1060

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++VVDVIEEE VVIEGVKIPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVVDVIEEEPVVIEGVKIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLF+MVRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFIMVRPRKILYMAIDGVAPRAKMNQ  113



>ref|XP_006342572.1| PREDICTED: 5'-3' exoribonuclease 3-like [Solanum tuberosum]
Length=1117

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKYSMV+VD+IEEEA VIEG+K P+DTSKPNPNNIE+DNLYLDMNGI+H
Sbjct  1    MGVPAFYRWLAEKYSMVIVDIIEEEAPVIEGIKFPLDTSKPNPNNIEYDNLYLDMNGIVH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFHCMFDYIDRLFSMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_002280236.2| PREDICTED: 5'-3' exoribonuclease 3 [Vitis vinifera]
Length=1065

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE V I+G+ IPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVEIDGISIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_011083514.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X2 [Sesamum indicum]
Length=1088

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDVIEEEAVVIEGVKIPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVIEEEAVVIEGVKIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCIFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_011083513.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Sesamum indicum]
Length=1092

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDVIEEEAVVIEGVKIPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVIEEEAVVIEGVKIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCIFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_004238343.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Solanum lycopersicum]
Length=1109

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEEAVVIE V+IPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEAVVIEDVRIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFECMFDYIDRLFSMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_011083517.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X5 [Sesamum indicum]
Length=1058

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDVIEEEAVVIEGVKIPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVIEEEAVVIEGVKIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCIFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_011083515.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X3 [Sesamum indicum]
Length=1062

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDVIEEEAVVIEGVKIPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVIEEEAVVIEGVKIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCIFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_004252797.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Solanum lycopersicum]
Length=1116

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKYSMV+VDVIEEEA VIEG+K P+DTSKPNPNNIE+DNLYLDMNGI+H
Sbjct  1    MGVPAFYRWLAEKYSMVIVDVIEEEAPVIEGIKFPLDTSKPNPNNIEYDNLYLDMNGIVH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFNCMFDYIDRLFSMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010314645.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Solanum lycopersicum]
Length=1120

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKYSMV+VDVIEEEA VIEG+K P+DTSKPNPNNIE+DNLYLDMNGI+H
Sbjct  1    MGVPAFYRWLAEKYSMVIVDVIEEEAPVIEGIKFPLDTSKPNPNNIEYDNLYLDMNGIVH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFNCMFDYIDRLFSMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_006342032.1| PREDICTED: 5'-3' exoribonuclease 3-like [Solanum tuberosum]
Length=1099

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEEAVVIE V+IPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEAVVIEDVRIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFECMFDYIDRLFSMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008465736.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X2 [Cucumis melo]
Length=1105

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE VVI+G+ IPVDTSKPNPNN+EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVVIDGIAIPVDTSKPNPNNLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFSEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008465734.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Cucumis melo]
 ref|XP_008465735.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Cucumis melo]
Length=1109

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE VVI+G+ IPVDTSKPNPNN+EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVVIDGIAIPVDTSKPNPNNLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFSEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|AAF87130.1|AC006434_26 F10A5.15 [Arabidopsis thaliana]
Length=1037

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWLAEKY ++V DVIEEE V IEG+KIPVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLAEKYPLLVADVIEEEPVEIEGIKIPVDTSKPNPNNLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010416454.1| PREDICTED: 5'-3' exoribonuclease 3 [Camelina sativa]
Length=1032

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWLAEKY ++V DVIEEE V IEG+KIPVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLAEKYPLLVADVIEEEPVEIEGIKIPVDTSKPNPNNLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|NP_565114.1| 5'-3' exoribonuclease 3 [Arabidopsis thaliana]
 sp|Q9FQ03.1|XRN3_ARATH RecName: Full=5'-3' exoribonuclease 3; AltName: Full=Protein 
EXORIBONUCLEASE 3 [Arabidopsis thaliana]
 gb|AAG40732.1|AF286719_1 XRN3 [Arabidopsis thaliana]
 gb|AEE35742.1| 5'-3' exoribonuclease 3 [Arabidopsis thaliana]
Length=1020

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWLAEKY ++V DVIEEE V IEG+KIPVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLAEKYPLLVADVIEEEPVEIEGIKIPVDTSKPNPNNLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010428590.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Camelina 
sativa]
Length=1044

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWLAEKY ++V DVIEEE V IEG+KIPVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLAEKYPLLVADVIEEEPVEIEGIKIPVDTSKPNPNNLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010471679.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Camelina 
sativa]
Length=1049

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWLAEKY ++V DVIEEE V IEG+KIPVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLAEKYPLLVADVIEEEPVEIEGIKIPVDTSKPNPNNLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>emb|CDY39046.1| BnaA02g17350D [Brassica napus]
Length=1038

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++V DV+EEEAV IEG+KIPVDTSKPNPN++E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVSDVVEEEAVEIEGIKIPVDTSKPNPNDLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>emb|CDY13548.1| BnaC02g23590D [Brassica napus]
Length=1030

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++V DV+EEEAV IEG+KIPVDTSKPNPN++E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVSDVVEEEAVEIEGIKIPVDTSKPNPNDLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_002457601.1| hypothetical protein SORBIDRAFT_03g010040 [Sorghum bicolor]
 gb|EES02721.1| hypothetical protein SORBIDRAFT_03g010040 [Sorghum bicolor]
Length=1066

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V IEGVK+PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIEGVKVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_009128117.1| PREDICTED: 5'-3' exoribonuclease 3-like [Brassica rapa]
Length=1036

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++V DV+EEEAV IEG+KIPVDTSKPNPN++E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVSDVVEEEAVEIEGIKIPVDTSKPNPNDLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010533698.1| PREDICTED: 5'-3' exoribonuclease 3-like [Tarenaya hassleriana]
Length=1053

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++VVDV+EEE VVIEGVKIPVDTSKPNPN++E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVVDVVEEEPVVIEGVKIPVDTSKPNPNDLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|EMT31761.1| 5'-3' exoribonuclease 3 [Aegilops tauschii]
Length=1053

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V IEGV++PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIEGVQVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLF+MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFIMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_002306919.2| EXORIBONUCLEASE 2 family protein [Populus trichocarpa]
 gb|EEE93915.2| EXORIBONUCLEASE 2 family protein [Populus trichocarpa]
Length=1052

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE VVIEGVKIPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVVIEGVKIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFGEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_002445167.1| hypothetical protein SORBIDRAFT_07g005160 [Sorghum bicolor]
 gb|EES14662.1| hypothetical protein SORBIDRAFT_07g005160 [Sorghum bicolor]
Length=945

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V IEGV++PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIEGVRVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLF+MVRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFKCMFDYIDRLFIMVRPRKLMYMAIDGVAPRAKMNQ  113



>ref|XP_006645089.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Oryza brachyantha]
Length=1066

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEEAV IEGVK+PVDTSKPNPN++EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEAVEIEGVKVPVDTSKPNPNSLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KFK41999.1| hypothetical protein AALP_AA2G199000 [Arabis alpina]
Length=1031

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++V DV+EEEAV IEGVKIPVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVSDVVEEEAVEIEGVKIPVDTSKPNPNNLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TFEEVF+CMFDYIDRLFVMVRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFEEVFQCMFDYIDRLFVMVRPRKILYMAIDGVAPRAKMNQ  113



>gb|KDO84810.1| hypothetical protein CISIN_1g001209mg [Citrus sinensis]
Length=789

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VV DVIEEE VVI+GVKIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVADVIEEEPVVIDGVKIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_003564736.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Brachypodium distachyon]
Length=1061

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V IEGVK+PVDTSKPNPN++EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIEGVKVPVDTSKPNPNSLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFVMVRPRKLMYMAIDGVAPRAKMNQ  113



>ref|XP_010061039.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Eucalyptus grandis]
 gb|KCW67941.1| hypothetical protein EUGRSUZ_F01638 [Eucalyptus grandis]
Length=1073

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE VVI+GV IPVDTSKPNPN+IEFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVVIDGVPIPVDTSKPNPNSIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF EVF CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFNEVFECMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_002510514.1| 5'->3' exoribonuclease, putative [Ricinus communis]
 gb|EEF52701.1| 5'->3' exoribonuclease, putative [Ricinus communis]
Length=1113

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVD IEEE VVI+GVKIPVD S+PNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDAIEEEPVVIDGVKIPVDASRPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+FEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008673878.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Zea mays]
 tpg|DAA54014.1| TPA: hypothetical protein ZEAMMB73_402768 [Zea mays]
Length=1066

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V IEGVK+PVDTSKPNPN++EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIEGVKVPVDTSKPNPNSLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPR+LLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFGEVFQCMFDYIDRLFVMVRPRRLLYMAIDGVAPRAKMNQ  113



>ref|XP_004972701.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Setaria italica]
Length=1048

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V I GV++PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIGGVRVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFVMVRPRKLMYMAIDGVAPRAKMNQ  113



>gb|EMS57631.1| 5'-3' exoribonuclease 3 [Triticum urartu]
Length=1033

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V IEGV++PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIEGVQVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLF+MVRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFIMVRPRKLMYMAIDGVAPRAKMNQ  113



>ref|XP_010539049.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Tarenaya 
hassleriana]
Length=930

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++V DV+EE+ V I+GVKIPVDT KPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVQDVVEEQPVEIDGVKIPVDTRKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFSEVFQCVFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KDO84809.1| hypothetical protein CISIN_1g001209mg [Citrus sinensis]
Length=819

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VV DVIEEE VVI+GVKIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVADVIEEEPVVIDGVKIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_004143781.1| PREDICTED: 5'-3' exoribonuclease 3-like [Cucumis sativus]
Length=1101

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE VVI+G+ IPVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVVIDGIAIPVDTSKPNPNKLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFSEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010539048.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Tarenaya 
hassleriana]
Length=934

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++V DV+EE+ V I+GVKIPVDT KPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVQDVVEEQPVEIDGVKIPVDTRKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFSEVFQCVFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_009412009.1| PREDICTED: 5'-3' exoribonuclease 3 [Musa acuminata subsp. malaccensis]
Length=1109

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V IEGVK+PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIEGVKVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCIFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010909408.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Elaeis guineensis]
Length=1106

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEEAV I+GVKIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEAVEIDGVKIPVDTSKPNPNGMEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_004967800.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Setaria italica]
Length=1074

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEEAV IEGVK+PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEAVEIEGVKVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPR+LLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFGEVFQCMFDYIDRLFVMVRPRRLLYMAIDGVAPRAKMNQ  113



>ref|XP_004972700.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Setaria italica]
Length=1064

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V I GV++PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIGGVRVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFVMVRPRKLMYMAIDGVAPRAKMNQ  113



>gb|KGN51170.1| hypothetical protein Csa_5G471090 [Cucumis sativus]
Length=1105

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE VVI+G+ IPVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVVIDGIAIPVDTSKPNPNKLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFSEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010909409.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Elaeis guineensis]
Length=1074

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEEAV I+GVKIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEAVEIDGVKIPVDTSKPNPNGMEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>dbj|BAB86550.1| putative 5-3 exoribonuclease [Oryza sativa Japonica Group]
Length=1064

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEEAV IEGVK+PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEAVEIEGVKVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFVMVRPRKLMYMAIDGVAPRAKMNQ  113



>gb|EAY76660.1| hypothetical protein OsI_04616 [Oryza sativa Indica Group]
Length=1068

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEEAV IEGVK+PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEAVEIEGVKVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFVMVRPRKLMYMAIDGVAPRAKMNQ  113



>gb|EEE55749.1| hypothetical protein OsJ_04252 [Oryza sativa Japonica Group]
Length=1042

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEEAV IEGVK+PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEAVEIEGVKVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFVMVRPRKLMYMAIDGVAPRAKMNQ  113



>ref|NP_001044947.1| Os01g0872700 [Oryza sativa Japonica Group]
 dbj|BAD82721.1| putative 5'-3' exoribonuclease (XRN3) [Oryza sativa Japonica 
Group]
 dbj|BAF06861.1| Os01g0872700 [Oryza sativa Japonica Group]
 dbj|BAG94577.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1068

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEEAV IEGVK+PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEAVEIEGVKVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFVMVRPRKLMYMAIDGVAPRAKMNQ  113



