BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J12

Length=548
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010690773.1|  PREDICTED: endophilin-A1                           286   2e-92   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009631701.1|  PREDICTED: intersectin-1                           281   1e-90   Nicotiana tomentosiformis
ref|XP_009802569.1|  PREDICTED: hematopoietic lineage cell-specif...    281   2e-90   Nicotiana sylvestris
ref|XP_004150141.1|  PREDICTED: uncharacterized protein LOC101205534    279   8e-90   Cucumis sativus [cucumbers]
ref|XP_006362005.1|  PREDICTED: uncharacterized protein LOC102580820    279   1e-89   Solanum tuberosum [potatoes]
ref|XP_004230879.1|  PREDICTED: intersectin-1                           278   1e-89   
gb|KJB32579.1|  hypothetical protein B456_005G247800                    277   4e-89   Gossypium raimondii
ref|XP_010271500.1|  PREDICTED: endophilin-A1-like                      276   8e-89   Nelumbo nucifera [Indian lotus]
ref|XP_006487313.1|  PREDICTED: intersectin-1-like                      276   1e-88   Citrus sinensis [apfelsine]
ref|XP_008461013.1|  PREDICTED: intersectin-1                           276   1e-88   Cucumis melo [Oriental melon]
ref|XP_010109769.1|  hypothetical protein L484_008445                   275   2e-88   Morus notabilis
gb|KDP41725.1|  hypothetical protein JCGZ_26743                         275   2e-88   Jatropha curcas
gb|ACJ84520.1|  unknown                                                 269   4e-88   Medicago truncatula
ref|XP_010263867.1|  PREDICTED: endophilin-A1-like isoform X1           275   5e-88   Nelumbo nucifera [Indian lotus]
gb|KHG07438.1|  SH3 domain-containing 21                                275   5e-88   Gossypium arboreum [tree cotton]
ref|XP_007042046.1|  SH3 domain-containing protein                      274   6e-88   
ref|XP_010263868.1|  PREDICTED: endophilin-A2-like isoform X2           274   6e-88   Nelumbo nucifera [Indian lotus]
ref|XP_008796880.1|  PREDICTED: endophilin-A2-like                      274   7e-88   Phoenix dactylifera
ref|XP_010531469.1|  PREDICTED: endophilin-A3                           274   1e-87   Tarenaya hassleriana [spider flower]
ref|XP_011088479.1|  PREDICTED: hematopoietic lineage cell-specif...    272   3e-87   Sesamum indicum [beniseed]
ref|XP_009378426.1|  PREDICTED: uncharacterized protein LOC103966...    271   4e-87   
ref|XP_002313015.1|  SH3 domain-containing protein 2                    272   4e-87   Populus trichocarpa [western balsam poplar]
ref|XP_010933758.1|  PREDICTED: endophilin-A2-like                      272   4e-87   Elaeis guineensis
ref|XP_007199921.1|  hypothetical protein PRUPE_ppa007358mg             272   5e-87   Prunus persica
ref|XP_009378425.1|  PREDICTED: uncharacterized protein LOC103966...    271   5e-87   
ref|XP_008236987.1|  PREDICTED: src substrate cortactin                 272   5e-87   Prunus mume [ume]
ref|XP_011047486.1|  PREDICTED: endophilin-A1                           272   6e-87   Populus euphratica
ref|XP_009378424.1|  PREDICTED: endophilin-A2-like isoform X1           271   8e-87   Pyrus x bretschneideri [bai li]
ref|XP_009376516.1|  PREDICTED: uncharacterized protein LOC103965...    269   1e-86   Pyrus x bretschneideri [bai li]
ref|XP_002512983.1|  clathrin binding protein, putative                 271   1e-86   Ricinus communis
ref|XP_009376515.1|  PREDICTED: uncharacterized protein LOC103965...    270   1e-86   Pyrus x bretschneideri [bai li]
gb|KFK30100.1|  hypothetical protein AALP_AA7G216900                    271   1e-86   Arabis alpina [alpine rockcress]
ref|XP_009376514.1|  PREDICTED: endophilin-A3-like isoform X1           270   2e-86   Pyrus x bretschneideri [bai li]
ref|XP_009384539.1|  PREDICTED: endophilin-A1-like                      270   3e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG01755.1|  Nostrin                                                 270   4e-86   Gossypium arboreum [tree cotton]
ref|XP_010919378.1|  PREDICTED: endophilin-A2-like isoform X2           270   5e-86   Elaeis guineensis
ref|XP_002306133.1|  SH3 domain-containing protein 2                    269   6e-86   Populus trichocarpa [western balsam poplar]
ref|XP_006411698.1|  hypothetical protein EUTSA_v10025489mg             268   1e-85   Eutrema salsugineum [saltwater cress]
gb|ADD09605.1|  SH3 domain-containing protein                           268   1e-85   Trifolium repens [creeping white clover]
ref|XP_009110394.1|  PREDICTED: src substrate protein p85               268   1e-85   Brassica rapa
ref|NP_001190914.1|  SH3 domain-containing protein                      266   1e-85   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69077.1|  BnaC01g03760D                                          268   1e-85   
gb|KEH30468.1|  clathrin-binding protein, putative                      268   2e-85   Medicago truncatula
ref|XP_008791647.1|  PREDICTED: endophilin-A3-like                      268   2e-85   Phoenix dactylifera
ref|XP_010919377.1|  PREDICTED: endophilin-A2-like isoform X1           269   2e-85   Elaeis guineensis
ref|XP_003607042.1|  Rho guanine nucleotide exchange factor             268   2e-85   Medicago truncatula
ref|XP_003540970.1|  PREDICTED: myosin-3-like isoform 1                 268   2e-85   Glycine max [soybeans]
gb|KFK30487.1|  hypothetical protein AALP_AA7G267900                    268   2e-85   Arabis alpina [alpine rockcress]
gb|KHN25423.1|  Endophilin-A1                                           268   2e-85   Glycine soja [wild soybean]
ref|XP_006829161.1|  hypothetical protein AMTR_s00001p00270050          268   3e-85   Amborella trichopoda
ref|XP_003603992.1|  Neutrophil cytosol factor                          267   4e-85   Medicago truncatula
ref|XP_004507503.1|  PREDICTED: intersectin-1-like isoform X3           267   4e-85   Cicer arietinum [garbanzo]
emb|CAA18845.1|  putative protein                                       268   5e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283938.1|  hypothetical protein CARUB_v10005057mg             267   5e-85   Capsella rubella
ref|XP_002867108.1|  SH3 domain-containing protein 2                    266   6e-85   
ref|XP_004507501.1|  PREDICTED: intersectin-1-like isoform X1           266   6e-85   
ref|NP_567969.1|  SH3 domain-containing protein                         266   6e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500776.1|  PREDICTED: intersectin-1-like isoform X1           266   7e-85   Cicer arietinum [garbanzo]
gb|EPS66080.1|  hypothetical protein M569_08697                         266   7e-85   Genlisea aurea
ref|XP_004290307.1|  PREDICTED: endophilin-A1-like                      266   8e-85   Fragaria vesca subsp. vesca
ref|XP_006580985.1|  PREDICTED: uncharacterized protein LOC100783...    266   1e-84   
ref|XP_007135930.1|  hypothetical protein PHAVU_009G004000g             266   1e-84   Phaseolus vulgaris [French bean]
ref|XP_010530811.1|  PREDICTED: src substrate cortactin                 266   1e-84   Tarenaya hassleriana [spider flower]
ref|XP_006661952.1|  PREDICTED: pericentrin-like                        266   2e-84   Oryza brachyantha
gb|EYU37851.1|  hypothetical protein MIMGU_mgv1a008590mg                265   2e-84   Erythranthe guttata [common monkey flower]
ref|XP_011037191.1|  PREDICTED: intersectin-1-like                      265   2e-84   Populus euphratica
ref|XP_009401790.1|  PREDICTED: intersectin-1-like                      265   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG28140.1|  clathrin binding protein                                265   3e-84   Zea mays [maize]
ref|XP_002266234.1|  PREDICTED: endophilin-A3 isoform X3                263   1e-83   Vitis vinifera
ref|XP_010664761.1|  PREDICTED: uncharacterized protein LOC100264...    263   1e-83   Vitis vinifera
ref|NP_001065045.1|  Os10g0512700                                       263   1e-83   
ref|XP_006282652.1|  hypothetical protein CARUB_v10005066mg             260   1e-83   
ref|XP_010437576.1|  PREDICTED: src substrate cortactin-like            263   1e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010664760.1|  PREDICTED: uncharacterized protein LOC100264...    262   2e-83   Vitis vinifera
ref|XP_010432388.1|  PREDICTED: src substrate cortactin-like            263   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_003537844.1|  PREDICTED: uncharacterized protein LOC100777...    263   2e-83   Glycine max [soybeans]
ref|XP_002279562.1|  PREDICTED: endophilin-A2 isoform X1                262   3e-83   Vitis vinifera
ref|XP_009761874.1|  PREDICTED: uncharacterized protein LOC104213988    255   3e-83   Nicotiana sylvestris
ref|XP_002464381.1|  hypothetical protein SORBIDRAFT_01g017250          262   4e-83   Sorghum bicolor [broomcorn]
ref|XP_003522865.1|  PREDICTED: intersectin-1-like isoform 1            262   5e-83   Glycine max [soybeans]
ref|NP_001130175.1|  uncharacterized protein LOC100191269               262   5e-83   Zea mays [maize]
ref|NP_001242513.1|  uncharacterized protein LOC100783004               261   6e-83   
gb|KJB12165.1|  hypothetical protein B456_002G004300                    261   6e-83   Gossypium raimondii
ref|XP_007131765.1|  hypothetical protein PHAVU_011G040000g             261   7e-83   Phaseolus vulgaris [French bean]
ref|XP_006352058.1|  PREDICTED: intersectin-1-like                      261   1e-82   Solanum tuberosum [potatoes]
ref|XP_002866827.1|  hypothetical protein ARALYDRAFT_327853             260   2e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_003574180.1|  PREDICTED: intersectin-1-like                      259   4e-82   Brachypodium distachyon [annual false brome]
ref|XP_006282653.1|  hypothetical protein CARUB_v10005066mg             259   7e-82   Capsella rubella
ref|XP_004982624.1|  PREDICTED: endophilin-A2-like isoform X2           258   9e-82   Setaria italica
ref|XP_004982623.1|  PREDICTED: endophilin-A2-like isoform X1           258   1e-81   Setaria italica
emb|CDP20867.1|  unnamed protein product                                258   1e-81   Coffea canephora [robusta coffee]
gb|KCW67915.1|  hypothetical protein EUGRSUZ_F01618                     257   2e-81   Eucalyptus grandis [rose gum]
ref|XP_008681397.1|  PREDICTED: hypothetical protein isoform X2         258   2e-81   
ref|XP_004243144.1|  PREDICTED: src substrate cortactin-like            257   3e-81   Solanum lycopersicum
emb|CDY17473.1|  BnaC03g65900D                                          257   3e-81   Brassica napus [oilseed rape]
ref|XP_009609368.1|  PREDICTED: intersectin-1-like isoform X2           257   3e-81   Nicotiana tomentosiformis
ref|XP_009609367.1|  PREDICTED: intersectin-1-like isoform X1           257   4e-81   Nicotiana tomentosiformis
ref|XP_010061017.1|  PREDICTED: intersectin-1-like                      257   4e-81   Eucalyptus grandis [rose gum]
ref|XP_010446423.1|  PREDICTED: endophilin-A3                           256   6e-81   Camelina sativa [gold-of-pleasure]
dbj|BAJ89635.1|  predicted protein                                      256   7e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX76295.1|  BnaA08g11050D                                          256   9e-81   
ref|XP_009108717.1|  PREDICTED: endophilin-A2-like                      255   2e-80   Brassica rapa
ref|XP_011074634.1|  PREDICTED: src substrate cortactin-like            254   6e-80   Sesamum indicum [beniseed]
ref|XP_008681396.1|  PREDICTED: hypothetical protein isoform X1         256   7e-80   
emb|CDP07443.1|  unnamed protein product                                253   8e-80   Coffea canephora [robusta coffee]
ref|XP_009109509.1|  PREDICTED: intersectin-1                           253   1e-79   Brassica rapa
ref|XP_010647675.1|  PREDICTED: endophilin-A3 isoform X2                253   2e-79   Vitis vinifera
emb|CDX90304.1|  BnaA08g16800D                                          254   3e-79   
ref|XP_009411494.1|  PREDICTED: src substrate cortactin-like            251   6e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010906310.1|  PREDICTED: uncharacterized protein LOC105033...    250   6e-79   Elaeis guineensis
ref|XP_011092842.1|  PREDICTED: endophilin-A2-like                      250   1e-78   Sesamum indicum [beniseed]
emb|CDY12115.1|  BnaC03g60310D                                          252   2e-78   Brassica napus [oilseed rape]
ref|XP_010906309.1|  PREDICTED: endophilin-A1-like isoform X2           249   3e-78   Elaeis guineensis
ref|XP_002448249.1|  hypothetical protein SORBIDRAFT_06g023950          246   3e-77   
ref|XP_008366753.1|  PREDICTED: uncharacterized protein LOC103430393    238   2e-76   
ref|XP_010437002.1|  PREDICTED: intersectin-1-like                      244   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_008652384.1|  PREDICTED: uncharacterized protein LOC100191...    245   3e-76   Zea mays [maize]
ref|XP_006652590.1|  PREDICTED: intersectin-1-like                      244   4e-76   Oryza brachyantha
ref|XP_008663421.1|  PREDICTED: LOW QUALITY PROTEIN: endophilin-A...    243   7e-76   
ref|XP_004976396.1|  PREDICTED: endophilin-A2-like isoform X7           243   9e-76   Setaria italica
ref|XP_004976395.1|  PREDICTED: endophilin-A2-like isoform X6           243   1e-75   
ref|NP_001190913.1|  SH3 domain-containing protein                      241   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976392.1|  PREDICTED: endophilin-A2-like isoform X3           243   2e-75   
ref|XP_004976394.1|  PREDICTED: endophilin-A2-like isoform X5           243   2e-75   
ref|XP_008347090.1|  PREDICTED: uncharacterized protein LOC103410106    239   3e-75   
ref|XP_004976393.1|  PREDICTED: endophilin-A2-like isoform X4           243   3e-75   
ref|XP_003580243.1|  PREDICTED: endophilin-A2-like                      241   3e-75   Brachypodium distachyon [annual false brome]
ref|XP_004976390.1|  PREDICTED: endophilin-A2-like isoform X1           243   4e-75   
gb|ABR16031.1|  unknown                                                 241   4e-75   Picea sitchensis
ref|XP_004976391.1|  PREDICTED: endophilin-A2-like isoform X2           243   5e-75   
dbj|BAJ88132.1|  predicted protein                                      241   7e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001141834.1|  uncharacterized protein LOC100273976               240   1e-74   Zea mays [maize]
ref|XP_004291816.1|  PREDICTED: src substrate cortactin-like            238   5e-74   Fragaria vesca subsp. vesca
gb|EMT16700.1|  hypothetical protein F775_32426                         239   7e-74   
ref|XP_008221323.1|  PREDICTED: intersectin-1-like                      238   7e-74   
ref|XP_010105278.1|  hypothetical protein L484_019422                   237   1e-73   
emb|CAE02784.2|  OSJNBa0011L07.8                                        238   1e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007225776.1|  hypothetical protein PRUPE_ppa007451mg             237   1e-73   Prunus persica
ref|XP_009337703.1|  PREDICTED: uncharacterized protein LOC103930131    236   4e-73   
ref|XP_009382718.1|  PREDICTED: endophilin-A3-like isoform X2           234   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382717.1|  PREDICTED: endophilin-A3-like isoform X1           235   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010906308.1|  PREDICTED: endophilin-A1-like isoform X1           236   1e-72   Elaeis guineensis
ref|XP_009335566.1|  PREDICTED: endophilin-A1-like                      234   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_007135931.1|  hypothetical protein PHAVU_009G004000g             233   3e-72   Phaseolus vulgaris [French bean]
ref|XP_008350497.1|  PREDICTED: uncharacterized protein LOC103413834    234   4e-72   
ref|XP_010647674.1|  PREDICTED: endophilin-A3 isoform X1                232   4e-71   Vitis vinifera
ref|XP_010028641.1|  PREDICTED: uncharacterized protein LOC104418872    228   5e-71   
ref|XP_006412199.1|  hypothetical protein EUTSA_v10025594mg             229   1e-70   
tpg|DAA49323.1|  TPA: hypothetical protein ZEAMMB73_082862              228   2e-70   
ref|XP_006423446.1|  hypothetical protein CICLE_v10029446mg             218   6e-69   
gb|KDO43878.1|  hypothetical protein CISIN_1g0166992mg                  216   4e-68   Citrus sinensis [apfelsine]
ref|XP_010471129.1|  PREDICTED: uncharacterized protein LOC104750968    214   2e-66   
gb|EMS57971.1|  Nostrin                                                 218   3e-66   Triticum urartu
gb|EYU36758.1|  hypothetical protein MIMGU_mgv1a009270mg                214   1e-64   Erythranthe guttata [common monkey flower]
gb|AFW59009.1|  hypothetical protein ZEAMMB73_187444                    213   6e-64   
ref|XP_002971082.1|  hypothetical protein SELMODRAFT_94776              210   6e-63   
ref|XP_002962005.1|  hypothetical protein SELMODRAFT_164821             210   6e-63   
ref|XP_001758759.1|  predicted protein                                  206   2e-61   
gb|ABR18100.1|  unknown                                                 199   1e-58   Picea sitchensis
ref|XP_010244214.1|  PREDICTED: uncharacterized protein LOC104588...    196   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_001775866.1|  predicted protein                                  192   4e-56   
ref|XP_008347383.1|  PREDICTED: uncharacterized protein LOC103410459    184   5e-56   
ref|XP_002960199.1|  hypothetical protein SELMODRAFT_163731             192   1e-55   
ref|XP_002967508.1|  hypothetical protein SELMODRAFT_169133             192   1e-55   
ref|XP_007131766.1|  hypothetical protein PHAVU_011G040000g             189   4e-55   Phaseolus vulgaris [French bean]
ref|XP_001774854.1|  predicted protein                                  184   8e-53   
ref|XP_006849407.1|  hypothetical protein AMTR_s00160p00065370          182   1e-52   
ref|XP_009626330.1|  PREDICTED: uncharacterized protein LOC104117...    182   4e-52   Nicotiana tomentosiformis
ref|XP_009793728.1|  PREDICTED: endophilin-A2-like isoform X1           181   1e-51   Nicotiana sylvestris
ref|XP_010273384.1|  PREDICTED: endophilin-A1                           180   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_007040922.1|  Intersectin-2                                      179   4e-51   Theobroma cacao [chocolate]
ref|XP_006365386.1|  PREDICTED: endophilin-A-like isoform X1            179   4e-51   Solanum tuberosum [potatoes]
ref|XP_004246038.1|  PREDICTED: endophilin-A-like                       179   5e-51   Solanum lycopersicum
ref|XP_010933056.1|  PREDICTED: intersectin-2-like isoform X2           179   1e-50   Elaeis guineensis
gb|KJB60142.1|  hypothetical protein B456_009G291600                    174   3e-50   Gossypium raimondii
