BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J15

Length=540
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623136.1|  PREDICTED: uncharacterized protein LOC104114398  67.4    1e-10   
ref|XP_009774864.1|  PREDICTED: uncharacterized protein LOC104224850  64.7    1e-09   Nicotiana sylvestris
ref|XP_009622089.1|  PREDICTED: uncharacterized protein LOC104113584  65.5    2e-09   Nicotiana tomentosiformis
ref|XP_009792727.1|  PREDICTED: uncharacterized protein LOC104239708  64.7    4e-09   Nicotiana sylvestris
ref|XP_011096696.1|  PREDICTED: uncharacterized protein LOC105175802  64.7    5e-09   Sesamum indicum [beniseed]
ref|NP_001234800.1|  ethylene-responsive nuclear protein              63.5    9e-09   
ref|XP_004233154.1|  PREDICTED: uncharacterized protein LOC101257038  62.8    1e-08   Solanum lycopersicum
ref|XP_010315586.1|  PREDICTED: ethylene-responsive nuclear prote...  63.2    1e-08   
gb|EYU19108.1|  hypothetical protein MIMGU_mgv1a006346mg              62.0    3e-08   Erythranthe guttata [common monkey flower]
emb|CDP12578.1|  unnamed protein product                              61.6    5e-08   Coffea canephora [robusta coffee]
ref|XP_006353001.1|  PREDICTED: uncharacterized protein LOC102595566  60.8    5e-08   Solanum tuberosum [potatoes]
ref|XP_006360311.1|  PREDICTED: uncharacterized protein LOC102598774  60.1    1e-07   Solanum tuberosum [potatoes]
emb|CDX94012.1|  BnaC07g36460D                                        53.5    1e-06   
ref|XP_007022906.1|  Ethylene-responsive nuclear / ethylene-regul...  57.0    1e-06   
ref|XP_004158096.1|  PREDICTED: uncharacterized protein LOC101226968  57.0    1e-06   
ref|XP_010529356.1|  PREDICTED: uncharacterized protein LOC104806249  56.2    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_006283784.1|  hypothetical protein CARUB_v10004874mg           55.8    4e-06   Capsella rubella
ref|XP_008445595.1|  PREDICTED: uncharacterized protein LOC103488573  55.5    4e-06   Cucumis melo [Oriental melon]
ref|XP_002867871.1|  hypothetical protein ARALYDRAFT_492798           55.5    5e-06   
ref|XP_010434262.1|  PREDICTED: uncharacterized protein LOC104718251  55.1    6e-06   Camelina sativa [gold-of-pleasure]
emb|CAA75349.1|  ERT2                                                 55.1    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193820.1|  ethylene-responsive/regulated nuclear protein       55.1    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486479.1|  PREDICTED: uncharacterized protein LOC101504530  54.7    8e-06   Cicer arietinum [garbanzo]
ref|XP_010449145.1|  PREDICTED: uncharacterized protein LOC104731467  54.3    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006468334.1|  PREDICTED: uncharacterized protein LOC102615656  54.3    1e-05   Citrus sinensis [apfelsine]
ref|XP_010537563.1|  PREDICTED: uncharacterized protein LOC104812214  54.3    1e-05   Tarenaya hassleriana [spider flower]
gb|KDO75206.1|  hypothetical protein CISIN_1g048490mg                 54.3    1e-05   Citrus sinensis [apfelsine]
ref|XP_006448871.1|  hypothetical protein CICLE_v10015182mg           54.3    1e-05   Citrus clementina [clementine]
gb|KJB66579.1|  hypothetical protein B456_010G144500                  53.9    1e-05   Gossypium raimondii
emb|CDX98678.1|  BnaA03g44630D                                        53.9    1e-05   
gb|KDP23865.1|  hypothetical protein JCGZ_27134                       53.9    1e-05   Jatropha curcas
gb|KFK28683.1|  hypothetical protein AALP_AA7G032900                  53.5    2e-05   Arabis alpina [alpine rockcress]
ref|XP_010439554.1|  PREDICTED: uncharacterized protein LOC104722974  53.5    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006413843.1|  hypothetical protein EUTSA_v10025304mg           53.5    2e-05   
ref|XP_010278675.1|  PREDICTED: uncharacterized protein LOC104612796  52.8    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_008225647.1|  PREDICTED: uncharacterized protein LOC103325271  51.6    1e-04   Prunus mume [ume]
ref|XP_006403106.1|  hypothetical protein EUTSA_v10003311mg           51.2    1e-04   Eutrema salsugineum [saltwater cress]
ref|XP_010051884.1|  PREDICTED: uncharacterized protein LOC104440660  51.6    1e-04   Eucalyptus grandis [rose gum]
ref|XP_002523173.1|  hypothetical protein RCOM_1336320                51.2    1e-04   
ref|XP_007213959.1|  hypothetical protein PRUPE_ppa004941mg           51.2    1e-04   
gb|KGN49478.1|  hypothetical protein Csa_6G525630                     51.2    1e-04   Cucumis sativus [cucumbers]
gb|EPS73325.1|  hypothetical protein M569_01439                       50.8    1e-04   Genlisea aurea
ref|XP_008439534.1|  PREDICTED: uncharacterized protein LOC103484301  50.8    1e-04   Cucumis melo [Oriental melon]
ref|XP_010098540.1|  hypothetical protein L484_025980                 50.8    1e-04   Morus notabilis
ref|XP_011037724.1|  PREDICTED: uncharacterized protein LOC105134859  50.8    2e-04   Populus euphratica
ref|XP_003546277.1|  PREDICTED: uncharacterized protein LOC100819191  50.8    2e-04   Glycine max [soybeans]
emb|CDX76446.1|  BnaA08g09540D                                        50.1    2e-04   
ref|XP_008383456.1|  PREDICTED: uncharacterized protein LOC103446161  50.4    2e-04   
ref|XP_007147455.1|  hypothetical protein PHAVU_006G126000g           50.1    3e-04   Phaseolus vulgaris [French bean]
emb|CDY31430.1|  BnaC03g63940D                                        50.1    3e-04   Brassica napus [oilseed rape]
ref|XP_003594598.1|  Ethylene-regulated transcript 2 (ERT2)           50.1    3e-04   Medicago truncatula
ref|XP_006377940.1|  hypothetical protein POPTR_0011s16510g           49.7    4e-04   
ref|XP_009108482.1|  PREDICTED: uncharacterized protein LOC103834174  49.3    4e-04   Brassica rapa
ref|XP_009362199.1|  PREDICTED: uncharacterized protein LOC103952353  49.3    5e-04   Pyrus x bretschneideri [bai li]
emb|CDX82787.1|  BnaC01g12370D                                        48.9    7e-04   
emb|CDX79012.1|  BnaA01g10790D                                        48.5    8e-04   
ref|XP_009134073.1|  PREDICTED: uncharacterized protein LOC103858457  48.5    8e-04   Brassica rapa