>ref|XP_007160680.1| hypothetical protein PHAVU_001G007900g [Phaseolus vulgaris]
 gb|ESW32674.1| hypothetical protein PHAVU_001G007900g [Phaseolus vulgaris]
Length=1067

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MV+VD IEEEAVVI+G++IPVDTSK NPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVIVDAIEEEAVVIDGIQIPVDTSKENPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F+EVF CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFDEVFECMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_006300301.1| hypothetical protein CARUB_v10019710mg [Capsella rubella]
 gb|EOA33199.1| hypothetical protein CARUB_v10019710mg [Capsella rubella]
Length=1024

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWLAEKY ++V DVIEEE V IEG+KIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLAEKYPLLVADVIEEEPVEIEGIKIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010104435.1| 5'-3' exoribonuclease 3 [Morus notabilis]
 gb|EXC00968.1| 5'-3' exoribonuclease 3 [Morus notabilis]
Length=1082

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDV+EEE VVI+ V IPVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVVEEEPVVIDDVSIPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008677703.1| PREDICTED: uncharacterized protein LOC100501093 isoform X1 [Zea 
mays]
 gb|AFW61091.1| hypothetical protein ZEAMMB73_651968 [Zea mays]
Length=1058

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V IEGV++PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIEGVRVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLF+MVRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFIMVRPRKLMYMAIDGVAPRAKMNQ  113



>gb|AFW61092.1| hypothetical protein ZEAMMB73_651968 [Zea mays]
Length=1079

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V IEGV++PVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIEGVRVPVDTSKPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF EVF+CMFDYIDRLF+MVRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFAEVFQCMFDYIDRLFIMVRPRKLMYMAIDGVAPRAKMNQ  113



>ref|XP_009335203.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X2 [Pyrus x bretschneideri]
Length=1065

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +V+VDV+EEE VVI+ V IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVIVDVVEEEPVVIDDVSIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_011045114.1| PREDICTED: LOW QUALITY PROTEIN: 5'-3' exoribonuclease 3 [Populus 
euphratica]
Length=1094

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VV DVIEEE VVIEGVKIPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVADVIEEEPVVIEGVKIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F EVF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFGEVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_009335194.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Pyrus x bretschneideri]
Length=1069

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +V+VDV+EEE VVI+ V IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVIVDVVEEEPVVIDDVSIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_007017771.1| 5'-3' exoribonuclease 3 isoform 1 [Theobroma cacao]
 gb|EOY14996.1| 5'-3' exoribonuclease 3 isoform 1 [Theobroma cacao]
Length=1106

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +V++DVIEEE VVI+GV IPVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVIMDVIEEEPVVIDGVSIPVDTSKPNPNKLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_007017772.1| 5'-3' exoribonuclease 3 isoform 2 [Theobroma cacao]
 gb|EOY14997.1| 5'-3' exoribonuclease 3 isoform 2 [Theobroma cacao]
Length=1110

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +V++DVIEEE VVI+GV IPVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVIMDVIEEEPVVIDGVSIPVDTSKPNPNKLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_008387954.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X2 [Malus domestica]
Length=1065

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +V+VDV+EEE VVI+ V IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVIVDVVEEEPVVIDDVSIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KDP36941.1| hypothetical protein JCGZ_08232 [Jatropha curcas]
Length=1122

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE+VVI+GV IPVDTS+PNPN+IE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEESVVIDGVNIPVDTSRPNPNSIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008387953.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Malus domestica]
Length=1069

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +V+VDV+EEE VVI+ V IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVIVDVVEEEPVVIDDVSIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_007225407.1| hypothetical protein PRUPE_ppa000605mg [Prunus persica]
 gb|EMJ26606.1| hypothetical protein PRUPE_ppa000605mg [Prunus persica]
Length=1076

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDV+EEE VVI+ + IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVVEEEPVVIDNISIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010255162.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Nelumbo nucifera]
Length=930

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDV+EEE VVI+G+ IPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVVEEEPVVIDGISIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDR SPTTF+EVF+C+FDY+DRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRSSPTTFDEVFQCVFDYVDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010255163.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X2 [Nelumbo nucifera]
Length=926

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDV+EEE VVI+G+ IPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVVEEEPVVIDGISIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDR SPTTF+EVF+C+FDY+DRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRSSPTTFDEVFQCVFDYVDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_006435154.1| hypothetical protein CICLE_v10000087mg [Citrus clementina]
 gb|ESR48394.1| hypothetical protein CICLE_v10000087mg [Citrus clementina]
Length=1120

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VV DVIEEE VVI+GVKIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVADVIEEEPVVIDGVKIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_006435155.1| hypothetical protein CICLE_v10000087mg [Citrus clementina]
 gb|ESR48395.1| hypothetical protein CICLE_v10000087mg [Citrus clementina]
Length=1123

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VV DVIEEE VVI+GVKIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVADVIEEEPVVIDGVKIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008364939.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Malus domestica]
Length=1065

 Score =   183 bits (464),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +V+VDV+EEE VVI+ V IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVIVDVVEEEPVVIDDVSIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KDO84807.1| hypothetical protein CISIN_1g001209mg [Citrus sinensis]
Length=1120

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VV DVIEEE VVI+GVKIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVADVIEEEPVVIDGVKIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KDO84806.1| hypothetical protein CISIN_1g001209mg [Citrus sinensis]
Length=1123

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VV DVIEEE VVI+GVKIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVADVIEEEPVVIDGVKIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_011028986.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Populus euphratica]
Length=1087

 Score =   183 bits (464),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE VVIEGVKIPVDTS+PNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVVIEGVKIPVDTSRPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP +F+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPASFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_011028987.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Populus euphratica]
Length=1085

 Score =   183 bits (464),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE VVIEGVKIPVDTS+PNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVVIEGVKIPVDTSRPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP +F+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPASFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KJB59764.1| hypothetical protein B456_009G270300 [Gossypium raimondii]
Length=1100

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++VVDVIEEE VVIEGV IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVVDVIEEEPVVIEGVSIPVDTSKPNPNKLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCIFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_011028988.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X3 [Populus euphratica]
Length=1079

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE VVIEGVKIPVDTS+PNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVVIEGVKIPVDTSRPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP +F+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPASFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KDO84808.1| hypothetical protein CISIN_1g001209mg [Citrus sinensis]
Length=1118

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VV DVIEEE VVI+GVKIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVADVIEEEPVVIDGVKIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KJB59762.1| hypothetical protein B456_009G270300 [Gossypium raimondii]
Length=1104

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++VVDVIEEE VVIEGV IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVVDVIEEEPVVIEGVSIPVDTSKPNPNKLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCIFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KJB59761.1| hypothetical protein B456_009G270300 [Gossypium raimondii]
Length=1075

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++VVDVIEEE VVIEGV IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVVDVIEEEPVVIEGVSIPVDTSKPNPNKLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCIFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008364938.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Malus domestica]
Length=1069

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +V+VDV+EEE VVI+ V IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVIVDVVEEEPVVIDDVSIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KHG20595.1| 5'-3' exoribonuclease 3 -like protein [Gossypium arboreum]
Length=1104

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++VVDVIEEE VVIEGV IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVVDVIEEEPVVIEGVSIPVDTSKPNPNKLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCIFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_006473637.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Citrus sinensis]
Length=1120

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VV DVIEEE VVI+GVKIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVADVIEEEPVVIDGVKIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>emb|CDP07414.1| unnamed protein product [Coffea canephora]
Length=1086

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++VVDVIEEE VVIEGVKIPVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVVDVIEEEPVVIEGVKIPVDTSKPNPNNLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F+EVF+C+FDYIDRLFVMVRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFDEVFQCIFDYIDRLFVMVRPRKVLYMAIDGVAPRAKMNQ  113



>ref|XP_006473636.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Citrus sinensis]
Length=1123

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VV DVIEEE VVI+GVKIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVADVIEEEPVVIDGVKIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KJB59763.1| hypothetical protein B456_009G270300 [Gossypium raimondii]
Length=1079

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++VVDVIEEE VVIEGV IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVVDVIEEEPVVIEGVSIPVDTSKPNPNKLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+C+FDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCIFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_003549459.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Glycine max]
Length=1065

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MV+VD IEEEAVVI+GV+IPVDTS  NPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVIVDAIEEEAVVIDGVQIPVDTSNKNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F+EVF CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFDEVFECMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_006601346.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Glycine max]
 gb|KHN12651.1| 5'-3' exoribonuclease 3 [Glycine soja]
Length=1069

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MV+VD IEEEAVVI+GV+IPVDTS  NPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVIVDAIEEEAVVIDGVQIPVDTSNKNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F+EVF CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFDEVFECMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008221291.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X3 [Prunus mume]
Length=1019

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDV+EEE VVI+ + IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVVEEEPVVIDNISIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TF+EVF+CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFDEVFQCMFDYIDRLFAMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_003545041.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Glycine max]
Length=1075

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MV+VD IEEE VVI+GV+IPVDTSK NPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVIVDAIEEEPVVIDGVQIPVDTSKKNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F+EVF CMFDYIDRLF+MVRPR+LLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFDEVFECMFDYIDRLFIMVRPRELLYMAIDGVAPRAKMNQ  113



>ref|XP_008221289.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X2 [Prunus mume]
Length=1079

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDV+EEE VVI+ + IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVVEEEPVVIDNISIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TF+EVF+CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFDEVFQCMFDYIDRLFAMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_007156369.1| hypothetical protein PHAVU_003G280400g [Phaseolus vulgaris]
 gb|ESW28363.1| hypothetical protein PHAVU_003G280400g [Phaseolus vulgaris]
Length=1057

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVD IEEE VVI+GVKIPVDTS  NPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDSIEEEPVVIDGVKIPVDTSDKNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F+EVF CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFDEVFECMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_006596562.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Glycine max]
Length=1079

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MV+VD IEEE VVI+GV+IPVDTSK NPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVIVDAIEEEPVVIDGVQIPVDTSKKNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F+EVF CMFDYIDRLF+MVRPR+LLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFDEVFECMFDYIDRLFIMVRPRELLYMAIDGVAPRAKMNQ  113



>gb|KDP25015.1| hypothetical protein JCGZ_23998 [Jatropha curcas]
Length=1130

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE+VVI GVKIPVDTS+PN NN+E+DNLYLDMNGI+H
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEESVVINGVKIPVDTSRPNLNNVEYDNLYLDMNGIVH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KHN39437.1| 5'-3' exoribonuclease 3 [Glycine soja]
Length=1060

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MV+VD IEEE VVI+GV+IPVDTSK NPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVIVDAIEEEPVVIDGVQIPVDTSKKNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+F+EVF CMFDYIDRLF+MVRPR+LLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFDEVFECMFDYIDRLFIMVRPRELLYMAIDGVAPRAKMNQ  113



>ref|XP_010532420.1| PREDICTED: 5'-3' exoribonuclease 3-like [Tarenaya hassleriana]
Length=883

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWLAEKY ++V DVIEEE V I GVK+PVDTSKPNPN+IE+DNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLAEKYPLIVQDVIEEEPVEISGVKLPVDTSKPNPNDIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED PSPTTF EVF+CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDMPSPTTFSEVFQCMFDYIDRLFAMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008221288.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Prunus mume]
Length=1083

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDV+EEE VVI+ + IPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVVEEEPVVIDNISIPVDTSKPNPNGLEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP+TF+EVF+CMFDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPSTFDEVFQCMFDYIDRLFAMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_011465800.1| PREDICTED: 5'-3' exoribonuclease 3-like [Fragaria vesca subsp. 
vesca]
Length=795

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDV+EEE +VI+ V IPVDTSKPNPN +EFDNLYLDMN IIH
Sbjct  1    MGVPAFYRWLAEKYQLVVVDVVEEEPIVIDDVSIPVDTSKPNPNGLEFDNLYLDMNAIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+CMF+YIDRLF MVRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFQCMFEYIDRLFGMVRPRKVLYMAIDGVAPRAKMNQ  113



>ref|XP_011459126.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=1048

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 106/113 (94%), Gaps = 1/113 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDV+EEE VVI+ V IPVDTSKPNPN  E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVVEEEPVVIDDVSIPVDTSKPNPNG-EYDNLYLDMNGIIH  59

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  60   PCFHPEDRPSPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  112