ref|XP_010933055.1|  PREDICTED: intersectin-2-like isoform X1           179   5e-50   Elaeis guineensis
gb|KJB60143.1|  hypothetical protein B456_009G291600                    174   6e-50   Gossypium raimondii
ref|XP_001777056.1|  predicted protein                                  175   1e-49   
ref|XP_008802987.1|  PREDICTED: uncharacterized protein LOC103716668    178   1e-49   Phoenix dactylifera
gb|KJB60141.1|  hypothetical protein B456_009G291600                    174   1e-49   Gossypium raimondii
ref|XP_010518975.1|  PREDICTED: endophilin-A-like                       175   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_006854237.1|  hypothetical protein AMTR_s00048p00229110          174   2e-49   Amborella trichopoda
ref|XP_009352104.1|  PREDICTED: src substrate protein p85-like          174   2e-49   Pyrus x bretschneideri [bai li]
ref|XP_008371553.1|  PREDICTED: src substrate protein p85               174   2e-49   Malus domestica [apple tree]
ref|XP_011005826.1|  PREDICTED: intersectin-1 isoform X2                174   3e-49   Populus euphratica
gb|KJB60138.1|  hypothetical protein B456_009G291600                    174   4e-49   Gossypium raimondii
ref|XP_009402970.1|  PREDICTED: intersectin-1-like isoform X1           176   7e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010540699.1|  PREDICTED: endophilin-A-like                       174   7e-49   Tarenaya hassleriana [spider flower]
ref|XP_010929403.1|  PREDICTED: uncharacterized protein LOC105050...    172   8e-49   Elaeis guineensis
ref|XP_011005824.1|  PREDICTED: intersectin-1 isoform X1                172   9e-49   Populus euphratica
ref|XP_010929395.1|  PREDICTED: nostrin isoform X1                      172   1e-48   Elaeis guineensis
gb|ACF88110.1|  unknown                                                 172   1e-48   Zea mays [maize]
gb|KCW72749.1|  hypothetical protein EUGRSUZ_E01201                     172   1e-48   Eucalyptus grandis [rose gum]
ref|XP_010113014.1|  Myosin heavy chain IB                              174   2e-48   
ref|XP_004512443.1|  PREDICTED: uncharacterized protein LOC101499228    174   2e-48   
ref|XP_009360818.1|  PREDICTED: src substrate protein p85-like          171   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_010056148.1|  PREDICTED: endophilin-A3 isoform X1                172   3e-48   Eucalyptus grandis [rose gum]
ref|XP_008373493.1|  PREDICTED: nostrin                                 171   3e-48   Malus domestica [apple tree]
ref|XP_007158110.1|  hypothetical protein PHAVU_002G125000g             171   5e-48   Phaseolus vulgaris [French bean]
ref|XP_008349180.1|  PREDICTED: src substrate protein p85-like          171   5e-48   
gb|KDP21190.1|  hypothetical protein JCGZ_21661                         171   6e-48   Jatropha curcas
ref|XP_002519756.1|  vav3, putative                                     170   6e-48   Ricinus communis
ref|XP_007211515.1|  hypothetical protein PRUPE_ppa008017mg             170   7e-48   Prunus persica
ref|XP_010644764.1|  PREDICTED: uncharacterized protein LOC100249...    169   7e-48   Vitis vinifera
ref|XP_008789814.1|  PREDICTED: src substrate protein p85               170   8e-48   Phoenix dactylifera
ref|XP_006369865.1|  SH3 domain-containing protein 3                    170   1e-47   
ref|XP_008225382.1|  PREDICTED: src substrate protein p85 isoform X1    169   2e-47   Prunus mume [ume]
ref|XP_010460973.1|  PREDICTED: intersectin-2-like                      171   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010499689.1|  PREDICTED: intersectin-2-like                      171   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006415327.1|  hypothetical protein EUTSA_v10007690mg             171   2e-47   Eutrema salsugineum [saltwater cress]
ref|NP_174429.1|  SH3 domain-containing protein                         171   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002267588.1|  PREDICTED: endophilin-A isoform X1                 169   2e-47   Vitis vinifera
ref|XP_002272365.1|  PREDICTED: src substrate cortactin                 169   2e-47   Vitis vinifera
ref|XP_008225384.1|  PREDICTED: src substrate protein p85 isoform X2    169   2e-47   
ref|XP_010478895.1|  PREDICTED: intersectin-2                           171   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006307311.1|  hypothetical protein CARUB_v10008931mg             171   3e-47   
ref|NP_001242725.1|  uncharacterized protein LOC100802256               168   4e-47   Glycine max [soybeans]
ref|XP_006307312.1|  hypothetical protein CARUB_v10008931mg             171   5e-47   
ref|XP_004293651.1|  PREDICTED: src substrate cortactin-like            168   5e-47   Fragaria vesca subsp. vesca
emb|CDY12418.1|  BnaC08g09070D                                          170   6e-47   Brassica napus [oilseed rape]
ref|XP_008238032.1|  PREDICTED: nostrin-like                            168   6e-47   Prunus mume [ume]
gb|EYU37462.1|  hypothetical protein MIMGU_mgv1a008673mg                168   9e-47   Erythranthe guttata [common monkey flower]
ref|XP_004309886.1|  PREDICTED: src substrate cortactin-like            167   1e-46   Fragaria vesca subsp. vesca
ref|XP_002462913.1|  hypothetical protein SORBIDRAFT_02g034310          167   2e-46   Sorghum bicolor [broomcorn]
ref|XP_007209300.1|  hypothetical protein PRUPE_ppa007834mg             167   2e-46   Prunus persica
ref|NP_001049658.1|  Os03g0266700                                       167   2e-46   
ref|XP_004984671.1|  PREDICTED: intersectin-1-like                      167   2e-46   Setaria italica
ref|XP_007159517.1|  hypothetical protein PHAVU_002G244100g             166   2e-46   Phaseolus vulgaris [French bean]
tpg|DAA40947.1|  TPA: hypothetical protein ZEAMMB73_945312              166   2e-46   
ref|XP_009108117.1|  PREDICTED: intersectin-1                           168   2e-46   Brassica rapa
ref|XP_003531274.1|  PREDICTED: intersectin-2-like                      166   2e-46   Glycine max [soybeans]
ref|XP_006573487.1|  PREDICTED: uncharacterized protein LOC100816554    166   3e-46   Glycine max [soybeans]
ref|XP_002891145.1|  SH3 domain-containing protein 1                    168   3e-46   Arabidopsis lyrata subsp. lyrata
gb|AAP06881.1|  unknown protein                                         168   4e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002316744.1|  SH3 domain-containing protein 3                    166   5e-46   Populus trichocarpa [western balsam poplar]
gb|ACG32776.1|  clathrin binding protein                                165   5e-46   Zea mays [maize]
gb|KHG30793.1|  Rho guanine nucleotide exchange factor 6                166   5e-46   Gossypium arboreum [tree cotton]
ref|XP_002468124.1|  hypothetical protein SORBIDRAFT_01g040020          166   5e-46   
ref|XP_006649811.1|  PREDICTED: intersectin-1-like                      166   6e-46   Oryza brachyantha
gb|KJB66901.1|  hypothetical protein B456_010G163900                    165   7e-46   Gossypium raimondii
ref|XP_010559274.1|  PREDICTED: nostrin isoform X1                      165   8e-46   Tarenaya hassleriana [spider flower]
ref|XP_003534329.1|  PREDICTED: endophilin-A3-like isoform X1           165   9e-46   Glycine max [soybeans]
ref|XP_011096472.1|  PREDICTED: src substrate protein p85               164   1e-45   Sesamum indicum [beniseed]
ref|NP_001150587.1|  clathrin binding protein                           164   1e-45   Zea mays [maize]
ref|XP_011465301.1|  PREDICTED: nostrin isoform X2                      165   1e-45   Fragaria vesca subsp. vesca
gb|KEH27665.1|  clathrin-binding protein                                163   1e-45   Medicago truncatula
ref|XP_004504244.1|  PREDICTED: intersectin-2-like                      164   1e-45   Cicer arietinum [garbanzo]
emb|CDP19824.1|  unnamed protein product                                164   2e-45   Coffea canephora [robusta coffee]
ref|XP_004300402.1|  PREDICTED: nostrin isoform X1                      164   2e-45   Fragaria vesca subsp. vesca
gb|KHN06451.1|  Rho guanine nucleotide exchange factor 6                163   3e-45   Glycine soja [wild soybean]
ref|XP_004957812.1|  PREDICTED: src substrate cortactin-like            163   3e-45   Setaria italica
gb|KDP39730.1|  hypothetical protein JCGZ_02750                         164   3e-45   Jatropha curcas
gb|KFK28488.1|  hypothetical protein AALP_AA7G002500                    160   3e-45   Arabis alpina [alpine rockcress]
ref|XP_011082136.1|  PREDICTED: endophilin-A2 isoform X1                163   5e-45   Sesamum indicum [beniseed]
ref|XP_010942953.1|  PREDICTED: endophilin-A-like isoform X2            164   6e-45   Elaeis guineensis
ref|XP_003612558.1|  Rho guanine nucleotide exchange factor             163   6e-45   Medicago truncatula
ref|XP_008443793.1|  PREDICTED: intersectin-1                           162   6e-45   Cucumis melo [Oriental melon]
ref|XP_010244216.1|  PREDICTED: uncharacterized protein LOC104588...    162   6e-45   
ref|XP_006657745.1|  PREDICTED: src substrate cortactin-like            162   7e-45   Oryza brachyantha
ref|XP_011045329.1|  PREDICTED: endophilin-A2-like                      162   1e-44   Populus euphratica
ref|NP_001149747.1|  clathrin binding protein                           161   3e-44   Zea mays [maize]
emb|CAB53647.1|  putative protein                                       160   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011018379.1|  PREDICTED: endophilin-A2 isoform X2                160   4e-44   Populus euphratica
gb|EMT06559.1|  hypothetical protein F775_28962                         160   4e-44   
ref|XP_004161135.1|  PREDICTED: uncharacterized LOC101214418            160   5e-44   
ref|NP_193540.3|  SH3 domain-containing protein                         160   6e-44   Arabidopsis thaliana [mouse-ear cress]
gb|EYU28161.1|  hypothetical protein MIMGU_mgv1a009230mg                160   6e-44   Erythranthe guttata [common monkey flower]
ref|XP_003629889.1|  Rho guanine nucleotide exchange factor             160   6e-44   Medicago truncatula
gb|EPS68446.1|  hypothetical protein M569_06322                         160   6e-44   Genlisea aurea
ref|XP_003563046.1|  PREDICTED: intersectin-1                           160   6e-44   Brachypodium distachyon [annual false brome]
ref|XP_006355580.1|  PREDICTED: intersectin-2-like                      160   7e-44   Solanum tuberosum [potatoes]
emb|CDY01515.1|  BnaC07g35050D                                          160   8e-44   
ref|XP_011018378.1|  PREDICTED: endophilin-A3 isoform X1                160   9e-44   Populus euphratica
ref|XP_009136900.1|  PREDICTED: nostrin                                 159   1e-43   Brassica rapa
ref|XP_006368260.1|  SH3 domain-containing protein 1                    160   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_004232988.1|  PREDICTED: intersectin-1                           159   1e-43   Solanum lycopersicum
gb|KCW67914.1|  hypothetical protein EUGRSUZ_F01618                     159   1e-43   Eucalyptus grandis [rose gum]
ref|XP_002868013.1|  AT4g18060/F15J5_30                                 159   1e-43   Arabidopsis lyrata subsp. lyrata
ref|NP_001059744.1|  Os07g0508300                                       159   1e-43   
gb|EAZ04006.1|  hypothetical protein OsI_26146                          159   1e-43   
emb|CDP19879.1|  unnamed protein product                                160   1e-43   
gb|EMS46459.1|  Rho guanine nucleotide exchange factor 6                160   1e-43   
ref|XP_002519892.1|  clathrin binding protein, putative                 159   1e-43   
gb|EMT08692.1|  hypothetical protein F775_26327                         160   1e-43   
dbj|BAJ95821.1|  predicted protein                                      159   2e-43   
ref|XP_010434582.1|  PREDICTED: nostrin-like                            159   2e-43   
ref|XP_010439907.1|  PREDICTED: nostrin                                 158   2e-43   
ref|XP_006284032.1|  hypothetical protein CARUB_v10005154mg             158   2e-43   
ref|XP_009788389.1|  PREDICTED: endophilin-A3                           157   6e-43   
ref|XP_007025215.1|  SH3 domain-containing protein                      157   6e-43   
ref|XP_009610883.1|  PREDICTED: intersectin-1                           157   7e-43   
ref|XP_009416040.1|  PREDICTED: src substrate cortactin                 157   7e-43   
ref|XP_006414156.1|  hypothetical protein EUTSA_v10025600mg             157   8e-43   
gb|AFK40492.1|  unknown                                                 157   1e-42   
ref|XP_008806221.1|  PREDICTED: endophilin-A2-like isoform X2           157   1e-42   
ref|XP_010449507.1|  PREDICTED: nostrin-like                            156   1e-42   
ref|XP_003558275.1|  PREDICTED: endophilin-A-like                       157   2e-42   
gb|AAL32440.1|AF367775_1  SH3 domain-containing protein 3               155   3e-42   
gb|KDO78017.1|  hypothetical protein CISIN_1g017467mg                   154   4e-42   
dbj|BAK03874.1|  predicted protein                                      155   6e-42   
emb|CAN68081.1|  hypothetical protein VITISV_021806                     160   6e-42   
ref|XP_006467554.1|  PREDICTED: intersectin-1-like                      154   7e-42   
ref|XP_010667801.1|  PREDICTED: endophilin-A1                           154   1e-41   
ref|XP_008444263.1|  PREDICTED: uncharacterized protein LOC103487...    153   1e-41   
ref|XP_008444262.1|  PREDICTED: intersectin-1 isoform X1                153   4e-41   
ref|XP_010052118.1|  PREDICTED: LOW QUALITY PROTEIN: intersectin-1      152   6e-41   
ref|XP_004145574.1|  PREDICTED: uncharacterized protein LOC101211108    152   1e-40   
ref|XP_009626331.1|  PREDICTED: uncharacterized protein LOC104117...    150   2e-40   
ref|XP_009793729.1|  PREDICTED: endophilin-A2-like isoform X2           150   4e-40   
ref|XP_002304394.1|  SH3 domain-containing protein 1                    146   1e-38   
ref|XP_004170607.1|  PREDICTED: uncharacterized protein LOC101231286    145   4e-38   
gb|KDO78016.1|  hypothetical protein CISIN_1g017467mg                   143   3e-37   
ref|XP_001764041.1|  predicted protein                                  141   7e-37   
ref|XP_001771051.1|  predicted protein                                  141   8e-37   
ref|XP_011027998.1|  PREDICTED: uncharacterized protein LOC105128...    140   3e-36   
ref|XP_011027997.1|  PREDICTED: endophilin-A3-like isoform X1           140   4e-36   
ref|XP_010942952.1|  PREDICTED: endophilin-A-like isoform X1            138   2e-35   
ref|XP_001774026.1|  predicted protein                                  137   2e-35   
ref|XP_010559275.1|  PREDICTED: nostrin isoform X2                      134   3e-34   
gb|KHN11810.1|  Intersectin-1                                           134   3e-34   
ref|XP_008377235.1|  PREDICTED: uncharacterized protein LOC103440339    133   3e-34   
ref|XP_010677525.1|  PREDICTED: nostrin                                 134   3e-34   
ref|XP_004147428.1|  PREDICTED: uncharacterized protein LOC101214418    132   2e-33   
gb|KEH27664.1|  clathrin-binding protein                                131   3e-33   
ref|XP_001752175.1|  predicted protein                                  131   4e-33   
ref|XP_009407070.1|  PREDICTED: intersectin-2-like                      131   6e-33   
gb|KEH27662.1|  clathrin-binding protein                                131   7e-33   
gb|KEH27663.1|  clathrin-binding protein                                131   7e-33   
ref|XP_008806223.1|  PREDICTED: endophilin-A2-like isoform X4           130   1e-32   
ref|XP_008806222.1|  PREDICTED: endophilin-A2-like isoform X3           130   1e-32   
ref|XP_008806220.1|  PREDICTED: endophilin-A2-like isoform X1           131   1e-32   
ref|XP_009402973.1|  PREDICTED: intersectin-1-like isoform X2           130   3e-32   
gb|KCW75982.1|  hypothetical protein EUGRSUZ_D00347                     128   4e-32   
tpg|DAA40946.1|  TPA: hypothetical protein ZEAMMB73_945312              120   4e-31   
ref|XP_008652439.1|  PREDICTED: uncharacterized protein LOC103632380    119   5e-30   
tpg|DAA60671.1|  TPA: hypothetical protein ZEAMMB73_294275              118   2e-29   
ref|XP_006489905.1|  PREDICTED: uncharacterized protein LOC102614...    115   9e-29   
ref|XP_010056149.1|  PREDICTED: endophilin-A3 isoform X2                119   1e-28   
ref|XP_010095135.1|  hypothetical protein L484_015635                   115   2e-28   
ref|XP_006489904.1|  PREDICTED: uncharacterized protein LOC102614...    115   3e-28   
gb|KEH20702.1|  clathrin-binding protein                                110   1e-25   
ref|XP_008654185.1|  PREDICTED: uncharacterized protein LOC103634441    107   1e-24   
ref|XP_008654187.1|  PREDICTED: uncharacterized protein LOC103634443    106   5e-24   
gb|AFW68397.1|  hypothetical protein ZEAMMB73_738646                  97.8    6e-21   
gb|AFK34217.1|  unknown                                               93.6    1e-20   
gb|KDO38537.1|  hypothetical protein CISIN_1g044055mg                 90.5    2e-19   
gb|AFW80188.1|  hypothetical protein ZEAMMB73_021923                  91.7    7e-18   
gb|KJB60140.1|  hypothetical protein B456_009G291600                  85.5    8e-17   
ref|XP_006471619.1|  PREDICTED: endophilin-A1-like                    85.1    1e-16   
emb|CDY12114.1|  BnaC03g60300D                                        82.4    1e-16   
ref|XP_006489910.1|  PREDICTED: src substrate cortactin-like isof...  84.0    2e-16   
ref|XP_006489906.1|  PREDICTED: src substrate cortactin-like isof...  83.6    4e-16   
ref|XP_006489908.1|  PREDICTED: src substrate cortactin-like isof...  83.6    4e-16   
ref|XP_011082137.1|  PREDICTED: endophilin-A2 isoform X2              82.0    1e-15   
gb|KDO43887.1|  hypothetical protein CISIN_1g0166991mg                64.7    3e-10   
gb|KDO43886.1|  hypothetical protein CISIN_1g0166991mg                64.7    4e-10   
ref|XP_006489909.1|  PREDICTED: src substrate cortactin-like isof...  65.5    6e-10   
gb|KDO43885.1|  hypothetical protein CISIN_1g0166991mg                64.7    9e-10   
ref|XP_006849052.1|  hypothetical protein AMTR_s00028p00189940        63.2    1e-09   
gb|KDO43883.1|  hypothetical protein CISIN_1g0166991mg                64.7    1e-09   
gb|KDO43884.1|  hypothetical protein CISIN_1g0166991mg                64.3    1e-09   
ref|XP_011028000.1|  PREDICTED: endophilin-A3-like isoform X4         63.2    7e-09   
ref|XP_011027999.1|  PREDICTED: endophilin-A3-like isoform X3         63.2    1e-08   
ref|XP_006468248.1|  PREDICTED: uncharacterized protein LOC102612415  58.2    5e-07   
ref|NP_001140764.1|  hypothetical protein                             54.3    6e-06   
gb|AAG13502.1|AC068924_7  unknown protein                             53.9    7e-06   