>ref|XP_009623136.1| PREDICTED: uncharacterized protein LOC104114398 [Nicotiana tomentosiformis]
Length=268

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKKVK +S I Q+VKD     +N  SPL+VETGFPTSLVDL   +R
Sbjct  1    MSFPWKKVKKTS-ICQLVKDHIRFHRNGGSPLIVETGFPTSLVDLFFKNR  49



>ref|XP_009774864.1| PREDICTED: uncharacterized protein LOC104224850 [Nicotiana sylvestris]
Length=261

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M FPWKK+K +S I ++VK+     +N  SPL+VETGFPTSL+DL V +R 
Sbjct  1    MSFPWKKLKKTS-ICRLVKEHIRSHRNGGSPLIVETGFPTSLIDLFVKNRQ  50



>ref|XP_009622089.1| PREDICTED: uncharacterized protein LOC104113584 [Nicotiana tomentosiformis]
Length=424

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +2

Query  173  FPWKKVKSSSRISQMVKDQFHHRKNAA--SPLVVETGFPTSLVDLIVNHR  316
            FPWKKVK  + ISQMVK+   + +  A  SPL+VETGFPTSLVDL+V +R
Sbjct  4    FPWKKVKKGASISQMVKEHVMNSQRGAGSSPLMVETGFPTSLVDLVVKNR  53



>ref|XP_009792727.1| PREDICTED: uncharacterized protein LOC104239708 [Nicotiana sylvestris]
Length=424