>ref|XP_004291380.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=1052

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 106/113 (94%), Gaps = 1/113 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDV+EEE VVI+ V IPVDTSKPNPN  E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVVEEEPVVIDDVSIPVDTSKPNPNG-EYDNLYLDMNGIIH  59

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  60   PCFHPEDRPSPTTFDEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  112



>ref|XP_008808990.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Phoenix dactylifera]
Length=1104

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V I+GVKIPVDTSK NPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIDGVKIPVDTSKINPNGMEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFAIVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008808991.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X2 [Phoenix dactylifera]
Length=1072

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MVVVDV+EEE V I+GVKIPVDTSK NPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVVVDVVEEEPVEIDGVKIPVDTSKINPNGMEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTTF+EVF+CMFDYIDRLF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTFDEVFQCMFDYIDRLFAIVRPRKLLYMAIDGVAPRAKMNQ  113



>emb|CDX73185.1| BnaC06g36330D [Brassica napus]
Length=1004

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 95/116 (82%), Gaps = 19/116 (16%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +++                PVDTSKPNPNN+E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLII----------------PVDTSKPNPNNLEYDNLYLDMNGIIH  44

Query  365  PCFHPEDR---PSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDR   PSPTTFEEVF+CMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  45   PCFHPEDRVSFPSPTTFEEVFQCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  100



>ref|XP_010244085.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Nelumbo nucifera]
Length=1060

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY  VVVDV+EEE V I+G+ IPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPRVVVDVVEEEPVEIDGICIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF  +F+YIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFENIFNYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010244084.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Nelumbo nucifera]
Length=1064

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY  VVVDV+EEE V I+G+ IPVDTSKPNPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPRVVVDVVEEEPVEIDGICIPVDTSKPNPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPTTF+EVF  +F+YIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTTFDEVFENIFNYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_004499238.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Cicer arietinum]
Length=1091

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MV+VD +EEE VVIEGV IP+DTSK NPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVIVDAVEEEPVVIEGVSIPIDTSKENPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+FEEVF+ MFDYIDRLF MVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFEEVFQLMFDYIDRLFNMVRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_004499239.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Cicer arietinum]
Length=1087

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY MV+VD +EEE VVIEGV IP+DTSK NPNNIE+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPMVIVDAVEEEPVVIEGVSIPIDTSKENPNNIEYDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSPT+FEEVF+ MFDYIDRLF MVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPSPTSFEEVFQLMFDYIDRLFNMVRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_005846916.1| hypothetical protein CHLNCDRAFT_24310, partial [Chlorella variabilis]
 gb|EFN54814.1| hypothetical protein CHLNCDRAFT_24310, partial [Chlorella variabilis]
Length=326

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV ++YRWL+++Y  VV DV+E+E  VI GV++PVDTS+PNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPSYYRWLSQRYPKVVKDVVEDEVQVINGVEVPVDTSQPNPNGLEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTT +EVF  MFDYIDRLF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTEQEVFTTMFDYIDRLFAIVRPRKLLYMAIDGVAPRAKMNQ  113



>gb|KHG26578.1| 5'-3' exoribonuclease 3 -like protein [Gossypium arboreum]
Length=1088

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFY+WLAEKY +++VDVIEE A +++GV IPVDTSKPNPN IEFDNLYLDMNGIIH
Sbjct  1    MGVPAFYKWLAEKYPLILVDVIEEVAEMVDGVTIPVDTSKPNPNRIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDR SP TF+EVFR +F+YIDRLF+MVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRSSPRTFDEVFRRIFEYIDRLFIMVRPRKLLFMAIDGVAPRAKMNQ  113



>gb|KIY97657.1| 5'-3' exoribonuclease 2 [Monoraphidium neglectum]
Length=370

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWL+EKY  ++VDV EE    I GV++PVDTS PNPN IEFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLSEKYPKIIVDVKEELPEWINGVEVPVDTSTPNPNGIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTT  EVF  +FDYIDRLF MVRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTEREVFLNIFDYIDRLFAMVRPRKVLYMAIDGVAPRAKMNQ  113



>dbj|BAB09325.1| 5'-3' exoribonuclease 2 [Arabidopsis thaliana]
Length=746

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  185  MGVTAFYRWLAEKY--SMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGI  358
            MGV +FYRWL ++Y  ++  V   E   V   GV IP+D+SKPNPN  E+DNLYLDMNGI
Sbjct  1    MGVPSFYRWLIQRYPLTIQEVIEEEPLEVNGGGVTIPIDSSKPNPNGYEYDNLYLDMNGI  60

Query  359  IHPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            IHPCFHPED+PSPTTF EVF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   IHPCFHPEDKPSPTTFTEVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  115



>gb|AAK32883.1|AF367296_1 AT5g42540/K16E1_1 [Arabidopsis thaliana]
 gb|AAM10286.1| AT5g42540/K16E1_1 [Arabidopsis thaliana]
Length=813

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  185  MGVTAFYRWLAEKY--SMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGI  358
            MGV +FYRWL ++Y  ++  V   E   V   GV IP+D+SKPNPN  E+DNLYLDMNGI
Sbjct  1    MGVPSFYRWLIQRYPLTIQEVIEEEPLEVNGGGVTIPIDSSKPNPNGYEYDNLYLDMNGI  60

Query  359  IHPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            IHPCFHPED+PSPTTF EVF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   IHPCFHPEDKPSPTTFTEVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  115



>ref|XP_006279471.1| hypothetical protein CARUB_v10025807mg [Capsella rubella]
 gb|EOA12369.1| hypothetical protein CARUB_v10025807mg [Capsella rubella]
Length=1006

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV +FY+WL E+Y +++ +VIEEE   V  GV IP+DTSKPNPN  E+DNLYLDMNGII
Sbjct  1    MGVPSFYKWLIERYPLILQEVIEEEPLEVNGGVTIPIDTSKPNPNGYEYDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPED+PSPTTF EVF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEDKPSPTTFTEVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  114



>ref|XP_010442174.1| PREDICTED: 5'-3' exoribonuclease 2-like [Camelina sativa]
Length=1007

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV +FY+WL E+Y +++ +VIEEE   V  GV IPVDTSKPNPN  E+DNLYLDMNGII
Sbjct  1    MGVPSFYKWLIERYPLILQEVIEEEPLEVNGGVTIPVDTSKPNPNGYEYDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPED+PSPTTF +VF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEDKPSPTTFTQVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  114



>ref|XP_002865509.1| hypothetical protein ARALYDRAFT_917497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41768.1| hypothetical protein ARALYDRAFT_917497 [Arabidopsis lyrata subsp. 
lyrata]
Length=1053

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV +FYRWL ++Y +++ +VIEEE   V  GV IP+DTSKPNPN  E+DNLYLDMNGII
Sbjct  1    MGVPSFYRWLIQRYPLIIQEVIEEEPLEVNGGVTIPIDTSKPNPNGYEYDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPED+PSPTTF EVF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEDKPSPTTFTEVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  114



>ref|NP_199069.1| 5'-3' exoribonuclease 2 [Arabidopsis thaliana]
 sp|Q9FQ02.1|XRN2_ARATH RecName: Full=5'-3' exoribonuclease 2; AltName: Full=Protein 
EXORIBONUCLEASE 2 [Arabidopsis thaliana]
 gb|AAG40733.1|AF286720_1 XRN2 [Arabidopsis thaliana]
 dbj|BAD43863.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD94308.1| 5'-3' exoribonuclease 2 [Arabidopsis thaliana]
 gb|AED94824.1| 5'-3' exoribonuclease 2 [Arabidopsis thaliana]
Length=1012

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  185  MGVTAFYRWLAEKY--SMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGI  358
            MGV +FYRWL ++Y  ++  V   E   V   GV IP+D+SKPNPN  E+DNLYLDMNGI
Sbjct  1    MGVPSFYRWLIQRYPLTIQEVIEEEPLEVNGGGVTIPIDSSKPNPNGYEYDNLYLDMNGI  60

Query  359  IHPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            IHPCFHPED+PSPTTF EVF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   IHPCFHPEDKPSPTTFTEVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  115



>ref|XP_009101845.1| PREDICTED: 5'-3' exoribonuclease 2 [Brassica rapa]
Length=981

 Score =   170 bits (430),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 4/114 (4%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNN-IEFDNLYLDMNGII  361
            MGV +FYRWL E+Y +++ D IEEEA+ ++    PVDTSKPNPN  +E+DNLYLDMNGII
Sbjct  1    MGVPSFYRWLIERYPLILQDAIEEEALDVKV---PVDTSKPNPNGGVEYDNLYLDMNGII  57

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPEDR SPTTF EVF+CMFDYIDRLF+MVRPRKLL++AIDGVAPRAKMNQ
Sbjct  58   HPCFHPEDRASPTTFSEVFQCMFDYIDRLFLMVRPRKLLFLAIDGVAPRAKMNQ  111



>ref|XP_010494189.1| PREDICTED: 5'-3' exoribonuclease 2-like isoform X1 [Camelina 
sativa]
Length=1007

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV +FY+WL E+Y +++ +VIEEE   V  GV IP+DTSKPNPN  E+DNLYLDMNGII
Sbjct  1    MGVPSFYKWLIERYPLILQEVIEEEPLEVNGGVTIPIDTSKPNPNGYEYDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPED+PSPTTF +VF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEDKPSPTTFTQVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  114



>ref|NP_001190450.1| 5'-3' exoribonuclease 2 [Arabidopsis thaliana]
 gb|AED94825.1| 5'-3' exoribonuclease 2 [Arabidopsis thaliana]
Length=1023

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  185  MGVTAFYRWLAEKY--SMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGI  358
            MGV +FYRWL ++Y  ++  V   E   V   GV IP+D+SKPNPN  E+DNLYLDMNGI
Sbjct  1    MGVPSFYRWLIQRYPLTIQEVIEEEPLEVNGGGVTIPIDSSKPNPNGYEYDNLYLDMNGI  60

Query  359  IHPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            IHPCFHPED+PSPTTF EVF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   IHPCFHPEDKPSPTTFTEVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  115



>dbj|BAD93823.1| 5'-3' exoribonuclease 2 [Arabidopsis thaliana]
Length=1012

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  185  MGVTAFYRWLAEKY--SMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGI  358
            MGV +FYRWL ++Y  ++  V   E   V   GV IP+D+SKPNPN  E+DNLYLDMNGI
Sbjct  1    MGVPSFYRWLIQRYPLTIQEVIEEEPLEVNGGGVTIPIDSSKPNPNGYEYDNLYLDMNGI  60

Query  359  IHPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            IHPCFHPED+PSPTTF EVF+CMFDYIDRLFVMVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   IHPCFHPEDKPSPTTFTEVFQCMFDYIDRLFVMVRPRKLLFMAIDGVAPRAKMNQ  115



>ref|XP_006417024.1| hypothetical protein EUTSA_v10009553mg, partial [Eutrema salsugineum]
 gb|ESQ35377.1| hypothetical protein EUTSA_v10009553mg, partial [Eutrema salsugineum]
Length=902

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 99/117 (85%), Gaps = 4/117 (3%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee----avviegvkiPVDTSKPNPNNIEFDNLYLDMN  352
            MGV +FYRWL E+Y +++ DVIEEE          V + VDTSKPNPN +E+DNLYLDMN
Sbjct  1    MGVPSFYRWLIERYPLILQDVIEEEPLEIGGGGGVVTVSVDTSKPNPNGVEYDNLYLDMN  60

Query  353  GIIHPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            GIIHPCFHPEDRPSPTTF EVF+CMFDYIDRLFVMVRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   GIIHPCFHPEDRPSPTTFSEVFQCMFDYIDRLFVMVRPRKLLYLAIDGVAPRAKMNQ  117



>gb|KFK32919.1| hypothetical protein AALP_AA6G306200 [Arabis alpina]
Length=964

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWL EKY +++ +VIE+E +   GV +PV+TS+PNPN  E+DNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLIEKYPLILQEVIEQEPLEFNGVTVPVNTSQPNPNG-EYDNLYLDMNGIIH  59

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED+P+PTTF EVF+CMFDYIDRLFVM+RPRKLL+MAIDGVAPRAKMNQ
Sbjct  60   PCFHPEDKPAPTTFSEVFQCMFDYIDRLFVMIRPRKLLFMAIDGVAPRAKMNQ  112