>ref|XP_010690773.1| PREDICTED: endophilin-A1 [Beta vulgaris subsp. vulgaris]
Length=370

 Score =   286 bits (731),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQATRLREQVA+QQQAV KQFG G  GSD + TDE+ELHQHQKLEKLYISTRAAK
Sbjct  1    MEAIRKQATRLREQVAKQQQAVLKQFGAGGYGSDNMVTDEAELHQHQKLEKLYISTRAAK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG ENTCTSG+TLSKAA+ FSRA  QM
Sbjct  61   HFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGGENTCTSGSTLSKAAVSFSRARAQM  120

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  164



>ref|XP_009631701.1| PREDICTED: intersectin-1 [Nicotiana tomentosiformis]
Length=368

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQATRLREQVARQQQAV KQFG G  GSD V TDE+EL QH KLEKLYISTRAAK
Sbjct  1    MEAIRKQATRLREQVARQQQAVLKQFGAGGYGSDLV-TDEAELQQHHKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLSKAAL FSRA  QM
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGTTLSKAALGFSRARAQM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|XP_009802569.1| PREDICTED: hematopoietic lineage cell-specific protein [Nicotiana 
sylvestris]
Length=370

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQATRLREQVARQQQAV KQFG G  GSD V TDE+EL QH KLEKLYISTRAAK
Sbjct  1    MEAIRKQATRLREQVARQQQAVLKQFGAGGYGSDLV-TDEAELQQHHKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLSKAAL FSRA  QM
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGTTLSKAALGFSRARAQM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|XP_004150141.1| PREDICTED: uncharacterized protein LOC101205534 [Cucumis sativus]
 ref|XP_004167324.1| PREDICTED: uncharacterized protein LOC101227373 [Cucumis sativus]
 gb|KGN61846.1| hypothetical protein Csa_2G251470 [Cucumis sativus]
Length=375

