BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J14

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFK36986.1|  unknown                                                 194   2e-59   Lotus japonicus
ref|XP_009604122.1|  PREDICTED: AP-1 complex subunit mu-2               200   1e-58   Nicotiana tomentosiformis
ref|XP_009763320.1|  PREDICTED: AP-1 complex subunit mu-2               199   5e-58   Nicotiana sylvestris
gb|KHN14546.1|  AP-1 complex subunit mu-1-I                             197   1e-57   Glycine soja [wild soybean]
gb|KHN13429.1|  AP-1 complex subunit mu-2                               192   1e-57   Glycine soja [wild soybean]
ref|XP_010682420.1|  PREDICTED: AP-1 complex subunit mu-2               197   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006366366.1|  PREDICTED: AP-1 complex subunit mu-2-like          197   2e-57   Solanum tuberosum [potatoes]
ref|XP_004239119.1|  PREDICTED: AP-1 complex subunit mu-2               197   2e-57   Solanum lycopersicum
ref|XP_009623841.1|  PREDICTED: AP-1 complex subunit mu-2               197   2e-57   Nicotiana tomentosiformis
ref|XP_003517576.1|  PREDICTED: AP-1 complex subunit mu-2-like          197   2e-57   
gb|EYU22519.1|  hypothetical protein MIMGU_mgv1a006868mg                196   5e-57   Erythranthe guttata [common monkey flower]
ref|XP_009774686.1|  PREDICTED: AP-1 complex subunit mu-2-like          196   6e-57   Nicotiana sylvestris
ref|XP_004489791.1|  PREDICTED: AP-1 complex subunit mu-1-like          196   6e-57   Cicer arietinum [garbanzo]
ref|XP_003613166.1|  AP-1 complex subunit mu                            196   7e-57   Medicago truncatula
ref|XP_004135264.1|  PREDICTED: AP-1 complex subunit mu-1-like          196   7e-57   Cucumis sativus [cucumbers]
ref|XP_008446174.1|  PREDICTED: AP-1 complex subunit mu-2               196   7e-57   Cucumis melo [Oriental melon]
ref|XP_003519692.1|  PREDICTED: AP-1 complex subunit mu-2-like          196   8e-57   Glycine max [soybeans]
ref|XP_004155408.1|  PREDICTED: AP-1 complex subunit mu-1-like          196   9e-57   
ref|XP_003552037.1|  PREDICTED: AP-1 complex subunit mu-2-like          195   1e-56   Glycine max [soybeans]
gb|KHN25155.1|  AP-1 complex subunit mu-1-I                             195   1e-56   Glycine soja [wild soybean]
ref|XP_010458434.1|  PREDICTED: AP-1 complex subunit mu-2-like          195   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_007153765.1|  hypothetical protein PHAVU_003G063300g             195   1e-56   Phaseolus vulgaris [French bean]
ref|XP_010475954.1|  PREDICTED: AP-1 complex subunit mu-2-like          195   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_008239309.1|  PREDICTED: AP-1 complex subunit mu-2-like          195   2e-56   Prunus mume [ume]
ref|XP_007157311.1|  hypothetical protein PHAVU_002G059300g             195   2e-56   Phaseolus vulgaris [French bean]
ref|XP_006417426.1|  hypothetical protein EUTSA_v10007700mg             195   2e-56   Eutrema salsugineum [saltwater cress]
emb|CDY61312.1|  BnaAnng17500D                                          194   2e-56   Brassica napus [oilseed rape]
gb|KFK43365.1|  hypothetical protein AALP_AA1G116700                    194   2e-56   Arabis alpina [alpine rockcress]
ref|XP_006307589.1|  hypothetical protein CARUB_v10009212mg             194   2e-56   Capsella rubella
ref|XP_011086615.1|  PREDICTED: AP-1 complex subunit mu-2               194   3e-56   Sesamum indicum [beniseed]
ref|XP_002889832.1|  clathrin adaptor complexes medium subunit fa...    194   3e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010553612.1|  PREDICTED: AP-1 complex subunit mu-2               194   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_008340089.1|  PREDICTED: AP-1 complex subunit mu-2-like          194   3e-56   Malus domestica [apple tree]
ref|XP_007225645.1|  hypothetical protein PRUPE_ppa006083mg             194   3e-56   Prunus persica
ref|XP_002314604.1|  clathrin adaptor complexes medium subunit fa...    194   3e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011045271.1|  PREDICTED: AP-1 complex subunit mu-2               194   3e-56   Populus euphratica
emb|CDY54239.1|  BnaC08g49960D                                          194   4e-56   Brassica napus [oilseed rape]
ref|XP_004237270.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    194   4e-56   Solanum lycopersicum
gb|KEH20175.1|  clathrin assembly protein AP47, putative                194   4e-56   Medicago truncatula
ref|XP_004298991.1|  PREDICTED: AP-1 complex subunit mu-2               194   4e-56   Fragaria vesca subsp. vesca
emb|CDX97909.1|  BnaA06g06600D                                          194   4e-56   
ref|XP_010044585.1|  PREDICTED: AP-1 complex subunit mu-2               194   5e-56   Eucalyptus grandis [rose gum]
ref|XP_003531990.1|  PREDICTED: AP-1 complex subunit mu-2-like          194   5e-56   Glycine max [soybeans]
ref|XP_008389705.1|  PREDICTED: AP-1 complex subunit mu-2               194   5e-56   Malus domestica [apple tree]
gb|KDO69520.1|  hypothetical protein CISIN_1g014251mg                   190   6e-56   Citrus sinensis [apfelsine]
ref|XP_008221881.1|  PREDICTED: AP-1 complex subunit mu-2               193   7e-56   Prunus mume [ume]
gb|EYU28424.1|  hypothetical protein MIMGU_mgv1a006870mg                193   7e-56   Erythranthe guttata [common monkey flower]
gb|KJB50248.1|  hypothetical protein B456_008G160500                    192   7e-56   Gossypium raimondii
emb|CDY19316.1|  BnaC05g08250D                                          193   7e-56   Brassica napus [oilseed rape]
ref|XP_011071132.1|  PREDICTED: AP-1 complex subunit mu-2               193   7e-56   Sesamum indicum [beniseed]
ref|XP_007044745.1|  Clathrin adaptor complexes medium subunit fa...    190   7e-56   
ref|XP_002511345.1|  clathrin coat assembly protein ap-1, putative      193   7e-56   Ricinus communis
ref|XP_006300485.1|  hypothetical protein CARUB_v10020333mg             193   8e-56   Capsella rubella
ref|XP_007209161.1|  hypothetical protein PRUPE_ppa006082mg             193   8e-56   Prunus persica
ref|NP_176277.1|  protein HAPLESS 13                                    193   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510910.1|  PREDICTED: AP-1 complex subunit mu-2               193   8e-56   Camelina sativa [gold-of-pleasure]
emb|CDP13203.1|  unnamed protein product                                193   8e-56   Coffea canephora [robusta coffee]
ref|XP_002886592.1|  clathrin adaptor complexes medium subunit fa...    193   8e-56   
ref|XP_010491832.1|  PREDICTED: AP-1 complex subunit mu-2-like          193   9e-56   Camelina sativa [gold-of-pleasure]
ref|XP_007036353.1|  Clathrin adaptor complexes medium subunit fa...    193   9e-56   
emb|CDY63681.1|  BnaA01g35660D                                          192   1e-55   Brassica napus [oilseed rape]
ref|XP_009103973.1|  PREDICTED: AP-1 complex subunit mu-2               192   1e-55   Brassica rapa
gb|KFK40761.1|  hypothetical protein AALP_AA2G037600                    192   1e-55   Arabis alpina [alpine rockcress]
ref|XP_010248608.1|  PREDICTED: AP-1 complex subunit mu-2-like          192   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010923038.1|  PREDICTED: AP-1 complex subunit mu-2               192   1e-55   Elaeis guineensis
ref|XP_010251124.1|  PREDICTED: AP-1 complex subunit mu-2               192   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010547708.1|  PREDICTED: AP-1 complex subunit mu-2-like          192   1e-55   Tarenaya hassleriana [spider flower]
ref|XP_008791180.1|  PREDICTED: AP-1 complex subunit mu-2               192   1e-55   Phoenix dactylifera
ref|XP_009359189.1|  PREDICTED: AP-1 complex subunit mu-2               192   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_006392117.1|  hypothetical protein EUTSA_v10023468mg             192   2e-55   Eutrema salsugineum [saltwater cress]
ref|XP_002527911.1|  clathrin coat assembly protein ap-1, putative      189   2e-55   
ref|XP_003567979.1|  PREDICTED: AP-1 complex subunit mu-2-like          192   2e-55   Brachypodium distachyon [annual false brome]
emb|CDY46183.1|  BnaA01g23050D                                          192   2e-55   Brassica napus [oilseed rape]
ref|XP_010533915.1|  PREDICTED: AP-1 complex subunit mu-2-like          192   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_006847624.1|  hypothetical protein AMTR_s00014p00250090          192   3e-55   Amborella trichopoda
gb|AFW83687.1|  hypothetical protein ZEAMMB73_283352                    186   3e-55   
gb|KJB50247.1|  hypothetical protein B456_008G160500                    191   3e-55   Gossypium raimondii
gb|KHG01625.1|  AP-1 complex subunit mu-1-I                             191   3e-55   Gossypium arboreum [tree cotton]
gb|KDP26640.1|  hypothetical protein JCGZ_17798                         191   3e-55   Jatropha curcas
gb|EPS71689.1|  hypothetical protein M569_03066                         191   4e-55   Genlisea aurea
ref|XP_006439891.1|  hypothetical protein CICLE_v10023962mg             191   4e-55   Citrus clementina [clementine]
ref|XP_007044744.1|  Clathrin adaptor complexes medium subunit fa...    191   4e-55   Theobroma cacao [chocolate]
ref|XP_002274463.1|  PREDICTED: AP-1 complex subunit mu-2               191   5e-55   Vitis vinifera
ref|XP_009409953.1|  PREDICTED: AP-1 complex subunit mu-2               191   6e-55   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ97229.1|  predicted protein                                      191   6e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO82237.1|  hypothetical protein CISIN_1g014235mg                   187   6e-55   Citrus sinensis [apfelsine]
ref|XP_009148415.1|  PREDICTED: AP-1 complex subunit mu-2-like          191   6e-55   Brassica rapa
ref|XP_008392998.1|  PREDICTED: AP-1 complex subunit mu-2               190   8e-55   
gb|KJB31190.1|  hypothetical protein B456_005G180000                    188   9e-55   Gossypium raimondii
ref|XP_004509658.1|  PREDICTED: AP-1 complex subunit mu-1-like          190   1e-54   Cicer arietinum [garbanzo]
gb|EPS68502.1|  hypothetical protein M569_06266                         190   1e-54   Genlisea aurea
gb|KDO82236.1|  hypothetical protein CISIN_1g014235mg                   187   1e-54   Citrus sinensis [apfelsine]
ref|XP_006438265.1|  hypothetical protein CICLE_v10031619mg             188   2e-54   
ref|XP_010100380.1|  AP-1 complex subunit mu-1-I                        189   2e-54   Morus notabilis
ref|XP_009417102.1|  PREDICTED: AP-1 complex subunit mu-2-like          189   2e-54   
gb|KJB31189.1|  hypothetical protein B456_005G180000                    189   2e-54   Gossypium raimondii
gb|KDP31052.1|  hypothetical protein JCGZ_11428                         189   2e-54   Jatropha curcas
ref|XP_010102500.1|  AP-1 complex subunit mu-1                          189   2e-54   Morus notabilis
gb|KCW86678.1|  hypothetical protein EUGRSUZ_B03301                     193   2e-54   Eucalyptus grandis [rose gum]
ref|XP_010924114.1|  PREDICTED: AP-1 complex subunit mu-2-like          189   3e-54   Elaeis guineensis
gb|KHG12319.1|  AP-1 complex subunit mu-1                               189   3e-54   Gossypium arboreum [tree cotton]
ref|XP_006646248.1|  PREDICTED: AP-1 complex subunit mu-2-like          189   4e-54   
ref|XP_006438266.1|  hypothetical protein CICLE_v10031619mg             188   6e-54   Citrus clementina [clementine]
ref|XP_009386436.1|  PREDICTED: AP-1 complex subunit mu-2-like          188   7e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001056201.1|  Os05g0543100                                       188   7e-54   
ref|XP_011034097.1|  PREDICTED: AP-1 complex subunit mu-2-like          188   7e-54   Populus euphratica
ref|NP_001140632.1|  hypothetical protein                               188   8e-54   Zea mays [maize]
ref|XP_004241506.1|  PREDICTED: AP-1 complex subunit mu-2-like          188   8e-54   
ref|XP_006347435.1|  PREDICTED: AP-1 complex subunit mu-2-like          188   8e-54   Solanum tuberosum [potatoes]
ref|XP_003569636.1|  PREDICTED: AP-1 complex subunit mu-2               187   9e-54   Brachypodium distachyon [annual false brome]
ref|XP_004969676.1|  PREDICTED: AP-1 complex subunit mu-1-like          187   1e-53   Setaria italica
ref|NP_001288528.1|  AP-1 complex subunit mu-2                          187   1e-53   Zea mays [maize]
ref|NP_001044001.1|  Os01g0703600                                       187   1e-53   
ref|XP_004298980.1|  PREDICTED: AP-1 complex subunit mu-2-like          187   2e-53   Fragaria vesca subsp. vesca
emb|CDM83667.1|  unnamed protein product                                187   2e-53   Triticum aestivum [Canadian hard winter wheat]
gb|EMT15970.1|  AP-1 complex subunit mu-1                               186   3e-53   
gb|ABR18420.1|  unknown                                                 186   4e-53   Picea sitchensis
ref|XP_009609076.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    185   6e-53   Nicotiana tomentosiformis
ref|XP_009772293.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    185   6e-53   Nicotiana sylvestris
ref|XP_009609074.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    186   6e-53   Nicotiana tomentosiformis
ref|XP_009772291.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    185   6e-53   Nicotiana sylvestris
ref|XP_008374401.1|  PREDICTED: AP-1 complex subunit mu-2-like          185   8e-53   
ref|XP_011071917.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    184   8e-53   Sesamum indicum [beniseed]
ref|XP_008792874.1|  PREDICTED: AP-1 complex subunit mu-2-like          189   1e-52   
gb|AFW83685.1|  hypothetical protein ZEAMMB73_283352                    188   1e-52   
gb|EAY75520.1|  hypothetical protein OsI_03424                          185   1e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_002968864.1|  hypothetical protein SELMODRAFT_91068              184   1e-52   
ref|XP_011071915.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    184   3e-52   Sesamum indicum [beniseed]
emb|CDY63680.1|  BnaA01g35650D                                          184   3e-52   Brassica napus [oilseed rape]
gb|EMT29153.1|  AP-1 complex subunit mu-1                               180   2e-50   
ref|XP_006354823.1|  PREDICTED: AP-1 complex subunit mu-2-like          176   8e-50   Solanum tuberosum [potatoes]
ref|XP_010678835.1|  PREDICTED: AP-1 complex subunit mu-2-like          175   4e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001782369.1|  predicted protein                                  174   1e-48   
gb|EMS61432.1|  AP-1 complex subunit mu-1                               172   8e-48   Triticum urartu
ref|XP_001781339.1|  predicted protein                                  171   2e-47   
gb|AAF17661.1|AC009398_10  F20B24.16                                    170   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172543.1|  clathrin adaptor complexes medium subunit famil...    171   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAN71247.1|  LD27989p                                                151   5e-42   Drosophila melanogaster
ref|XP_009835575.1|  AP-1 complex subunit mu-1                          147   2e-41   Aphanomyces astaci
gb|KIZ03697.1|  AP-1 complex subunit mu-1                               155   2e-41   Monoraphidium neglectum
ref|XP_011408446.1|  PREDICTED: AP-1 complex subunit mu-1-like          150   2e-41   Amphimedon queenslandica
gb|KFM77982.1|  AP-1 complex subunit mu-1                               148   2e-41   Stegodyphus mimosarum
gb|EFX86177.1|  hypothetical protein DAPPUDRAFT_222170                  154   3e-41   Daphnia pulex
gb|KHN82492.1|  AP-1 complex subunit mu-1-I                             154   3e-41   Toxocara canis
ref|XP_001902851.1|  Clathrin coat assembly protein AP47                145   7e-41   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001359566.1|  GA21750                                            153   8e-41   Drosophila pseudoobscura pseudoobscura
ref|XP_003748057.1|  PREDICTED: AP-1 complex subunit mu-1-like          153   9e-41   Galendromus occidentalis
ref|NP_649906.1|  adaptor protein complex 1, mu subunit                 153   1e-40   Drosophila melanogaster
ref|XP_001998648.1|  GI23520                                            153   1e-40   Drosophila mojavensis
ref|XP_002070012.1|  GK11256                                            153   1e-40   Drosophila willistoni
gb|ERE75426.1|  AP-1 complex subunit mu-2                               149   1e-40   Cricetulus griseus [Chinese hamsters]
ref|XP_005850786.1|  hypothetical protein CHLNCDRAFT_29685              153   2e-40   Chlorella variabilis
ref|XP_002411827.1|  clathrin coat assembly protein, putative           153   2e-40   Ixodes scapularis [blacklegged tick]
ref|XP_001990364.1|  clathrin associated protein 47                     152   2e-40   Drosophila grimshawi
gb|ETP32967.1|  hypothetical protein F442_18448                         152   2e-40   Phytophthora parasitica P10297
ref|XP_008913378.1|  hypothetical protein PPTG_17400                    152   2e-40   Phytophthora parasitica INRA-310
ref|XP_009518106.1|  hypothetical protein PHYSODRAFT_349597             152   2e-40   Phytophthora sojae
gb|ELT98131.1|  hypothetical protein CAPTEDRAFT_178783                  152   2e-40   Capitella teleta
ref|XP_005646699.1|  Mu1-adaptin                                        151   4e-40   Coccomyxa subellipsoidea C-169
gb|EDL78305.1|  rCG31866, isoform CRA_b                                 149   4e-40   Rattus norvegicus [brown rat]
ref|XP_011176465.1|  PREDICTED: AP-1 complex subunit mu-1               151   4e-40   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_004518112.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    151   4e-40   
ref|XP_003385149.1|  PREDICTED: AP-1 complex subunit mu-1-like          151   6e-40   Amphimedon queenslandica
gb|ERG87092.1|  ap-1 complex subunit mu-1-i                             151   6e-40   
ref|NP_001006851.1|  adaptor-related protein complex 1, mu 2 subunit    151   6e-40   Xenopus tropicalis [western clawed frog]
ref|XP_001637219.1|  predicted protein                                  151   6e-40   Nematostella vectensis
ref|XP_011472581.1|  PREDICTED: AP-1 complex subunit mu-2-like          146   7e-40   
emb|CCA17153.1|  Clathrin assembly complex putative                     150   1e-39   Albugo laibachii Nc14
ref|XP_006510013.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   1e-39   Mus musculus [mouse]
ref|XP_006510012.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    150   1e-39   Mus musculus [mouse]
ref|XP_008102017.1|  PREDICTED: AP-1 complex subunit mu-2               150   1e-39   Anolis carolinensis [Carolina anole]
ref|XP_001520622.2|  PREDICTED: AP-1 complex subunit mu-2               146   1e-39   
ref|XP_005181067.1|  PREDICTED: AP-1 complex subunit mu-1               150   1e-39   Musca domestica
ref|XP_008561429.1|  PREDICTED: AP-1 complex subunit mu-2               149   1e-39   Galeopterus variegatus [Malayan flying lemur]
gb|KIH46983.1|  adaptor complexe medium subunit family protein          143   1e-39   Ancylostoma duodenale
gb|EKC25539.1|  AP-1 complex subunit mu-1                               149   1e-39   Crassostrea gigas
ref|NP_001086866.1|  adaptor-related protein complex 1, mu 2 subunit    150   1e-39   Xenopus laevis [clawed frog]
ref|XP_011414129.1|  PREDICTED: AP-1 complex subunit mu-1               150   2e-39   Crassostrea gigas
ref|NP_001084934.1|  uncharacterized protein LOC431991                  150   2e-39   Xenopus laevis [clawed frog]
emb|CDI54254.1|  probable clathrin assembly protein AP47                150   2e-39   Melanopsichium pennsylvanicum 4
ref|XP_008848253.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   2e-39   
ref|XP_008848254.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   2e-39   Nannospalax galili
ref|XP_005346947.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   2e-39   
ref|XP_005346948.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    149   2e-39   Microtus ochrogaster [prairie voles]
ref|XP_007638674.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   2e-39   Cricetulus griseus [Chinese hamsters]
ref|XP_005078605.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   2e-39   Mesocricetus auratus [Syrian golden hamster]
ref|XP_001750591.1|  hypothetical protein                               149   2e-39   Monosiga brevicollis MX1
ref|NP_001103770.1|  AP-1 complex subunit mu-2 isoform 1                149   2e-39   Mus musculus [mouse]
sp|Q9WVP1.3|AP1M2_MOUSE  RecName: Full=AP-1 complex subunit mu-2;...    149   2e-39   Mus musculus [mouse]
ref|XP_005078606.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   2e-39   Mesocricetus auratus [Syrian golden hamster]
ref|NP_033808.2|  AP-1 complex subunit mu-2 isoform 2                   149   2e-39   Mus musculus [mouse]
ref|XP_008249777.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    149   2e-39   
ref|XP_003447927.1|  PREDICTED: AP-1 complex subunit mu-2-like          149   2e-39   Oreochromis niloticus
ref|XP_003760513.1|  PREDICTED: AP-1 complex subunit mu-2               149   2e-39   Sarcophilus harrisii
ref|XP_006987069.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   2e-39   
ref|NP_001102466.1|  AP-1 complex subunit mu-2                          149   2e-39   Rattus norvegicus [brown rat]
ref|XP_003974418.1|  PREDICTED: AP-1 complex subunit mu-1-like          149   2e-39   Takifugu rubripes [tiger puffer]
ref|XP_005346946.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   2e-39   
ref|XP_004378403.1|  PREDICTED: AP-1 complex subunit mu-2               149   3e-39   Trichechus manatus latirostris
emb|CCI49557.1|  unnamed protein product                                149   3e-39   Albugo candida
ref|XP_008960091.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    149   3e-39   Pan paniscus [bonobo]
emb|CEF67920.1|  AP-47                                                  150   3e-39   Strongyloides ratti
ref|XP_008960092.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X4    149   3e-39   Pan paniscus [bonobo]
gb|KDD76988.1|  adaptor complexes medium subunit domain-containin...    153   3e-39   Helicosporidium sp. ATCC 50920
gb|AEE62403.1|  unknown                                                 149   3e-39   Dendroctonus ponderosae
emb|CCI49556.1|  unnamed protein product                                149   3e-39   Albugo candida
ref|XP_968639.1|  PREDICTED: AP-1 complex subunit mu-1                  149   3e-39   Tribolium castaneum [rust-red flour beetle]
ref|NP_001251914.1|  Protein UNC-101, isoform c                         145   3e-39   Caenorhabditis elegans [roundworm]
gb|ERG81662.1|  ap-1 complex subunit mu-1-i                             149   3e-39   
ref|XP_010976634.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    148   3e-39   Camelus dromedarius [camel]
ref|XP_004748486.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   3e-39   Mustela putorius furo [black ferret]
ref|XP_008706307.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   3e-39   Ursus maritimus [white bear]
ref|XP_011287393.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   3e-39   Felis catus [cat]
ref|XP_010952555.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    148   3e-39   Camelus bactrianus [camel]
gb|EFB12978.1|  hypothetical protein PANDA_010309                       149   3e-39   Ailuropoda melanoleuca
emb|CCF51403.1|  probable clathrin assembly protein AP47                149   3e-39   Ustilago hordei
ref|XP_003809630.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   3e-39   Pan paniscus [bonobo]
ref|XP_009015103.1|  hypothetical protein HELRODRAFT_98900              149   4e-39   Helobdella robusta
ref|XP_002921414.1|  PREDICTED: AP-1 complex subunit mu-2               149   4e-39   Ailuropoda melanoleuca
ref|XP_005994174.1|  PREDICTED: AP-1 complex subunit mu-2               149   4e-39   Latimeria chalumnae
ref|XP_001165482.2|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   4e-39   
ref|XP_006875162.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   4e-39   Chrysochloris asiatica
ref|XP_007079414.1|  PREDICTED: AP-1 complex subunit mu-2               149   4e-39   
ref|XP_006875163.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   4e-39   Chrysochloris asiatica
ref|XP_004748487.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   4e-39   Mustela putorius furo [black ferret]
gb|EPB91852.1|  DNA polymerase kappa subunit                            144   4e-39   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_008706308.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   4e-39   Ursus maritimus [white bear]
ref|XP_005785717.1|  Apm1, medium subunit of the adaptin 1 complex      149   4e-39   Emiliania huxleyi CCMP1516