>ref|XP_010681159.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=1051

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 1/113 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++VVDVIEEEAV I+G+KIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVVDVIEEEAVEIDGIKIPVDTSKPNPN-LEYDNLYLDMNGIIH  59

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP TF+EVF+ +FDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  60   PCFHPEDRPSPATFDEVFQNVFDYIDRLFNMVRPRKLLYMAIDGVAPRAKMNQ  112



>ref|XP_010681153.1| PREDICTED: 5'-3' exoribonuclease 3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=1055

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 1/113 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY ++VVDVIEEEAV I+G+KIPVDTSKPNPN +E+DNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLAEKYPLIVVDVIEEEAVEIDGIKIPVDTSKPNPN-LEYDNLYLDMNGIIH  59

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRPSP TF+EVF+ +FDYIDRLF MVRPRKLLYMAIDGVAPRAKMNQ
Sbjct  60   PCFHPEDRPSPATFDEVFQNVFDYIDRLFNMVRPRKLLYMAIDGVAPRAKMNQ  112



>gb|KJB58125.1| hypothetical protein B456_009G195600 [Gossypium raimondii]
Length=1087

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFY+WLAEKY +++VDVIEE   +++GV I VDTSKPNPN IEFDNLYLDMNGIIH
Sbjct  1    MGVPAFYKWLAEKYPLILVDVIEEVPEMVDGVTIAVDTSKPNPNRIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDR SP TF+EVFR +F+YIDRLF+MVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRSSPRTFDEVFRRIFEYIDRLFIMVRPRKLLFMAIDGVAPRAKMNQ  113



>gb|KJB58124.1| hypothetical protein B456_009G195600 [Gossypium raimondii]
Length=1102

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFY+WLAEKY +++VDVIEE   +++GV I VDTSKPNPN IEFDNLYLDMNGIIH
Sbjct  1    MGVPAFYKWLAEKYPLILVDVIEEVPEMVDGVTIAVDTSKPNPNRIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDR SP TF+EVFR +F+YIDRLF+MVRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRSSPRTFDEVFRRIFEYIDRLFIMVRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_011011029.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X2 [Populus euphratica]
Length=1383

 Score =   167 bits (424),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL EKY +++ DV+EE  ++I GV +P+DTS PNPN IEFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLTEKYPLIIADVMEETPLLINGVSVPLDTSCPNPNGIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE  P PTT+EEVF  +F YIDR+F +VRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEGLPPPTTYEEVFAAVFKYIDRIFSIVRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_011011028.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X1 [Populus euphratica]
Length=1402

 Score =   167 bits (424),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL EKY +++ DV+EE  ++I GV +P+DTS PNPN IEFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLTEKYPLIIADVMEETPLLINGVSVPLDTSCPNPNGIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE  P PTT+EEVF  +F YIDR+F +VRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEGLPPPTTYEEVFAAVFKYIDRIFSIVRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_011011031.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X4 [Populus euphratica]
Length=1233

 Score =   167 bits (423),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL EKY +++ DV+EE  ++I GV +P+DTS PNPN IEFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLTEKYPLIIADVMEETPLLINGVSVPLDTSCPNPNGIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE  P PTT+EEVF  +F YIDR+F +VRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEGLPPPTTYEEVFAAVFKYIDRIFSIVRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_011011030.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X3 [Populus euphratica]
Length=1233

 Score =   167 bits (423),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL EKY +++ DV+EE  ++I GV +P+DTS PNPN IEFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLTEKYPLIIADVMEETPLLINGVSVPLDTSCPNPNGIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE  P PTT+EEVF  +F YIDR+F +VRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEGLPPPTTYEEVFAAVFKYIDRIFSIVRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_006375951.1| hypothetical protein POPTR_0013s06720g, partial [Populus trichocarpa]
 gb|ERP53748.1| hypothetical protein POPTR_0013s06720g, partial [Populus trichocarpa]
Length=306

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL EKY ++  DV+EE  ++I GV +P+DTS PNPN IEFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLTEKYPLITADVMEETPLLINGVSVPLDTSCPNPNGIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE  P PTT+EEVF  +F YIDR+F ++RPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   PCFHPEGLPPPTTYEEVFAAVFKYIDRIFSIIRPRKLLFMAIDGVAPRAKMNQ  113



>ref|XP_011396981.1| 5'-3' exoribonuclease 2 [Auxenochlorella protothecoides]
 gb|KFM24095.1| 5'-3' exoribonuclease 2 [Auxenochlorella protothecoides]
Length=912

 Score =   165 bits (418),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWL+ +Y  VV D +EEE   I  V++PVDTS+PNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLSTRYPKVVKDCVEEEVQTIGDVEVPVDTSQPNPNGMEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED+P+PTT  EVF  +FDYIDR+F ++RPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDKPAPTTENEVFLAIFDYIDRIFAIIRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_001418304.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96597.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=802

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRW+A+KY  +V DV+E+E V   G ++ +++++ NPN IEFDNLYLDMNGIIH
Sbjct  1    MGVPSFYRWIAQKYPKIVADVVEDEPVDALGRRVELNSAEANPNGIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTT EEVF C+FDYIDRLF+M+RPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTEEEVFECIFDYIDRLFLMIRPRKVLYMAIDGVAPRAKMNQ  113



>gb|EJD76028.1| hypothetical protein LOAG_16951 [Loa loa]
Length=159

 Score =   151 bits (382),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AF+RWL  KY  V+VD +EE+   + GV+IPV+T  PNPN  EFDNLYLDMNGIIH
Sbjct  1    MGVPAFFRWLTRKYPSVIVDAVEEKPRDMNGVRIPVNTVDPNPNFQEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PC HPEDRPSP T EE+F  +F+YIDRLF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCTHPEDRPSPKTEEEMFTLIFEYIDRLFAIVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_009602318.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=456

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL E+Y   VV+V EE   VI GV +P+DTS PNPN IEFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLLERYPQSVVEVNEETPAVINGVTVPIDTSDPNPNGIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE  P+P T ++VF+ +F+YIDR+F +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPESLPAPETHDQVFKAVFNYIDRIFSIVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010269902.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X4 [Nelumbo nucifera]
Length=939

 Score =   162 bits (410),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 80/113 (71%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+  FY WL  KYS V   V EE  V I+GV IPVDTS PNPN IEFDNLY+DMNG+IH
Sbjct  1    MGIPGFYGWLVRKYSDVKQKVREEFPVTIDGVTIPVDTSIPNPNGIEFDNLYIDMNGVIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED+PSP T+EEVF+ +F YIDR+F ++RPRKLLY+AIDGVAPRAKMN 
Sbjct  61   PCFHPEDQPSPKTYEEVFKAIFKYIDRIFSLIRPRKLLYLAIDGVAPRAKMNH  113



>ref|XP_010269901.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X3 [Nelumbo nucifera]
Length=965

 Score =   162 bits (410),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 80/113 (71%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+  FY WL  KYS V   V EE  V I+GV IPVDTS PNPN IEFDNLY+DMNG+IH
Sbjct  1    MGIPGFYGWLVRKYSDVKQKVREEFPVTIDGVTIPVDTSIPNPNGIEFDNLYIDMNGVIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED+PSP T+EEVF+ +F YIDR+F ++RPRKLLY+AIDGVAPRAKMN 
Sbjct  61   PCFHPEDQPSPKTYEEVFKAIFKYIDRIFSLIRPRKLLYLAIDGVAPRAKMNH  113



>ref|XP_010269899.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X1 [Nelumbo nucifera]
Length=1020

 Score =   162 bits (410),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 80/113 (71%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+  FY WL  KYS V   V EE  V I+GV IPVDTS PNPN IEFDNLY+DMNG+IH
Sbjct  1    MGIPGFYGWLVRKYSDVKQKVREEFPVTIDGVTIPVDTSIPNPNGIEFDNLYIDMNGVIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED+PSP T+EEVF+ +F YIDR+F ++RPRKLLY+AIDGVAPRAKMN 
Sbjct  61   PCFHPEDQPSPKTYEEVFKAIFKYIDRIFSLIRPRKLLYLAIDGVAPRAKMNH  113



>ref|XP_010269900.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X2 [Nelumbo nucifera]
Length=1018

 Score =   162 bits (410),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 80/113 (71%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+  FY WL  KYS V   V EE  V I+GV IPVDTS PNPN IEFDNLY+DMNG+IH
Sbjct  1    MGIPGFYGWLVRKYSDVKQKVREEFPVTIDGVTIPVDTSIPNPNGIEFDNLYIDMNGVIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED+PSP T+EEVF+ +F YIDR+F ++RPRKLLY+AIDGVAPRAKMN 
Sbjct  61   PCFHPEDQPSPKTYEEVFKAIFKYIDRIFSLIRPRKLLYLAIDGVAPRAKMNH  113



>ref|NP_001170327.1| uncharacterized protein LOC100384297 [Zea mays]
 ref|XP_008644149.1| PREDICTED: uncharacterized protein LOC100384297 isoform X1 [Zea 
mays]
 gb|ACN36629.1| unknown [Zea mays]
 gb|AFW67374.1| hypothetical protein ZEAMMB73_239358 [Zea mays]
Length=490

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + V D  EEE V +E    +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLTVSDAEEEEPVELEPGAFVPVDLRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP+PTT++EVF+ +FDYID LF ++RPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPAPTTYDEVFKSIFDYIDHLFGLIRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_008797390.1| PREDICTED: 5'-3' exoribonuclease 4-like [Phoenix dactylifera]
Length=279

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + V DVIEEE  V      + VD S+PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLAVADVIEEEPGVAADGLPLAVDPSRPNPNGVEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RPSP T+++VFR +F YID LF ++RPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPSPATYDDVFRSIFAYIDHLFGLIRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_009602317.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=511

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL E+Y   VV+V EE   VI GV +P+DTS PNPN IEFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLLERYPQSVVEVNEETPAVINGVTVPIDTSDPNPNGIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE  P+P T ++VF+ +F+YIDR+F +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPESLPAPETHDQVFKAVFNYIDRIFSIVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_002301985.1| EXORIBONUCLEASE 2 family protein [Populus trichocarpa]
 gb|EEE81258.1| EXORIBONUCLEASE 2 family protein [Populus trichocarpa]
Length=851

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE VVIEGVKIPVDTS+PNPNNIE+DNLYLDMNGI+H
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVVIEGVKIPVDTSRPNPNNIEYDNLYLDMNGIVH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAI  490
            PCFHPEDRPSPT+F+EVF+CMFDYIDRLFV+VRPRKLLYMAI
Sbjct  61   PCFHPEDRPSPTSFDEVFQCMFDYIDRLFVVVRPRKLLYMAI  102



>ref|XP_002301984.2| hypothetical protein POPTR_0002s02570g [Populus trichocarpa]
 gb|EEE81257.2| hypothetical protein POPTR_0002s02570g [Populus trichocarpa]
Length=961

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLAEKY +VVVDVIEEE VVIEGVKIPVDTS+PNPNNIE+DNLYLDMNGI+H
Sbjct  1    MGVPAFYRWLAEKYPLVVVDVIEEEPVVIEGVKIPVDTSRPNPNNIEYDNLYLDMNGIVH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAI  490
            PCFHPEDRPSPT+F+EVF+CMFDYIDRLFV+VRPRKLLYMAI
Sbjct  61   PCFHPEDRPSPTSFDEVFQCMFDYIDRLFVVVRPRKLLYMAI  102



>emb|CDP04956.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   151 bits (382),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 85/113 (75%), Gaps = 13/113 (12%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWLAE+Y                 V +P+DT+ PNPN +EFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLAERYP-------------RSVVDVPIDTTAPNPNGLEFDNLYLDMNGIIH  47

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHP+  P+P T+++VF+ +F YIDRLF M+RPRKL YMAIDGVAPRAKMNQ
Sbjct  48   PCFHPDGLPAPETYDQVFKAVFKYIDRLFSMIRPRKLFYMAIDGVAPRAKMNQ  100



>ref|XP_004172506.1| PREDICTED: 5'-3' exoribonuclease 4-like, partial [Cucumis sativus]
Length=254