 Score =   279 bits (714),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQAT+LREQVARQQQAV KQ   GG+GGSD + TDE+ELHQHQKLEKLYISTRA 
Sbjct  1    MDAIRKQATKLREQVARQQQAVLKQFGAGGYGGSDNIITDEAELHQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG+TLSKAAL + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSKAALNYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGN+LKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNMLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_006362005.1| PREDICTED: uncharacterized protein LOC102580820 [Solanum tuberosum]
Length=370

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQATRLREQVARQQQAV KQFG G  GSD V TDE+E+ QH KLE+LYISTRAAK
Sbjct  1    MEAIRKQATRLREQVARQQQAVLKQFGAGGYGSDLV-TDEAEMQQHHKLERLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLSKAAL FSRA  QM
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGTTLSKAALGFSRARAQM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|XP_004230879.1| PREDICTED: intersectin-1 [Solanum lycopersicum]
Length=368

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQATRLREQVARQQQAV KQFG G  GSD V TDE+E+ QH KLE+LYISTRAAK
Sbjct  1    MEAIRKQATRLREQVARQQQAVLKQFGAGGYGSDLV-TDEAEMQQHHKLERLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLSKAAL FSRA  QM
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGTTLSKAALGFSRARAQM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>gb|KJB32579.1| hypothetical protein B456_005G247800 [Gossypium raimondii]
Length=370

 Score =   277 bits (709),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLREQVARQQQAVFKQ   GG+GGSD V TDE EL QHQKLEKLY+STRA 
Sbjct  1    MEAIRKQATRLREQVARQQQAVFKQFGAGGYGGSDNVITDEVELQQHQKLEKLYVSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLSKAAL + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGNTLSKAALGYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_010271500.1| PREDICTED: endophilin-A1-like [Nelumbo nucifera]
Length=371

 Score =   276 bits (707),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQATRLREQVA+QQQAVFKQ  GGG+GGSD V TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MDAIRKQATRLREQVAKQQQAVFKQFGGGGYGGSDSVVTDEAELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG ENTCTSG+TLSKAAL  +RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGVENTCTSGSTLSKAALGCARARSQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLK+LGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKSLGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_006487313.1| PREDICTED: intersectin-1-like [Citrus sinensis]
Length=373

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LREQVARQQQAVFKQ  GGG+GGSD V TDE+ELHQHQ+LE+LYISTRA 
Sbjct  1    MEAIRKQATKLREQVARQQQAVFKQFGGGGYGGSDNVVTDEAELHQHQRLERLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGS+NTCTSG TLSKAAL + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSDNTCTSGNTLSKAALSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMV+GAPL+DARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVLGAPLDDARHLAQRYDRMRQE  165



>ref|XP_008461013.1| PREDICTED: intersectin-1 [Cucumis melo]
Length=375

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LREQVARQQQAV KQ   GG+GGSD + TDE+ELHQHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATKLREQVARQQQAVLKQFGAGGYGGSDNIITDEAELHQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLSKAAL + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGNTLSKAALNYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGN+LKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNMLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_010109769.1| hypothetical protein L484_008445 [Morus notabilis]
 gb|EXC24674.1| hypothetical protein L484_008445 [Morus notabilis]
Length=371

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLREQVARQQQAV KQ   GG+GGSD + TDE+ELHQHQ+LEKLYISTRA 
Sbjct  1    MEAIRKQATRLREQVARQQQAVLKQFGAGGYGGSDNLVTDEAELHQHQRLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCTSG TL++AAL + RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTSGGTLTRAALSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>gb|KDP41725.1| hypothetical protein JCGZ_26743 [Jatropha curcas]
Length=371

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LREQVA+QQQAV KQ   GG+GGSD V TDE+ELHQHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATKLREQVAKQQQAVLKQFGAGGYGGSDNVITDEAELHQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLSKAAL + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGNTLSKAALNYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLR+MVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRSMVMGAPLEDARHLAQRYDRMRQE  165



>gb|ACJ84520.1| unknown [Medicago truncatula]
Length=196

 Score =   269 bits (687),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++LREQVARQQQAV KQ   GG+GGSD + TDE EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQASKLREQVARQQQAVLKQFGAGGYGGSDNMVTDEVELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCTSG+TLS+AAL ++ A  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTSGSTLSRAALNYAHARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQ+
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQD  165



>ref|XP_010263867.1| PREDICTED: endophilin-A1-like isoform X1 [Nelumbo nucifera]
Length=371

 Score =   275 bits (702),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQATRLREQVA+QQQAVFKQFGGG+GGSD + TDE+EL QHQKLEKLYISTRA K
Sbjct  1    MEAIRKQATRLREQVAKQQQAVFKQFGGGYGGSDNIVTDEAELQQHQKLEKLYISTRAGK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLS++SRKYG+EN CTSG+TLSKAAL + RA  Q+
Sbjct  61   HFQRDIVRGVEGYIVTGSKQVEIGTKLSDDSRKYGAENNCTSGSTLSKAALSYGRARAQI  120

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGA LEDARHLAQRYDRMRQE
Sbjct  121  EKERGNLLKALGTQVAEPLRAMVMGAALEDARHLAQRYDRMRQE  164



>gb|KHG07438.1| SH3 domain-containing 21 [Gossypium arboreum]
Length=398

 Score =   275 bits (704),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLREQVARQQQAVFKQ   GG+GGSD V TDE EL QHQKLEKLY+STRA 
Sbjct  1    MEAIRKQATRLREQVARQQQAVFKQFGAGGYGGSDNVITDEVELQQHQKLEKLYVSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLS++SRKYG+ENTCTSG TLSKAAL + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLSDDSRKYGAENTCTSGNTLSKAALGYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_007042046.1| SH3 domain-containing protein [Theobroma cacao]
 gb|EOX97877.1| SH3 domain-containing protein [Theobroma cacao]
Length=370

 Score =   274 bits (701),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLREQVARQQQAV KQ   GG+GGSD + TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATRLREQVARQQQAVLKQFGAGGYGGSDNLVTDEAELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLSKAAL + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGNTLSKAALGYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_010263868.1| PREDICTED: endophilin-A2-like isoform X2 [Nelumbo nucifera]
Length=370

 Score =   274 bits (701),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQATRLREQVA+QQQAVFKQFGGG+GGSD + TDE+EL QHQKLEKLYISTRA K
Sbjct  1    MEAIRKQATRLREQVAKQQQAVFKQFGGGYGGSDNIVTDEAELQQHQKLEKLYISTRAGK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLS++SRKYG+EN CTSG+TLSKAAL + RA  Q+
Sbjct  61   HFQRDIVRGVEGYIVTGSKQVEIGTKLSDDSRKYGAENNCTSGSTLSKAALSYGRARAQI  120

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGA LEDARHLAQRYDRMRQE
Sbjct  121  EKERGNLLKALGTQVAEPLRAMVMGAALEDARHLAQRYDRMRQE  164



>ref|XP_008796880.1| PREDICTED: endophilin-A2-like [Phoenix dactylifera]
Length=371

 Score =   274 bits (701),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfg-gSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLREQVARQQQAV KQFG      SD V TDE+EL QHQKLEKLYISTRAA
Sbjct  1    MEAIRKQATRLREQVARQQQAVLKQFGASGHGSSDSVITDEAELQQHQKLEKLYISTRAA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG ENTCTSG TLSKAA+ +SRA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGNKLSEDSRKYGVENTCTSGNTLSKAAISYSRARSQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKERGNLLKA GTQVAEPLRAMVMGAPLEDARHLAQRYD+MRQE
Sbjct  121  IEKERGNLLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDKMRQE  165



>ref|XP_010531469.1| PREDICTED: endophilin-A3 [Tarenaya hassleriana]
Length=371

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQAT+LREQVARQQQAV +Q   GG+GGSD V TDE+EL QH KLEKLYISTRAA
Sbjct  1    MDAIRKQATKLREQVARQQQAVLRQFGAGGYGGSDTVITDEAELQQHHKLEKLYISTRAA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCTS  TL++A+L FSRA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTSSTTLTRASLNFSRAQAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_011088479.1| PREDICTED: hematopoietic lineage cell-specific protein-like [Sesamum 
indicum]
Length=366

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 148/164 (90%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA+RLREQVARQQQAV KQF GG   SD V  D++EL QHQKLEKLYISTRAAK
Sbjct  1    MEAIRKQASRLREQVARQQQAVLKQFYGG---SDSVVADDAELQQHQKLEKLYISTRAAK  57

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG ENTCTSG TLSKAA  F+RA  QM
Sbjct  58   HFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGVENTCTSGNTLSKAATNFARARAQM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  118  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  161



>ref|XP_009378426.1| PREDICTED: uncharacterized protein LOC103966925 isoform X3 [Pyrus 
x bretschneideri]
Length=346

 Score =   271 bits (694),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLREQVARQQQAV KQ   GG+GGSD + TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATRLREQVARQQQAVLKQFGAGGYGGSDNLVTDEAELVQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG+TLS+A+L + RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSRASLSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_002313015.1| SH3 domain-containing protein 2 [Populus trichocarpa]
 gb|EEE86970.1| SH3 domain-containing protein 2 [Populus trichocarpa]
Length=371

 Score =   272 bits (696),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LREQVA+QQQAV KQ  GGG+GGSD + TDE+ELHQHQKLE+LYISTRA 
Sbjct  1    MEAIRKQATKLREQVAKQQQAVLKQFGGGGYGGSDTLVTDEAELHQHQKLERLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+K SE+SRKYG+ENTCTSG TLSKAA+ + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKFSEDSRKYGAENTCTSGNTLSKAAVNYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_010933758.1| PREDICTED: endophilin-A2-like [Elaeis guineensis]
Length=371

 Score =   272 bits (696),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfg-gSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQATRLREQVARQQQAV KQFG G    SD V TDE+EL QHQKLEKLYISTRAA
Sbjct  1    MDAIRKQATRLREQVARQQQAVLKQFGAGGHGSSDSVITDEAELQQHQKLEKLYISTRAA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG E+TCTSG TLSKAA+ +SRA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGNKLSEDSRKYGVEHTCTSGNTLSKAAISYSRARSQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE GNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYD+MRQE
Sbjct  121  IEKEHGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDKMRQE  165



>ref|XP_007199921.1| hypothetical protein PRUPE_ppa007358mg [Prunus persica]
 gb|EMJ01120.1| hypothetical protein PRUPE_ppa007358mg [Prunus persica]
Length=371

 Score =   272 bits (695),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQATRLREQVARQQQAV KQ   GG+GGSD + TDE+EL QHQKLE+LYISTRA 
Sbjct  1    MDAIRKQATRLREQVARQQQAVLKQFGAGGYGGSDNLVTDEAELLQHQKLERLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG+TLS+A+L + RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSRASLSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_009378425.1| PREDICTED: uncharacterized protein LOC103966925 isoform X2 [Pyrus 
x bretschneideri]
Length=347

 Score =   271 bits (693),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLREQVARQQQAV KQ   GG+GGSD + TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATRLREQVARQQQAVLKQFGAGGYGGSDNLVTDEAELVQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG+TLS+A+L + RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSRASLSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_008236987.1| PREDICTED: src substrate cortactin [Prunus mume]
Length=371

 Score =   272 bits (695),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQATRLREQVARQQQAV KQ   GG+GGSD + TDE+EL QHQKLE+LYISTRA 
Sbjct  1    MDAIRKQATRLREQVARQQQAVLKQFGAGGYGGSDNLVTDEAELLQHQKLERLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG+TLS+A+L + RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSRASLSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_011047486.1| PREDICTED: endophilin-A1 [Populus euphratica]
Length=371

 Score =   272 bits (695),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LREQVA+QQQAV KQ   GG+GGSD + TDE+ELHQHQKLE+LYISTRA 
Sbjct  1    MEAIRKQATKLREQVAKQQQAVLKQFGAGGYGGSDTLVTDEAELHQHQKLERLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+K SE+SRKYG+ENTCTSG TLSKAA+ + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKFSEDSRKYGAENTCTSGNTLSKAAVNYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_009378424.1| PREDICTED: endophilin-A2-like isoform X1 [Pyrus x bretschneideri]
Length=371

 Score =   271 bits (694),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLREQVARQQQAV KQ   GG+GGSD + TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATRLREQVARQQQAVLKQFGAGGYGGSDNLVTDEAELVQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG+TLS+A+L + RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSRASLSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_009376516.1| PREDICTED: uncharacterized protein LOC103965220 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009376517.1| PREDICTED: uncharacterized protein LOC103965220 isoform X3 [Pyrus 
x bretschneideri]
Length=298

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLR+QVARQQQAV KQ   GG+GGSD   TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATRLRDQVARQQQAVLKQFGAGGYGGSDSFVTDEAELGQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG+TLS+A+L + RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSRASLSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAM+MGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMIMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_002512983.1| clathrin binding protein, putative [Ricinus communis]
 gb|EEF49486.1| clathrin binding protein, putative [Ricinus communis]
Length=371

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LREQVARQQQAV KQ    G+GG+D V TDE+ELHQHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATKLREQVARQQQAVLKQFGASGYGGADGVITDEAELHQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTG+KQVEIG+KLSE+ RKYG+ENTCTSG TLSKAAL + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGAKQVEIGTKLSEDCRKYGAENTCTSGNTLSKAALNYERARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMG PLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGTPLEDARHLAQRYDRMRQE  165



>ref|XP_009376515.1| PREDICTED: uncharacterized protein LOC103965220 isoform X2 [Pyrus 
x bretschneideri]
Length=346

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLR+QVARQQQAV KQ   GG+GGSD   TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATRLRDQVARQQQAVLKQFGAGGYGGSDSFVTDEAELGQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG+TLS+A+L + RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSRASLSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAM+MGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMIMGAPLEDARHLAQRYDRMRQE  165