ref|XP_004595558.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   4e-39   Ochotona princeps [southern American pika]
ref|XP_004595557.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   4e-39   Ochotona princeps [southern American pika]
ref|XP_011287387.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   4e-39   Felis catus [cat]
ref|XP_004616623.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   4e-39   Sorex araneus [Eurasian shrew]
ref|XP_006184914.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   4e-39   
ref|XP_006184915.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   4e-39   Camelus ferus
ref|XP_004616624.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   4e-39   Sorex araneus [Eurasian shrew]
gb|ETN70109.1|  adaptor complexe medium subunit family protein          149   4e-39   Necator americanus
ref|XP_007107325.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    148   4e-39   Physeter catodon
ref|XP_010826657.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    149   4e-39   Bison bison bison
ref|XP_004689085.1|  PREDICTED: AP-1 complex subunit mu-2               149   4e-39   Condylura cristata
ref|XP_005945801.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    148   4e-39   
ref|XP_010826656.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   4e-39   Bison bison bison
ref|NP_001029683.1|  AP-1 complex subunit mu-2                          149   4e-39   Bos taurus [bovine]
ref|XP_004311234.1|  PREDICTED: AP-1 complex subunit mu-2               148   4e-39   
ref|XP_005208805.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   4e-39   Bos taurus [bovine]
ref|XP_010952553.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    149   4e-39   Camelus bactrianus [camel]
ref|XP_007107326.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X4    148   4e-39   Physeter catodon
ref|XP_006206549.1|  PREDICTED: AP-1 complex subunit mu-2               148   5e-39   
emb|CDJ83045.1|  Clathrin adaptor domain containing protein             148   5e-39   Haemonchus contortus [red stomach worm]
ref|XP_008875643.1|  hypothetical protein H310_10930                    149   5e-39   Aphanomyces invadans
ref|XP_007993426.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    147   5e-39   Chlorocebus sabaeus
ref|XP_004277412.1|  PREDICTED: AP-1 complex subunit mu-2               148   5e-39   Orcinus orca [Orca]
ref|XP_006741114.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    148   5e-39   Leptonychotes weddellii
ref|XP_001696311.1|  Mu1-Adaptin                                        148   5e-39   Chlamydomonas reinhardtii
ref|XP_004398930.1|  PREDICTED: AP-1 complex subunit mu-2               148   5e-39   Odobenus rosmarus divergens
ref|XP_004008570.1|  PREDICTED: AP-1 complex subunit mu-2 isoform 1     148   5e-39   Ovis aries [domestic sheep]
ref|XP_007169036.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    148   5e-39   Balaenoptera acutorostrata scammoni
ref|XP_006068423.1|  PREDICTED: cyclin-dependent kinase 4 inhibit...    148   5e-39   Bubalus bubalis [domestic water buffalo]
ref|XP_006741115.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    148   5e-39   Leptonychotes weddellii
ref|XP_007993425.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    147   5e-39   Chlorocebus sabaeus
ref|XP_007107324.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    148   5e-39   Physeter catodon
ref|XP_005970300.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X4    148   5e-39   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005612003.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    148   5e-39   Equus caballus [domestic horse]
ref|XP_006068422.1|  PREDICTED: cyclin-dependent kinase 4 inhibit...    148   6e-39   Bubalus bubalis [domestic water buffalo]
ref|XP_005970301.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X5    148   6e-39   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005945800.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    148   6e-39   Haplochromis burtoni
ref|XP_004567930.1|  PREDICTED: AP-1 complex subunit mu-2-like          148   6e-39   Maylandia zebra
ref|XP_006068424.1|  PREDICTED: cyclin-dependent kinase 4 inhibit...    148   6e-39   
ref|XP_001491944.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    148   6e-39   Equus caballus [domestic horse]
ref|XP_007460738.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    148   6e-39   Lipotes vexillifer [baiji]
ref|XP_007107323.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    148   6e-39   Physeter catodon
ref|XP_005682517.1|  PREDICTED: AP-1 complex subunit mu-2               148   6e-39   
ref|XP_005752282.1|  PREDICTED: AP-1 complex subunit mu-2-like          148   6e-39   Pundamilia nyererei
ref|XP_003402522.1|  PREDICTED: AP-1 complex subunit mu-1-like          142   6e-39   
ref|XP_008066225.1|  PREDICTED: AP-1 complex subunit mu-2               148   6e-39   Carlito syrichta
ref|XP_004008571.1|  PREDICTED: AP-1 complex subunit mu-2 isoform 2     148   7e-39   
gb|EJW82791.1|  AP-1 complex subunit mu-1                               146   7e-39   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_006898834.1|  PREDICTED: AP-1 complex subunit mu-2               148   7e-39   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008413480.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    148   7e-39   Poecilia reticulata
gb|EST09503.1|  putative clathrin assembly protein AP47                 148   7e-39   Kalmanozyma brasiliensis GHG001
ref|XP_010729248.1|  PREDICTED: AP-1 complex subunit mu-1-like          148   8e-39   
ref|XP_007551649.1|  PREDICTED: AP-1 complex subunit mu-2               148   8e-39   
ref|XP_004900367.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    148   8e-39   
ref|XP_007430264.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    147   8e-39   
ref|XP_005797576.1|  PREDICTED: AP-1 complex subunit mu-2-like          148   8e-39   
ref|XP_005336193.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    148   8e-39   
ref|NP_005489.2|  AP-1 complex subunit mu-2 isoform 2                   148   8e-39   
ref|XP_003798005.1|  PREDICTED: AP-1 complex subunit mu-2               148   8e-39   
dbj|BAD96666.1|  adaptor-related protein complex 1, mu 2 subunit ...    148   8e-39   
emb|CBQ73883.1|  probable clathrin assembly protein AP47                148   8e-39   
ref|XP_004900366.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    148   8e-39   
ref|XP_004060052.1|  PREDICTED: AP-1 complex subunit mu-2               148   8e-39   
ref|XP_008413472.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    148   8e-39   
ref|XP_005336192.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    148   8e-39   
dbj|BAG51230.1|  unnamed protein product                                148   8e-39   
ref|XP_005612002.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    148   8e-39   
gb|EHH29630.1|  hypothetical protein EGK_10105                          148   8e-39   
ref|XP_010372061.1|  PREDICTED: AP-1 complex subunit mu-2               148   8e-39   
gb|KFO28757.1|  AP-1 complex subunit mu-2                               147   8e-39   
gb|ELK28705.1|  AP-1 complex subunit mu-2                               147   9e-39   
ref|XP_001942784.1|  PREDICTED: AP-1 complex subunit mu-1               148   9e-39   
ref|XP_007430263.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    148   9e-39   
ref|NP_001287816.1|  AP-1 complex subunit mu-2 isoform 1                148   9e-39   
ref|XP_006161599.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    147   9e-39   
ref|XP_006023420.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X4    146   9e-39   
ref|XP_005405662.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    147   9e-39   
ref|XP_853941.2|  PREDICTED: AP-1 complex subunit mu-2                  148   9e-39   
ref|XP_006265657.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    146   9e-39   
ref|XP_005110316.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    147   9e-39   
gb|EPQ03306.1|  AP-1 complex subunit mu-2                               147   9e-39   
ref|XP_011378588.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    147   1e-38   
ref|XP_008315813.1|  PREDICTED: AP-1 complex subunit mu-2               147   1e-38   
ref|XP_011390066.1|  putative clathrin assembly protein AP47            148   1e-38   
ref|XP_003097680.1|  CRE-UNC-101 protein                                147   1e-38   
dbj|BAF63024.1|  adaptor-related protein complex 1 mu 1 subunit         147   1e-38   
ref|XP_008156278.1|  PREDICTED: AP-1 complex subunit mu-2               147   1e-38   
ref|XP_001652559.1|  AAEL007124-PA                                      147   1e-38   
gb|ETN64452.1|  clathrin coat assembly protein ap-1                     147   1e-38   
ref|XP_008614336.1|  AP-1 complex subunit mu-1                          147   1e-38   
dbj|GAC93824.1|  potential clathrin-associated protein                  149   1e-38   
ref|XP_008985504.1|  PREDICTED: AP-1 complex subunit mu-2               147   1e-38   
ref|XP_005405663.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    147   1e-38   
ref|XP_011378587.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    147   1e-38   
gb|EGT35242.1|  hypothetical protein CAEBREN_14107                      147   1e-38   
ref|XP_001661031.1|  AAEL010704-PA                                      147   1e-38   
gb|KDO31695.1|  AP-1 complex subunit mu-1                               147   1e-38   
ref|XP_002640613.1|  Hypothetical protein CBG08724                      147   1e-38   
ref|XP_004632905.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    147   1e-38   
ref|XP_006105801.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    147   1e-38   
ref|XP_003461299.1|  PREDICTED: AP-1 complex subunit mu-2               147   1e-38   
ref|XP_008413466.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    148   1e-38   
ref|XP_006161598.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    147   1e-38   
ref|XP_317947.4|  AGAP011374-PA                                         147   1e-38   
ref|XP_004068079.1|  PREDICTED: AP-1 complex subunit mu-1-like          147   1e-38   
ref|XP_006765888.1|  PREDICTED: AP-1 complex subunit mu-2               147   1e-38   
emb|CEF68429.1|  AP-47                                                  147   1e-38   
ref|XP_005859262.1|  PREDICTED: AP-1 complex subunit mu-2               147   1e-38   
ref|XP_007430262.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    147   1e-38   
ref|XP_007951771.1|  PREDICTED: AP-1 complex subunit mu-2               147   1e-38   
emb|CAC12810.1|  clathrin assembly protein complex AP1, mu subunit      145   1e-38   
ref|XP_004632904.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    147   1e-38   
ref|XP_003144659.1|  clathrin-associated protein AP47                   147   1e-38   
ref|XP_008535684.1|  PREDICTED: AP-1 complex subunit mu-2               148   1e-38   
ref|XP_004442690.1|  PREDICTED: AP-1 complex subunit mu-2               147   1e-38   
ref|XP_010633345.1|  PREDICTED: AP-1 complex subunit mu-2               147   1e-38   
gb|EYB89248.1|  hypothetical protein Y032_0234g3148                     147   1e-38   
ref|XP_010870651.1|  PREDICTED: AP-1 complex subunit mu-2-like          147   2e-38   
gb|EJW85257.1|  AP-47 protein                                           147   2e-38   
emb|CBY09496.1|  unnamed protein product                                140   2e-38   
ref|XP_002945806.1|  hypothetical protein VOLCADRAFT_108841             147   2e-38   
ref|XP_009074832.1|  PREDICTED: AP-1 complex subunit mu-1-like          139   2e-38   
ref|XP_011378586.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    147   2e-38   
emb|CDQ83431.1|  unnamed protein product                                147   2e-38   
gb|EFO28029.2|  AP-1 complex subunit mu-1-I                             146   2e-38   
ref|XP_010794367.1|  PREDICTED: AP-1 complex subunit mu-1               139   2e-38   
ref|XP_002423855.1|  clathrin coat assembly protein ap-1, putative      147   2e-38   
emb|CEG84107.1|  Putative AP-1 complex subunit mu-1                     140   2e-38   
emb|CDP94008.1|  Protein Bm13789, isoform c                             147   2e-38   
ref|XP_007258409.1|  PREDICTED: AP-1 complex subunit mu-1-like          147   2e-38   
gb|KHN79706.1|  AP-1 complex subunit mu-1-I                             147   2e-38   
ref|XP_006634903.1|  PREDICTED: AP-1 complex subunit mu-1-like          147   2e-38   
ref|XP_006023419.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    147   2e-38   
ref|XP_008560877.1|  PREDICTED: AP-1 complex subunit mu-1               147   2e-38   
ref|XP_001901415.1|  Clathrin coat assembly protein AP47                146   2e-38   
ref|XP_008275248.1|  PREDICTED: AP-1 complex subunit mu-2               147   2e-38   
ref|XP_004365235.1|  AP-1 complex subunit mu-1                          147   2e-38   
ref|NP_001040675.1|  Protein UNC-101, isoform a                         146   2e-38   
ref|XP_006023417.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    146   3e-38   
ref|XP_006265656.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    146   3e-38   
emb|CDQ02752.1|  Protein BM-APM-1                                       146   3e-38   
ref|XP_003136033.1|  AP-1 complex subunit mu-1                          146   3e-38   
gb|EHJ64804.1|  hypothetical protein KGM_02865                          146   3e-38   
gb|ESA11631.1|  hypothetical protein GLOINDRAFT_96718                   145   3e-38   
ref|XP_010738871.1|  PREDICTED: AP-1 complex subunit mu-2               146   3e-38   
ref|XP_003972641.1|  PREDICTED: AP-1 complex subunit mu-2-like          146   3e-38   
ref|XP_009300339.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    146   4e-38   
ref|XP_006023418.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    146   4e-38   
gb|AAH85546.1|  Ap1m2 protein                                           146   4e-38   
ref|XP_007231366.1|  PREDICTED: AP-1 complex subunit mu-2               146   4e-38   
ref|XP_006905939.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    146   4e-38   
ref|XP_005737083.1|  PREDICTED: AP-1 complex subunit mu-2-like          145   4e-38   
ref|XP_010766992.1|  PREDICTED: AP-1 complex subunit mu-2               146   4e-38   
ref|XP_006905938.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    146   5e-38   
ref|XP_002179260.1|  predicted protein                                  146   5e-38   
emb|CAF92586.1|  unnamed protein product                                145   5e-38   
gb|AAH05021.1|  Adaptor-related protein complex 1, mu 2 subunit         145   5e-38   
ref|XP_004923800.1|  PREDICTED: AP-1 complex subunit mu-1-like          145   5e-38   
ref|XP_005279610.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    145   5e-38   
ref|XP_001116045.2|  PREDICTED: AP-1 complex subunit mu-2-like          139   5e-38   
emb|CDS06625.1|  Putative AP-1 complex subunit mu-1                     146   5e-38   
ref|XP_006009041.1|  PREDICTED: AP-1 complex subunit mu-1-like          145   5e-38   
ref|XP_005279609.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    145   6e-38   
ref|XP_006804064.1|  PREDICTED: AP-1 complex subunit mu-1-like          145   6e-38   
gb|EXX50896.1|  Apm1p                                                   145   6e-38   
ref|XP_789616.3|  PREDICTED: AP-1 complex subunit mu-1-like             145   6e-38   
ref|XP_011498712.1|  PREDICTED: AP-1 complex subunit mu-1               145   7e-38   
ref|XP_007550892.1|  PREDICTED: AP-1 complex subunit mu-1-like          145   7e-38   
dbj|BAM18015.1|  clathrin coat assembly protein ap-1                    145   7e-38   
ref|XP_001732521.1|  hypothetical protein MGL_0296                      145   7e-38   
ref|XP_008404413.1|  PREDICTED: AP-1 complex subunit mu-1-like          145   7e-38   
ref|XP_007877975.1|  hypothetical protein PFL1_02271                    145   7e-38   
ref|XP_003428199.1|  PREDICTED: AP-1 complex subunit mu-1               145   7e-38   
ref|XP_008277644.1|  PREDICTED: AP-1 complex subunit mu-1-like          145   8e-38   
ref|XP_006905937.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    145   9e-38   
ref|XP_009041591.1|  hypothetical protein AURANDRAFT_70425              145   9e-38   
ref|XP_003452381.1|  PREDICTED: AP-1 complex subunit mu-1-like          145   9e-38   
ref|XP_006680441.1|  hypothetical protein BATDEDRAFT_37174              145   9e-38   
ref|XP_002158238.1|  PREDICTED: AP-1 complex subunit mu-1-like          145   9e-38   
ref|XP_009043800.1|  hypothetical protein LOTGIDRAFT_205544             145   1e-37   
ref|XP_011303754.1|  PREDICTED: AP-1 complex subunit mu-1               145   1e-37   
gb|ETN70776.1|  adaptor complexe medium subunit family protein          144   1e-37   
emb|CBJ29677.1|  Clathrin assembly complex, medium subunit              145   1e-37   
ref|XP_005588716.1|  PREDICTED: AP-1 complex subunit mu-2-like          140   1e-37   
emb|CDH59177.1|  ap-1 complex subunit mu-1                              145   1e-37   
gb|AAA72418.1|  unnamed protein product                                 144   1e-37   
gb|ACO12360.1|  AP-1 complex subunit mu-1                               144   2e-37   
ref|XP_008486041.1|  PREDICTED: AP-1 complex subunit mu-1               144   2e-37   
ref|XP_011169377.1|  PREDICTED: AP-1 complex subunit mu-1-like          144   2e-37   
gb|EGI59321.1|  AP-1 complex subunit mu-1                               144   2e-37   
gb|EIE87124.1|  AP-1 complex subunit mu-1                               144   2e-37   
ref|WP_028824236.1|  hypothetical protein                               140   2e-37   
ref|XP_005166336.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    144   2e-37   
gb|ADO27999.1|  AP-1 complex subunit mu-2                               144   2e-37   
dbj|GAN07517.1|  clathrin adaptor, mu subunit                           144   2e-37   
gb|EYC03836.1|  hypothetical protein Y032_0091g2449                     144   2e-37   
ref|XP_003372804.1|  AP-1 complex subunit mu-1-I                        144   2e-37   
ref|XP_011064332.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    144   2e-37   
ref|XP_011332351.1|  PREDICTED: AP-1 complex subunit mu-1               144   2e-37   
ref|XP_011141637.1|  PREDICTED: AP-1 complex subunit mu-1               144   2e-37   
emb|CDH49035.1|  clathrin adaptor mu subunit                            144   2e-37   
emb|CDS07968.1|  Putative AP-1 complex subunit mu-1                     144   2e-37   
ref|XP_003249906.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    144   2e-37   
ref|XP_006631551.1|  PREDICTED: AP-1 complex subunit mu-2-like          144   2e-37   
ref|XP_002602503.1|  hypothetical protein BRAFLDRAFT_266579             144   2e-37   
emb|CCV00015.1|  unnamed protein product                                144   2e-37   
ref|XP_003700057.1|  PREDICTED: AP-1 complex subunit mu-1-like          144   3e-37   
ref|XP_009039824.1|  hypothetical protein AURANDRAFT_72236              144   3e-37   
emb|CDW55306.1|  clathrin coat assembly protein ap 1                    144   3e-37   
dbj|GAM27282.1|  hypothetical protein SAMD00019534_104570               147   3e-37   
ref|XP_003484470.1|  PREDICTED: AP-1 complex subunit mu-1-like          144   3e-37   
gb|KFD56950.1|  hypothetical protein M513_02207                         144   3e-37   
ref|XP_007433201.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    142   3e-37   
ref|XP_007433202.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    142   3e-37   
ref|XP_003690372.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    144   3e-37   
ref|XP_003398021.1|  PREDICTED: AP-1 complex subunit mu-1-like          143   3e-37   
ref|XP_003484471.1|  PREDICTED: AP-1 complex subunit mu-1-like          143   4e-37   
dbj|GAK65594.1|  clathrin adaptor mu subunit                            147   4e-37   
ref|XP_005534076.1|  PREDICTED: AP-1 complex subunit mu-2               143   4e-37   
gb|KDN38638.1|  putative clathrin assembly protein AP47                 144   4e-37   
ref|NP_991277.1|  AP-1 complex subunit mu-2                             143   5e-37   
ref|NP_001158766.1|  AP-1 complex subunit mu-2                          143   5e-37   
ref|XP_010871083.1|  PREDICTED: AP-1 complex subunit mu-2-like          143   5e-37   
pdb|4EN2|M  Chain M, Hiv-1 Nef In Complex With Mhc-I Cytoplasmic ...    139   6e-37   
gb|EIE83851.1|  AP-1 complex subunit mu-1                               142   6e-37   
ref|XP_002122488.1|  PREDICTED: AP-1 complex subunit mu-1               142   7e-37   
ref|XP_007433200.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    142   7e-37   
emb|CBY41102.1|  unnamed protein product                                142   9e-37   
ref|NP_001107913.1|  AP-1 complex subunit mu-1                          142   1e-36   
ref|XP_009164262.1|  hypothetical protein T265_01872                    137   1e-36   
ref|XP_003230562.2|  PREDICTED: AP-1 complex subunit mu-1               142   1e-36   
ref|XP_002113923.1|  hypothetical protein TRIADDRAFT_50452              142   1e-36   
pdb|4EMZ|A  Chain A, Hiv-1 Nef In Complex With Mhc-I Cytoplasmic ...    138   2e-36   
emb|CEG74228.1|  Putative Clathrin adaptor, mu subunit                  142   2e-36   
gb|AAX26225.2|  SJCHGC09053 protein                                     141   2e-36   
ref|XP_003796571.1|  PREDICTED: AP-1 complex subunit mu-1 isoform 4     140   2e-36   
ref|XP_005087143.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X4    140   2e-36   
gb|ELW67094.1|  AP-1 complex subunit mu-1                               140   2e-36   
ref|XP_007488611.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    141   2e-36   
emb|CAX69648.1|  AP-1 complex subunit mu-1 (Adaptor-related prote...    141   2e-36   
emb|CDJ88728.1|  S-adenosyl-L-homocysteine hydrolase and Clathrin...    145   2e-36   
ref|XP_003275994.1|  PREDICTED: AP-1 complex subunit mu-1 isoform 3     140   2e-36   
ref|XP_007488610.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    141   2e-36   
gb|KIJ26488.1|  hypothetical protein M422DRAFT_192145                   135   2e-36   
ref|XP_006008165.1|  PREDICTED: AP-1 complex subunit mu-1-like          139   2e-36   
ref|XP_008529547.1|  PREDICTED: AP-1 complex subunit mu-1               140   3e-36   
ref|XP_011220106.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    140   3e-36   
ref|XP_005970299.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X3    141   3e-36   
ref|XP_002293836.1|  mu subunit of tetrameric clathrin adaptor co...    141   3e-36   
ref|XP_008156043.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    140   3e-36   
ref|XP_005970298.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    141   3e-36   
gb|KIJ37136.1|  hypothetical protein M422DRAFT_232110                   138   3e-36   
gb|KFV57165.1|  AP-1 complex subunit mu-1                               140   4e-36   
ref|XP_007072084.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    140   4e-36   
ref|XP_009898920.1|  PREDICTED: AP-1 complex subunit mu-1               140   4e-36   
gb|KFQ44767.1|  AP-1 complex subunit mu-1                               140   4e-36   
ref|XP_005279112.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    140   4e-36   
gb|KFV61684.1|  AP-1 complex subunit mu-1                               140   4e-36   
ref|XP_009816798.1|  PREDICTED: AP-1 complex subunit mu-1               140   4e-36   
ref|XP_006122524.1|  PREDICTED: AP-1 complex subunit mu-1               140   4e-36   
ref|XP_005604151.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    140   4e-36   
ref|XP_009292424.1|  PREDICTED: AP-1 complex subunit mu-1               140   4e-36   
ref|XP_003975436.1|  PREDICTED: AP-1 complex subunit mu-1-like          140   4e-36   
ref|XP_005806343.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    140   4e-36   
gb|KFQ97932.1|  AP-1 complex subunit mu-1                               140   4e-36   
ref|XP_005359191.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    140   4e-36   
ref|XP_003448533.1|  PREDICTED: AP-1 complex subunit mu-1               140   4e-36   
ref|XP_005087141.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    140   4e-36   
ref|XP_005806342.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    140   4e-36   
ref|XP_009561136.1|  PREDICTED: AP-1 complex subunit mu-1               140   4e-36   
ref|XP_008332791.1|  PREDICTED: AP-1 complex subunit mu-1               140   4e-36   
gb|KFP91414.1|  AP-1 complex subunit mu-1                               140   4e-36   