 Score =   152 bits (383),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavvi-egvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   + DV+EEE V    GV  P+D SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPRSIADVVEEEPVGGPSGVLFPIDVSKPNPNGMEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P P T++ VF+ +FDYID LF +VRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPPPATYDAVFKSIFDYIDHLFSLVRPRKVLYMAIDGVAPRAKMNQ  114



>gb|AFW67375.1| hypothetical protein ZEAMMB73_239358 [Zea mays]
Length=652

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + V D  EEE V +E    +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLTVSDAEEEEPVELEPGAFVPVDLRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP+PTT++EVF+ +FDYID LF ++RPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPAPTTYDEVFKSIFDYIDHLFGLIRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_004981452.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X2 [Setaria italica]
Length=989

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + V D  EEE V +E    +PVD  +PNPN IEFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLTVSDAEEEEPVELEPGAFVPVDLRRPNPNGIEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP+PTT++EVF+ +FDYID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPAPTTYDEVFKSIFDYIDHLFGLVRPRKLLYMAIDGVAPRAKMNQ  114



>gb|KDO53276.1| hypothetical protein CISIN_1g0021471mg, partial [Citrus sinensis]
 gb|KDO53277.1| hypothetical protein CISIN_1g0021471mg, partial [Citrus sinensis]
 gb|KDO53278.1| hypothetical protein CISIN_1g0021471mg, partial [Citrus sinensis]
 gb|KDO53279.1| hypothetical protein CISIN_1g0021471mg, partial [Citrus sinensis]
Length=413

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +VDV+EE+  V  EGV  PVD SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSIVDVVEEDPQVDGEGVARPVDVSKPNPNGMEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ +P+PT++++VF+ +FDYID +F++VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGKPAPTSYDDVFKSIFDYIDHIFLLVRPRKLLYLAIDGVAPRAKMNQ  114



>ref|XP_004981451.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X1 [Setaria italica]
Length=1024

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + V D  EEE V +E    +PVD  +PNPN IEFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLTVSDAEEEEPVELEPGAFVPVDLRRPNPNGIEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP+PTT++EVF+ +FDYID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPAPTTYDEVFKSIFDYIDHLFGLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_010919845.1| PREDICTED: LOW QUALITY PROTEIN: 5'-3' exoribonuclease 3-like 
[Elaeis guineensis]
Length=872

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL ++Y + VV V+EE   V+ GV +P+D+S PNPN +EFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLVDRYPLSVVPVVEEFPKVVNGVLVPIDSSSPNPNGVEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED+P+P ++EEV++ +F YID +F M+RPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDQPAPNSYEEVYKAVFKYIDHIFYMIRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008784687.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X2 [Phoenix dactylifera]
Length=879

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL ++Y + VV V+EE   V+ GV +P+D+S+PNPN +EFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLVDRYPLSVVPVVEEFPKVVNGVLVPIDSSRPNPNGVEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED+P+P ++EEV++ +F YID +F ++RPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDQPAPNSYEEVYKAVFKYIDHIFSLIRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_008784686.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X1 [Phoenix dactylifera]
Length=925

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL ++Y + VV V+EE   V+ GV +P+D+S+PNPN +EFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLVDRYPLSVVPVVEEFPKVVNGVLVPIDSSRPNPNGVEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED+P+P ++EEV++ +F YID +F ++RPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDQPAPNSYEEVYKAVFKYIDHIFSLIRPRKLLYMAIDGVAPRAKMNQ  113



>emb|CDP08580.1| unnamed protein product [Coffea canephora]
Length=980

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +VDV+EEE      G  +PVD SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSIVDVVEEEPREDANGDVVPVDVSKPNPNGMEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+PTT+++VFR +FDY+D LF +VRPR+LLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPTTYDDVFRSIFDYVDHLFSLVRPRRLLYMAIDGVAPRAKMNQ  114



>ref|XP_002519992.1| 5'->3' exoribonuclease, putative [Ricinus communis]
 gb|EEF42316.1| 5'->3' exoribonuclease, putative [Ricinus communis]
Length=1545

 Score =   160 bits (404),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ +FY+WL EKY   VVDVIE    +  GV +P++T+ PNPN IEFDNLYLDMNGIIH
Sbjct  1    MGIPSFYKWLTEKYPDTVVDVIEARRRMGNGVLLPINTALPNPNGIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHP D P P T+EEVFR +F YID++F MVRPRKLL++ IDGVAPRAKMNQ
Sbjct  61   PCFHPSDLPPPKTYEEVFRNVFMYIDKIFSMVRPRKLLFLGIDGVAPRAKMNQ  113



>ref|XP_010277307.1| PREDICTED: 5'-3' exoribonuclease 4 isoform X1 [Nelumbo nucifera]
Length=944

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + + DVIEEE +    GV +P+D SKPNPN+IEFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSISDVIEEEPSEDANGVLLPIDVSKPNPNDIEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+++VF+ +FDYID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYDDVFKSIFDYIDHLFSLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_009391174.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=864

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL ++Y + VV V EE  VV+ GV++P+D+S+PNPN +EFDNLYLDMNGI+H
Sbjct  1    MGIPAFYRWLVDRYPLSVVQVREEAPVVVNGVQVPIDSSRPNPNGVEFDNLYLDMNGIVH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP P +++EV++ +F YID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPPPKSYDEVYKAVFVYIDHLFSLVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_003080029.1| putative 5-3 exoribonuclease (ISS) [Ostreococcus tauri]
 emb|CAL53677.1| Putative 5-3 exonuclease [Ostreococcus tauri]
Length=1057

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWL++KY  +V DV+E+E +   G  + +D S+ NPN IEFDNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLSQKYPKIVEDVVEDEPMDELGRAVALDASRANPNGIEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP+PTT  EVF  +FDYIDRLF+M+RPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPAPTTEGEVFENIFDYIDRLFLMIRPRKVLYMAIDGVAPRAKMNQ  113



>ref|XP_008644148.1| PREDICTED: uncharacterized protein LOC100384297 isoform X2 [Zea 
mays]
 gb|AFW67376.1| hypothetical protein ZEAMMB73_239358 [Zea mays]
Length=990

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + V D  EEE V +E    +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLTVSDAEEEEPVELEPGAFVPVDLRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP+PTT++EVF+ +FDYID LF ++RPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPAPTTYDEVFKSIFDYIDHLFGLIRPRKLLYMAIDGVAPRAKMNQ  114



>dbj|BAJ85609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1014

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   V D  E+E V +E    +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPQTVSDAEEKEPVELEPGAFVPVDPRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RPSPTT++EVF+ +FDYID LF +VRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPSPTTYDEVFKSIFDYIDHLFCLVRPRKVLYMAIDGVAPRAKMNQ  114



>gb|EMT08825.1| 5'-3' exoribonuclease 4 [Aegilops tauschii]
Length=1323

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvv-vdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y         EE   +  G  +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPQTRCRAEEEEPVELEPGAFVPVDPRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RPSPTT++EVF+ +FDYID LF +VRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPSPTTYDEVFKSIFDYIDHLFCLVRPRKILYMAIDGVAPRAKMNQ  114



>ref|XP_007147140.1| hypothetical protein PHAVU_006G0992001g, partial [Phaseolus vulgaris]
 gb|ESW19134.1| hypothetical protein PHAVU_006G0992001g, partial [Phaseolus vulgaris]
Length=406

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 6/113 (5%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y + +VDV+EE+A         VD SKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPLSIVDVVEEDAGGA------VDVSKPNPNGMEFDNLYLDMNGIIH  54

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHP+ +P+P T+E+VF+ MFDYID LF +VRPRKLL++AIDGVAPRAKMNQ
Sbjct  55   PCFHPDGKPAPATYEDVFKIMFDYIDHLFSLVRPRKLLFLAIDGVAPRAKMNQ  107



>gb|EYU37061.1| hypothetical protein MIMGU_mgv1a002926mg [Erythranthe guttata]
Length=423

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKY-SMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   +V  V EE      G  +PVD S+PNPN IEFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPKCIVDVVEEEPRNAANGAPLPVDVSRPNPNGIEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+++VF+ +FDYID L  +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYDDVFKSIFDYIDHLVSLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_010925975.1| PREDICTED: 5'-3' exoribonuclease 4-like [Elaeis guineensis]
Length=418

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + ++DVIEEE A   +GV +PVD  KPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLAILDVIEEEPAEGEDGVLVPVDLIKPNPNGVEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP P T+++VF+ +F+YID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPLPATYDDVFKSIFNYIDHLFWLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_009604765.1| PREDICTED: 5'-3' exoribonuclease 4-like [Nicotiana tomentosiformis]
 ref|XP_009604766.1| PREDICTED: 5'-3' exoribonuclease 4-like [Nicotiana tomentosiformis]
Length=407

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +VDV+EEE      G+ +PVD SKPNPN +EFDN+YLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSIVDVVEEEPKEDSHGLFVPVDVSKPNPNGMEFDNMYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE + +P T+ +VF+ +FDYID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKAAPATYNDVFKSIFDYIDHLFSLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_010228481.1| PREDICTED: LOW QUALITY PROTEIN: 5'-3' exoribonuclease 4-like 
[Brachypodium distachyon]
Length=1306

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavvie-gvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   V D  EEE V +E G  +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPQTVSDAAEEEPVELEPGAFVPVDLRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RPSPTT+++VF+ +FDYID LF +VRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPSPTTYDQVFKSIFDYIDHLFCLVRPRKLVYMAIDGVAPRAKMNQ  114



>ref|XP_006826276.1| hypothetical protein AMTR_s00004p00046450 [Amborella trichopoda]
 gb|ERM93513.1| hypothetical protein AMTR_s00004p00046450 [Amborella trichopoda]
Length=936

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSM-vvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +V  + EE      GV +PVD SKPNPNN EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLCIVDVIEEEPVEGDNGVLLPVDVSKPNPNNTEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P+T+ EVF+ +F YID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPSTYNEVFKSIFAYIDHLFALVRPRKLLYMAIDGVAPRAKMNQ  114



>gb|ACA05276.1| putative ethylene insensitive 5/7 [Solanum lycopersicum]
Length=696

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 4/113 (4%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y + +VD++EEE         PVD SKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPLSIVDMVEEEPKDDV----PVDISKPNPNGMEFDNLYLDMNGIIH  56

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE +P+P T+ +VF  +FDYID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  57   PCFHPEGKPAPATYNDVFNSIFDYIDHLFSLVRPRKLLYMAIDGVAPRAKMNQ  109



>ref|XP_008345760.1| PREDICTED: 5'-3' exoribonuclease 4-like [Malus domestica]
Length=369

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   + DV+EE A        +PVD S PNPN  EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPQSIADVVEEHAREDSNGVPVPVDVSGPNPNGSEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ +P+P T+++VF+ +FDYID LF +VRPRKLL++AIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGKPAPATYDDVFKSIFDYIDHLFTLVRPRKLLFLAIDGVAPRAKMNQ  114



>ref|XP_003626391.1| 5'-3' exoribonuclease [Medicago truncatula]
Length=629

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +2

Query  185  MGVTAFYRWLAEKY--SMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGI  358
            MGV AFYRWLA++Y  S+V V        V  G   PVD S+PNPN +EFDNLYLDMNGI
Sbjct  1    MGVPAFYRWLADRYPRSIVDVVEEAPSPSVAGGPPFPVDVSRPNPNGMEFDNLYLDMNGI  60

Query  359  IHPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            IHPCFHP+ +P+P T+++VF+ MFDYID LF +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   IHPCFHPDGKPAPATYDDVFKSMFDYIDHLFSLVRPRKLLYLAIDGVAPRAKMNQ  115



>ref|XP_006392535.1| hypothetical protein EUTSA_v10023239mg [Eutrema salsugineum]
 gb|ESQ29821.1| hypothetical protein EUTSA_v10023239mg [Eutrema salsugineum]
Length=946

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y   + DV+EEE        IPVD ++PNPN  EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPKSISDVVEEEPTDAGRDLIPVDITRPNPNGFEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE +P+P T+++VF+ MF+YID LF +VRPRK+LY+AIDGVAPRAKMNQ
Sbjct  61   PCFHPEGKPTPATYDDVFKSMFEYIDHLFTLVRPRKVLYLAIDGVAPRAKMNQ  113