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +2

Query  173  FPWKKVKSSSRISQMVKDQFHHRKNAA--SPLVVETGFPTSLVDLIVNHR  316
            FPWKKVK  + +SQMVK+   + +  A  SPL+VETGFPTSLVDL+V +R
Sbjct  4    FPWKKVKKGASLSQMVKEHVMNSQRGAGSSPLMVETGFPTSLVDLVVKNR  53



>ref|XP_011096696.1| PREDICTED: uncharacterized protein LOC105175802 [Sesamum indicum]
Length=477

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 3/52 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHH--RKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKKVKS+ RISQ+V D  H+  ++   S LVVETGFPTSLVDL + +R
Sbjct  1    MAFPWKKVKST-RISQLVNDHLHNSQKRRDGSSLVVETGFPTSLVDLFMKNR  51



>ref|NP_001234800.1| ethylene-responsive nuclear protein [Solanum lycopersicum]
 gb|ABB13294.1| ethylene-responsive nuclear protein [Solanum lycopersicum]
Length=406

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKKVK +S ISQ+VKD  H    + SPL+VETGFPTSLVD +V +R
Sbjct  1    MPFPWKKVKKTS-ISQLVKD--HVNSQSGSPLMVETGFPTSLVDFVVKNR  47



>ref|XP_004233154.1| PREDICTED: uncharacterized protein LOC101257038 [Solanum lycopersicum]
Length=341

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 5/50 (10%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKK+K +S ISQ+VKD  H +K    PL+VETGFP+SLVDL V +R
Sbjct  1    MSFPWKKLKKTS-ISQLVKDHIHSQK----PLMVETGFPSSLVDLFVKNR  45



>ref|XP_010315586.1| PREDICTED: ethylene-responsive nuclear protein isoform X1 [Solanum 
lycopersicum]
Length=443

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKKVK +S ISQ+VKD  H    + SPL+VETGFPTSLVD +V +R
Sbjct  1    MPFPWKKVKKTS-ISQLVKD--HVNSQSGSPLMVETGFPTSLVDFVVKNR  47



>gb|EYU19108.1| hypothetical protein MIMGU_mgv1a006346mg [Erythranthe guttata]
Length=447

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 3/52 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHH--RKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKKVKS+ RISQ V D  H+  R+   S L VETGFPTSLVDL + +R
Sbjct  1    MPFPWKKVKST-RISQFVNDHLHNSQRRRDGSSLFVETGFPTSLVDLFIKNR  51



>emb|CDP12578.1| unnamed protein product [Coffea canephora]
Length=451

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQF-HHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKKVK++ +ISQ+V D     R+    PLVVETGFPTSLVD++V +R
Sbjct  1    MPFPWKKVKNT-KISQLVTDHLDSQRRLGGPPLVVETGFPTSLVDIVVRNR  50



>ref|XP_006353001.1| PREDICTED: uncharacterized protein LOC102595566 [Solanum tuberosum]
Length=340

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 5/50 (10%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKK+K +S ISQ+VKD  H    + SP +VETGFP+SLVDL V +R
Sbjct  1    MSFPWKKLKKTS-ISQLVKDHVH----SQSPFMVETGFPSSLVDLFVKNR  45



>ref|XP_006360311.1| PREDICTED: uncharacterized protein LOC102598774 [Solanum tuberosum]
Length=437

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKKVK +S ISQ+VKD  H      S L+VETGFPTSLVDL+V +R
Sbjct  1    MPFPWKKVKKTS-ISQLVKD--HVNSQNGSHLMVETGFPTSLVDLVVKNR  47



>emb|CDX94012.1| BnaC07g36460D [Brassica napus]
Length=66

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 2/52 (4%)
 Frame = +2

Query  167  MGFPWKKVKS-SSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KS S RIS+ V       K   S LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKSKSKSGRISRFVSGLQQSPKRGGS-LVVETGFPTSLIDLFVKNRD  51



>ref|XP_007022906.1| Ethylene-responsive nuclear / ethylene-regulated nuclear protein 
(ERT2)-like protein [Theobroma cacao]
 gb|EOY25528.1| Ethylene-responsive nuclear / ethylene-regulated nuclear protein 
(ERT2)-like protein [Theobroma cacao]
Length=414