>gb|AFK36986.1| unknown [Lotus japonicus]
Length=161

 Score =   194 bits (493),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/99 (94%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSIT+EE TPERKAPIRVKFEIPY
Sbjct  63   TSMGSAAYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSITAEEATPERKAPIRVKFEIPY  122

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  123  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  161



>ref|XP_009604122.1| PREDICTED: AP-1 complex subunit mu-2 [Nicotiana tomentosiformis]
Length=426

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/98 (98%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSIT+EE TPERKAPIRVKFEIPY
Sbjct  328  TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITAEEATPERKAPIRVKFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  388  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  425



>ref|XP_009763320.1| PREDICTED: AP-1 complex subunit mu-2 [Nicotiana sylvestris]
Length=426

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/98 (97%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSIT+EE TPERK PIRVKFEIPY
Sbjct  328  TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITAEEATPERKTPIRVKFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  388  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  425



>gb|KHN14546.1| AP-1 complex subunit mu-1-I, partial [Glycine soja]
Length=406

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSIT EE TPERKAPIRVKFEIPY
Sbjct  308  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSITDEEATPERKAPIRVKFEIPY  367

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLK+IEKSGYQALPWVRYITMAGEYELRL+
Sbjct  368  FTVSGIQVRYLKVIEKSGYQALPWVRYITMAGEYELRLI  406



>gb|KHN13429.1| AP-1 complex subunit mu-2 [Glycine soja]
Length=220

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEF LPSI  EE TPERKAPIRVKFEIPY
Sbjct  122  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFHLPSIVDEEATPERKAPIRVKFEIPY  181

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  220



>ref|XP_010682420.1| PREDICTED: AP-1 complex subunit mu-2 [Beta vulgaris subsp. vulgaris]
Length=428

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/99 (94%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDAL+WKIKSFPGGKEYMLRAEF LPSITS+E TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPEKDALVWKIKSFPGGKEYMLRAEFSLPSITSDEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_006366366.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum tuberosum]
Length=426

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/98 (96%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEF+LPSIT+EE  PERKAPIRVKFEIPY
Sbjct  328  TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFKLPSITAEEAVPERKAPIRVKFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  388  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  425