>ref|XP_011075832.1| PREDICTED: 5'-3' exoribonuclease 3-like [Sesamum indicum]
 ref|XP_011075833.1| PREDICTED: 5'-3' exoribonuclease 3-like [Sesamum indicum]
 ref|XP_011075834.1| PREDICTED: 5'-3' exoribonuclease 3-like [Sesamum indicum]
 ref|XP_011075835.1| PREDICTED: 5'-3' exoribonuclease 3-like [Sesamum indicum]
Length=814

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWL E+Y + VVDV+E+      GVKIPVDT+ PNPN  EFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLLERYPLSVVDVVEDSPAFANGVKIPVDTTMPNPNGFEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE+ PSP +++EVF  +F YIDR+F ++RPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPENLPSPKSYDEVFTAVFKYIDRIFWLIRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_004494674.1| PREDICTED: 5'-3' exoribonuclease 4-like [Cicer arietinum]
Length=958

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 92/114 (81%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   +VDV+E+           PVD SKPNPN IEFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPRSIVDVVEDSPTAAASGVPFPVDVSKPNPNGIEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ +P+P T+++VFR +FDYID LF +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGKPAPATYDDVFRSIFDYIDHLFSLVRPRKLLYLAIDGVAPRAKMNQ  114



>gb|ABF99327.1| 5'-3' exoribonuclease, putative, expressed [Oryza sativa Japonica 
Group]
Length=682

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKY-SMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   V   V EE   +  G  +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPQTVSDAVEEEPVELEPGAFVPVDLRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP+PTT++EVF+ +F YID LF +VRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPAPTTYDEVFKSIFAYIDHLFGLVRPRKLIYMAIDGVAPRAKMNQ  114



>gb|KJB45021.1| hypothetical protein B456_007G285900 [Gossypium raimondii]
Length=964

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV  FYRWLA++Y   +VDVIEEE     +G +IPVD SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPTFYRWLADRYPQSIVDVIEEEPREDADGNQIPVDVSKPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+++VF+ +FDYID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYDDVFKSIFDYIDHLFSLVRPRKLLYMAIDGVAPRAKMNQ  114



>gb|EMS54431.1| 5'-3' exoribonuclease 4 [Triticum urartu]
Length=1362

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++    V D  EEE V +E    +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVRAFYRWLADRSPQTVSDAEEEEPVELEPGAFVPVDPRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RPSPTT++EVF+ +FDYID LF +VRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPSPTTYDEVFKSIFDYIDHLFCLVRPRKILYMAIDGVAPRAKMNQ  114



>ref|XP_010511186.1| PREDICTED: 5'-3' exoribonuclease 4 [Camelina sativa]
Length=948

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y   + DV+EEE     G  IPVD ++PNPN  EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPKSISDVVEEEPTDGGGDLIPVDITRPNPNGFEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE +P+P T+++VF+ MF+YID LF ++RPRK+LY+AIDGVAPRAKMNQ
Sbjct  61   PCFHPEGKPAPATYDDVFKSMFEYIDHLFTLIRPRKILYLAIDGVAPRAKMNQ  113



>ref|XP_006433057.1| hypothetical protein CICLE_v10000168mg [Citrus clementina]
 ref|XP_006471738.1| PREDICTED: 5'-3' exoribonuclease 4-like [Citrus sinensis]
 gb|ESR46297.1| hypothetical protein CICLE_v10000168mg [Citrus clementina]
Length=959

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +VDV+EE+  V  EGV  PVD SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSIVDVVEEDPQVDGEGVARPVDVSKPNPNGMEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ +P+PT++++VF+ +FDYID +F++VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGKPAPTSYDDVFKSIFDYIDHIFLLVRPRKLLYLAIDGVAPRAKMNQ  114



>gb|AES82609.2| 5'-3' exoribonuclease [Medicago truncatula]
Length=945

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +2

Query  185  MGVTAFYRWLAEKY--SMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGI  358
            MGV AFYRWLA++Y  S+V V        V  G   PVD S+PNPN +EFDNLYLDMNGI
Sbjct  1    MGVPAFYRWLADRYPRSIVDVVEEAPSPSVAGGPPFPVDVSRPNPNGMEFDNLYLDMNGI  60

Query  359  IHPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            IHPCFHP+ +P+P T+++VF+ MFDYID LF +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   IHPCFHPDGKPAPATYDDVFKSMFDYIDHLFSLVRPRKLLYLAIDGVAPRAKMNQ  115



>gb|ABF99328.1| 5'-3' exoribonuclease, putative, expressed [Oryza sativa Japonica 
Group]
Length=718

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKY-SMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   V   V EE   +  G  +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPQTVSDAVEEEPVELEPGAFVPVDLRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP+PTT++EVF+ +F YID LF +VRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPAPTTYDEVFKSIFAYIDHLFGLVRPRKLIYMAIDGVAPRAKMNQ  114



>ref|XP_003626390.1| 5'-3' exoribonuclease [Medicago truncatula]
 gb|AES82608.1| 5'-3' exoribonuclease [Medicago truncatula]
Length=956

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +2

Query  185  MGVTAFYRWLAEKY--SMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGI  358
            MGV AFYRWLA++Y  S+V V        V  G   PVD S+PNPN +EFDNLYLDMNGI
Sbjct  1    MGVPAFYRWLADRYPRSIVDVVEEAPSPSVAGGPPFPVDVSRPNPNGMEFDNLYLDMNGI  60

Query  359  IHPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            IHPCFHP+ +P+P T+++VF+ MFDYID LF +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   IHPCFHPDGKPAPATYDDVFKSMFDYIDHLFSLVRPRKLLYLAIDGVAPRAKMNQ  115



>ref|XP_003057885.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57836.1| predicted protein [Micromonas pusilla CCMP1545]
Length=398

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  287  PVDTSKPNPNNIEFDNLYLDMNGIIHPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRP  466
            PVD S PNPN  EFDNLYLDMNGIIHPCFHPEDRP+PTT EEVF C+FDYIDRLF M+RP
Sbjct  7    PVDCSAPNPNGQEFDNLYLDMNGIIHPCFHPEDRPAPTTEEEVFECIFDYIDRLFAMIRP  66

Query  467  RKLLYMAIDGVAPRAKMNQ  523
            RKLLYMAIDGVAPRAKMNQ
Sbjct  67   RKLLYMAIDGVAPRAKMNQ  85



>ref|XP_006340038.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X1 [Solanum tuberosum]
 ref|XP_006340039.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X2 [Solanum tuberosum]
Length=978

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 4/113 (4%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y + +VD++EEE         PVD SKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPLSIVDMVEEEPKDDV----PVDVSKPNPNGMEFDNLYLDMNGIIH  56

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE +P+P T+ +VF  +FDYID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  57   PCFHPEGKPAPATYNDVFNSIFDYIDHLFSLVRPRKLLYMAIDGVAPRAKMNQ  109



>gb|EYC03740.1| hypothetical protein Y032_0092g2598 [Ancylostoma ceylanicum]
Length=266

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AF+RWL  KY  ++V+  E+     +G +IP+D++KPNPN  EFDNLYLDMNGIIH
Sbjct  1    MGVPAFFRWLTRKYPSIIVNANEDRQRNADGTRIPIDSTKPNPNFQEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PC HPEDRP P   +E+F  +F+YIDR+F +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCTHPEDRPPPANEDEMFALIFEYIDRIFSIVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_002466304.1| hypothetical protein SORBIDRAFT_01g005340 [Sorghum bicolor]
 gb|EER93302.1| hypothetical protein SORBIDRAFT_01g005340 [Sorghum bicolor]
Length=990

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + V D  EEE V +E    +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLTVSDAEEEEPVELEPGAFVPVDLRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP+PTT++EVF+ +F YID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPAPTTYDEVFKSIFYYIDHLFGLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|NP_001233774.1| ethylene insensitive 5/7 [Solanum lycopersicum]
 gb|ADQ27233.1| 5'-3' exoribonuclease 4 [Solanum lycopersicum]
Length=978

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 4/113 (4%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y + +VD++EEE         PVD SKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPLSIVDMVEEEPKDDV----PVDISKPNPNGMEFDNLYLDMNGIIH  56

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE +P+P T+ +VF  +FDYID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  57   PCFHPEGKPAPATYNDVFNSIFDYIDHLFSLVRPRKLLYMAIDGVAPRAKMNQ  109



>ref|XP_003591033.1| 5'-3' exoribonuclease [Medicago truncatula]
Length=1029

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 5/113 (4%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y + + DV+E++ V       P+D SKPNPN IEFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPLSISDVVEDDDVPS-----PIDASKPNPNGIEFDNLYLDMNGIIH  55

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHP+ +PSP T++EVF+ +FDY+D LF +VRPRKLLY+A DGVAPRAKMNQ
Sbjct  56   PCFHPDGKPSPATYDEVFKLVFDYVDHLFSLVRPRKLLYLATDGVAPRAKMNQ  108



>ref|XP_010776763.1| PREDICTED: 5'-3' exoribonuclease 2-like [Notothenia coriiceps]
Length=238

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AF+RWL+ KY+ +VV  +EE+     GV IPVDT+KPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFFRWLSRKYASIVVHCVEEKGKECNGVCIPVDTTKPNPNEVEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PC HPED+ +P   +E+   +F+YIDRLF +VRPR++LYMAIDGVAPRAKMNQ
Sbjct  61   PCTHPEDKAAPKNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQ  113



>ref|XP_010246757.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X3 [Nelumbo nucifera]
Length=1073

 Score =   155 bits (392),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 75/114 (66%), Positives = 84/114 (74%), Gaps = 8/114 (7%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWL  KY              +E     +D+SKPNPN IEFDNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLVHKYP-------STVVNAVEERGHEIDSSKPNPNGIEFDNLYLDMNGIIH  53

Query  365  PCFHPEDRP-SPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED    PTTF+EVF  +F+YIDRLF +VRPRKLLYMA+DGVAPRAKMNQ
Sbjct  54   PCFHPEDELFPPTTFQEVFERIFEYIDRLFRIVRPRKLLYMAVDGVAPRAKMNQ  107



>ref|XP_010246750.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X2 [Nelumbo nucifera]
Length=1099

 Score =   155 bits (392),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 75/114 (66%), Positives = 84/114 (74%), Gaps = 8/114 (7%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWL  KY              +E     +D+SKPNPN IEFDNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLVHKYP-------STVVNAVEERGHEIDSSKPNPNGIEFDNLYLDMNGIIH  53

Query  365  PCFHPEDRP-SPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED    PTTF+EVF  +F+YIDRLF +VRPRKLLYMA+DGVAPRAKMNQ
Sbjct  54   PCFHPEDELFPPTTFQEVFERIFEYIDRLFRIVRPRKLLYMAVDGVAPRAKMNQ  107



>ref|XP_008797339.1| PREDICTED: 5'-3' exoribonuclease 4-like [Phoenix dactylifera]
Length=716

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + V DVIEEE  V      + VD S+PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLAVADVIEEEPGVAADGLPLAVDPSRPNPNGVEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RPSP T+++VFR +F YID LF ++RPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPSPATYDDVFRSIFAYIDHLFGLIRPRKLLYMAIDGVAPRAKMNQ  114



>gb|EAY92163.1| hypothetical protein OsI_13876 [Oryza sativa Indica Group]
Length=997

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   V D +EEE V +E    +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPQTVSDAVEEEPVELEPGAFVPVDLRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP+PTT++EVF+ +F YID LF +VRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPAPTTYDEVFKSIFAYIDHLFGLVRPRKLIYMAIDGVAPRAKMNQ  114



>gb|EAZ28895.1| hypothetical protein OsJ_12935 [Oryza sativa Japonica Group]
Length=997

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   V D +EEE V +E    +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPQTVSDAVEEEPVELEPGAFVPVDLRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP+PTT++EVF+ +F YID LF +VRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPAPTTYDEVFKSIFAYIDHLFGLVRPRKLIYMAIDGVAPRAKMNQ  114



>ref|NP_001051542.1| Os03g0794800 [Oryza sativa Japonica Group]
 gb|AAT76426.1| putative 5'-3' exonuclease [Oryza sativa Japonica Group]
 gb|ABF99326.1| 5'-3' exoribonuclease, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13456.1| Os03g0794800 [Oryza sativa Japonica Group]
Length=988