>gb|KFK30100.1| hypothetical protein AALP_AA7G216900 [Arabis alpina]
Length=368

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 151/164 (92%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+RLREQVARQQQAVFKQFGGG  GS    +D++ELHQHQKLEKLYISTRAAK
Sbjct  1    MDAIRKQASRLREQVARQQQAVFKQFGGGGYGSGL--SDDAELHQHQKLEKLYISTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCT+G  L++AAL + RA  QM
Sbjct  59   HFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALSYGRARAQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  162



>ref|XP_009376514.1| PREDICTED: endophilin-A3-like isoform X1 [Pyrus x bretschneideri]
Length=371

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLR+QVARQQQAV KQ   GG+GGSD   TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATRLRDQVARQQQAVLKQFGAGGYGGSDSFVTDEAELGQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG+TLS+A+L + RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSRASLSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAM+MGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMIMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_009384539.1| PREDICTED: endophilin-A1-like [Musa acuminata subsp. malaccensis]
Length=371

 Score =   270 bits (690),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 146/165 (88%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++LREQVARQQQAVFKQ  G  +GGSD V TD  E  QHQKLEKLYISTRAA
Sbjct  1    MEAIRKQASKLREQVARQQQAVFKQFGGSVYGGSDNVITDSPEYQQHQKLEKLYISTRAA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQ+EIG+KLSE+SRKYG ENTCTSG TLSK AL F RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQIEIGNKLSEDSRKYGGENTCTSGNTLSKGALSFGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            ME ERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQ+
Sbjct  121  MENERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQD  165



>gb|KHG01755.1| Nostrin [Gossypium arboreum]
Length=370

 Score =   270 bits (689),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA+R REQVARQQQAV KQFG G  G SD + TDE+EL QHQKLEKLYISTR A
Sbjct  1    MEAIRKQASRFREQVARQQQAVLKQFGAGGYGGSDNLITDEAELQQHQKLEKLYISTRTA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YI+TGSKQVEIG+KLSE+S+KYGSENTCTSG TLSKAAL F RA   
Sbjct  61   KHFQRDIVRGVEGYIITGSKQVEIGTKLSEDSKKYGSENTCTSGNTLSKAALSFGRARAH  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMG+PLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGSPLEDARHLAQRYDRMRQE  165



>ref|XP_010919378.1| PREDICTED: endophilin-A2-like isoform X2 [Elaeis guineensis]
Length=371

 Score =   270 bits (689),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfg-gSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT LREQVARQQQAV KQFG G    SD V TDE E  QHQKLEKLYISTRAA
Sbjct  1    MEAIRKQATWLREQVARQQQAVLKQFGAGGYGSSDSVITDEVEFQQHQKLEKLYISTRAA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YI+TGSKQVEIG+KLSE+SRKYG ENTCTSG TLSKAAL +SRA  Q
Sbjct  61   KHFQRDIVRGVEGYIITGSKQVEIGNKLSEDSRKYGVENTCTSGNTLSKAALSYSRACSQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKERGNLLK LGTQVAEPLRAMVMGAPLEDARH AQRYDRMRQE
Sbjct  121  IEKERGNLLKVLGTQVAEPLRAMVMGAPLEDARHFAQRYDRMRQE  165



>ref|XP_002306133.1| SH3 domain-containing protein 2 [Populus trichocarpa]
 gb|EEE86644.1| SH3 domain-containing protein 2 [Populus trichocarpa]
Length=372

 Score =   269 bits (688),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LREQVA+QQQAV KQ   GG+GGSD V TDE+ELHQHQKLE+LYISTRA 
Sbjct  1    MEAIRKQATKLREQVAKQQQAVLKQFGAGGYGGSDTVITDEAELHQHQKLERLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRD+VRGVE YIVTGSKQVEIG++ SE+SRKYG+ENTCTSG TLSKAA+ ++ A  Q
Sbjct  61   KHFQRDVVRGVEGYIVTGSKQVEIGTRFSEDSRKYGAENTCTSGNTLSKAAVNYANARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_006411698.1| hypothetical protein EUTSA_v10025489mg [Eutrema salsugineum]
 gb|ESQ53151.1| hypothetical protein EUTSA_v10025489mg [Eutrema salsugineum]
Length=374

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LREQVARQQQAV +Q  GGG+GGSD V TDE ELH+HQKLEKLYISTR+A
Sbjct  1    MEAIRKQATKLREQVARQQQAVLRQFGGGGYGGSDTVITDEEELHRHQKLEKLYISTRSA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KL ++SRK+GSENTCTSG TL++A+L F+ A  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLCDDSRKFGSENTCTSGNTLTRASLSFASARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>gb|ADD09605.1| SH3 domain-containing protein [Trifolium repens]
Length=379

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++LREQVARQQQAV KQ   GG+GGSD + TDE+EL QHQKLEKLYISTRAA
Sbjct  1    MEAIRKQASKLREQVARQQQAVLKQFGAGGYGGSDNMVTDEAELQQHQKLEKLYISTRAA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIV GSKQVEIG+KLSE+SRKYG+ENTCTSG+TLS+AAL ++RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVNGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSRAALNYARARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQ+
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQD  165



>ref|XP_009110394.1| PREDICTED: src substrate protein p85 [Brassica rapa]
 emb|CDX75452.1| BnaA01g02500D [Brassica napus]
Length=369

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 150/164 (91%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+RLREQVARQQQAVFKQFGGG  GS    +D +ELHQHQKLEKLYISTRAAK
Sbjct  1    MDAIRKQASRLREQVARQQQAVFKQFGGGGHGSGL--SDNAELHQHQKLEKLYISTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCT+G  L++AAL + RA  QM
Sbjct  59   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALSYGRARAQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLRAMVMGAPLEDARHLAQRYDR+RQE
Sbjct  119  EKERGNMLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRIRQE  162



>ref|NP_001190914.1| SH3 domain-containing protein [Arabidopsis thaliana]
 gb|AEE86407.1| SH3 domain-containing protein [Arabidopsis thaliana]
Length=317

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 150/164 (91%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+RLREQVARQQQAVFKQFGGG  GS     DE+EL+QHQKLEKLYISTRAAK
Sbjct  1    MDAIRKQASRLREQVARQQQAVFKQFGGGGYGSGL--ADEAELNQHQKLEKLYISTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCT+G  L++AAL + RA  QM
Sbjct  59   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALNYGRARAQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  162



>emb|CDX69077.1| BnaC01g03760D [Brassica napus]
Length=369

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 150/164 (91%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+RLREQVARQQQAVFKQFGGG  GS    +D +ELHQHQKLEKLYISTRAAK
Sbjct  1    MDAIRKQASRLREQVARQQQAVFKQFGGGGHGSGL--SDNAELHQHQKLEKLYISTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCT+G  L++AAL + RA  QM
Sbjct  59   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALSYGRARAQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLRAMVMGAPLEDARHLAQRYDR+RQE
Sbjct  119  EKERGNMLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRIRQE  162



>gb|KEH30468.1| clathrin-binding protein, putative [Medicago truncatula]
Length=356

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVARQQQAV KQ  GGG+GGSD + TDE ELH HQKLEKLYISTRA 
Sbjct  1    MDAIRKQASKLREQVARQQQAVLKQFGGGGYGGSDNMVTDERELHLHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRD+VRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TL +AAL +SRA  Q
Sbjct  61   KHYQRDVVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGGTLCRAALSYSRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQ+
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRMRQD  165



>ref|XP_008791647.1| PREDICTED: endophilin-A3-like [Phoenix dactylifera]
Length=371

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfg-gSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT LREQVARQQQAV KQFG G    SD V  DE+EL QHQKLEKLYISTRAA
Sbjct  1    MEAIRKQATWLREQVARQQQAVLKQFGAGGYGSSDGVIADETELQQHQKLEKLYISTRAA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YI+TGSKQVEIG+KLS++SRKYG ENTCTSG TLSKAAL +SRA  Q
Sbjct  61   KHFQRDIVRGVEGYIITGSKQVEIGNKLSDDSRKYGVENTCTSGNTLSKAALSYSRARSQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKERGNLLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDR+RQE
Sbjct  121  IEKERGNLLKALGTQVAEPLRAMVIGAPLEDARHLAQRYDRIRQE  165



>ref|XP_010919377.1| PREDICTED: endophilin-A2-like isoform X1 [Elaeis guineensis]
Length=401

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfg-gSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT LREQVARQQQAV KQFG G    SD V TDE E  QHQKLEKLYISTRAA
Sbjct  1    MEAIRKQATWLREQVARQQQAVLKQFGAGGYGSSDSVITDEVEFQQHQKLEKLYISTRAA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YI+TGSKQVEIG+KLSE+SRKYG ENTCTSG TLSKAAL +SRA  Q
Sbjct  61   KHFQRDIVRGVEGYIITGSKQVEIGNKLSEDSRKYGVENTCTSGNTLSKAALSYSRACSQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKERGNLLK LGTQVAEPLRAMVMGAPLEDARH AQRYDRMRQE
Sbjct  121  IEKERGNLLKVLGTQVAEPLRAMVMGAPLEDARHFAQRYDRMRQE  165



>ref|XP_003607042.1| Rho guanine nucleotide exchange factor [Medicago truncatula]
 gb|AES89239.1| clathrin-binding protein, putative [Medicago truncatula]
Length=372

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVARQQQAV KQ  GGG+GGSD + TDE ELH HQKLEKLYISTRA 
Sbjct  1    MDAIRKQASKLREQVARQQQAVLKQFGGGGYGGSDNMVTDERELHLHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRD+VRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TL +AAL +SRA  Q
Sbjct  61   KHYQRDVVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGGTLCRAALSYSRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQ+
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRMRQD  165



>ref|XP_003540970.1| PREDICTED: myosin-3-like isoform 1 [Glycine max]
Length=371

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVARQQQAV KQ  GGG+GGSD V TD  EL  HQKLEKLYISTRA 
Sbjct  1    MDAIRKQASKLREQVARQQQAVLKQFGGGGYGGSDNVVTDGVELQLHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLS+AAL F+RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGNTLSRAALSFARAHAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRMRQE  165



>gb|KFK30487.1| hypothetical protein AALP_AA7G267900 [Arabis alpina]
Length=373

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++LREQVARQQQAV +Q  GGG+GG+D V TDE ELH+HQKLEKLYISTR++
Sbjct  1    MEAIRKQASKLREQVARQQQAVMRQFGGGGYGGTDTVITDEEELHRHQKLEKLYISTRSS  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KL E+SRKYGSENTCTSG TL+KA+L F+ A  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLCEDSRKYGSENTCTSGDTLTKASLSFANARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLK+LGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKSLGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>gb|KHN25423.1| Endophilin-A1 [Glycine soja]
Length=371

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVARQQQAV KQ  GGG+GGSD V TD  EL  HQKLEKLYISTRA 
Sbjct  1    MDAIRKQASKLREQVARQQQAVLKQFGGGGYGGSDNVVTDGVELQLHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLS+AAL F+RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGNTLSRAALSFARAHAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRMRQE  165



>ref|XP_006829161.1| hypothetical protein AMTR_s00001p00270050 [Amborella trichopoda]
 gb|ERM96577.1| hypothetical protein AMTR_s00001p00270050 [Amborella trichopoda]
Length=371

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQAT+LREQVA+QQQAVFKQ  GGG+GGSD V TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MDALRKQATKLREQVAKQQQAVFKQFGGGGYGGSDNVITDEAELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE +IVTGSKQVEIG+KLSE+SRKYG+EN+CTSG TL+KAAL ++R   Q
Sbjct  61   KHFQRDIVRGVEGFIVTGSKQVEIGTKLSEDSRKYGNENSCTSGGTLAKAALSYARGRAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKERGNL KALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  121  IEKERGNLHKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  165



>ref|XP_003603992.1| Neutrophil cytosol factor [Medicago truncatula]
 gb|AES74243.1| clathrin-binding protein [Medicago truncatula]
Length=371

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++LREQVARQQQAV KQ   GG+GGSD + TDE EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQASKLREQVARQQQAVLKQFGAGGYGGSDNMVTDEVELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCTSG+TLS+AAL ++ A  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTSGSTLSRAALNYAHARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQ+
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQD  165



>ref|XP_004507503.1| PREDICTED: intersectin-1-like isoform X3 [Cicer arietinum]
Length=371

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVARQQQAV KQ   GG+GGSD + TDE ELH HQ+LEKLYISTRA 
Sbjct  1    MDAIRKQASKLREQVARQQQAVLKQFGAGGYGGSDNMVTDERELHLHQRLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRD+VRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCTSG TL +AAL ++RA  Q
Sbjct  61   KHYQRDVVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTSGGTLCRAALSYARARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRMRQE  165



>emb|CAA18845.1| putative protein [Arabidopsis thaliana]
 emb|CAB80183.1| putative protein [Arabidopsis thaliana]
Length=397

 Score =   268 bits (684),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 150/164 (91%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+RLREQVARQQQAVFKQFGGG  GS     DE+EL+QHQKLEKLYISTRAAK
Sbjct  1    MDAIRKQASRLREQVARQQQAVFKQFGGGGYGSGL--ADEAELNQHQKLEKLYISTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCT+G  L++AAL + RA  QM
Sbjct  59   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALNYGRARAQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  162



>ref|XP_006283938.1| hypothetical protein CARUB_v10005057mg [Capsella rubella]
 gb|EOA16836.1| hypothetical protein CARUB_v10005057mg [Capsella rubella]
Length=377