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M FPWKK K + RIS++V D  H        LVVETGFPTSL+DL V +RD
Sbjct  1    MPFPWKKAKVT-RISRLVAD-LHQSPKRGGSLVVETGFPTSLIDLFVKNRD  49



>ref|XP_004158096.1| PREDICTED: uncharacterized protein LOC101226968 [Cucumis sativus]
 gb|KGN65904.1| hypothetical protein Csa_1G537530 [Cucumis sativus]
Length=439

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 3/49 (6%)
 Frame = +2

Query  173  FPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
             PWK  ++S RISQ+V D   H    AS LVVETGFPTS+VDL V HRD
Sbjct  4    LPWKTTRAS-RISQIVAD--LHSPKRASSLVVETGFPTSIVDLFVKHRD  49



>ref|XP_010529356.1| PREDICTED: uncharacterized protein LOC104806249 [Tarenaya hassleriana]
Length=429

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KS  RIS++V D     K+  S LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKAKSG-RISRLVSDLQQSSKHGGS-LVVETGFPTSLIDLFVKNRD  49



>ref|XP_006283784.1| hypothetical protein CARUB_v10004874mg [Capsella rubella]
 gb|EOA16682.1| hypothetical protein CARUB_v10004874mg [Capsella rubella]
Length=425

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KSS RIS+ V D     K+  S LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKSKSS-RISRFVSDLQQSPKHGGS-LVVETGFPTSLIDLFVKNRD  49



>ref|XP_008445595.1| PREDICTED: uncharacterized protein LOC103488573 [Cucumis melo]
Length=439

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +2

Query  179  WKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            WK  ++S RISQ+V D FH  K A S LVVETGFPTS+VDL V HRD
Sbjct  6    WKTTRAS-RISQIVAD-FHSPKRAGS-LVVETGFPTSIVDLFVKHRD  49



>ref|XP_002867871.1| hypothetical protein ARALYDRAFT_492798 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44130.1| hypothetical protein ARALYDRAFT_492798 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KSS RIS+ V D     K+  S LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKSKSS-RISRFVSDLQQSPKHGGS-LVVETGFPTSLIDLFVKNRD  49



>ref|XP_010434262.1| PREDICTED: uncharacterized protein LOC104718251 [Camelina sativa]
Length=426

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KSS RIS+ V D     K+  S LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKSKSS-RISRFVTDLQQSPKHGGS-LVVETGFPTSLIDLFVKNRD  49



>emb|CAA75349.1| ERT2 [Arabidopsis thaliana]
Length=407

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KSS RIS+ V D F         LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKSKSS-RISRFVSD-FQQSPKHGGSLVVETGFPTSLIDLFVKNRD  49



>ref|NP_193820.1| ethylene-responsive/regulated nuclear protein [Arabidopsis thaliana]
 emb|CAB45883.1| ethylene-regulated transcript 2 (ERT2) [Arabidopsis thaliana]
 emb|CAB79088.1| ethylene-regulated transcript 2 (ERT2) [Arabidopsis thaliana]
 dbj|BAC43137.1| putative ethylene-regulated transcript 2 ERT2 [Arabidopsis thaliana]
 gb|AEE84371.1| ethylene-responsive/regulated nuclear protein [Arabidopsis thaliana]
Length=405

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KSS RIS+ V D F         LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKSKSS-RISRFVSD-FQQSPKHGGSLVVETGFPTSLIDLFVKNRD  49



>ref|XP_004486479.1| PREDICTED: uncharacterized protein LOC101504530 [Cicer arietinum]
Length=407

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 2/50 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKK    +RISQ+V D    ++  +  LVVETGFPTSL+DL V +R
Sbjct  1    MPFPWKKKNRVTRISQIVADLQSPKRGGS--LVVETGFPTSLIDLFVKNR  48



>ref|XP_010449145.1| PREDICTED: uncharacterized protein LOC104731467 [Camelina sativa]
Length=422

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK +SS RIS+ V D F         LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKSRSS-RISRFVSD-FQQSPKHGGSLVVETGFPTSLIDLFVKNRD  49



>ref|XP_006468334.1| PREDICTED: uncharacterized protein LOC102615656 [Citrus sinensis]
Length=456

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK K S RIS++V D F         LVV+TGFPTSLVDL V +RD
Sbjct  1    MPLPWKKTKVS-RISRLVAD-FQSPPKRGGSLVVQTGFPTSLVDLFVKNRD  49