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   V D +EEE V +E    +PVD  +PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPQTVSDAVEEEPVELEPGAFVPVDLRRPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RP+PTT++EVF+ +F YID LF +VRPRKL+YMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPAPTTYDEVFKSIFAYIDHLFGLVRPRKLIYMAIDGVAPRAKMNQ  114



>gb|KFM64851.1| 5'-3' exoribonuclease 2, partial [Stegodyphus mimosarum]
Length=244

 Score =   146 bits (368),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AF+RWL+ KY  +VV  IEE+  ++ GVKIPVDTS PNPN++EFDNLYLDMNGIIH
Sbjct  1    MGVPAFFRWLSRKYPSIVVHCIEEKPKIVNGVKIPVDTSLPNPNDVEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PC HPE++P+P   EE+   +F+YIDR+F +VRPR+LLYMAIDGVAPRAKMNQ
Sbjct  61   PCCHPENKPAPKDEEEMMIAIFEYIDRIFSIVRPRRLLYMAIDGVAPRAKMNQ  113



>ref|XP_007030645.1| Exoribonuclease 4 isoform 1 [Theobroma cacao]
 gb|EOY11147.1| Exoribonuclease 4 isoform 1 [Theobroma cacao]
Length=990

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   + DVIEEE      G +IPVD SKPNPN +EFDNLYLD+NGII
Sbjct  1    MGVPAFYRWLADRYPQSIADVIEEEPREDGLGNQIPVDVSKPNPNGLEFDNLYLDINGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ +P+P T+++VF+ +FDYID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGKPAPATYDDVFKSIFDYIDHLFSLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_010917731.1| PREDICTED: 5'-3' exoribonuclease 4 isoform X3 [Elaeis guineensis]
Length=858

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + V DVI+EE  V      + VD S+PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLTVADVIDEEPGVGADGLPLAVDPSRPNPNGVEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RPSP T+++VFR +F YID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPSPATYDDVFRSIFAYIDHLFGLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_002275560.2| PREDICTED: 5'-3' exoribonuclease 3-like [Vitis vinifera]
Length=834

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MG+ AFYRWLA++Y + VV+ +E+   V+ GV + VDT++PNPN  EFDNLYLDMNGIIH
Sbjct  1    MGIPAFYRWLADRYPLAVVNAVEDRPAVVNGVSVAVDTTRPNPNGNEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE  P+P T+ +VF+ +F YIDR+F +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEGLPAPKTYTDVFKAVFKYIDRIFSLVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_010246744.1| PREDICTED: 5'-3' exoribonuclease 3-like isoform X1 [Nelumbo nucifera]
Length=1154

 Score =   154 bits (390),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 75/114 (66%), Positives = 84/114 (74%), Gaps = 8/114 (7%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWL  KY              +E     +D+SKPNPN IEFDNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLVHKYP-------STVVNAVEERGHEIDSSKPNPNGIEFDNLYLDMNGIIH  53

Query  365  PCFHPEDRP-SPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPED    PTTF+EVF  +F+YIDRLF +VRPRKLLYMA+DGVAPRAKMNQ
Sbjct  54   PCFHPEDELFPPTTFQEVFERIFEYIDRLFRIVRPRKLLYMAVDGVAPRAKMNQ  107



>ref|XP_007513000.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16558.1| predicted protein [Bathycoccus prasinos]
Length=1062

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWL+ KY  ++ DV+E+E V I G K+ VD+SK NPN  EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLSVKYPKIIADVVEDEVVDINGNKVFVDSSKSNPNGQEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPEDRP PTT EEVF  +F+YI+RLF+M+RPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   PCFHPEDRPPPTTEEEVFLNIFEYIERLFLMIRPRKVLYMAIDGVAPRAKMNQ  113



>ref|XP_006301240.1| hypothetical protein CARUB_v10021640mg [Capsella rubella]
 gb|EOA34138.1| hypothetical protein CARUB_v10021640mg [Capsella rubella]
Length=948

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   + DV+EEE      G  IPVD +KPNPN  EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPKSISDVVEEEPTDGGRGDLIPVDITKPNPNGFEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+++VF+ MF+YID LF ++RPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYDDVFKSMFEYIDHLFTLIRPRKILYMAIDGVAPRAKMNQ  114



>ref|XP_006382752.1| 5'-3' exoribonuclease family protein [Populus trichocarpa]
 gb|ERP60549.1| 5'-3' exoribonuclease family protein [Populus trichocarpa]
Length=948

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +VDVIEEE      G   P+D SKPNPN IE+DNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSIVDVIEEEPQEDSNGNSKPIDVSKPNPNGIEYDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+++VF+ +F YID LF +VRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYDDVFKSIFVYIDHLFALVRPRKLLFMAIDGVAPRAKMNQ  114



>ref|XP_010754608.1| PREDICTED: 5'-3' exoribonuclease 2 [Larimichthys crocea]
Length=521

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AF+RWL+ KYS ++V  +EE+     GV+IPVDT+KPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFFRWLSRKYSSIIVHCVEEKGKECNGVRIPVDTTKPNPNEVEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PC HPED+P+P   +E+   +F+YIDRLF +VRPR++LYMAIDGVAPRAKMNQ
Sbjct  61   PCTHPEDKPAPKNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQ  113



>ref|XP_010917728.1| PREDICTED: 5'-3' exoribonuclease 4 isoform X1 [Elaeis guineensis]
Length=913

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + V DVI+EE  V      + VD S+PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLTVADVIDEEPGVGADGLPLAVDPSRPNPNGVEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RPSP T+++VFR +F YID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPSPATYDDVFRSIFAYIDHLFGLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_011091940.1| PREDICTED: 5'-3' exoribonuclease 4 [Sesamum indicum]
Length=946

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +VDV+EEE    E    +P+D S+PNPN IEFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLCIVDVVEEEPRKDERGLPLPIDVSRPNPNGIEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+++VFR +F+YID L  +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYDDVFRSIFEYIDHLVSLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_011032477.1| PREDICTED: 5'-3' exoribonuclease 4 [Populus euphratica]
Length=948

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +VDVIEEE      G   P+D SKPNPN IE+DNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSIVDVIEEEPQEDSNGNSKPIDVSKPNPNGIEYDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+++VF+ +F YID LF +VRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYDDVFKSIFVYIDHLFALVRPRKLLFMAIDGVAPRAKMNQ  114



>ref|XP_010917730.1| PREDICTED: 5'-3' exoribonuclease 4 isoform X2 [Elaeis guineensis]
Length=905

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + V DVI+EE  V      + VD S+PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLTVADVIDEEPGVGADGLPLAVDPSRPNPNGVEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE RPSP T+++VFR +F YID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGRPSPATYDDVFRSIFAYIDHLFGLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_002512252.1| 5'->3' exoribonuclease, putative [Ricinus communis]
 gb|EEF49704.1| 5'->3' exoribonuclease, putative [Ricinus communis]
Length=964

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +VDV+EEE      GV  P+D SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLAIVDVVEEEPKEDSNGVIGPIDISKPNPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ +P P T+++VF+ +FDYID LF +VRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGKPPPPTYDDVFKSIFDYIDHLFTLVRPRKLLFMAIDGVAPRAKMNQ  114



>gb|KDP23624.1| hypothetical protein JCGZ_23457 [Jatropha curcas]
Length=965

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +VDV+EEE      GV IP+D S+PNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLAIVDVVEEEPKEDANGVSIPIDVSRPNPNGVEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T++ VF+ +FDYID +F +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPPTYDVVFKSIFDYIDHIFSLVRPRKLLYLAIDGVAPRAKMNQ  114



>ref|XP_004302012.1| PREDICTED: 5'-3' exoribonuclease 4 [Fragaria vesca subsp. vesca]
Length=971

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +VDV+EE           P+D S+PNPN  EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSIVDVVEEHPREDPNGVPRPIDVSRPNPNGFEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ RP+P T+E+V++ +FDYID LF +VRPRKLL+MAIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGRPAPVTYEDVYKSIFDYIDHLFTLVRPRKLLFMAIDGVAPRAKMNQ  114



>ref|XP_010090276.1| 5'-3' exoribonuclease 4 [Morus notabilis]
 gb|EXB39214.1| 5'-3' exoribonuclease 4 [Morus notabilis]
Length=957

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + + DV+EEE         +P+D SKPNPN +EFDNLYLDMNG+I
Sbjct  1    MGVPAFYRWLADRYPLSISDVVEEEPKEDSNGIPMPIDVSKPNPNGLEFDNLYLDMNGLI  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+ +VF+ +F+YID LF +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYNDVFKSIFEYIDHLFSLVRPRKLLYLAIDGVAPRAKMNQ  114



>ref|XP_003521740.1| PREDICTED: 5'-3' exoribonuclease 4-like [Glycine max]
Length=960

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y + + DV+EEE  V  G    VD SKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPLSIADVVEEEPSVGSGA---VDVSKPNPNGMEFDNLYLDMNGIIH  57

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHP+ + +PTT+E+VF+ +FDYID +F +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  58   PCFHPDGKSAPTTYEDVFKSIFDYIDHIFSLVRPRKLLYLAIDGVAPRAKMNQ  110



>ref|XP_010659929.1| PREDICTED: 5'-3' exoribonuclease 4 [Vitis vinifera]
Length=975

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y + V+DV+EEE          +D S+PNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPLAVMDVVEEEPSEGGAE---IDVSRPNPNGMEFDNLYLDMNGIIH  57

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHP+ +P+PTT+++VF+ +FDYID LF +VRPR+LLYMAIDGVAPRAKMNQ
Sbjct  58   PCFHPDGKPAPTTYDDVFKSIFDYIDHLFSLVRPRRLLYMAIDGVAPRAKMNQ  110



>gb|EJW76545.1| hypothetical protein WUBG_12547, partial [Wuchereria bancrofti]
Length=123

 Score =   141 bits (355),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AF+RWL  KY  VVVD +EE+   + G+++PV+T  PNPN  EFDNLYLDMNGIIH
Sbjct  7    MGVPAFFRWLTRKYPSVVVDAVEEKPRDLNGIRVPVNTVDPNPNFQEFDNLYLDMNGIIH  66

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKM  517
            PC HPEDRP P T EE+F  +F+YIDRLF +VRPRKLLYMAIDGVAPRAK+
Sbjct  67   PCTHPEDRPCPKTEEEMFMLIFEYIDRLFAIVRPRKLLYMAIDGVAPRAKV  117



>ref|XP_010102036.1| 5'-3' exoribonuclease 3 [Morus notabilis]
 gb|EXB91256.1| 5'-3' exoribonuclease 3 [Morus notabilis]
Length=1010

 Score =   153 bits (386),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 77/115 (67%), Positives = 89/115 (77%), Gaps = 9/115 (8%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV +FYRWL +KY        +     IE  +I ++TS PNPN IEFDNLYLDMNGIIH
Sbjct  1    MGVPSFYRWLVDKYP-------KVVENAIEETEISLNTSLPNPNGIEFDNLYLDMNGIIH  53

Query  365  PCFHPE--DRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHPE  D  +P+TFEEVF+ MF+YIDRLF +VRPRKLLYMA+DGVAPRAKMNQ
Sbjct  54   PCFHPEEEDISTPSTFEEVFKNMFEYIDRLFNIVRPRKLLYMAVDGVAPRAKMNQ  108



>ref|XP_006604839.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X4 [Glycine max]
Length=719

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 5/113 (4%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y + + DV+EE+          VD SKPNP+ +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPLSITDVVEEDPSAGA-----VDVSKPNPSGMEFDNLYLDMNGIIH  55

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHP+ +P+P T+E+VF+ +FDYID +F +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  56   PCFHPDGKPAPATYEDVFKSIFDYIDHIFSLVRPRKLLYLAIDGVAPRAKMNQ  108



>dbj|BAE21766.1| unnamed protein product [Mus musculus]
Length=417

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AF+RWL+ KY  ++V+ +EE+     GVKIPVD SKPNPN++EFDNLYLDMNGIIH
Sbjct  1    MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PC HPED+P+P   +E+   +F+YIDRLF +VRPR+LLYMAIDGVAPRAKMNQ
Sbjct  61   PCTHPEDKPAPKNEDEMMVAIFEYIDRLFNIVRPRRLLYMAIDGVAPRAKMNQ  113