 Score =   267 bits (683),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 151/164 (92%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+RLREQVARQQQAVFKQFGGG  GS    +DE+EL+QHQKLEKLYISTRAAK
Sbjct  1    MDAIRKQASRLREQVARQQQAVFKQFGGGGYGSGL--SDEAELNQHQKLEKLYISTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGS+NTCT+G  L++AAL + RA  QM
Sbjct  59   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSDNTCTNGNVLTRAALSYGRARAQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  162



>ref|XP_002867108.1| SH3 domain-containing protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43367.1| SH3 domain-containing protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=368

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 150/164 (91%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+RLREQVARQQQAVFKQFGGG  GS     DE+EL+QHQKLEKLYISTRAAK
Sbjct  1    MDAIRKQASRLREQVARQQQAVFKQFGGGGYGSGLA--DEAELNQHQKLEKLYISTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCT+G  L++AAL + RA  QM
Sbjct  59   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALNYGRARAQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  162



>ref|XP_004507501.1| PREDICTED: intersectin-1-like isoform X1 [Cicer arietinum]
 ref|XP_004507502.1| PREDICTED: intersectin-1-like isoform X2 [Cicer arietinum]
Length=372

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVARQQQAV KQFG G  G SD + TDE ELH HQ+LEKLYISTRA 
Sbjct  1    MDAIRKQASKLREQVARQQQAVLKQFGAGGYGGSDNMVTDERELHLHQRLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRD+VRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCTSG TL +AAL ++RA  Q
Sbjct  61   KHYQRDVVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTSGGTLCRAALSYARARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRMRQE  165



>ref|NP_567969.1| SH3 domain-containing protein [Arabidopsis thaliana]
 gb|AAL32439.1|AF367774_1 SH3 domain-containing protein 2 [Arabidopsis thaliana]
 gb|AAL59954.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20118.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64716.1| unknown [Arabidopsis thaliana]
 gb|AEE86405.1| SH3 domain-containing protein [Arabidopsis thaliana]
Length=368

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 150/164 (91%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+RLREQVARQQQAVFKQFGGG  GS     DE+EL+QHQKLEKLYISTRAAK
Sbjct  1    MDAIRKQASRLREQVARQQQAVFKQFGGGGYGSGLA--DEAELNQHQKLEKLYISTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCT+G  L++AAL + RA  QM
Sbjct  59   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALNYGRARAQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  162



>ref|XP_004500776.1| PREDICTED: intersectin-1-like isoform X1 [Cicer arietinum]
 ref|XP_004500777.1| PREDICTED: intersectin-1-like isoform X2 [Cicer arietinum]
Length=371

 Score =   266 bits (681),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++LREQVARQQQAV KQ   GG+GGSD + TDE EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQASKLREQVARQQQAVLKQFGAGGYGGSDNMVTDEVELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCTSG+TLS+AAL ++RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTSGSTLSRAALNYARARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERG LLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQ+
Sbjct  121  MEKERGTLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQD  165



>gb|EPS66080.1| hypothetical protein M569_08697 [Genlisea aurea]
Length=370

 Score =   266 bits (681),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVARQQQAV KQFG   G SD V  D++E+ QHQ+LEKLYISTR+AK
Sbjct  1    MEAIRKQASKLREQVARQQQAVMKQFGAYGG-SDNVVADDAEIQQHQRLEKLYISTRSAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG+TLSKAA  FSRA   +
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGNENTCTSGSTLSKAASSFSRARALV  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|XP_004290307.1| PREDICTED: endophilin-A1-like [Fragaria vesca subsp. vesca]
Length=371

 Score =   266 bits (680),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA+RLREQVARQQQAV KQ   GG+GGSD + TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQASRLREQVARQQQAVLKQFGAGGYGGSDNLVTDEAELVQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG+TLS+A+L + RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGSTLSRASLSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERG LLK+LGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGTLLKSLGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_006580985.1| PREDICTED: uncharacterized protein LOC100783004 isoform X1 [Glycine 
max]
 gb|KHN20037.1| Endophilin-A2 [Glycine soja]
Length=371

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++LREQVARQQQAV KQ   GG+GGSD + TDE EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQASKLREQVARQQQAVLKQFGAGGYGGSDNMVTDEVELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG++NTCTSG+TLS+AAL ++RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGADNTCTSGSTLSRAALNYARARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERG+LLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGSLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_007135930.1| hypothetical protein PHAVU_009G004000g [Phaseolus vulgaris]
 gb|ESW07924.1| hypothetical protein PHAVU_009G004000g [Phaseolus vulgaris]
Length=371

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++LREQVARQQQAV KQ   GG+GGSD + TDE EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQASKLREQVARQQQAVLKQFGAGGYGGSDNMVTDEVELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG++NTCTSG+TLS+AAL ++RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGADNTCTSGSTLSRAALNYARARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERG+LLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGSLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_010530811.1| PREDICTED: src substrate cortactin [Tarenaya hassleriana]
Length=372

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQATRLREQVARQQQAV KQ  GGG+GGSD V TDE+EL QH KLEKLYISTRAA
Sbjct  1    MEAIRKQATRLREQVARQQQAVLKQFGGGGYGGSDSVITDEAELQQHHKLEKLYISTRAA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSE+TCT+G  LS+AAL + RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSESTCTNGNALSRAALNYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQRYDR+RQE
Sbjct  121  MEKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRLRQE  165



>ref|XP_006661952.1| PREDICTED: pericentrin-like [Oryza brachyantha]
Length=370

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA++LREQVARQQQAV KQFGGG+G +D    DE+E  QH KLEKLYISTRAAK
Sbjct  1    MDAIRKQASKLREQVARQQQAVMKQFGGGYG-ADGAFADEAEAQQHSKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KL E+ +KYGSENTCTSG+TLSKAALCF++A   M
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGSENTCTSGSTLSKAALCFAKARSLM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKA+GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKAMGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>gb|EYU37851.1| hypothetical protein MIMGU_mgv1a008590mg [Erythranthe guttata]
Length=368

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA+RLREQVARQQQAV KQFGG  G SD V  D++EL QHQKLE LYISTR AK
Sbjct  1    MEAIRKQASRLREQVARQQQAVLKQFGGYGG-SDSVVPDDAELLQHQKLEHLYISTRGAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+E+TCTSG+TLSKAA  F+RA  QM
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGTESTCTSGSTLSKAASNFARARAQM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|XP_011037191.1| PREDICTED: intersectin-1-like [Populus euphratica]
Length=371

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LREQVA+QQQAV KQ   GG+GGSD V TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATKLREQVAKQQQAVLKQFGAGGYGGSDTVITDEAELLQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG++ SE+SRKYG+ENTCTSG TLSKAA+ ++    Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTRFSEDSRKYGAENTCTSGNTLSKAAVNYANTRAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_009401790.1| PREDICTED: intersectin-1-like [Musa acuminata subsp. malaccensis]
Length=371

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++ REQVARQQQAVFKQ  GGG+G SD + +D +E  QHQKLEKLYISTRAA
Sbjct  1    MEAIRKQASKFREQVARQQQAVFKQFGGGGYGSSDSIFSDAAEYQQHQKLEKLYISTRAA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLS++SRKYG ENTCTSG TLSKAALC++RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGNKLSDDSRKYGVENTCTSGNTLSKAALCYARARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            ME ERGNLLKALG+QVAEPLRAMVMGAPLEDARHLAQRYDR+RQE
Sbjct  121  MENERGNLLKALGSQVAEPLRAMVMGAPLEDARHLAQRYDRVRQE  165



>gb|ACG28140.1| clathrin binding protein [Zea mays]
Length=369

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVARQQQAV KQFGGG+G +D V  DE+E HQH KLEKLYISTRAAK
Sbjct  1    MEAIRKQASKLREQVARQQQAVMKQFGGGYG-ADGVFADEAEAHQHSKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KL E+ +KYG+ENTCTSG+TLSKAAL F++A   M
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGTENTCTSGSTLSKAALSFAKARSMM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|XP_002266234.1| PREDICTED: endophilin-A3 isoform X3 [Vitis vinifera]
 emb|CAN81938.1| hypothetical protein VITISV_028002 [Vitis vinifera]
 emb|CBI38007.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++ REQVA+QQQAV KQ  GGG+GGSD V TDE+EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQASKFREQVAKQQQAVLKQFGGGGYGGSDNVITDEAELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE +IVTGSKQVEIG+KLSE+ RKYG ENTCTSG TLSKAAL + RA  Q
Sbjct  61   KHFQRDIVRGVEGFIVTGSKQVEIGTKLSEDCRKYGVENTCTSGNTLSKAALNYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRY+RMRQE
Sbjct  121  IEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYERMRQE  165



>ref|XP_010664761.1| PREDICTED: uncharacterized protein LOC100264255 isoform X3 [Vitis 
vinifera]
Length=343

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggf-ggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT++ +QVA+QQQAV KQF GG  GG D V TDESEL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATKIIDQVAKQQQAVLKQFSGGGYGGPDNVLTDESELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE +IVTGSKQVEIG+KLSE+SRKYG ENTCTSG+TLSKAAL F+RA  Q
Sbjct  61   KHFQRDIVRGVEGFIVTGSKQVEIGTKLSEDSRKYGVENTCTSGSTLSKAALSFARARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGT+V EPLRAMVMGAPLEDARHLAQRY+RMR E
Sbjct  121  MEKERGNLLKALGTKVGEPLRAMVMGAPLEDARHLAQRYERMRME  165



>ref|NP_001065045.1| Os10g0512700 [Oryza sativa Japonica Group]
 gb|ABB47881.1| SH3 domain-containing protein 3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26959.1| Os10g0512700 [Oryza sativa Japonica Group]
 gb|EEC67303.1| hypothetical protein OsI_34298 [Oryza sativa Indica Group]
 gb|EEE51263.1| hypothetical protein OsJ_32141 [Oryza sativa Japonica Group]
Length=370

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVARQQQAV KQFGGG+G +D    DE+E  QH KLEKLYISTRAAK
Sbjct  1    MEAIRKQASKLREQVARQQQAVMKQFGGGYG-ADGAFADEAEAQQHSKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KL E+ +KYG+ENTCTSG+TLSKAALCF++A   M
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGAENTCTSGSTLSKAALCFAKARSLM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|XP_006282652.1| hypothetical protein CARUB_v10005066mg [Capsella rubella]
 gb|EOA15550.1| hypothetical protein CARUB_v10005066mg [Capsella rubella]
Length=274

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+ IRKQA++LREQVARQQQAV +Q  GGG+GGSD V TDE ELH+HQKL+KLYISTR+A
Sbjct  1    METIRKQASKLREQVARQQQAVLRQFGGGGYGGSDTVITDEEELHRHQKLDKLYISTRSA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQRDIVRGVE YI+TGSKQVEIG+KL E+SRKYGSENTCT+G TL++A+L F+ A  Q
Sbjct  61   KRFQRDIVRGVEGYIITGSKQVEIGTKLCEDSRKYGSENTCTNGNTLTRASLSFANARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLK  GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKTFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_010437576.1| PREDICTED: src substrate cortactin-like [Camelina sativa]
 ref|XP_010447046.1| PREDICTED: src substrate cortactin-like [Camelina sativa]
Length=368

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 150/164 (91%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA+RLREQVARQQQAVFKQFGGG  GS    +DE+EL+QHQKLEKLYISTRAAK
Sbjct  1    MEAIRKQASRLREQVARQQQAVFKQFGGGGYGSGL--SDEAELNQHQKLEKLYISTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGS+NTCT+G  L +AAL + RA  QM
Sbjct  59   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSDNTCTNGNVLIRAALSYGRARAQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  162



>ref|XP_010664760.1| PREDICTED: uncharacterized protein LOC100264255 isoform X2 [Vitis 
vinifera]
Length=345

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT++ +QVA+QQQAV KQF GG  G  D V TDESEL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATKIIDQVAKQQQAVLKQFSGGGYGGPDNVLTDESELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE +IVTGSKQVEIG+KLSE+SRKYG ENTCTSG+TLSKAAL F+RA  Q
Sbjct  61   KHFQRDIVRGVEGFIVTGSKQVEIGTKLSEDSRKYGVENTCTSGSTLSKAALSFARARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGT+V EPLRAMVMGAPLEDARHLAQRY+RMR E
Sbjct  121  MEKERGNLLKALGTKVGEPLRAMVMGAPLEDARHLAQRYERMRME  165



>ref|XP_010432388.1| PREDICTED: src substrate cortactin-like [Camelina sativa]
Length=368

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 150/164 (91%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA+RLREQVARQQQAVFKQFGGG  GS    +DE+EL+QHQKLEKLYISTRAAK
Sbjct  1    MEAIRKQASRLREQVARQQQAVFKQFGGGGYGSGL--SDEAELNQHQKLEKLYISTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGS+NTCT+G  L +AAL + RA  QM
Sbjct  59   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSDNTCTNGNVLIRAALSYGRARAQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  162



>ref|XP_003537844.1| PREDICTED: uncharacterized protein LOC100777051 isoform 1 [Glycine 
max]
 gb|KHN39833.1| Endophilin-A1 [Glycine soja]
Length=371

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVARQQQAV KQ  GGG+GGSD V TD  EL  HQ+LEKLYISTRA 
Sbjct  1    MDAIRKQASKLREQVARQQQAVLKQFGGGGYGGSDNVVTDGVELQLHQRLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLS+AAL F++A  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGNTLSRAALSFAQAHAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKERGNLLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  121  IEKERGNLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRMRQE  165