>ref|XP_004239119.1| PREDICTED: AP-1 complex subunit mu-2 [Solanum lycopersicum]
 ref|XP_006357615.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum tuberosum]
Length=426

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/99 (95%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEF LPSIT+EE+ PERKAPIRVKFEIPY
Sbjct  328  TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFTLPSITAEESVPERKAPIRVKFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  388  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  426



>ref|XP_009623841.1| PREDICTED: AP-1 complex subunit mu-2 [Nicotiana tomentosiformis]
Length=426

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/99 (95%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEF LPSIT+EE+ PERKAPIRVKFEIPY
Sbjct  328  TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFTLPSITAEESAPERKAPIRVKFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  388  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  426



>ref|XP_003517576.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
Length=428

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSIT EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSITDEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLK+IEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKVIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|EYU22519.1| hypothetical protein MIMGU_mgv1a006868mg [Erythranthe guttata]
Length=428

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE D+L+WKIKSFPGGKEYMLRAEFRLPSITSEE+TPERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPESDSLVWKIKSFPGGKEYMLRAEFRLPSITSEESTPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_009774686.1| PREDICTED: AP-1 complex subunit mu-2-like [Nicotiana sylvestris]
Length=426

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/99 (94%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEF LPSIT+EE+ PERKAPIRVKFEIPY
Sbjct  328  TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFTLPSITAEESAPERKAPIRVKFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSG+QVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  388  FTVSGMQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  426



>ref|XP_004489791.1| PREDICTED: AP-1 complex subunit mu-1-like [Cicer arietinum]
Length=428

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSIT EE  PERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSITDEEAAPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_003613166.1| AP-1 complex subunit mu [Medicago truncatula]
 gb|AES96124.1| clathrin assembly protein AP47, putative [Medicago truncatula]
 gb|AFK41114.1| unknown [Medicago truncatula]
Length=428

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSIT EE  PERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSITDEEAAPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_004135264.1| PREDICTED: AP-1 complex subunit mu-1-like [Cucumis sativus]
 gb|KGN51772.1| hypothetical protein Csa_5G599290 [Cucumis sativus]
Length=428

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DAL WKI+SFPGGKEYMLRAEFRLPSITSEE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPENDALCWKIRSFPGGKEYMLRAEFRLPSITSEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_008446174.1| PREDICTED: AP-1 complex subunit mu-2 [Cucumis melo]
Length=428

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DAL WKI+SFPGGKEYMLRAEFRLPSITSEE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPEHDALCWKIRSFPGGKEYMLRAEFRLPSITSEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_003519692.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
 gb|KHN00382.1| AP-1 complex subunit mu-1-I [Glycine soja]
Length=428

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFHLPSITDEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_004155408.1| PREDICTED: AP-1 complex subunit mu-1-like, partial [Cucumis sativus]
Length=428

 Score =   196 bits (497),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DAL WKI+SFPGGKEYMLRAEFRLPSITSEE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPENDALCWKIRSFPGGKEYMLRAEFRLPSITSEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_003552037.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
Length=428

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSI  EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSIVDEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|KHN25155.1| AP-1 complex subunit mu-1-I [Glycine soja]
Length=428

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSI  EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSIVDEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_010458434.1| PREDICTED: AP-1 complex subunit mu-2-like [Camelina sativa]
Length=428

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE+TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEESTPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_007153765.1| hypothetical protein PHAVU_003G063300g [Phaseolus vulgaris]
 gb|ESW25759.1| hypothetical protein PHAVU_003G063300g [Phaseolus vulgaris]
Length=428

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSI  EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSIIDEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_010475954.1| PREDICTED: AP-1 complex subunit mu-2-like [Camelina sativa]
Length=428

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE+TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEESTPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_008239309.1| PREDICTED: AP-1 complex subunit mu-2-like [Prunus mume]
Length=428

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPG KEYMLRAEFRLPSITSEE  PERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPESDALVWKIKSFPGNKEYMLRAEFRLPSITSEEAVPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_007157311.1| hypothetical protein PHAVU_002G059300g [Phaseolus vulgaris]
 gb|ESW29305.1| hypothetical protein PHAVU_002G059300g [Phaseolus vulgaris]
Length=428

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSIT E+ TPERKAPI VKFEIPY
Sbjct  330  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSITDEDATPERKAPINVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_006417426.1| hypothetical protein EUTSA_v10007700mg [Eutrema salsugineum]
 gb|ESQ35779.1| hypothetical protein EUTSA_v10007700mg [Eutrema salsugineum]
Length=428

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS++YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSASYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>emb|CDY61312.1| BnaAnng17500D [Brassica napus]
Length=428

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>gb|KFK43365.1| hypothetical protein AALP_AA1G116700 [Arabis alpina]
Length=428

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_006307589.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
 ref|XP_006307590.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
 gb|EOA40487.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
 gb|EOA40488.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
Length=428

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_011086615.1| PREDICTED: AP-1 complex subunit mu-2 [Sesamum indicum]
Length=428

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            +SMGS++YAPE DAL+WKIKSFPGGKEYMLRAEFRLPSITSEE TP+RKAPIRVKFEIPY
Sbjct  330  SSMGSASYAPESDALVWKIKSFPGGKEYMLRAEFRLPSITSEEATPDRKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  427



>ref|XP_002889832.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH66091.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=428

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_010553612.1| PREDICTED: AP-1 complex subunit mu-2 [Tarenaya hassleriana]
Length=428

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_008340089.1| PREDICTED: AP-1 complex subunit mu-2-like [Malus domestica]
Length=428

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPE DALIWKI+SFPGGKEYMLRAEFRLPS+T+EE+TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPESDALIWKIRSFPGGKEYMLRAEFRLPSVTAEESTPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_007225645.1| hypothetical protein PRUPE_ppa006083mg [Prunus persica]
 gb|EMJ26844.1| hypothetical protein PRUPE_ppa006083mg [Prunus persica]
Length=428

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPE DALIWKI+SFPGGKEYMLRAEFRLPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPESDALIWKIRSFPGGKEYMLRAEFRLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_002314604.1| clathrin adaptor complexes medium subunit family protein [Populus 
trichocarpa]
 gb|EEF00775.1| clathrin adaptor complexes medium subunit family protein [Populus 
trichocarpa]
Length=428

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPENDALLWKIKSFPGGKEYMLRAEFSLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_011045271.1| PREDICTED: AP-1 complex subunit mu-2 [Populus euphratica]
 ref|XP_011045272.1| PREDICTED: AP-1 complex subunit mu-2 [Populus euphratica]
Length=428

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPENDALLWKIKSFPGGKEYMLRAEFSLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>emb|CDY54239.1| BnaC08g49960D [Brassica napus]
Length=428

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPS+T+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSVTAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_004237270.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Solanum lycopersicum]
Length=426

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEF LPSI++EE  PERK+PIRVKFEIPY
Sbjct  328  TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFSLPSISAEEAVPERKSPIRVKFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  388  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  425



>gb|KEH20175.1| clathrin assembly protein AP47, putative [Medicago truncatula]
Length=428

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSIT EE  PERKAPIR+KFEIPY
Sbjct  330  TSMGSAAYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSITDEEAAPERKAPIRLKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_004298991.1| PREDICTED: AP-1 complex subunit mu-2 [Fragaria vesca subsp. vesca]
Length=428

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+TYAPE DALIWKI+SFPGGKEY+LRAEF LPS+T+EE+TPERKAPIRVKFEIPY
Sbjct  330  TSLGSATYAPENDALIWKIRSFPGGKEYLLRAEFHLPSVTAEESTPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>emb|CDX97909.1| BnaA06g06600D [Brassica napus]
Length=428

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLK+IEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKVIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_010044585.1| PREDICTED: AP-1 complex subunit mu-2 [Eucalyptus grandis]
Length=428

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPENDALVWKIKSFPGGKEYMLRAEFSLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_003531990.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
Length=428

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEF LPSI  EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFHLPSIVDEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_008389705.1| PREDICTED: AP-1 complex subunit mu-2 [Malus domestica]
Length=428

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPE DALIWKI+SFPGGKEYMLRAEFRLPS+T+EE+TPERKAP+RVKFEIPY
Sbjct  330  TSLGSAAYAPESDALIWKIRSFPGGKEYMLRAEFRLPSVTAEESTPERKAPVRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>gb|KDO69520.1| hypothetical protein CISIN_1g014251mg [Citrus sinensis]
 gb|KDO69521.1| hypothetical protein CISIN_1g014251mg [Citrus sinensis]
Length=308

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPG KEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPY
Sbjct  210  TSMGSARYAPENDALVWKIKSFPGNKEYMLRAEFSLPSITAEEAAPERKAPIRVKFEIPY  269

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  270  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  308



>ref|XP_008221881.1| PREDICTED: AP-1 complex subunit mu-2 [Prunus mume]
Length=428

 Score =   193 bits (491),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPE DALIWKI+SFPGGKEYMLRAEFRLPSIT+EE TPER+APIRVKFEIPY
Sbjct  330  TSLGSAAYAPESDALIWKIRSFPGGKEYMLRAEFRLPSITAEEATPERRAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|EYU28424.1| hypothetical protein MIMGU_mgv1a006870mg [Erythranthe guttata]
Length=428

 Score =   193 bits (491),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DAL+WKIKSFPGGKEYMLRAEFRLPSI SEE+ PERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPENDALVWKIKSFPGGKEYMLRAEFRLPSIESEESGPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>gb|KJB50248.1| hypothetical protein B456_008G160500 [Gossypium raimondii]
Length=368

 Score =   192 bits (487),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPY
Sbjct  270  TSMGSAAYAPENDALMWKIRSFPGGKEYMLRAEFTLPSITDEEATPERKAPIRVKFEIPY  329

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  330  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  368



>emb|CDY19316.1| BnaC05g08250D [Brassica napus]
Length=428

 Score =   193 bits (491),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPS+T+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSVTAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLK+IEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKVIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_011071132.1| PREDICTED: AP-1 complex subunit mu-2 [Sesamum indicum]
Length=428

 Score =   193 bits (491),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPEKDALIWKIKSFPGGKEYMLRAEFRLPSI S+E+  ERKAP+RVKFEIPY
Sbjct  330  TSMGSAAYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSIQSDESAAERKAPVRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_007044745.1| Clathrin adaptor complexes medium subunit family protein isoform 
2 [Theobroma cacao]
 gb|EOY00577.1| Clathrin adaptor complexes medium subunit family protein isoform 
2 [Theobroma cacao]
Length=308

 Score =   190 bits (482),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPY
Sbjct  210  TSMGSAAYAPESDALMWKIRSFPGGKEYMLRAEFTLPSITDEEATPERKAPIRVKFEIPY  269

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  270  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  308



>ref|XP_002511345.1| clathrin coat assembly protein ap-1, putative [Ricinus communis]
 gb|EEF51947.1| clathrin coat assembly protein ap-1, putative [Ricinus communis]
Length=428

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            +SMGS+TYAPE DAL+WKIKSFPG KEYMLRAEF+LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  SSMGSATYAPENDALVWKIKSFPGNKEYMLRAEFKLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_006300485.1| hypothetical protein CARUB_v10020333mg [Capsella rubella]
 gb|EOA33383.1| hypothetical protein CARUB_v10020333mg [Capsella rubella]
Length=428

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS++YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSASYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_007209161.1| hypothetical protein PRUPE_ppa006082mg [Prunus persica]
 gb|EMJ10360.1| hypothetical protein PRUPE_ppa006082mg [Prunus persica]
Length=428

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPG KEYMLRAEFRLPSITSEE  PERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPESDALVWKIKSFPGNKEYMLRAEFRLPSITSEEAVPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGY ALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELRLM  428



>ref|NP_176277.1| protein HAPLESS 13 [Arabidopsis thaliana]
 sp|O22715.1|AP1M2_ARATH RecName: Full=AP-1 complex subunit mu-2; AltName: Full=Adaptor 
protein complex AP-1 subunit mu-2; AltName: Full=Adaptor protein-1 
mu-adaptin 2; AltName: Full=Adaptor-related protein 
complex 1 subunit mu-2; AltName: Full=At-muB2-Ad; AltName: 
Full=Clathrin assembly protein complex 1 mu-2 medium chain; 
AltName: Full=Mu1-adaptin 2; AltName: Full=Protein HAPLESS 13 
[Arabidopsis thaliana]
 gb|AAB71967.1| putative Clathrin Coat Assembly protein [Arabidopsis thaliana]
 gb|AAM20503.1| clathrin adaptor medium chain protein MU1B, putative [Arabidopsis 
thaliana]
 gb|AAN72155.1| clathrin adaptor medium chain protein MU1B, putative [Arabidopsis 
thaliana]
 gb|AEE33731.1| protein HAPLESS 13 [Arabidopsis thaliana]
Length=428

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS++YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSASYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_010510910.1| PREDICTED: AP-1 complex subunit mu-2 [Camelina sativa]
 ref|XP_010418020.1| PREDICTED: AP-1 complex subunit mu-2 [Camelina sativa]
 ref|XP_010473257.1| PREDICTED: AP-1 complex subunit mu-2 [Camelina sativa]
Length=428

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS++YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSASYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>emb|CDP13203.1| unnamed protein product [Coffea canephora]
Length=428

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGSSTYAPE DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPY
Sbjct  330  TSMGSSTYAPENDALVWKIKSFPGGKEYMLRAEFTLPSITAEEPLPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_002886592.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH62851.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=428

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS++YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSASYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_010491832.1| PREDICTED: AP-1 complex subunit mu-2-like [Camelina sativa]
Length=428

 Score =   193 bits (490),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE+TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEESTPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGY ALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELRLM  428



>ref|XP_007036353.1| Clathrin adaptor complexes medium subunit family protein [Theobroma 
cacao]
 gb|EOY20854.1| Clathrin adaptor complexes medium subunit family protein [Theobroma 
cacao]
Length=429

 Score =   193 bits (490),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPG KEYMLRAEFRLPSIT+EE  PERKAP+RVKFEIPY
Sbjct  331  TSMGSARYAPENDALVWKIKSFPGNKEYMLRAEFRLPSITAEEAAPERKAPVRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  391  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  429



>emb|CDY63681.1| BnaA01g35660D [Brassica napus]
Length=428

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_009103973.1| PREDICTED: AP-1 complex subunit mu-2 [Brassica rapa]
Length=428

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>gb|KFK40761.1| hypothetical protein AALP_AA2G037600 [Arabis alpina]
Length=428

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_010248608.1| PREDICTED: AP-1 complex subunit mu-2-like [Nelumbo nucifera]
Length=428

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DALIWKIKSFPGGKEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPENDALIWKIKSFPGGKEYMLRAEFSLPSITAEEAAPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_010923038.1| PREDICTED: AP-1 complex subunit mu-2 [Elaeis guineensis]
Length=428

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPE+KAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPENDALVWKIKSFPGGKEYMLRAEFSLPSITAEEATPEKKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_010251124.1| PREDICTED: AP-1 complex subunit mu-2 [Nelumbo nucifera]
Length=428

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DALIWKIKSFPGGKEYMLRAEF LPSITSE+  PERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPENDALIWKIKSFPGGKEYMLRAEFGLPSITSEDAAPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_010547708.1| PREDICTED: AP-1 complex subunit mu-2-like [Tarenaya hassleriana]
Length=428

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEKDAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYVPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_008791180.1| PREDICTED: AP-1 complex subunit mu-2 [Phoenix dactylifera]
Length=428

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPE+KAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPENDALVWKIKSFPGGKEYMLRAEFSLPSITAEEATPEKKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_009359189.1| PREDICTED: AP-1 complex subunit mu-2 [Pyrus x bretschneideri]
Length=428

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPE DALIWKI+SFPGGKEYMLRAEF LPS+T+EE+TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPESDALIWKIRSFPGGKEYMLRAEFHLPSVTAEESTPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_006392117.1| hypothetical protein EUTSA_v10023468mg [Eutrema salsugineum]
 gb|ESQ29403.1| hypothetical protein EUTSA_v10023468mg [Eutrema salsugineum]
Length=428

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF LPS+T+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSVTAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_002527911.1| clathrin coat assembly protein ap-1, putative [Ricinus communis]
 gb|EEF34468.1| clathrin coat assembly protein ap-1, putative [Ricinus communis]
Length=309

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DAL+WKIKSFPGGKEYM+RAEF LPSIT+EE  PERKAPIRVKFEIPY
Sbjct  211  TSMGSASYAPENDALMWKIKSFPGGKEYMMRAEFSLPSITAEEGAPERKAPIRVKFEIPY  270

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  271  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  309



>ref|XP_003567979.1| PREDICTED: AP-1 complex subunit mu-2-like [Brachypodium distachyon]
Length=429