>ref|XP_010537563.1| PREDICTED: uncharacterized protein LOC104812214 [Tarenaya hassleriana]
Length=433

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KS  RIS+ V D     K+  S LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKAKSG-RISRFVADLQQSPKHGGS-LVVETGFPTSLIDLFVKNRD  49



>gb|KDO75206.1| hypothetical protein CISIN_1g048490mg [Citrus sinensis]
Length=444

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK K S RIS++V D F         LVV+TGFPTSLVDL V +RD
Sbjct  1    MPLPWKKTKVS-RISRLVAD-FQSPPKRGGSLVVQTGFPTSLVDLFVKNRD  49



>ref|XP_006448871.1| hypothetical protein CICLE_v10015182mg [Citrus clementina]
 gb|ESR62111.1| hypothetical protein CICLE_v10015182mg [Citrus clementina]
Length=458

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK K S RIS++V D F         LVV+TGFPTSLVDL V +RD
Sbjct  1    MPLPWKKTKVS-RISRLVAD-FQSPPKRGGSLVVQTGFPTSLVDLFVKNRD  49



>gb|KJB66579.1| hypothetical protein B456_010G144500 [Gossypium raimondii]
Length=321

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M FPWKK K + RIS++V    H        LVVETGFPTSL+DL V +RD
Sbjct  1    MHFPWKKAKVT-RISRLVAG-LHQSPKRGGSLVVETGFPTSLIDLFVKNRD  49



>emb|CDX98678.1| BnaA03g44630D [Brassica napus]
Length=330

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 2/52 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSS-RISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KS S RIS+ V +     K   S LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKSKSKSGRISRFVSNLRQSPKRGGS-LVVETGFPTSLIDLFVKNRD  51



>gb|KDP23865.1| hypothetical protein JCGZ_27134 [Jatropha curcas]
Length=510

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK K S RIS++V D    +  +   LVVETGFPTSLVDL V +RD
Sbjct  1    MPLPWKKAKVS-RISRLVAD--LQQPKSGKSLVVETGFPTSLVDLFVKNRD  48



>gb|KFK28683.1| hypothetical protein AALP_AA7G032900 [Arabis alpina]
Length=413

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 32/51 (63%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KS  RIS+ V D F         LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKSKSG-RISRFVSD-FQQSPKHGGSLVVETGFPTSLIDLFVKNRD  49



>ref|XP_010439554.1| PREDICTED: uncharacterized protein LOC104722974 [Camelina sativa]
Length=419

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KSS RIS+ V D     K+  S LVVETGFPTSL+DL V +R+
Sbjct  1    MPLPWKKSKSS-RISRFVTDLQQSPKHGGS-LVVETGFPTSLIDLFVKNRN  49



>ref|XP_006413843.1| hypothetical protein EUTSA_v10025304mg [Eutrema salsugineum]
 gb|ESQ55296.1| hypothetical protein EUTSA_v10025304mg [Eutrema salsugineum]
Length=420

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KS  RIS+ V D     K+  S LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKSKSG-RISRFVSDLQQSPKHGGS-LVVETGFPTSLIDLFVKNRD  49



>ref|XP_010278675.1| PREDICTED: uncharacterized protein LOC104612796 [Nelumbo nucifera]
Length=459

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK K   RIS+ V D    ++  +  LVVETGFPTSL+DLIV +RD
Sbjct  1    MPLPWKKAKIG-RISRFVADLRSSKRGGS--LVVETGFPTSLIDLIVKNRD  48



>ref|XP_008225647.1| PREDICTED: uncharacterized protein LOC103325271 [Prunus mume]
Length=519

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK++ + RISQ V D    ++  +  LVV+TGFPTSLVDL V +RD
Sbjct  1    MPLPWKKMRVN-RISQFVADLQSPKRGGS--LVVQTGFPTSLVDLFVKNRD  48



>ref|XP_006403106.1| hypothetical protein EUTSA_v10003311mg [Eutrema salsugineum]
 gb|ESQ44559.1| hypothetical protein EUTSA_v10003311mg [Eutrema salsugineum]
Length=345