>ref|XP_002279562.1| PREDICTED: endophilin-A2 isoform X1 [Vitis vinifera]
 emb|CBI19795.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggf-ggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT++ +QVA+QQQAV KQF GG  GG D V TDESEL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATKIIDQVAKQQQAVLKQFSGGGYGGPDNVLTDESELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE +IVTGSKQVEIG+KLSE+SRKYG ENTCTSG+TLSKAAL F+RA  Q
Sbjct  61   KHFQRDIVRGVEGFIVTGSKQVEIGTKLSEDSRKYGVENTCTSGSTLSKAALSFARARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGT+V EPLRAMVMGAPLEDARHLAQRY+RMR E
Sbjct  121  MEKERGNLLKALGTKVGEPLRAMVMGAPLEDARHLAQRYERMRME  165



>ref|XP_009761874.1| PREDICTED: uncharacterized protein LOC104213988, partial [Nicotiana 
sylvestris]
Length=168

 Score =   255 bits (652),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQAT+LREQVA+QQ AVFKQF  G GG D   TDE EL QHQ LEKLYISTRA K
Sbjct  1    MEAIRKQATKLREQVAKQQHAVFKQFASGLGGQDNSVTDEVELQQHQTLEKLYISTRAGK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YI++GSKQ+EIG++L+++SRKYG+ENTCTSG TLSKAAL +SRA  ++
Sbjct  61   HFQRDIVRGVEGYIISGSKQIEIGTRLADDSRKYGAENTCTSGNTLSKAALSYSRAQAEI  120

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER +LLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDR+RQE
Sbjct  121  EKEREDLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRVRQE  164



>ref|XP_002464381.1| hypothetical protein SORBIDRAFT_01g017250 [Sorghum bicolor]
 gb|EER91379.1| hypothetical protein SORBIDRAFT_01g017250 [Sorghum bicolor]
Length=369

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVARQQQAV KQFGGG+G +D V  DE+E  QH KLEKLYISTRAAK
Sbjct  1    MEAIRKQASKLREQVARQQQAVMKQFGGGYG-ADGVFADEAEAQQHSKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KL E+ +KYG+ENTCTSG+TLSKAAL F++A   M
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGTENTCTSGSTLSKAALSFAKARSMM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|XP_003522865.1| PREDICTED: intersectin-1-like isoform 1 [Glycine max]
 gb|KHN33720.1| Endophilin-A2 [Glycine soja]
Length=371

 Score =   262 bits (669),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++LREQVARQQQAV KQ   GG+GGSD + TDE EL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQASKLREQVARQQQAVLKQFGAGGYGGSDNMVTDEVELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE++RKYG++NTCTSG+TLS+AAL ++ A  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDNRKYGADNTCTSGSTLSRAALNYAHARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERG+LLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGSLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|NP_001130175.1| uncharacterized protein LOC100191269 [Zea mays]
 gb|ACF78319.1| unknown [Zea mays]
 tpg|DAA49321.1| TPA: clathrin binding protein [Zea mays]
Length=369

 Score =   262 bits (669),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVARQQQAV KQFGGG+G +D V  DE+E  QH KLEKLYISTRAAK
Sbjct  1    MEAIRKQASKLREQVARQQQAVMKQFGGGYG-ADGVFADEAEAQQHSKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KL E+ +KYG+ENTCTSG+TLSKAAL F++A   M
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGTENTCTSGSTLSKAALSFAKARSMM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|NP_001242513.1| uncharacterized protein LOC100783004 [Glycine max]
 gb|ACU17874.1| unknown [Glycine max]
Length=365

 Score =   261 bits (667),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++L EQVARQQQAV KQ   GG+GGSD + TDE EL QHQKLE+LYISTRA 
Sbjct  1    MEAIRKQASKLLEQVARQQQAVLKQFGAGGYGGSDNMVTDEVELQQHQKLEELYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG++NTCTSG+TLS+AAL ++RA  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGADNTCTSGSTLSRAALNYARARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERG+LLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGSLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>gb|KJB12165.1| hypothetical protein B456_002G004300 [Gossypium raimondii]
Length=370

 Score =   261 bits (668),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA+R REQVARQQQAV KQFG G  G SD + TDE+EL QHQKLEKLYISTR A
Sbjct  1    MEAIRKQASRFREQVARQQQAVLKQFGAGGYGGSDNLITDEAELQQHQKLEKLYISTRTA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YI+ GSKQVEI +KLSE+S+KYGSENTCTSG TLSKAAL F RA   
Sbjct  61   KHFQRDIVRGVEGYIIIGSKQVEIETKLSEDSKKYGSENTCTSGNTLSKAALSFGRARAH  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKE GNLLKALGTQVAEPLRAMVMG+PLEDARHLAQRYDRMRQE
Sbjct  121  MEKEHGNLLKALGTQVAEPLRAMVMGSPLEDARHLAQRYDRMRQE  165



>ref|XP_007131765.1| hypothetical protein PHAVU_011G040000g [Phaseolus vulgaris]
 gb|ESW03759.1| hypothetical protein PHAVU_011G040000g [Phaseolus vulgaris]
Length=371

 Score =   261 bits (668),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVARQQQAV KQ  GGG+GGSD V T+  EL  HQKLEKLYISTRA 
Sbjct  1    MDAIRKQASKLREQVARQQQAVLKQFGGGGYGGSDNVATNGMELQLHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLS+AAL F++A  Q
Sbjct  61   KHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGNTLSRAALSFAQARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
             EKERGNLLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDR+RQE
Sbjct  121  TEKERGNLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRIRQE  165



>ref|XP_006352058.1| PREDICTED: intersectin-1-like [Solanum tuberosum]
Length=370

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MD+IRKQAT+LREQVA+QQQAVFKQF  G GG D   TDE EL QHQKLEKLYISTRA K
Sbjct  1    MDSIRKQATKLREQVAKQQQAVFKQFSSGLGGPDNSVTDEVELQQHQKLEKLYISTRAGK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YI+T SKQ+EIG++LSE+SRKYG+ENTCTSG+TLSKAAL +SRA  ++
Sbjct  61   HFQRDIVRGVEGYIITASKQIEIGTRLSEDSRKYGAENTCTSGSTLSKAALSYSRAQGEI  120

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER +LLK+LGTQVAEPLRAMV+GAPLEDARHLAQRYDR+RQE
Sbjct  121  EKEREDLLKSLGTQVAEPLRAMVVGAPLEDARHLAQRYDRVRQE  164



>ref|XP_002866827.1| hypothetical protein ARALYDRAFT_327853 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43086.1| hypothetical protein ARALYDRAFT_327853 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+ IRKQA++LREQVARQQQAV +Q  GGG+GGSD V TDE E H+HQKLEKLY+STR+A
Sbjct  1    METIRKQASKLREQVARQQQAVLRQFGGGGYGGSDTVITDEEEFHRHQKLEKLYLSTRSA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE +IVTGSKQVEIG+KL E+SR+YGSENTCTSG TL++A+L F+ A  Q
Sbjct  61   KHFQRDIVRGVEGFIVTGSKQVEIGTKLCEDSRRYGSENTCTSGNTLTRASLSFANARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLK LGTQVAEPLRAMVMGAPLEDARHL QRYDRMRQE
Sbjct  121  MEKERGNLLKTLGTQVAEPLRAMVMGAPLEDARHLTQRYDRMRQE  165



>ref|XP_003574180.1| PREDICTED: intersectin-1-like [Brachypodium distachyon]
Length=370

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA++LREQVARQQQAV KQFGGG+G +D V  DE E  QH KLEKLYISTRAAK
Sbjct  1    MDAIRKQASKLREQVARQQQAVLKQFGGGYG-ADSVFADEGEAQQHTKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KL E+ +KYG ENTCTSG+TLS+AAL F++A   M
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGVENTCTSGSTLSRAALSFAKARSLM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|XP_006282653.1| hypothetical protein CARUB_v10005066mg [Capsella rubella]
 gb|EOA15551.1| hypothetical protein CARUB_v10005066mg [Capsella rubella]
Length=373

 Score =   259 bits (661),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+ IRKQA++LREQVARQQQAV +Q  GGG+GGSD V TDE ELH+HQKL+KLYISTR+A
Sbjct  1    METIRKQASKLREQVARQQQAVLRQFGGGGYGGSDTVITDEEELHRHQKLDKLYISTRSA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQRDIVRGVE YI+TGSKQVEIG+KL E+SRKYGSENTCT+G TL++A+L F+ A  Q
Sbjct  61   KRFQRDIVRGVEGYIITGSKQVEIGTKLCEDSRKYGSENTCTNGNTLTRASLSFANARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLK  GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERGNLLKTFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_004982624.1| PREDICTED: endophilin-A2-like isoform X2 [Setaria italica]
Length=369

 Score =   258 bits (660),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVARQQQAV KQFGGG+G +D    DE++  QH KLEKLYISTRAAK
Sbjct  1    MEAIRKQASKLREQVARQQQAVMKQFGGGYG-ADGAFADEADAQQHSKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KL E+ +KYG+ENTCTSG+TLSKAAL F++A   M
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGTENTCTSGSTLSKAALSFAKARSMM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|XP_004982623.1| PREDICTED: endophilin-A2-like isoform X1 [Setaria italica]
Length=373

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVARQQQAV KQFGGG+G +D    DE++  QH KLEKLYISTRAAK
Sbjct  1    MEAIRKQASKLREQVARQQQAVMKQFGGGYG-ADGAFADEADAQQHSKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KL E+ +KYG+ENTCTSG+TLSKAAL F++A   M
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGTENTCTSGSTLSKAALSFAKARSMM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>emb|CDP20867.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 143/164 (87%), Gaps = 7/164 (4%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQATRLREQ      AV KQFGG    SD V TDE+EL QHQKLEKLYISTRAAK
Sbjct  1    MEAIRKQATRLREQ------AVLKQFGGYGA-SDSVVTDEAELQQHQKLEKLYISTRAAK  53

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIV GSKQVEIG+KLSE+SRKYG ENTCTSG+TLSKAAL F+RA  +M
Sbjct  54   HFQRDIVRGVEGYIVAGSKQVEIGTKLSEDSRKYGVENTCTSGSTLSKAALNFARARAEM  113

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  114  EKERGNLLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  157



>gb|KCW67915.1| hypothetical protein EUGRSUZ_F01618 [Eucalyptus grandis]
Length=344

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQAT+LR+QVA+QQQAVF+QF G +G SD V  DE+EL  HQ+LEKLYISTRA K
Sbjct  1    MEAIRKQATKLRDQVAKQQQAVFRQFTGVYG-SDNVIADETELQHHQRLEKLYISTRAGK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIV GSKQVEIG+KLSE+ RKYG+ENTCT+G TLSKAAL FSRA  Q+
Sbjct  60   HFQRDIVRGVEGYIVHGSKQVEIGTKLSEDCRKYGAENTCTTGTTLSKAALNFSRARAQI  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E+ERGNLLK LGTQVAEPLRAMVMGAPLEDAR LAQRYDR+RQE
Sbjct  120  ERERGNLLKTLGTQVAEPLRAMVMGAPLEDARQLAQRYDRVRQE  163



>ref|XP_008681397.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACF88071.1| unknown [Zea mays]
 gb|AFW68396.1| hypothetical protein ZEAMMB73_738646 [Zea mays]
Length=368

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++ REQVARQQQAV KQFGGG+G +D V  +E+E  QH KLEKLYISTRAAK
Sbjct  1    MEAIRKQASKFREQVARQQQAVMKQFGGGYG-ADGVFANEAEAQQHSKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KL E+ +KYG+ENTC+SG+TLSKAAL F++A   M
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGTENTCSSGSTLSKAALSFAKARSMM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>ref|XP_004243144.1| PREDICTED: src substrate cortactin-like [Solanum lycopersicum]
Length=370

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M++IRKQAT+LREQVA+QQQAVFKQF  G GG D   TDE EL QHQKLEKLYISTRA K
Sbjct  1    MESIRKQATKLREQVAKQQQAVFKQFSSGLGGPDNSVTDEVELQQHQKLEKLYISTRAGK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDI+RGVE YI+T SKQ+EIG++LSE+SRKYG+EN CTSG+TLSKAAL +SRA  ++
Sbjct  61   HFQRDIIRGVEGYIITASKQIEIGTRLSEDSRKYGAENKCTSGSTLSKAALSYSRAQGEI  120

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER +LLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDR+RQE
Sbjct  121  EKEREDLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRVRQE  164



>emb|CDY17473.1| BnaC03g65900D [Brassica napus]
Length=368

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 149/164 (91%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDA+RKQA+R+REQVARQ  AVFKQFGGG  GS    +D++ELHQHQKLEKLYISTRAAK
Sbjct  1    MDALRKQASRIREQVARQ--AVFKQFGGGGHGSGL--SDDAELHQHQKLEKLYISTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCT+G  L++AAL + RA  QM
Sbjct  57   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALSYGRARAQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E+ERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  117  EQERGNILKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  160



>ref|XP_009609368.1| PREDICTED: intersectin-1-like isoform X2 [Nicotiana tomentosiformis]
Length=365

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQAT+LREQVA+QQQAVFKQF  G GG D   TDE EL QHQKLEKLYISTRA K
Sbjct  1    MEAIKKQATKLREQVAKQQQAVFKQFASGLGGQDNSVTDEVELQQHQKLEKLYISTRAGK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YI++GSKQ+EIG++L+E+SRKYG+ENTCTSG TLSKAAL +SRA  ++
Sbjct  61   HFQRDIVRGVEGYIISGSKQIEIGTRLAEDSRKYGAENTCTSGNTLSKAALSYSRAQAEI  120

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER +LLKALGTQVAEPLRAMV+GAPLEDAR LAQRYDR+RQE
Sbjct  121  EKEREDLLKALGTQVAEPLRAMVVGAPLEDARQLAQRYDRVRQE  164