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DAL+WKIKSFPGGKEYM RAEF LPSITSEE TPE+KAPIRVKFEIPY
Sbjct  331  TSMGSAAYAPERDALVWKIKSFPGGKEYMCRAEFSLPSITSEEATPEKKAPIRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLK+IEKSGYQALPWVRYITMAGEYELRL+
Sbjct  391  FTVSGIQVRYLKVIEKSGYQALPWVRYITMAGEYELRLI  429



>emb|CDY46183.1| BnaA01g23050D [Brassica napus]
Length=428

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG K+YMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKDYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLV  428



>ref|XP_010533915.1| PREDICTED: AP-1 complex subunit mu-2-like [Tarenaya hassleriana]
Length=428

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS++YAPEKDAL WKIKSFPG KEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSASYAPEKDALAWKIKSFPGNKEYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLL  428



>ref|XP_006847624.1| hypothetical protein AMTR_s00014p00250090 [Amborella trichopoda]
 gb|ERN09205.1| hypothetical protein AMTR_s00014p00250090 [Amborella trichopoda]
Length=428

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+TYAPEK+AL+WKIKSFPGGKEYMLRA+F LPSIT+EE TPE+KAPIRVKFEIPY
Sbjct  330  TSMGSATYAPEKEALLWKIKSFPGGKEYMLRAQFSLPSITAEEATPEKKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|AFW83687.1| hypothetical protein ZEAMMB73_283352 [Zea mays]
Length=227

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WKIKSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPY
Sbjct  129  TSMGSAAYAPERDAMVWKIKSFPGGKEYMCRAEFSLPSITAEEGAPEKKAPIRVKFEIPY  188

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  189  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  227



>gb|KJB50247.1| hypothetical protein B456_008G160500 [Gossypium raimondii]
Length=428

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPENDALMWKIRSFPGGKEYMLRAEFTLPSITDEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|KHG01625.1| AP-1 complex subunit mu-1-I [Gossypium arboreum]
Length=417

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPY
Sbjct  319  TSMGSAAYAPENDALMWKIRSFPGGKEYMLRAEFTLPSITDEEATPERKAPIRVKFEIPY  378

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  379  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  417



>gb|KDP26640.1| hypothetical protein JCGZ_17798 [Jatropha curcas]
Length=428

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPENDALMWKIKSFPGGKEYMLRAEFNLPSITAEEGVPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|EPS71689.1| hypothetical protein M569_03066, partial [Genlisea aurea]
Length=430

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DAL+WKIKSFPGGKEYMLRAEFRLPSI SEE  PE+KAPIRVKFEIPY
Sbjct  332  TSMGSASYAPESDALVWKIKSFPGGKEYMLRAEFRLPSIASEEAGPEKKAPIRVKFEIPY  391

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  392  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  430



>ref|XP_006439891.1| hypothetical protein CICLE_v10023962mg [Citrus clementina]
 ref|XP_006476855.1| PREDICTED: AP-1 complex subunit mu-2-like [Citrus sinensis]
 gb|ESR53131.1| hypothetical protein CICLE_v10023962mg [Citrus clementina]
 gb|KDO69517.1| hypothetical protein CISIN_1g014251mg [Citrus sinensis]
Length=428

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPG KEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPY
Sbjct  330  TSMGSARYAPENDALVWKIKSFPGNKEYMLRAEFSLPSITAEEAAPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_007044744.1| Clathrin adaptor complexes medium subunit family protein isoform 
1 [Theobroma cacao]
 gb|EOY00576.1| Clathrin adaptor complexes medium subunit family protein isoform 
1 [Theobroma cacao]
Length=428

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKI+SFPGGKEYMLRAEF LPSIT EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPESDALMWKIRSFPGGKEYMLRAEFTLPSITDEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_002274463.1| PREDICTED: AP-1 complex subunit mu-2 [Vitis vinifera]
 emb|CBI23375.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPENDALLWKIKSFPGGKEYMLRAEFSLPSITAEEGAPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_009409953.1| PREDICTED: AP-1 complex subunit mu-2 [Musa acuminata subsp. malaccensis]
Length=428

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+TYAPE DAL+WKIKSFPGGKEYM RAEF  PSIT+EE TPE+KAPIRVKFEIPY
Sbjct  330  TSMGSATYAPENDALVWKIKSFPGGKEYMCRAEFSFPSITAEEATPEKKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>dbj|BAJ97229.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=429

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WKIKSFPGGKEYM RAEF LPSITSEE TPE+KAPIRVKFEIPY
Sbjct  331  TSMGSAAYAPERDAMVWKIKSFPGGKEYMCRAEFSLPSITSEEATPEKKAPIRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLK+IEKSGYQALPWVRYITMAGEYELRL+
Sbjct  391  FTVSGIQVRYLKVIEKSGYQALPWVRYITMAGEYELRLI  429



>gb|KDO82237.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=284

 Score =   187 bits (474),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++Y PE +ALIWKI+SFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  186  TSMGSASYVPEDEALIWKIRSFPGGKEYMLRAEFTLPSITAEEATPERKAPIRVKFEIPY  245

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGY ALPWVRYITMAGEYELRL+
Sbjct  246  FTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELRLI  284



>ref|XP_009148415.1| PREDICTED: AP-1 complex subunit mu-2-like [Brassica rapa]
Length=428

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG KEYMLRAEF L SIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKEYMLRAEFHLTSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLK+IEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKVIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_008392998.1| PREDICTED: AP-1 complex subunit mu-2 [Malus domestica]
Length=428

 Score =   190 bits (483),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DAL+WK+KSFPG KEYMLRAEF LPSIT+EE  PER+APIRVKFEIPY
Sbjct  330  TSMGSAAYAPERDALVWKVKSFPGNKEYMLRAEFMLPSITAEEAVPERRAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>gb|KJB31190.1| hypothetical protein B456_005G180000 [Gossypium raimondii]
Length=339

 Score =   188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKI+SFPGGKEYMLRAEF LPSIT EE T ERKAPIRVKFEIPY
Sbjct  241  TSMGSAAYAPENDALLWKIRSFPGGKEYMLRAEFTLPSITDEEATQERKAPIRVKFEIPY  300

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  301  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  339



>ref|XP_004509658.1| PREDICTED: AP-1 complex subunit mu-1-like [Cicer arietinum]
Length=428

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPEKDALIWKI+SFPGGKEYMLRAEFRLPSIT EE  PERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFRLPSITDEEAPPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  GEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITTGGEYELRLI  428



>gb|EPS68502.1| hypothetical protein M569_06266, partial [Genlisea aurea]
Length=430

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ Y PE DAL WKIKSFPGGKEYMLRAEFRLPSITSEE+ PERKAPIRVKFEIPY
Sbjct  331  TSMGSAAYTPENDALSWKIKSFPGGKEYMLRAEFRLPSITSEESGPERKAPIRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT+AGEYELRL+
Sbjct  391  FTVSGIQVRYLKIIEKSGYQALPWVRYITVAGEYELRLL  429



>gb|KDO82236.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=309

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++Y PE +ALIWKI+SFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  211  TSMGSASYVPEDEALIWKIRSFPGGKEYMLRAEFTLPSITAEEATPERKAPIRVKFEIPY  270

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGY ALPWVRYITMAGEYELRL+
Sbjct  271  FTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELRLI  309



>ref|XP_006438265.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 gb|ESR51505.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 gb|KDO82235.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=358

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++Y PE +ALIWKI+SFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  260  TSMGSASYVPEDEALIWKIRSFPGGKEYMLRAEFTLPSITAEEATPERKAPIRVKFEIPY  319

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGY ALPWVRYITMAGEYELRL+
Sbjct  320  FTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELRLI  358



>ref|XP_010100380.1| AP-1 complex subunit mu-1-I [Morus notabilis]
 gb|EXB82514.1| AP-1 complex subunit mu-1-I [Morus notabilis]
Length=428

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKI+SFPGGKEYMLRAEF LPSIT+EE  PERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPENDALVWKIRSFPGGKEYMLRAEFCLPSITAEEGAPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_009417102.1| PREDICTED: AP-1 complex subunit mu-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417110.1| PREDICTED: AP-1 complex subunit mu-2-like [Musa acuminata subsp. 
malaccensis]
Length=428

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPGGKEYM RAEF LPSIT+EE TPE+KAPIRVKFEIPY
Sbjct  330  TSMGSAKYAPENDALVWKIKSFPGGKEYMCRAEFSLPSITAEEATPEKKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|KJB31189.1| hypothetical protein B456_005G180000 [Gossypium raimondii]
Length=407

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKI+SFPGGKEYMLRAEF LPSIT EE T ERKAPIRVKFEIPY
Sbjct  309  TSMGSAAYAPENDALLWKIRSFPGGKEYMLRAEFTLPSITDEEATQERKAPIRVKFEIPY  368

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  369  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  407



>gb|KDP31052.1| hypothetical protein JCGZ_11428 [Jatropha curcas]
Length=428

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+TYAPE DAL+WKIKSFPG KEYMLRAEF  PSIT+EE TP+R+API VKFEIPY
Sbjct  330  TSMGSATYAPENDALVWKIKSFPGNKEYMLRAEFSFPSITAEEATPQRRAPISVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  428



>ref|XP_010102500.1| AP-1 complex subunit mu-1 [Morus notabilis]
 gb|EXB93564.1| AP-1 complex subunit mu-1 [Morus notabilis]
Length=428

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPG KEYMLRAEF LPSIT+E+  PERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPENDALVWKIKSFPGNKEYMLRAEFSLPSITAEDAAPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|KCW86678.1| hypothetical protein EUGRSUZ_B03301 [Eucalyptus grandis]
Length=628

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  530  TSMGSAAYAPENDALVWKIKSFPGGKEYMLRAEFSLPSITAEEATPERKAPIRVKFEIPY  589

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  590  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  628



>ref|XP_010924114.1| PREDICTED: AP-1 complex subunit mu-2-like [Elaeis guineensis]
Length=428

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPE DAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPE+KAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPENDALVWKIKSFPGSKEYMLRAEFSLPSITAEEATPEKKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>gb|KHG12319.1| AP-1 complex subunit mu-1 [Gossypium arboreum]
 gb|KJB31186.1| hypothetical protein B456_005G180000 [Gossypium raimondii]
Length=428

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKI+SFPGGKEYMLRAEF LPSIT EE T ERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPENDALLWKIRSFPGGKEYMLRAEFTLPSITDEEATQERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_006646248.1| PREDICTED: AP-1 complex subunit mu-2-like [Oryza brachyantha]
Length=435

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WK+KSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPY
Sbjct  337  TSMGSAAYAPERDAMVWKVKSFPGGKEYMCRAEFSLPSITAEEAAPEKKAPIRVKFEIPY  396

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  397  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  435



>ref|XP_006438266.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 ref|XP_006483945.1| PREDICTED: AP-1 complex subunit mu-2-like [Citrus sinensis]
 gb|ESR51506.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 gb|KDO82234.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=428

 Score =   188 bits (477),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++Y PE +ALIWKI+SFPGGKEYMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYVPEDEALIWKIRSFPGGKEYMLRAEFTLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGY ALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELRLI  428



>ref|XP_009386436.1| PREDICTED: AP-1 complex subunit mu-2-like [Musa acuminata subsp. 
malaccensis]
Length=428

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPGGKEYM RAEF LPSIT+E+  PERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPEHDALVWKIKSFPGGKEYMCRAEFSLPSITAEDAIPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FT+SGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTISGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|NP_001056201.1| Os05g0543100 [Oryza sativa Japonica Group]
 gb|AAU43995.1| putative clathrin [Oryza sativa Japonica Group]
 dbj|BAF18115.1| Os05g0543100 [Oryza sativa Japonica Group]
 dbj|BAG89382.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79627.1| hypothetical protein OsI_20841 [Oryza sativa Indica Group]
 gb|EEE64556.1| hypothetical protein OsJ_19408 [Oryza sativa Japonica Group]
Length=430

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WKIKSFPGGKEYM RAEF LPSITSE+  PE+KAPIRVKFEIPY
Sbjct  332  TSMGSAAYAPERDAMVWKIKSFPGGKEYMCRAEFSLPSITSEDGMPEKKAPIRVKFEIPY  391

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  392  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  430



>ref|XP_011034097.1| PREDICTED: AP-1 complex subunit mu-2-like [Populus euphratica]
Length=428

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS++YAPE DAL+WKIKSF GGKEYMLRAEF L SIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSMGSASYAPENDALMWKIKSFSGGKEYMLRAEFSLSSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|NP_001140632.1| hypothetical protein [Zea mays]
 gb|ACF84213.1| unknown [Zea mays]
 gb|ACN28896.1| unknown [Zea mays]
 gb|ACR35886.1| unknown [Zea mays]
 gb|AFW83686.1| hypothetical protein ZEAMMB73_283352 [Zea mays]
Length=429

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WKIKSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPY
Sbjct  331  TSMGSAAYAPERDAMVWKIKSFPGGKEYMCRAEFSLPSITAEEGAPEKKAPIRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  391  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  429



>ref|XP_004241506.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum lycopersicum]
 ref|XP_010322540.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum lycopersicum]
Length=428

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMG +TYAPE+DA++WKIKSFPG K+YMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPY
Sbjct  330  TSMGYATYAPERDAVVWKIKSFPGNKDYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_006347435.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum tuberosum]
Length=428

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMG +TYAPE+DA++WKIKSFPG K+YMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPY
Sbjct  330  TSMGYATYAPERDAVVWKIKSFPGNKDYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_003569636.1| PREDICTED: AP-1 complex subunit mu-2 [Brachypodium distachyon]
Length=429

 Score =   187 bits (476),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+TYAPE+DA++WKIKSFPGGKEYM RAEF LPSI +EE  PE+KAPIRVKFEIPY
Sbjct  331  TSMGSATYAPERDAMVWKIKSFPGGKEYMCRAEFSLPSIAAEEGGPEKKAPIRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  391  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLL  429



>ref|XP_004969676.1| PREDICTED: AP-1 complex subunit mu-1-like [Setaria italica]
Length=429

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WK+KSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPY
Sbjct  331  TSMGSAAYAPERDAMVWKVKSFPGGKEYMCRAEFSLPSITAEEGAPEKKAPIRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  391  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  429



>ref|NP_001288528.1| AP-1 complex subunit mu-2 [Zea mays]
 ref|XP_002456218.1| hypothetical protein SORBIDRAFT_03g032290 [Sorghum bicolor]
 gb|ACN34099.1| unknown [Zea mays]
 gb|EES01338.1| hypothetical protein SORBIDRAFT_03g032290 [Sorghum bicolor]
 tpg|DAA57960.1| TPA: hypothetical protein ZEAMMB73_448798 [Zea mays]
Length=429

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WK+KSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPY
Sbjct  331  TSMGSAAYAPERDAMVWKVKSFPGGKEYMCRAEFSLPSITAEEGAPEKKAPIRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  391  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  429



>ref|NP_001044001.1| Os01g0703600 [Oryza sativa Japonica Group]
 dbj|BAF05915.1| Os01g0703600 [Oryza sativa Japonica Group]
 gb|EAZ13244.1| hypothetical protein OsJ_03168 [Oryza sativa Japonica Group]
Length=429

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WK+KSFPGGK+YM RAEF LPSIT+EE  PE+KAPIRVKFEIPY
Sbjct  331  TSMGSAAYAPERDAMVWKVKSFPGGKDYMCRAEFSLPSITAEEAAPEKKAPIRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  391  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  429



>ref|XP_004298980.1| PREDICTED: AP-1 complex subunit mu-2-like [Fragaria vesca subsp. 
vesca]
Length=428

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DAL+WKIKSFPG KEYMLRAEF LPSI +E+  PERKAPIRVKFEIPY
Sbjct  330  TSMGSAAYAPERDALVWKIKSFPGNKEYMLRAEFSLPSIVAEDAVPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQ+LPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQSLPWVRYITMAGEYELRLI  428



>emb|CDM83667.1| unnamed protein product [Triticum aestivum]
Length=429

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WK+KSFPGGKEYM RAEF LPSI++EE  PE+KAPIRVKFEIPY
Sbjct  331  TSMGSAAYAPERDAMVWKVKSFPGGKEYMCRAEFSLPSISAEEAVPEKKAPIRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  391  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  429



>gb|EMT15970.1| AP-1 complex subunit mu-1 [Aegilops tauschii]
Length=406

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WK+KSFPGGKEYM RAEF LPSI++EE  PE+KAPIRVKFEIPY
Sbjct  308  TSMGSAAYAPERDAMVWKVKSFPGGKEYMCRAEFSLPSISAEEAVPEKKAPIRVKFEIPY  367

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  368  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  406



>gb|ABR18420.1| unknown [Picea sitchensis]
Length=428

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGSS YAPEK+AL+WKIKSFPGGKEYMLRA+F LPSI++EE+ PE++APIRVKFEIPY
Sbjct  330  TSMGSSVYAPEKEALLWKIKSFPGGKEYMLRAQFSLPSISAEESIPEKRAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR++
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRMI  428