>emb|CBI34215.3| unnamed protein product [Vitis vinifera]
Length=1083

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y + V+DV+EEE          +D S+PNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPLAVMDVVEEEPSEGGAE---IDVSRPNPNGMEFDNLYLDMNGIIH  57

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHP+ +P+PTT+++VF+ +FDYID LF +VRPR+LLYMAIDGVAPRAKMNQ
Sbjct  58   PCFHPDGKPAPTTYDDVFKSIFDYIDHLFSLVRPRRLLYMAIDGVAPRAKMNQ  110



>ref|XP_009017020.1| hypothetical protein HELRODRAFT_191587 [Helobdella robusta]
 gb|ESO05087.1| hypothetical protein HELRODRAFT_191587 [Helobdella robusta]
Length=476

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AF+RWL+ KYS +VV   E++  +I+GV++P+D ++PNPNN+EFDNLYLDMNGIIH
Sbjct  1    MGVPAFFRWLSRKYSSIVVHAKEDKQKIIDGVQVPIDITQPNPNNVEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PC HPE++P+P   +E+   +F+YIDRL  +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCCHPENKPAPKNEDEMMVLIFEYIDRLMAIVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_009765212.1| PREDICTED: 5'-3' exoribonuclease 4 [Nicotiana sylvestris]
 ref|XP_009765213.1| PREDICTED: 5'-3' exoribonuclease 4 [Nicotiana sylvestris]
Length=982

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + +VDV+EEE      G+ +PVD SKPNPN +EFDN+YLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSIVDVVEEEPKEDSHGLFVPVDISKPNPNGMEFDNMYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+++VF+ +F YID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYDDVFKSIFVYIDHLFSLVRPRKLLYMAIDGVAPRAKMNQ  114



>gb|KGN60833.1| hypothetical protein Csa_2G012150 [Cucumis sativus]
Length=915

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavvi-egvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   + DV+EEE V    GV  P+D SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPRSIADVVEEEPVGGPSGVLFPIDVSKPNPNGMEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P P T++ VF+ +FDYID LF +VRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPPPATYDAVFKSIFDYIDHLFSLVRPRKVLYMAIDGVAPRAKMNQ  114



>ref|XP_006606481.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X3 [Glycine max]
Length=907

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + + DV+EE+  V +     P+D SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSIADVVEEDPAVGDDGVPFPIDASKPNPNGMEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ +P+P T+++VF+ +FDY+D L+ +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGKPAPATYDDVFKSIFDYLDHLYTLVRPRKLLYLAIDGVAPRAKMNQ  114



>gb|KHG14334.1| 5'-3' exoribonuclease 4 -like protein [Gossypium arboreum]
Length=886

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   +VDVIEEE      G +IPVD SK NPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPQSIVDVIEEEPREDGNGNQIPVDVSKANPNGLEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ +P+P T+++VF+ +FDYID L+ +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGKPAPATYDDVFKSIFDYIDHLYSLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_006606480.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X2 [Glycine max]
Length=931

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + + DV+EE+  V +     P+D SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSIADVVEEDPAVGDDGVPFPIDASKPNPNGMEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ +P+P T+++VF+ +FDY+D L+ +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGKPAPATYDDVFKSIFDYLDHLYTLVRPRKLLYLAIDGVAPRAKMNQ  114



>ref|XP_006606479.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X1 [Glycine max]
Length=932

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + + DV+EE+  V +     P+D SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSIADVVEEDPAVGDDGVPFPIDASKPNPNGMEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ +P+P T+++VF+ +FDY+D L+ +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGKPAPATYDDVFKSIFDYLDHLYTLVRPRKLLYLAIDGVAPRAKMNQ  114



>ref|XP_006604838.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X3 [Glycine max]
Length=903

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 5/113 (4%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y + + DV+EE+          VD SKPNP+ +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPLSITDVVEEDPSAGA-----VDVSKPNPSGMEFDNLYLDMNGIIH  55

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHP+ +P+P T+E+VF+ +FDYID +F +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  56   PCFHPDGKPAPATYEDVFKSIFDYIDHIFSLVRPRKLLYLAIDGVAPRAKMNQ  108



>gb|AAH47182.1| 5'-3' exoribonuclease 2 [Danio rerio]
 gb|AAI65726.1| Xrn2 protein [Danio rerio]
Length=540

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AF+RWL+ KY  ++V  +EE+A    GVKIPVDTSKPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFFRWLSRKYPSIIVHCLEEKAKEYNGVKIPVDTSKPNPNEVEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PC HPED+P+P   +E+   +F+YIDRLF +VRPR++LYMAIDGVAPRAKMNQ
Sbjct  61   PCTHPEDKPAPKNEDEMMVAIFEYIDRLFNIVRPRRVLYMAIDGVAPRAKMNQ  113



>ref|XP_004139217.1| PREDICTED: 5'-3' exoribonuclease 4-like [Cucumis sativus]
Length=934

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 92/114 (81%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvki-PVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   + DV+EEE V      + P+D SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPRSIADVVEEEPVGGPSGVLFPIDVSKPNPNGMEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P P T++ VF+ +FDYID LF +VRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPPPATYDAVFKSIFDYIDHLFSLVRPRKVLYMAIDGVAPRAKMNQ  114



>ref|XP_010528793.1| PREDICTED: 5'-3' exoribonuclease 4 [Tarenaya hassleriana]
Length=959

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   + DV+EE+      G  IPVD ++PNPN  EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPKSISDVVEEQPTDDGRGGVIPVDITRPNPNGFEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+++VF+ +F+YID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYDDVFKSIFEYIDHLFSLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_008455748.1| PREDICTED: LOW QUALITY PROTEIN: 5'-3' exoribonuclease 4 [Cucumis 
melo]
Length=963

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavvi-egvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   + DV+EEE +    GV +P+D SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPRSIADVVEEEPLDGPNGVLLPIDVSKPNPNGMEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P P T++ VF+ +FDYID LF +VRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPPPATYDAVFKSIFDYIDHLFSLVRPRKVLYMAIDGVAPRAKMNQ  114



>gb|AAD25627.1|AC005287_29 Dhm1- and Dhm2-like protein [Arabidopsis thaliana]
Length=965

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   + DV+EEE      G  IPVD ++PNPN  EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPKSISDVVEEEPTDGGRGDLIPVDITRPNPNGFEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+++VF+ MF+YID LF +VRPRK+LY+AIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYDDVFKSMFEYIDHLFTLVRPRKILYLAIDGVAPRAKMNQ  114



>gb|ADN33909.1| 5'-3' exoribonuclease [Cucumis melo subsp. melo]
Length=934

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavvi-egvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   + DV+EEE +    GV +P+D SKPNPN +EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPRSIADVVEEEPLDGPNGVLLPIDVSKPNPNGMEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P P T++ VF+ +FDYID LF +VRPRK+LYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPPPATYDAVFKSIFDYIDHLFSLVRPRKVLYMAIDGVAPRAKMNQ  114



>ref|NP_175851.1| 5'-3' exoribonuclease 4 [Arabidopsis thaliana]
 sp|Q9FQ04.1|XRN4_ARATH RecName: Full=5'-3' exoribonuclease 4; AltName: Full=Protein 
ACC INSENSITIVE 1; AltName: Full=Protein ETHYLENE INSENSITIVE 
5; AltName: Full=Protein EXORIBONUCLEASE 4 [Arabidopsis thaliana]
 gb|AAG40731.1|AF286718_1 XRN4 [Arabidopsis thaliana]
 gb|AAL36368.1| putative exonuclease [Arabidopsis thaliana]
 gb|AAM14350.1| putative exonuclease [Arabidopsis thaliana]
 gb|ABG34298.1| At1g54490 [Arabidopsis thaliana]
 gb|AEE33109.1| 5'-3' exoribonuclease 4 [Arabidopsis thaliana]
Length=947

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieee-avviegvkiPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y   + DV+EEE      G  IPVD ++PNPN  EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPKSISDVVEEEPTDGGRGDLIPVDITRPNPNGFEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHPE +P+P T+++VF+ MF+YID LF +VRPRK+LY+AIDGVAPRAKMNQ
Sbjct  61   HPCFHPEGKPAPATYDDVFKSMFEYIDHLFTLVRPRKILYLAIDGVAPRAKMNQ  114



>ref|XP_003146304.1| hypothetical protein LOAG_10732 [Loa loa]
Length=686

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AF+RWL  KY  V+VD +EE+   + GV+IPV+T  PNPN  EFDNLYLDMNGIIH
Sbjct  1    MGVPAFFRWLTRKYPSVIVDAVEEKPRDMNGVRIPVNTVDPNPNFQEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PC HPEDRPSP T EE+F  +F+YIDRLF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   PCTHPEDRPSPKTEEEMFTLIFEYIDRLFAIVRPRKLLYMAIDGVAPRAKMNQ  113



>ref|XP_006604837.1| PREDICTED: 5'-3' exoribonuclease 4-like isoform X2 [Glycine max]
Length=958

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 5/113 (4%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AFYRWLA++Y + + DV+EE+          VD SKPNP+ +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFYRWLADRYPLSITDVVEEDPSAGA-----VDVSKPNPSGMEFDNLYLDMNGIIH  55

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PCFHP+ +P+P T+E+VF+ +FDYID +F +VRPRKLLY+AIDGVAPRAKMNQ
Sbjct  56   PCFHPDGKPAPATYEDVFKSIFDYIDHIFSLVRPRKLLYLAIDGVAPRAKMNQ  108



>ref|XP_009398534.1| PREDICTED: 5'-3' exoribonuclease 4 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=972

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + + DVIE+E     G   +P+D ++PNPN  EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSISDVIEQEPAEGMGGAPLPLDLTEPNPNGFEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ RP P T+++VF+ +FDYID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGRPLPATYDDVFKSIFDYIDHLFGLVRPRKLLYMAIDGVAPRAKMNQ  114



>ref|XP_009398535.1| PREDICTED: 5'-3' exoribonuclease 4 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=970

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvk-iPVDTSKPNPNNIEFDNLYLDMNGII  361
            MGV AFYRWLA++Y + + DVIE+E     G   +P+D ++PNPN  EFDNLYLDMNGII
Sbjct  1    MGVPAFYRWLADRYPLSISDVIEQEPAEGMGGAPLPLDLTEPNPNGFEFDNLYLDMNGII  60

Query  362  HPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            HPCFHP+ RP P T+++VF+ +FDYID LF +VRPRKLLYMAIDGVAPRAKMNQ
Sbjct  61   HPCFHPDGRPLPATYDDVFKSIFDYIDHLFGLVRPRKLLYMAIDGVAPRAKMNQ  114



>gb|KFO29062.1| 5'-3' exoribonuclease 2 [Fukomys damarensis]
Length=1560

 Score =   152 bits (385),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 78/115 (68%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  179  AKMGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGI  358
            A MGV AF+RWL+ KY  ++V+ +EE+     GVKIPVD SKPNPN++EFDNLYLDMNGI
Sbjct  609  AVMGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGI  668

Query  359  IHPCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            IHPC HPED+P+P   +E+   +F+YIDRLF +VRPR+LLYMAIDGVAPRAKMNQ
Sbjct  669  IHPCTHPEDKPAPKNEDEMMVAIFEYIDRLFNIVRPRRLLYMAIDGVAPRAKMNQ  723



>ref|NP_001091411.1| 5'-3' exoribonuclease 2 [Xenopus laevis]
 gb|AAI33744.1| LOC100049102 protein [Xenopus laevis]
Length=457

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  185  MGVTAFYRWLAEKYSMvvvdvieeeavviegvkiPVDTSKPNPNNIEFDNLYLDMNGIIH  364
            MGV AF+RWL+ KY  ++V  +E++      +KIPVDT+KPNPN +EFDNLYLDMNGIIH
Sbjct  1    MGVPAFFRWLSRKYPSIIVHCVEQKPKECNNIKIPVDTTKPNPNEVEFDNLYLDMNGIIH  60

Query  365  PCFHPEDRPSPTTFEEVFRCMFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQ  523
            PC HPED+P+P   +E+   +F+YIDRLF +VRPR+LLYMAIDGVAPRAKMNQ
Sbjct  61   PCTHPEDKPAPKNEDEMMVAIFEYIDRLFNIVRPRRLLYMAIDGVAPRAKMNQ  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800