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 4/51 (8%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK   S RIS+ +  +F         LVVETGFPTSL+DL V +RD
Sbjct  1    MSLPWKK---SGRISRFM-SEFQQSPKRGGSLVVETGFPTSLIDLFVKNRD  47



>ref|XP_010051884.1| PREDICTED: uncharacterized protein LOC104440660 [Eucalyptus grandis]
 gb|KCW75720.1| hypothetical protein EUGRSUZ_D00100 [Eucalyptus grandis]
Length=481

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK + + RIS++V D     +   S LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKSRVT-RISRLVADLQSSPRRGGS-LVVETGFPTSLIDLFVKNRD  49



>ref|XP_002523173.1| hypothetical protein RCOM_1336320 [Ricinus communis]
 gb|EEF39204.1| hypothetical protein RCOM_1336320 [Ricinus communis]
Length=436

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK + S RIS++V D     K   S LVVETGFPTSLVDL V +R+
Sbjct  1    MPLPWKKSRVS-RISRIVAD-LQPPKPGNSSLVVETGFPTSLVDLFVKNRE  49



>ref|XP_007213959.1| hypothetical protein PRUPE_ppa004941mg [Prunus persica]
 gb|EMJ15158.1| hypothetical protein PRUPE_ppa004941mg [Prunus persica]
Length=484

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK++ + RISQ V D    ++  +  LVV+TGFPTSLVDL V +RD
Sbjct  1    MPLPWKKMRVN-RISQFVADLQSPKRGGS--LVVQTGFPTSLVDLFVKNRD  48



>gb|KGN49478.1| hypothetical protein Csa_6G525630 [Cucumis sativus]
Length=428

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK K + RIS++V D       AAS LVVETGFPTS+VDL V +RD
Sbjct  1    MPLPWKKTKPN-RISRIVAD-LQPPSRAAS-LVVETGFPTSVVDLFVKNRD  48



>gb|EPS73325.1| hypothetical protein M569_01439 [Genlisea aurea]
Length=385

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 2/49 (4%)
 Frame = +2

Query  179  WKKVKSSSRISQMVKDQFHH--RKNAASPLVVETGFPTSLVDLIVNHRD  319
            WK  + S RIS+ V D  H   ++   S LVVETGFPTSLVDL + +R+
Sbjct  6    WKMGRKSGRISEFVNDHLHQSRKRRDGSSLVVETGFPTSLVDLFMKNRE  54



>ref|XP_008439534.1| PREDICTED: uncharacterized protein LOC103484301 [Cucumis melo]
Length=429

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK K + RIS++V D      + A+ LVVETGFPTS+VDL V +RD
Sbjct  1    MPLPWKKTKPN-RISRIVADL--QPPSRATSLVVETGFPTSVVDLFVKNRD  48



>ref|XP_010098540.1| hypothetical protein L484_025980 [Morus notabilis]
 gb|EXB75200.1| hypothetical protein L484_025980 [Morus notabilis]
Length=396

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK K + RIS++V D    ++  +  LVVETGFPTSL+DL V +RD
Sbjct  1    MPLPWKKTKVT-RISRIVADLQSPKRGGS--LVVETGFPTSLIDLFVKNRD  48



>ref|XP_011037724.1| PREDICTED: uncharacterized protein LOC105134859 [Populus euphratica]
Length=479

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 36/52 (69%), Gaps = 5/52 (10%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKD-QFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M FPWKK K S R S++V D Q   R N+   LVVETGFPTSLVDL V +R+
Sbjct  1    MPFPWKKDKVS-RFSRIVADLQSPKRGNS---LVVETGFPTSLVDLFVKNRE  48



>ref|XP_003546277.1| PREDICTED: uncharacterized protein LOC100819191 [Glycine max]
Length=387

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKK     RISQ+V D    ++  +  LVVETGFPTSL+DL V +R
Sbjct  1    MPFPWKK-NRVPRISQIVADLQSPKRGGS--LVVETGFPTSLIDLFVKNR  47



>emb|CDX76446.1| BnaA08g09540D [Brassica napus]
Length=222

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KS  RIS++V D     K+  S L VETGFPTSL+ L+V +RD
Sbjct  1    MPLPWKKSKSG-RISRLVSDLQQSPKHGGS-LFVETGFPTSLIHLLVKNRD  49