>ref|XP_009609076.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=421

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMG + YAPE+DA++WKIKSFPG K+YMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPY
Sbjct  323  TSMGYAKYAPERDAVVWKIKSFPGNKDYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPY  382

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  383  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  421



>ref|XP_009772293.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X2 [Nicotiana 
sylvestris]
Length=421

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMG +TYAPE+DA++WKIKSFPG KEYMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPY
Sbjct  323  TSMGYATYAPERDAVVWKIKSFPGNKEYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPY  382

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRY TMAGEYELRL+
Sbjct  383  FTVSGIQVRYLKIIEKSGYQALPWVRYKTMAGEYELRLV  421



>ref|XP_009609074.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009609075.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=428

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMG + YAPE+DA++WKIKSFPG K+YMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPY
Sbjct  330  TSMGYAKYAPERDAVVWKIKSFPGNKDYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  428



>ref|XP_009772291.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009772292.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
sylvestris]
Length=428

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMG +TYAPE+DA++WKIKSFPG KEYMLRAEFRLPS+ SE+T P+RKAPIRVKFEIPY
Sbjct  330  TSMGYATYAPERDAVVWKIKSFPGNKEYMLRAEFRLPSVISEDTPPDRKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRY TMAGEYELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYKTMAGEYELRLV  428



>ref|XP_008374401.1| PREDICTED: AP-1 complex subunit mu-2-like [Malus domestica]
Length=428

 Score =   185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPE+DAL+WKIKSFPG KEYMLR+EF LPSIT+EE  PER+APIRVKFEIPY
Sbjct  330  TSIGSAAYAPERDALVWKIKSFPGNKEYMLRSEFTLPSITAEEAVPERRAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  427



>ref|XP_011071917.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X2 [Sesamum 
indicum]
Length=368

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMG++ YAPE DAL+WKIKSFPG KEYMLRAEFRLPSI SE+   +RKAPIRVKFEIPY
Sbjct  270  TSMGTAKYAPETDALLWKIKSFPGNKEYMLRAEFRLPSIVSEDAVADRKAPIRVKFEIPY  329

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAG+YELRL+
Sbjct  330  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGDYELRLI  368



>ref|XP_008792874.1| PREDICTED: AP-1 complex subunit mu-2-like [Phoenix dactylifera]
Length=708

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE DAL+WKIKSFPG KEYMLRAEF LPSIT+EE TPE+KAPIRVKFEIPY
Sbjct  610  TSMGSAAYAPENDALVWKIKSFPGNKEYMLRAEFSLPSITAEEATPEKKAPIRVKFEIPY  669

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  670  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  708



>gb|AFW83685.1| hypothetical protein ZEAMMB73_283352 [Zea mays]
Length=632

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WKIKSFPGGKEYM RAEF LPSIT+EE  PE+KAPIRVKFEIPY
Sbjct  534  TSMGSAAYAPERDAMVWKIKSFPGGKEYMCRAEFSLPSITAEEGAPEKKAPIRVKFEIPY  593

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  594  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  632



>gb|EAY75520.1| hypothetical protein OsI_03424 [Oryza sativa Indica Group]
Length=429

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE++A++WK+KSFPGGK+YM RAEF LPSIT+EE  PE+KAPIRVKFEIPY
Sbjct  331  TSMGSAAYAPEREAMVWKVKSFPGGKDYMCRAEFSLPSITAEEAAPEKKAPIRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL+
Sbjct  391  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI  429



>ref|XP_002968864.1| hypothetical protein SELMODRAFT_91068 [Selaginella moellendorffii]
 ref|XP_002974107.1| hypothetical protein SELMODRAFT_100170 [Selaginella moellendorffii]
 gb|EFJ25062.1| hypothetical protein SELMODRAFT_100170 [Selaginella moellendorffii]
 gb|EFJ29980.1| hypothetical protein SELMODRAFT_91068 [Selaginella moellendorffii]
Length=431

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGSS YAPEK+AL+WKIKSFPGGKEYMLRA+F LPSI SEE+ PE++APIRVKFEIPY
Sbjct  331  TSMGSSVYAPEKEALVWKIKSFPGGKEYMLRAQFGLPSIVSEESVPEKRAPIRVKFEIPY  390

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT AGEYELR++
Sbjct  391  FTVSGIQVRYLKIIEKSGYQALPWVRYITTAGEYELRMI  429



>ref|XP_011071915.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Sesamum 
indicum]
 ref|XP_011071916.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Sesamum 
indicum]
Length=428

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMG++ YAPE DAL+WKIKSFPG KEYMLRAEFRLPSI SE+   +RKAPIRVKFEIPY
Sbjct  330  TSMGTAKYAPETDALLWKIKSFPGNKEYMLRAEFRLPSIVSEDAVADRKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAG+YELRL+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGDYELRLI  428



>emb|CDY63680.1| BnaA01g35650D [Brassica napus]
Length=433

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKIKSFPG K+YMLRAEF LPSIT+EE TPERKAPIRVKFEIPY
Sbjct  330  TSLGSAAYAPEKDALVWKIKSFPGNKDYMLRAEFHLPSITAEEATPERKAPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEY  283
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEY
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEY  423



>gb|EMT29153.1| AP-1 complex subunit mu-1 [Aegilops tauschii]
Length=481

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 94/112 (84%), Gaps = 13/112 (12%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WKIKSFPGGKEYM RAEF LPSITSEE TPE+K PIRVKFEIPY
Sbjct  370  TSMGSAAYAPERDAMVWKIKSFPGGKEYMCRAEFSLPSITSEEATPEKKTPIRVKFEIPY  429

Query  182  FTVSGI-------------QVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGI             QVRYLK+IEKSGYQALPWVRYITMAGEYELRL+
Sbjct  430  FTVSGIQSCILLIYHVIPLQVRYLKVIEKSGYQALPWVRYITMAGEYELRLI  481



>ref|XP_006354823.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum tuberosum]
Length=385

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMG +TYAPE+DA++WKIKSFPG  +YMLRAEFRL S+ SE+T P+RKA IRVKFEIPY
Sbjct  287  TSMGYATYAPERDAVVWKIKSFPGNTDYMLRAEFRLSSVISEDTPPDRKASIRVKFEIPY  346

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSGIQVRYLKIIEKSGYQALPWVRY TMAGEYELRL+
Sbjct  347  FTVSGIQVRYLKIIEKSGYQALPWVRYKTMAGEYELRLI  385



>ref|XP_010678835.1| PREDICTED: AP-1 complex subunit mu-2-like [Beta vulgaris subsp. 
vulgaris]
Length=428

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+TY PE D ++WKI+SFPG KEY+LRAEFRLPS++S++  PERK P+RVKFEIPY
Sbjct  330  TSMGSATYKPENDTILWKIRSFPGNKEYLLRAEFRLPSVSSDDGVPERKVPVRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FT+SGIQVRYLK+IEKSGYQALPWVRYIT AGEYE+RL
Sbjct  390  FTISGIQVRYLKVIEKSGYQALPWVRYITAAGEYEIRL  427



>ref|XP_001782369.1| predicted protein [Physcomitrella patens]
 gb|EDQ52823.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMG++ YAPEK+ALIWKIKSFPGGKEYM+RA+F LPSI +EET  E++ PIRVKFEIPY
Sbjct  330  TSMGTAVYAPEKEALIWKIKSFPGGKEYMMRAKFGLPSIEAEETVVEKRPPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT AGEYELR+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITTAGEYELRI  427



>gb|EMS61432.1| AP-1 complex subunit mu-1 [Triticum urartu]
Length=420

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMGS+ YAPE+DA++WK+KSFPGGKEYM RAEF LPSI++EE  PE+KAPIRVKFEIPY
Sbjct  308  TSMGSAAYAPERDAMVWKVKSFPGGKEYMCRAEFSLPSISAEEAVPEKKAPIRVKFEIPY  367

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMA  274
            FTVSGIQVRYLKIIEKSGYQALPWVRYITMA
Sbjct  368  FTVSGIQVRYLKIIEKSGYQALPWVRYITMA  398



>ref|XP_001781339.1| predicted protein [Physcomitrella patens]
 gb|EDQ53867.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TSMG++ YAPEK+ALIWKIKSFPGGKEYM+RA+F LPSI +E+   E++ PIRVKFEIPY
Sbjct  330  TSMGTAVYAPEKEALIWKIKSFPGGKEYMMRAKFGLPSIEAEDVVIEKRPPIRVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT AGEYELR+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITTAGEYELRI  427



>gb|AAF17661.1|AC009398_10 F20B24.16 [Arabidopsis thaliana]
Length=411

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKI+ F G KE+ L+A+F LPSI +EE TPERKAPIRVKFEIP 
Sbjct  313  TSLGSAAYAPEKDALVWKIQYFYGNKEHTLKADFHLPSIAAEEATPERKAPIRVKFEIPK  372

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            F VSGIQVRYLKIIEKSGYQA PWVRYITMAGEYELRLM
Sbjct  373  FIVSGIQVRYLKIIEKSGYQAHPWVRYITMAGEYELRLM  411



>ref|NP_172543.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
thaliana]
 sp|Q9SAC9.1|AP1M1_ARATH RecName: Full=AP-1 complex subunit mu-1; AltName: Full=Adaptor 
protein complex AP-1 subunit mu-1; AltName: Full=Adaptor protein-1 
mu-adaptin 1; AltName: Full=Adaptor-related protein 
complex 1 subunit mu-1; AltName: Full=At-muB1-Ad; AltName: 
Full=Clathrin assembly protein complex 1 mu-1 medium chain; 
AltName: Full=Mu1-adaptin 1 [Arabidopsis thaliana]
 gb|AAD31340.1|AC007354_13 Similar to gb|L26291 clathrin-associated protein unc-101 from 
Caenorhabditis elegans and is a member of the PF|00928 Adapter 
complexes medium subunit family [Arabidopsis thaliana]
 gb|AEE28635.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
thaliana]
Length=428

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ YAPEKDAL+WKI+ F G KE+ L+A+F LPSI +EE TPERKAPIRVKFEIP 
Sbjct  330  TSLGSAAYAPEKDALVWKIQYFYGNKEHTLKADFHLPSIAAEEATPERKAPIRVKFEIPK  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            F VSGIQVRYLKIIEKSGYQA PWVRYITMAGEYELRLM
Sbjct  390  FIVSGIQVRYLKIIEKSGYQAHPWVRYITMAGEYELRLM  428



>gb|AAN71247.1| LD27989p [Drosophila melanogaster]
Length=225

 Score =   151 bits (382),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE++A+IW IKSFPGGKEY++RA F LPS+ SE+ T E K PI+V+FEIPY
Sbjct  128  TTIGSCKYAPEQNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNT-EGKPPIQVRFEIPY  186

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  187  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  223



>ref|XP_009835575.1| AP-1 complex subunit mu-1 [Aphanomyces astaci]
 gb|ETV75071.1| AP-1 complex subunit mu-1 [Aphanomyces astaci]
Length=134

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEET--TPERKAPIRVKFEI  175
             S+GS TY P++DA++W IK F G +EY++RA F LPSI++  T  T E KAPI+VKFEI
Sbjct  34   CSIGSVTYVPDRDAIVWTIKQFNGSREYLMRAHFGLPSISNTNTAATDEWKAPIQVKFEI  93

Query  176  PYFTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            PYFTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  94   PYFTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  133



>gb|KIZ03697.1| AP-1 complex subunit mu-1 [Monoraphidium neglectum]
Length=426

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
             S G++ YAPE+ A+IW IKSFPGGKEY+LR  F LPS+ +EE    +  PI+VKFEIPY
Sbjct  328  CSQGTAVYAPERSAMIWTIKSFPGGKEYLLRVNFNLPSVEAEEEVHGKMPPIKVKFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FTVSG+QVRYLK+IEKSGYQALPWVRYIT AG YE+R+M
Sbjct  388  FTVSGLQVRYLKVIEKSGYQALPWVRYITTAGNYEIRMM  426



>ref|XP_011408446.1| PREDICTED: AP-1 complex subunit mu-1-like [Amphimedon queenslandica]
Length=224

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
             + G++TYAPEK+AL WKIKSFPGGKEY+LRA F LPS+ SEE   E + PI VKFEIPY
Sbjct  128  CTAGTATYAPEKNALSWKIKSFPGGKEYVLRAHFGLPSVQSEEG--EGRPPISVKFEIPY  185

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  186  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  222



>gb|KFM77982.1| AP-1 complex subunit mu-1, partial [Stegodyphus mimosarum]
Length=159

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++G+  YAPE+ A+IW +KSFPGGKEY++RA F LPS+ SEE+  E K PI+VKFEIPY
Sbjct  63   TTVGNVKYAPEQSAIIWSVKSFPGGKEYLMRAHFGLPSVESEES--EGKPPIQVKFEIPY  120

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  121  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  157



>gb|EFX86177.1| hypothetical protein DAPPUDRAFT_222170 [Daphnia pulex]
Length=422

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS  Y PE++ LIW IKSFPGGKEY++RA F LPS+TSEET  E K PI+VKFEIPY
Sbjct  326  TSVGSVKYVPEQNVLIWSIKSFPGGKEYLMRAHFGLPSVTSEET--EGKPPIQVKFEIPY  383

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  384  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  420



>gb|KHN82492.1| AP-1 complex subunit mu-1-I [Toxocara canis]
Length=417

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 84/99 (85%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS  YAPE++A +W IKSFPGGKEY++RA F LPS+ SE+   E K P++VKFEIPY
Sbjct  321  TSIGSVKYAPEQNAFVWTIKSFPGGKEYLMRAHFNLPSVQSEDV--EGKPPMKVKFEIPY  378

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+M
Sbjct  379  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRMM  417



>ref|XP_001902851.1| Clathrin coat assembly protein AP47 [Brugia malayi]
Length=127

 Score =   145 bits (367),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+G+  Y PE+++ +W IKSFPGGKEY++RA F LPS+  E+   E + P++VKFEIPY
Sbjct  31   TSIGTVKYTPEQNSFVWTIKSFPGGKEYLMRAHFNLPSVQCEDR--EGRPPMKVKFEIPY  88

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+M
Sbjct  89   FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRMM  127



>ref|XP_001359566.1| GA21750 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002017486.1| GL21499 [Drosophila persimilis]
 gb|EAL28715.1| GA21750 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW34586.1| GL21499 [Drosophila persimilis]
Length=426

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE++A+IW +KSFPGGKEY++RA F LPS+ SEE T E K PI+V+FEIPY
Sbjct  329  TTIGSCKYAPEQNAIIWTVKSFPGGKEYLMRAHFGLPSVESEENT-EGKPPIQVRFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  388  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|XP_003748057.1| PREDICTED: AP-1 complex subunit mu-1-like [Metaseiulus occidentalis]
Length=426

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE+ A IW IKSFPGGKEY++RA F LPS+ SEE   E +API VKFEIPY
Sbjct  330  TTIGSCKYAPERSACIWTIKSFPGGKEYLMRAHFNLPSVESEEL--EARAPIEVKFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  388  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|NP_649906.1| adaptor protein complex 1, mu subunit [Drosophila melanogaster]
 ref|XP_001954851.1| GF16536 [Drosophila ananassae]
 ref|XP_001980806.1| GG17361 [Drosophila erecta]
 ref|XP_002031881.1| GM26246 [Drosophila sechellia]
 ref|XP_002096960.1| GE24766 [Drosophila yakuba]
 ref|XP_002104108.1| GD20786 [Drosophila simulans]
 gb|AAF14247.1|AF110231_1 clathrin-associated adaptor complex AP-1 medium chain [Drosophila 
melanogaster]
 emb|CAA06918.1| clathrin-associated protein [Drosophila melanogaster]
 gb|AAF54399.1| adaptor protein complex 1, mu subunit [Drosophila melanogaster]
 gb|AAL13850.1| LD31377p [Drosophila melanogaster]
 gb|EDV43412.1| GF16536 [Drosophila ananassae]
 gb|EDV49764.1| GG17361 [Drosophila erecta]
 gb|EDW42867.1| GM26246 [Drosophila sechellia]
 gb|EDW96672.1| GE24766 [Drosophila yakuba]
 gb|EDX13611.1| GD20786 [Drosophila simulans]
 gb|ACL85571.1| AP-47-PA, partial [synthetic construct]
 gb|ACL90447.1| AP-47-PA [synthetic construct]
Length=426

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE++A+IW IKSFPGGKEY++RA F LPS+ SE+ T E K PI+V+FEIPY
Sbjct  329  TTIGSCKYAPEQNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNT-EGKPPIQVRFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  388  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|XP_001998648.1| GI23520 [Drosophila mojavensis]
 ref|XP_002056361.1| GJ10271 [Drosophila virilis]
 gb|EDW14109.1| GI23520 [Drosophila mojavensis]
 gb|EDW59473.1| GJ10271 [Drosophila virilis]
Length=426

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE++A+IW IKSFPGGKEY++RA F LPS+ SE+ T E K PI+V+FEIPY
Sbjct  329  TTIGSCKYAPEQNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNT-EGKPPIQVRFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  388  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|XP_002070012.1| GK11256 [Drosophila willistoni]
 gb|EDW80998.1| GK11256 [Drosophila willistoni]
Length=426

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE++A+IW IKSFPGGKEY++RA F LPS+ SE+ T E K PI+V+FEIPY
Sbjct  329  TTIGSCKYAPEQNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNT-EGKPPIQVRFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  388  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  424



>gb|ERE75426.1| AP-1 complex subunit mu-2, partial [Cricetulus griseus]
Length=260

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  164  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  221

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  222  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  258



>ref|XP_005850786.1| hypothetical protein CHLNCDRAFT_29685 [Chlorella variabilis]
 gb|EFN58684.1| hypothetical protein CHLNCDRAFT_29685 [Chlorella variabilis]
Length=438

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS G++ YAPEKDAL+WKIK+FPGG+E++LR +F LPS+ +E+    R  PI+VKFEIPY
Sbjct  338  TSQGTAVYAPEKDALVWKIKNFPGGREFLLRCKFGLPSVAAEDEAQGRLPPIKVKFEIPY  397

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            ++VSGIQ+RYLK+IE+SGYQALPWVRY+T AG YE+R+
Sbjct  398  YSVSGIQIRYLKVIERSGYQALPWVRYLTQAGSYEIRM  435



>ref|XP_002411827.1| clathrin coat assembly protein, putative [Ixodes scapularis]
 gb|EEC14244.1| clathrin coat assembly protein, putative [Ixodes scapularis]
Length=448

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++G+  YAPE+ A++W IKSFPGGKEY++RA F LPS+ SEET  E +API+VKFEIPY
Sbjct  352  TTVGNVKYAPEQSAVVWSIKSFPGGKEYLMRAHFGLPSVESEET--EGRAPIQVKFEIPY  409

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  410  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  446



>ref|XP_001990364.1| clathrin associated protein 47 [Drosophila grimshawi]
 gb|EDV93426.1| clathrin associated protein 47 [Drosophila grimshawi]
Length=426

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE++A+IW +KSFPGGKEY++RA F LPS+ SE+ T E K PI+V+FEIPY
Sbjct  329  TTIGSCKYAPEQNAIIWTVKSFPGGKEYLMRAHFGLPSVESEDNT-EGKPPIQVRFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  388  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  424



>gb|ETP32967.1| hypothetical protein F442_18448 [Phytophthora parasitica P10297]
Length=425

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
             S+GS TY P++DA++W IK F G +EY++RA F LPS+ + E T + KAPI+VKFEIPY
Sbjct  327  CSIGSVTYVPDRDAIVWSIKQFNGSREYLMRAHFGLPSVDNHEATDDWKAPIQVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  387  FTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  424



>ref|XP_008913378.1| hypothetical protein PPTG_17400 [Phytophthora parasitica INRA-310]
 gb|ETI34967.1| hypothetical protein F443_18647 [Phytophthora parasitica P1569]
 gb|ETK75253.1| hypothetical protein L915_18128 [Phytophthora parasitica]
 gb|ETL28680.1| hypothetical protein L916_18030 [Phytophthora parasitica]
 gb|ETL81909.1| hypothetical protein L917_17848 [Phytophthora parasitica]
 gb|ETM35135.1| hypothetical protein L914_17933 [Phytophthora parasitica]
 gb|ETN01277.1| hypothetical protein PPTG_17400 [Phytophthora parasitica INRA-310]
 gb|ETO63720.1| hypothetical protein F444_18642 [Phytophthora parasitica P1976]
 gb|ETP04788.1| hypothetical protein F441_18507 [Phytophthora parasitica CJ01A1]
Length=425

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
             S+GS TY P++DA++W IK F G +EY++RA F LPS+ + E T + KAPI+VKFEIPY
Sbjct  327  CSIGSVTYVPDRDAIVWSIKQFNGSREYLMRAHFGLPSVDNHEATDDWKAPIQVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  387  FTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  424



>ref|XP_009518106.1| hypothetical protein PHYSODRAFT_349597 [Phytophthora sojae]
 gb|EGZ22818.1| hypothetical protein PHYSODRAFT_349597 [Phytophthora sojae]
Length=425

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
             S+GS TY P++DA++W IK F G +EY++RA F LPS+ + E T + KAPI+VKFEIPY
Sbjct  327  CSIGSVTYVPDRDAIVWSIKQFNGSREYLMRAHFGLPSVDNHEATDDWKAPIQVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  387  FTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  424



>gb|ELT98131.1| hypothetical protein CAPTEDRAFT_178783 [Capitella teleta]
Length=422

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T+ GS  YAP+++A+IW IKSFPGGKEY++RA F LPS+ +E+   E KAPI V+FEIPY
Sbjct  326  TTAGSCRYAPDQNAMIWTIKSFPGGKEYLMRAHFGLPSVVNEDL--EGKAPIHVRFEIPY  383

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  384  FTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_005646699.1| Mu1-adaptin [Coccomyxa subellipsoidea C-169]
 gb|EIE22155.1| Mu1-adaptin [Coccomyxa subellipsoidea C-169]
Length=393

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +2

Query  11   GSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPYFTV  190
            G++ Y PEK+AL+WKIKSFPGG+E++LRA+F LPS+ +EE    R  PI V FEIPYFTV
Sbjct  298  GTAVYVPEKEALVWKIKSFPGGREFLLRAKFSLPSVAAEEEPHGRMPPIAVNFEIPYFTV  357

Query  191  SGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            SGIQVRYLK+IEKSGYQALPWVRYIT  GEYE+R+
Sbjct  358  SGIQVRYLKVIEKSGYQALPWVRYITAGGEYEIRM  392



>gb|EDL78305.1| rCG31866, isoform CRA_b [Rattus norvegicus]
Length=330

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  234  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  291

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  292  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  328



>ref|XP_011176465.1| PREDICTED: AP-1 complex subunit mu-1 [Bactrocera cucurbitae]
 ref|XP_011208228.1| PREDICTED: AP-1 complex subunit mu-1 [Bactrocera dorsalis]
 ref|XP_011208229.1| PREDICTED: AP-1 complex subunit mu-1 [Bactrocera dorsalis]
Length=426

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE++A+IW IKSFPGGKEY++RA F LPS+ SE+   E K PI+V+FEIPY
Sbjct  329  TTIGSCKYAPEQNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNN-EGKPPIQVRFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  388  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|XP_004518112.1| PREDICTED: AP-1 complex subunit mu-1-like isoform X1 [Ceratitis 
capitata]
 ref|XP_004518113.1| PREDICTED: AP-1 complex subunit mu-1-like isoform X2 [Ceratitis 
capitata]
 ref|XP_004518114.1| PREDICTED: AP-1 complex subunit mu-1-like isoform X3 [Ceratitis 
capitata]
Length=426

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE++A+IW IKSFPGGKEY++RA F LPS+ SE+   E K PI+V+FEIPY
Sbjct  329  TTIGSCKYAPEQNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNN-EGKPPIQVRFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  388  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|XP_003385149.1| PREDICTED: AP-1 complex subunit mu-1-like [Amphimedon queenslandica]
Length=422

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
             + G++TYAPEK+AL WKIKSFPGGKEY+LRA F LPS+ SEE   E + PI VKFEIPY
Sbjct  326  CTAGTATYAPEKNALSWKIKSFPGGKEYVLRAHFGLPSVQSEEG--EGRPPISVKFEIPY  383

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  384  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  420



>gb|ERG87092.1| ap-1 complex subunit mu-1-i [Ascaris suum]
Length=422

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 2/99 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+G+  Y PE++A +W IKSFPGGKEY++RA F LPS+ S++   E K P++VKFEIPY
Sbjct  326  TSIGTVKYTPEQNAFVWTIKSFPGGKEYLMRAHFNLPSVQSDDV--EGKPPMKVKFEIPY  383

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM  298
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+M
Sbjct  384  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRMM  422



>ref|NP_001006851.1| adaptor-related protein complex 1, mu 2 subunit [Xenopus (Silurana) 
tropicalis]
 gb|AAH76939.1| adaptor-related protein complex 1, mu 1 subunit [Xenopus (Silurana) 
tropicalis]
Length=423

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E K PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWTIKSFPGGKEYLMRAHFGLPSVETEEL--EGKPPISVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_001637219.1| predicted protein [Nematostella vectensis]
 gb|EDO45156.1| predicted protein [Nematostella vectensis]
Length=423

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 84/97 (87%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++G+  YAPE++ +IW IKSFPGGKE+++RA F LPS+ SEET  E + PI++KFEIPY
Sbjct  327  TTVGNIKYAPEQNVVIWNIKSFPGGKEFLMRAHFNLPSVDSEET--EGRPPIKLKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  385  FTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  421



>ref|XP_011472581.1| PREDICTED: AP-1 complex subunit mu-2-like [Oryzias latipes]
Length=235

 Score =   146 bits (369),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 81/97 (84%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS GS+ Y PEKD ++W IKSFPGGKE+++RA F LPS+  +E   E K PI VKFEIPY
Sbjct  138  TSTGSAKYVPEKDLVLWTIKSFPGGKEFLMRAHFGLPSVEKDEL--EGKPPITVKFEIPY  195

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  196  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  232



>emb|CCA17153.1| Clathrin assembly complex putative [Albugo laibachii Nc14]
Length=424

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            +S+GS TY P++DA +W IK F G KEY++RA F LPS+ +EET  + KAPI+VKFEIPY
Sbjct  327  SSIGSVTYVPDRDAFVWTIKQFNGAKEYLMRAHFGLPSLNNEET-EDWKAPIQVKFEIPY  385

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  GEY+LR+
Sbjct  386  FTVSGIQVRYLKIIEKSGYQALPWVRYITQNGEYQLRM  423



>ref|XP_006510013.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Mus musculus]
 gb|EDL25179.1| adaptor protein complex AP-1, mu 2 subunit, isoform CRA_c [Mus 
musculus]
Length=388

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  292  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  349

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  350  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  386



>ref|XP_006510012.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Mus musculus]
Length=390

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  294  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  351

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  352  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  388



>ref|XP_008102017.1| PREDICTED: AP-1 complex subunit mu-2 [Anolis carolinensis]
Length=423

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEKD +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI V+FEIPY
Sbjct  327  TSIGSAKYLPEKDVVIWSIKSFPGGKEYLMRAHFGLPSVENEEL--EGRPPISVRFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_001520622.2| PREDICTED: AP-1 complex subunit mu-2 [Ornithorhynchus anatinus]
Length=257

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGK+Y++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  161  TSVGSAKYLPEKNIVIWTIKSFPGGKDYLMRAHFGLPSVEKEEM--EGRPPISVKFEIPY  218

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  219  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  255



>ref|XP_005181067.1| PREDICTED: AP-1 complex subunit mu-1 [Musca domestica]
 ref|XP_011291494.1| PREDICTED: AP-1 complex subunit mu-1 [Musca domestica]
Length=426

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE++A+IW IKSFPGGKEY++RA F LPS+ SE++  E K PI+V FEIPY
Sbjct  329  TTIGSCKYAPEQNAVIWTIKSFPGGKEYLMRAHFGLPSVKSEDSL-EGKPPIQVHFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  388  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  424



>ref|XP_008561429.1| PREDICTED: AP-1 complex subunit mu-2 [Galeopterus variegatus]
Length=359

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  263  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  320

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  321  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  357



>gb|KIH46983.1| adaptor complexe medium subunit family protein [Ancylostoma duodenale]
Length=159

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS  Y PE +A +W I+SFPGG+EY++RA F LPSI SEE   E K PI+VKFEIPY
Sbjct  63   TSVGSVKYVPELNAFVWTIRSFPGGREYLMRAHFSLPSIMSEEV--EGKPPIQVKFEIPY  120

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            +T SG+QVRYLKIIEKSGYQA+PWVRY+T  G+Y+LR+
Sbjct  121  YTTSGLQVRYLKIIEKSGYQAMPWVRYVTQNGDYQLRM  158



>gb|EKC25539.1| AP-1 complex subunit mu-1 [Crassostrea gigas]
Length=396

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAP+ +A+IW +KSFPGGKEY++RA F LPS+ +EE+  E + PI VKFEIPY
Sbjct  300  TTVGSCKYAPDMNAVIWTVKSFPGGKEYLMRAHFGLPSVIAEES--EGRPPIHVKFEIPY  357

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  358  FTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  394



>ref|NP_001086866.1| adaptor-related protein complex 1, mu 2 subunit [Xenopus laevis]
 gb|AAH77578.1| Ap1m1-prov protein [Xenopus laevis]
Length=423

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ ++W IKSFPGGKEY++RA F LPS+  EE   E K PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVVWTIKSFPGGKEYLMRAHFGLPSVEREEL--EGKPPINVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_011414129.1| PREDICTED: AP-1 complex subunit mu-1 [Crassostrea gigas]
Length=422

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAP+ +A+IW +KSFPGGKEY++RA F LPS+ +EE+  E + PI VKFEIPY
Sbjct  326  TTVGSCKYAPDMNAVIWTVKSFPGGKEYLMRAHFGLPSVIAEES--EGRPPIHVKFEIPY  383

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  384  FTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|NP_001084934.1| uncharacterized protein LOC431991 [Xenopus laevis]
 gb|AAH70627.1| MGC81419 protein [Xenopus laevis]
Length=423

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ ++W IKSFPGGKEY++RA F LPS+  EE   E K PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVVWTIKSFPGGKEYLMRAHFGLPSVEREEV--EGKPPISVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>emb|CDI54254.1| probable clathrin assembly protein AP47, partial [Melanopsichium 
pennsylvanicum 4]
Length=426

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
             ++GS  YAPEK A++WKIK   GGKE+++RA F LPS+ SE+T  +R+API +KFEIPY
Sbjct  329  AAIGSVVYAPEKSAMVWKIKQLGGGKEFLMRAHFGLPSVKSEDTV-DRRAPISIKFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRYLKI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  388  FTVSGIQVRYLKIVEKSGYQALPWVRYITQHGEYDLR  424



>ref|XP_008848253.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Nannospalax 
galili]
Length=425

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_008848254.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Nannospalax 
galili]
Length=423

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_005346947.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Microtus ochrogaster]
Length=425

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_005346948.1| PREDICTED: AP-1 complex subunit mu-2 isoform X3 [Microtus ochrogaster]
Length=423

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_007638674.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Cricetulus griseus]
 ref|XP_007624284.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Cricetulus griseus]
Length=425

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_005078605.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Mesocricetus 
auratus]
Length=425

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_001750591.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ84564.1| predicted protein [Monosiga brevicollis MX1]
Length=425

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T MG+  YAPE  A++W IK FPGGKE+M+RA F LPS+ SEE   E + PI+VKFEIPY
Sbjct  329  TVMGTCKYAPELSAVVWTIKQFPGGKEFMMRAHFNLPSVESEEA--ESRPPIQVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYITM G+Y++R
Sbjct  387  FTTSGIQVRYLKIIEKSGYQALPWVRYITMNGDYQIR  423



>ref|NP_001103770.1| AP-1 complex subunit mu-2 isoform 1 [Mus musculus]
 ref|XP_006987070.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Peromyscus maniculatus 
bairdii]
 dbj|BAB26971.1| unnamed protein product [Mus musculus]
 gb|EDL25177.1| adaptor protein complex AP-1, mu 2 subunit, isoform CRA_a [Mus 
musculus]
Length=425

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>sp|Q9WVP1.3|AP1M2_MOUSE RecName: Full=AP-1 complex subunit mu-2; AltName: Full=AP-mu 
chain family member mu1B; AltName: Full=Adaptor protein complex 
AP-1 subunit mu-2; AltName: Full=Adaptor-related protein 
complex 1 subunit mu-2; AltName: Full=Clathrin assembly protein 
complex 1 mu-2 medium chain 2; AltName: Full=Golgi adaptor 
HA1/AP1 adaptin mu-2 subunit; AltName: Full=Mu-adaptin 2; 
AltName: Full=Mu1B-adaptin [Mus musculus]
 gb|AAD28085.1|AF067146_1 clathrin adaptor medium chain protein MU1B [Mus musculus]
 gb|AAF61815.1| clathrin-associated adaptor medium chain mu1B [Mus musculus]
Length=423

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_005078606.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Mesocricetus 
auratus]
Length=423

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|NP_033808.2| AP-1 complex subunit mu-2 isoform 2 [Mus musculus]
 ref|XP_003499778.1| PREDICTED: AP-1 complex subunit mu-2 [Cricetulus griseus]
 ref|XP_006987071.1| PREDICTED: AP-1 complex subunit mu-2 isoform X3 [Peromyscus maniculatus 
bairdii]
 ref|XP_007624285.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Cricetulus griseus]
 gb|AAH03704.1| Adaptor protein complex AP-1, mu 2 subunit [Mus musculus]
 gb|EDL25178.1| adaptor protein complex AP-1, mu 2 subunit, isoform CRA_b [Mus 
musculus]
Length=423