>ref|XP_008383456.1| PREDICTED: uncharacterized protein LOC103446161 [Malus domestica]
Length=507

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 3/51 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK +++ RISQ V D  H  K   S L V+TGFP SL+DL V +RD
Sbjct  1    MPLPWKKTRAT-RISQFVAD-LHSPKRGGS-LFVQTGFPASLIDLFVKNRD  48



>ref|XP_007147455.1| hypothetical protein PHAVU_006G126000g [Phaseolus vulgaris]
 gb|ESW19449.1| hypothetical protein PHAVU_006G126000g [Phaseolus vulgaris]
Length=377

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKK     RISQ+V D    ++  +  LVVETGFPTSL+DL V +R
Sbjct  1    MPFPWKK-NRVPRISQIVADLQSPKRGGS--LVVETGFPTSLIDLFVKNR  47



>emb|CDY31430.1| BnaC03g63940D [Brassica napus]
Length=362

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M  PWKK KS  RIS++V D     K+  S L VETGFPTSL+DL V +R
Sbjct  1    MHLPWKKSKSG-RISRLVSDLQQSPKHGGS-LFVETGFPTSLIDLFVKNR  48



>ref|XP_003594598.1| Ethylene-regulated transcript 2 (ERT2) [Medicago truncatula]
 gb|AES64849.1| transmembrane protein, putative [Medicago truncatula]
Length=408

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 32/51 (63%), Gaps = 3/51 (6%)
 Frame = +2

Query  167  MGFPWKKVKSS-SRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHR  316
            M FPWKK K+  +RISQ V D         S LVV+TGFPTSL+DL   +R
Sbjct  1    MPFPWKKKKNRVTRISQFVAD--FQSPQRTSSLVVQTGFPTSLIDLFAKNR  49



>ref|XP_006377940.1| hypothetical protein POPTR_0011s16510g [Populus trichocarpa]
 gb|ERP55737.1| hypothetical protein POPTR_0011s16510g [Populus trichocarpa]
Length=484

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 5/52 (10%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKD-QFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M FPWKK K + R S++V D Q   R N+   LVVETGFPTSLVDL V +R+
Sbjct  1    MPFPWKKDKVA-RFSRIVADLQSPKRGNS---LVVETGFPTSLVDLFVKNRE  48



>ref|XP_009108482.1| PREDICTED: uncharacterized protein LOC103834174 [Brassica rapa]
Length=364

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KS  RIS++V D     K+  S L VETGFPTSL+ L V +RD
Sbjct  1    MPLPWKKSKSG-RISRLVSDLQQSPKHGGS-LFVETGFPTSLIHLFVKNRD  49



>ref|XP_009362199.1| PREDICTED: uncharacterized protein LOC103952353 [Pyrus x bretschneideri]
Length=491

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK +++ RISQ V D    ++  +  LVV+TGFPTSL+DL   +RD
Sbjct  1    MPLPWKKTRAN-RISQFVADLQSPKRGGS--LVVQTGFPTSLIDLFFKNRD  48



>emb|CDX82787.1| BnaC01g12370D [Brassica napus]
Length=416

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 31/51 (61%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KS  RIS+ V D     K   S LVVETGFPTSL+ L   +RD
Sbjct  1    MPLPWKKSKSG-RISKFVSDLQQSPKRGGS-LVVETGFPTSLIHLFFKNRD  49



>emb|CDX79012.1| BnaA01g10790D [Brassica napus]
Length=400

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 31/51 (61%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KS  RIS+ V D     K   S LVVETGFPTSL+ L   +RD
Sbjct  1    MPLPWKKSKSG-RISKFVSDLQQSPKRGGS-LVVETGFPTSLIHLFFKNRD  49



>ref|XP_009134073.1| PREDICTED: uncharacterized protein LOC103858457 [Brassica rapa]
Length=404

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 31/51 (61%), Gaps = 2/51 (4%)
 Frame = +2

Query  167  MGFPWKKVKSSSRISQMVKDQFHHRKNAASPLVVETGFPTSLVDLIVNHRD  319
            M  PWKK KS  RIS+ V D     K   S LVVETGFPTSL+ L   +RD
Sbjct  1    MPLPWKKSKSG-RISKFVSDLQQSPKRGGS-LVVETGFPTSLIHLFFKNRD  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645