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_008249777.1| PREDICTED: LOW QUALITY PROTEIN: AP-1 complex subunit mu-2 [Oryctolagus 
cuniculus]
Length=404

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  308  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  365

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  366  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  402



>ref|XP_003447927.1| PREDICTED: AP-1 complex subunit mu-2-like [Oreochromis niloticus]
Length=424

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS GS+ Y PEK+ ++W IKSFPGGKE+++RA F LPS+ +EE   E K PI VKFEIPY
Sbjct  327  TSTGSAKYVPEKNLVVWTIKSFPGGKEFLMRAHFGLPSVENEEM--ESKPPITVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_003760513.1| PREDICTED: AP-1 complex subunit mu-2 [Sarcophilus harrisii]
Length=423

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYLPEKNVVIWNIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIAVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_006987069.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Peromyscus maniculatus 
bairdii]
Length=438

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  342  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  399

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  400  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  436



>ref|NP_001102466.1| AP-1 complex subunit mu-2 [Rattus norvegicus]
 gb|EDL78304.1| rCG31866, isoform CRA_a [Rattus norvegicus]
 gb|AAI67082.1| Similar to Adaptor-related protein complex 1, mu 2 subunit (AP1M2) 
[Rattus norvegicus]
Length=423

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_003974418.1| PREDICTED: AP-1 complex subunit mu-1-like [Takifugu rubripes]
Length=423

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS GS+ + PEK A+ W IKSFPGGKEYM+RA F LPS+ SEE   E K PI V FEIPY
Sbjct  327  TSTGSAKWVPEKSAVQWNIKSFPGGKEYMMRAHFELPSVESEEL--ESKRPITVNFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYLKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_005346946.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Microtus ochrogaster]
Length=438

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+ +EE   E + PI VKFEIPY
Sbjct  342  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVETEEV--EGRPPIGVKFEIPY  399

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  400  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  436



>ref|XP_004378403.1| PREDICTED: AP-1 complex subunit mu-2 [Trichechus manatus latirostris]
Length=423

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWNIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>emb|CCI49557.1| unnamed protein product [Albugo candida]
Length=404

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            +S+G+ TY P++DA +W IK F G KEY++RA F LPS+ +EET  + KAPI+VKFEIPY
Sbjct  307  SSIGNVTYVPDRDAFVWTIKQFNGAKEYLMRAHFGLPSLNNEETD-DWKAPIQVKFEIPY  365

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  366  FTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  403



>ref|XP_008960091.1| PREDICTED: AP-1 complex subunit mu-2 isoform X3 [Pan paniscus]
Length=399

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  303  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  360

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  361  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  397



>emb|CEF67920.1| AP-47 [Strongyloides ratti]
Length=479

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE  A IW I+SFPGG+EY++RA F LPSI+S+ET  E+K PI V+FE+PY
Sbjct  319  TTVGSVRYAPEHSAFIWTIRSFPGGREYLMRAHFSLPSISSDET--EQKKPIHVRFEVPY  376

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLM*KLAGP  316
            FT SG+QVRYLKIIEKSGYQALPWVRY+T  G+Y++R++  L  P
Sbjct  377  FTTSGLQVRYLKIIEKSGYQALPWVRYVTQNGDYQIRILTILVFP  421



>ref|XP_008960092.1| PREDICTED: AP-1 complex subunit mu-2 isoform X4 [Pan paniscus]
Length=397

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  301  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  358

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  359  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  395



>gb|KDD76988.1| adaptor complexes medium subunit domain-containing protein, partial 
[Helicosporidium sp. ATCC 50920]
Length=871

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS G++TYAPEK+A++WKIK+FPG +E++LR +F LPS+ +EE    R  PI+VKFE+PY
Sbjct  329  TSQGTATYAPEKEAIVWKIKNFPGNREFLLRCKFGLPSVQAEEEVHGRMPPIKVKFEVPY  388

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT+SGIQ+RYLK+IE+SGYQALPWVRYIT AG+YE+R
Sbjct  389  FTISGIQIRYLKVIERSGYQALPWVRYITTAGDYEIR  425



>gb|AEE62403.1| unknown [Dendroctonus ponderosae]
 gb|ENN79999.1| hypothetical protein YQE_03560, partial [Dendroctonus ponderosae]
 gb|ERL93769.1| hypothetical protein D910_11055 [Dendroctonus ponderosae]
Length=422

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE++A+ W IKSFPGGKEY++RA F LPS+  E+T  E K PI+VKFEIPY
Sbjct  326  TTIGSVKYAPEQNAITWTIKSFPGGKEYLMRAHFGLPSVECEDT--EGKPPIQVKFEIPY  383

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  384  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  420



>emb|CCI49556.1| unnamed protein product [Albugo candida]
Length=408

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            +S+G+ TY P++DA +W IK F G KEY++RA F LPS+ +EET  + KAPI+VKFEIPY
Sbjct  311  SSIGNVTYVPDRDAFVWTIKQFNGAKEYLMRAHFGLPSLNNEETD-DWKAPIQVKFEIPY  369

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  370  FTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  407



>ref|XP_968639.1| PREDICTED: AP-1 complex subunit mu-1 [Tribolium castaneum]
 gb|EFA12022.1| hypothetical protein TcasGA2_TC001437 [Tribolium castaneum]
Length=422

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T++GS  YAPE++A+ W IKSFPGGKEY++RA F LPS+  E+T  E K PI+VKFEIPY
Sbjct  326  TTIGSVKYAPEQNAITWTIKSFPGGKEYLMRAHFGLPSVECEDT--EGKPPIQVKFEIPY  383

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  384  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|NP_001251914.1| Protein UNC-101, isoform c [Caenorhabditis elegans]
 emb|CBM41211.1| UNC-101, isoform c [Caenorhabditis elegans]
Length=273

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS  Y PE+ A +W IK+FPGGKEY+L A   LPS+ SEE+  E + PI+VKFEIPY
Sbjct  177  TSIGSVKYTPEQSAFVWTIKNFPGGKEYLLTAHLSLPSVMSEES--EGRPPIKVKFEIPY  234

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  GEYE+R+
Sbjct  235  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGEYEMRM  272



>gb|ERG81662.1| ap-1 complex subunit mu-1-i [Ascaris suum]
Length=406

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS  Y PE +A IW I+SFPGG+EY++RA F LPSI+SEE   E K PI VKFEIPY
Sbjct  310  TSVGSVKYVPELNAFIWTIRSFPGGREYLMRAHFSLPSISSEEN--EGKPPINVKFEIPY  367

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FT SG+QVRYLKIIEKSGYQALPWVRY+T  G+Y+LR+
Sbjct  368  FTTSGLQVRYLKIIEKSGYQALPWVRYVTQNGDYQLRM  405



>ref|XP_010976634.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Camelus dromedarius]
Length=397

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  301  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  358

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  359  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  395



>ref|XP_004748486.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Mustela putorius 
furo]
 ref|XP_004824375.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Mustela putorius 
furo]
Length=425

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_008706307.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Ursus maritimus]
Length=425

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_011287393.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Felis catus]
Length=425

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_010952555.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Camelus bactrianus]
Length=397

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  301  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  358

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  359  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  395



>gb|EFB12978.1| hypothetical protein PANDA_010309 [Ailuropoda melanoleuca]
Length=410

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  314  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  371

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  372  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  408



>emb|CCF51403.1| probable clathrin assembly protein AP47 [Ustilago hordei]
Length=439

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
             ++GS+ YAPEK A++WKIK   GGKE+++RA F LPS+ SE+T  +R+ PI +KFEIPY
Sbjct  329  AAIGSAVYAPEKSAMVWKIKQLGGGKEFLMRAHFGLPSVKSEDTV-DRRTPISIKFEIPY  387

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRYLKI+EKSGYQALPWVRYIT  GEY+LR
Sbjct  388  FTVSGIQVRYLKIVEKSGYQALPWVRYITQHGEYDLR  424



>ref|XP_003809630.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Pan paniscus]
 ref|XP_009432967.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Pan troglodytes]
Length=423

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_009015103.1| hypothetical protein HELRODRAFT_98900 [Helobdella robusta]
 gb|ESO07007.1| hypothetical protein HELRODRAFT_98900 [Helobdella robusta]
Length=422

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            T+ GS  Y+PE+ A+IW IKSFPGGK+Y++RA F LPS+T+E++  E K PI V FEIPY
Sbjct  326  TTCGSCKYSPEQSAVIWTIKSFPGGKDYLMRAHFGLPSVTAEDS--EGKPPIHVHFEIPY  383

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSG+QVRYLKIIEKSGYQALPWVRYIT  G+Y+LR
Sbjct  384  FTVSGVQVRYLKIIEKSGYQALPWVRYITQNGDYQLR  420



>ref|XP_002921414.1| PREDICTED: AP-1 complex subunit mu-2 [Ailuropoda melanoleuca]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_005994174.1| PREDICTED: AP-1 complex subunit mu-2 [Latimeria chalumnae]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ ++W IKSFPGGKEY++RA F LPS+ +EE   E K PI V+FEIPY
Sbjct  327  TSVGSAKYVPEKNTVVWTIKSFPGGKEYLMRAHFGLPSVENEEL--EGKPPISVQFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSG+QVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGVQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_001165482.2| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Pan troglodytes]
 ref|XP_008960090.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Pan paniscus]
Length=425

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_006875162.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Chrysochloris 
asiatica]
Length=425

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_007079414.1| PREDICTED: AP-1 complex subunit mu-2 [Panthera tigris altaica]
Length=414

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  318  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  375

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  376  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  412



>ref|XP_006875163.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Chrysochloris 
asiatica]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_004748487.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Mustela putorius 
furo]
 ref|XP_004824376.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Mustela putorius 
furo]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>gb|EPB91852.1| DNA polymerase kappa subunit [Mucor circinelloides f. circinelloides 
1006PhL]
Length=206

 Score =   144 bits (362),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
             S GS +Y PE+  L+WKIK F GGKE+++RA F LPS+ + E T E+K PI +KFEIPY
Sbjct  95   CSNGSVSYKPERSCLVWKIKQFQGGKEFIMRAHFGLPSVQAAEDT-EKKPPINIKFEIPY  153

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKI+EKSGYQALPWVRYIT  G+Y++R+
Sbjct  154  FTVSGIQVRYLKIVEKSGYQALPWVRYITQNGDYQMRM  191



>ref|XP_008706308.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Ursus maritimus]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_005785717.1| Apm1, medium subunit of the adaptin 1 complex [Emiliania huxleyi 
CCMP1516]
 ref|XP_005785718.1| Adaptor protein 1 medium subunit [Emiliania huxleyi CCMP1516]
 gb|EOD33288.1| Apm1, medium subunit of the adaptin 1 complex [Emiliania huxleyi 
CCMP1516]
 gb|EOD33289.1| Adaptor protein 1 medium subunit [Emiliania huxleyi CCMP1516]
Length=428

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+G+  YAPE+DA++W IK F GGKEY++RA F LPS+++EE   + K PI VKFEIPY
Sbjct  331  TSIGTVKYAPERDAIVWSIKQFHGGKEYLMRAHFGLPSVSNEEEKKD-KPPITVKFEIPY  389

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  390  FTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  427



>ref|XP_004595558.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Ochotona princeps]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_004595557.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Ochotona princeps]
Length=425

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_011287387.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Felis catus]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_004616623.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Sorex araneus]
Length=425

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_006184914.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Camelus ferus]
Length=425

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_006184915.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Camelus ferus]
 ref|XP_010976632.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Camelus dromedarius]
 ref|XP_010976633.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Camelus dromedarius]
 gb|EQB78325.1| AP-1 complex subunit mu-2 [Camelus ferus]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_004616624.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Sorex araneus]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>gb|ETN70109.1| adaptor complexe medium subunit family protein [Necator americanus]
Length=422

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS  YAPE+ A +W IKSFPGGKEY+L A F LPS+  EE   E + PI+VKFEIPY
Sbjct  326  TSIGSVRYAPEQSAFVWTIKSFPGGKEYLLSAHFSLPSVVGEEV--EGRPPIKVKFEIPY  383

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  GEY++R+
Sbjct  384  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGEYQMRM  421



>ref|XP_007107325.1| PREDICTED: AP-1 complex subunit mu-2 isoform X3 [Physeter catodon]
Length=401

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  305  TSVGSAKYMPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  362

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  363  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  399



>ref|XP_010826657.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Bison bison 
bison]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNTVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_004689085.1| PREDICTED: AP-1 complex subunit mu-2 [Condylura cristata]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_005945801.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X2 [Haplochromis 
burtoni]
Length=398

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS G++ Y PEK+ ++W IKSFPGGKE+++RA F LPS+ +EE   E K PI VKFEIPY
Sbjct  301  TSTGNAKYVPEKNLVVWTIKSFPGGKEFLMRAHFGLPSVENEEA--ESKPPITVKFEIPY  358

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  359  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  395



>ref|XP_010826656.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Bison bison 
bison]
Length=425

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNTVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|NP_001029683.1| AP-1 complex subunit mu-2 [Bos taurus]
 ref|XP_005890857.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Bos mutus]
 sp|Q3SYW1.3|AP1M2_BOVIN RecName: Full=AP-1 complex subunit mu-2; AltName: Full=AP-mu 
chain family member mu1B; AltName: Full=Adaptor protein complex 
AP-1 subunit mu-2; AltName: Full=Adaptor-related protein 
complex 1 subunit mu-2; AltName: Full=Clathrin assembly protein 
complex 1 mu-2 medium chain 2; AltName: Full=Golgi adaptor 
HA1/AP1 adaptin mu-2 subunit; AltName: Full=Mu-adaptin 2; 
AltName: Full=Mu1B-adaptin [Bos taurus]
 gb|AAI03359.1| Adaptor-related protein complex 1, mu 2 subunit [Bos taurus]
 tpg|DAA27930.1| TPA: AP-1 complex subunit mu-2 [Bos taurus]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNTVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_004311234.1| PREDICTED: AP-1 complex subunit mu-2 [Tursiops truncatus]
Length=397

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  301  TSVGSAKYMPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  358

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  359  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  395



>ref|XP_005208805.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Bos taurus]
 ref|XP_005890856.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Bos mutus]
 gb|ELR60002.1| AP-1 complex subunit mu-2 [Bos mutus]
Length=425

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  329  TSVGSAKYVPEKNTVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  386

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  387  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  423



>ref|XP_010952553.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Camelus bactrianus]
 ref|XP_010952554.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Camelus bactrianus]
Length=423

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  327  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  384

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  385  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  421



>ref|XP_007107326.1| PREDICTED: AP-1 complex subunit mu-2 isoform X4 [Physeter catodon]
Length=400

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  304  TSVGSAKYMPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  361

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  362  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  398



>ref|XP_006206549.1| PREDICTED: AP-1 complex subunit mu-2 [Vicugna pacos]
Length=414

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PEK+ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  318  TSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  375

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  376  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  412



>emb|CDJ83045.1| Clathrin adaptor domain containing protein [Haemonchus contortus]
 emb|CDJ81258.1| Clathrin adaptor domain containing protein [Haemonchus contortus]
Length=422

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+G+  YAPE+ A +W IKSFPGGKEY+L A F LPS+  EE   E K PI+VKFEIPY
Sbjct  326  TSIGAVRYAPEQSAFVWTIKSFPGGKEYLLSAHFSLPSVVGEEV--EGKPPIKVKFEIPY  383

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            FT SGIQVRYLKIIEKSGYQALPWVRYIT  GEY++R+
Sbjct  384  FTTSGIQVRYLKIIEKSGYQALPWVRYITQNGEYQMRM  421



>ref|XP_008875643.1| hypothetical protein H310_10930 [Aphanomyces invadans]
 gb|ETV95892.1| hypothetical protein H310_10930 [Aphanomyces invadans]
Length=430

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEET--TPERKAPIRVKFEI  175
             S+GS TY P++DA++W IK F G +EY++RA F LPSI++  T  T E KAPI+VKFEI
Sbjct  330  CSIGSVTYVPDRDAIVWTIKQFNGSREYLMRAHFGLPSISNTNTAATDEWKAPIQVKFEI  389

Query  176  PYFTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRL  295
            PYFTVSGIQVRYLKIIEKSGYQALPWVRYIT  G+Y+LR+
Sbjct  390  PYFTVSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRM  429



>ref|XP_007993426.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Chlorocebus 
sabaeus]
Length=355

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 82/97 (85%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    TSMGSSTYAPEKDALIWKIKSFPGGKEYMLRAEFRLPSITSEETTPERKAPIRVKFEIPY  181
            TS+GS+ Y PE++ +IW IKSFPGGKEY++RA F LPS+  EE   E + PI VKFEIPY
Sbjct  259  TSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEV--EGRPPIGVKFEIPY  316

Query  182  FTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELR  292
            FTVSGIQVRY+KIIEKSGYQALPWVRYIT +G+Y+LR
Sbjct  317  FTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR  353



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335