>ref|XP_009609367.1| PREDICTED: intersectin-1-like isoform X1 [Nicotiana tomentosiformis]
Length=367

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQAT+LREQVA+QQQAVFKQF  G GG D   TDE EL QHQKLEKLYISTRA K
Sbjct  1    MEAIKKQATKLREQVAKQQQAVFKQFASGLGGQDNSVTDEVELQQHQKLEKLYISTRAGK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YI++GSKQ+EIG++L+E+SRKYG+ENTCTSG TLSKAAL +SRA  ++
Sbjct  61   HFQRDIVRGVEGYIISGSKQIEIGTRLAEDSRKYGAENTCTSGNTLSKAALSYSRAQAEI  120

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER +LLKALGTQVAEPLRAMV+GAPLEDAR LAQRYDR+RQE
Sbjct  121  EKEREDLLKALGTQVAEPLRAMVVGAPLEDARQLAQRYDRVRQE  164



>ref|XP_010061017.1| PREDICTED: intersectin-1-like [Eucalyptus grandis]
 gb|KCW67916.1| hypothetical protein EUGRSUZ_F01618 [Eucalyptus grandis]
Length=369

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQAT+LR+QVA+QQQAVF+QF G +G SD V  DE+EL  HQ+LEKLYISTRA K
Sbjct  1    MEAIRKQATKLRDQVAKQQQAVFRQFTGVYG-SDNVIADETELQHHQRLEKLYISTRAGK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIV GSKQVEIG+KLSE+ RKYG+ENTCT+G TLSKAAL FSRA  Q+
Sbjct  60   HFQRDIVRGVEGYIVHGSKQVEIGTKLSEDCRKYGAENTCTTGTTLSKAALNFSRARAQI  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E+ERGNLLK LGTQVAEPLRAMVMGAPLEDAR LAQRYDR+RQE
Sbjct  120  ERERGNLLKTLGTQVAEPLRAMVMGAPLEDARQLAQRYDRVRQE  163



>ref|XP_010446423.1| PREDICTED: endophilin-A3 [Camelina sativa]
Length=374

 Score =   256 bits (655),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 147/166 (89%), Gaps = 2/166 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ--fgggfggSDYVGTDESELHQHQKLEKLYISTRA  230
            MD IRKQA++LREQVARQQQAV +Q   GGG+GGSD + TDE ELH+HQ LEKLYISTR+
Sbjct  1    MDTIRKQASKLREQVARQQQAVLRQFGGGGGYGGSDTLITDEEELHRHQNLEKLYISTRS  60

Query  231  AKHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALV  410
            AKHFQRDIVRGV+ YIVTGSKQVEIG+KL E+SRKYGS+NTCTSG TL++A+L F+ A  
Sbjct  61   AKHFQRDIVRGVQGYIVTGSKQVEIGTKLCEDSRKYGSDNTCTSGNTLTRASLSFANARA  120

Query  411  QMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
             MEKER NLLK LGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  121  LMEKERANLLKTLGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  166



>dbj|BAJ89635.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   256 bits (654),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 145/164 (88%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVARQQQAV KQFGGG+  +D V  DE E  QH KLEKLYISTRAAK
Sbjct  1    MEAIRKQASKLREQVARQQQAVLKQFGGGY--ADSVFADEGEAQQHSKLEKLYISTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVE+G+KL E+ +KYG ENTCTSG+TLS+AAL F++A   M
Sbjct  59   HFQRDIVRGVEGYIVTGSKQVELGNKLCEDGKKYGVENTCTSGSTLSRAALSFAKARSLM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNLLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  162



>emb|CDX76295.1| BnaA08g11050D [Brassica napus]
Length=367

 Score =   256 bits (653),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 148/164 (90%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+R+REQVARQ  AVFKQFGGG  GS    +D++ELH HQKLEKLYISTRAAK
Sbjct  1    MDAIRKQASRIREQVARQ--AVFKQFGGGGHGSGL--SDDAELHHHQKLEKLYISTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCT+G  L++AAL + RA  QM
Sbjct  57   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALNYGRARAQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLR+MV+GAPLEDARHLAQRYDRMRQE
Sbjct  117  EKERGNMLKALGTQVAEPLRSMVLGAPLEDARHLAQRYDRMRQE  160



>ref|XP_009108717.1| PREDICTED: endophilin-A2-like [Brassica rapa]
Length=367

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 148/164 (90%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+R+REQVARQ  AVFKQFGGG  GS    +D++ELH HQKLEKLYISTRAAK
Sbjct  1    MDAIRKQASRIREQVARQ--AVFKQFGGGGHGSGL--SDDAELHHHQKLEKLYISTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVE+G+KLSE+SRKYGSENTCT+G  L++AAL + RA  QM
Sbjct  57   HYQRDIVRGVEGYIVTGSKQVEVGTKLSEDSRKYGSENTCTNGNVLTRAALNYGRARAQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLR+MV+GAPLEDARHLAQRYDRMRQE
Sbjct  117  EKERGNMLKALGTQVAEPLRSMVLGAPLEDARHLAQRYDRMRQE  160



>ref|XP_011074634.1| PREDICTED: src substrate cortactin-like [Sesamum indicum]
Length=370

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQAT+LREQVA+QQQAV KQF GG GG D + +DE+E+ QHQKLEKLYISTRAAK
Sbjct  1    MEAIRKQATKLREQVAKQQQAVLKQFVGGIGGLDNLVSDENEVQQHQKLEKLYISTRAAK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTG+KQVEIG+KLSE+SRKYG+ENTCT+G+TLSK AL +SRA  Q+
Sbjct  61   HFQRDIVRGVEGYIVTGTKQVEIGTKLSEDSRKYGTENTCTNGSTLSKVALGYSRARAQI  120

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER NLLK LGTQVAEP+RAMV+G+ LEDARHLAQRYDR+RQE
Sbjct  121  EKERENLLKLLGTQVAEPIRAMVVGSALEDARHLAQRYDRVRQE  164



>ref|XP_008681396.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=459

 Score =   256 bits (655),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++ REQVARQQQAV KQFGGG+G +D V  +E+E  QH KLEKLYISTRAAK
Sbjct  1    MEAIRKQASKFREQVARQQQAVMKQFGGGYG-ADGVFANEAEAQQHSKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KL E+ +KYG+ENTC+SG+TLSKAAL F++A   M
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGNKLCEDGKKYGTENTCSSGSTLSKAALSFAKARSMM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  120  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  163



>emb|CDP07443.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   253 bits (647),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQAT+LREQVA+QQQAV KQF GG GGS+    D++EL QHQKLEKLYISTRA K
Sbjct  1    MEAIRKQATKLREQVAKQQQAVLKQFAGGLGGSETAVNDDTELQQHQKLEKLYISTRAGK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDI+RGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCT G+TLS+AAL +SRA   +
Sbjct  61   HFQRDIIRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTCGSTLSRAALSYSRARALI  120

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKE G+LLKALGTQVAEPLRAMV+GAPLEDAR LAQRYDR+RQE
Sbjct  121  EKEHGHLLKALGTQVAEPLRAMVVGAPLEDARQLAQRYDRVRQE  164



>ref|XP_009109509.1| PREDICTED: intersectin-1 [Brassica rapa]
Length=373

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++ REQVARQQQAV +Q  GGG+GGSD V TDE ELH+HQKLEKLYISTR+A
Sbjct  1    MEAIRKQASKFREQVARQQQAVLRQFGGGGYGGSDNVITDEEELHRHQKLEKLYISTRSA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE  IVTGSKQVEIG+KL E+SR+YGS NTCTSG TL++A+L F+ A  Q
Sbjct  61   KHFQRDIVRGVEGSIVTGSKQVEIGTKLCEDSRRYGSGNTCTSGNTLTRASLSFANARDQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMV+GAPL DARHLAQRY+RMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVIGAPLVDARHLAQRYERMRQE  165



>ref|XP_010647675.1| PREDICTED: endophilin-A3 isoform X2 [Vitis vinifera]
Length=387

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 149/181 (82%), Gaps = 17/181 (9%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQ----------------AVFKQ-fgggfggSDYVGTDESEL  185
            M+AIRKQA++ REQVA+QQQ                AV KQ  GGG+GGSD V TDE+EL
Sbjct  1    MEAIRKQASKFREQVAKQQQPSIQVGGMSKSNNYACAVLKQFGGGGYGGSDNVITDEAEL  60

Query  186  HQHQKLEKLYISTRAAKHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSG  365
             QHQKLEKLYISTRA KHFQRDIVRGVE +IVTGSKQVEIG+KLSE+ RKYG ENTCTSG
Sbjct  61   QQHQKLEKLYISTRAGKHFQRDIVRGVEGFIVTGSKQVEIGTKLSEDCRKYGVENTCTSG  120

Query  366  ATLSKAALCFSRALVQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQ  545
             TLSKAAL + RA  Q+EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRY+RMRQ
Sbjct  121  NTLSKAALNYGRARAQIEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYERMRQ  180

Query  546  E  548
            E
Sbjct  181  E  181



>emb|CDX90304.1| BnaA08g16800D [Brassica napus]
Length=422

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++ REQVARQQQAV +Q  GGG+GGSD V TDE ELH+HQKLEKLYISTR+A
Sbjct  1    MEAIRKQASKFREQVARQQQAVLRQFGGGGYGGSDNVITDEEELHRHQKLEKLYISTRSA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE  IVTGSKQVEIG+KL E+SR+YGS NTCTSG TL++A+L F+ A  Q
Sbjct  61   KHFQRDIVRGVEGSIVTGSKQVEIGTKLCEDSRRYGSGNTCTSGNTLTRASLSFANARDQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERGNLLKALGTQVAEPLRAMV+GAPL DARHLAQRY+RMRQE
Sbjct  121  MEKERGNLLKALGTQVAEPLRAMVIGAPLVDARHLAQRYERMRQE  165



>ref|XP_009411494.1| PREDICTED: src substrate cortactin-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score =   251 bits (642),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggS-DYVGTDESELHQHQKLEKLYISTRAA  233
            M+A+RKQA++LREQVARQQQAVFKQFGGG  GS D +  D +E  Q+QK+EKLYISTRAA
Sbjct  1    MEALRKQASKLREQVARQQQAVFKQFGGGGYGSPDSLFADAAEYKQNQKIEKLYISTRAA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG  NTCTSG TLS AAL ++RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGNKLSEDSRKYGVGNTCTSGNTLSNAALSYARARSQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            ME E GNLLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRM QE
Sbjct  121  MENEHGNLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRMHQE  165



>ref|XP_010906310.1| PREDICTED: uncharacterized protein LOC105033275 isoform X3 [Elaeis 
guineensis]
Length=333

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 146/165 (88%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQATR REQVARQQQAV KQ  GGG+GGS+ V  DE EL QHQ+LEKLYISTR+ 
Sbjct  1    MDALRKQATRFREQVARQQQAVLKQFGGGGYGGSENVLMDELELQQHQRLEKLYISTRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE Y+VTGSKQVEIG+KLSE+S++YG EN+CT G+TLSKAAL F RA  Q
Sbjct  61   KHFQRDIVRGVEGYVVTGSKQVEIGTKLSEDSKRYGVENSCTIGSTLSKAALGFGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +E+ERGNLLKALGTQVAEPLRAMV+GAPL DAR LAQRY+RMRQE
Sbjct  121  IEQERGNLLKALGTQVAEPLRAMVVGAPLGDARELAQRYERMRQE  165



>ref|XP_011092842.1| PREDICTED: endophilin-A2-like [Sesamum indicum]
Length=368

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA+RLREQVARQQQAV +QFG     +D +  +++EL QH+KLEKLYISTRAAK
Sbjct  1    MEAIRKQASRLREQVARQQQAVLRQFGAYGD-TDVIMNNDAELRQHKKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRG+E  IV GSKQ+EIG+K+SE+SRKYG +NTCTSG TLSKAA  F+RA  QM
Sbjct  60   HFQRDIVRGIEGCIVIGSKQIEIGTKMSEDSRKYGVQNTCTSGNTLSKAASNFARARAQM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERG+LLKALGTQV EPLRAMVMGAPL+DARHLAQRYDRMRQ+
Sbjct  120  EKERGDLLKALGTQVTEPLRAMVMGAPLDDARHLAQRYDRMRQD  163



>emb|CDY12115.1| BnaC03g60310D [Brassica napus]
Length=423

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQA++LREQVARQQQAV +Q  GGG+GGSD V TDE ELH+HQKLEKLYISTR+A
Sbjct  1    MEAIRKQASKLREQVARQQQAVLRQFGGGGYGGSDTVITDEEELHRHQKLEKLYISTRSA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE  IVTGSKQVEIG+KL E+SR+YGS NTCTSG TL++A+L F+ A  Q
Sbjct  61   KHFQRDIVRGVEGSIVTGSKQVEIGTKLCEDSRRYGSGNTCTSGNTLTRASLSFANARDQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERG LLKALGTQVAEPLRAMV GAPL DARHLAQRY+RMRQE
Sbjct  121  MEKERGTLLKALGTQVAEPLRAMVTGAPLVDARHLAQRYERMRQE  165



>ref|XP_010906309.1| PREDICTED: endophilin-A1-like isoform X2 [Elaeis guineensis]
Length=371

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 146/165 (88%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQATR REQVARQQQAV KQ  GGG+GGS+ V  DE EL QHQ+LEKLYISTR+ 
Sbjct  1    MDALRKQATRFREQVARQQQAVLKQFGGGGYGGSENVLMDELELQQHQRLEKLYISTRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE Y+VTGSKQVEIG+KLSE+S++YG EN+CT G+TLSKAAL F RA  Q
Sbjct  61   KHFQRDIVRGVEGYVVTGSKQVEIGTKLSEDSKRYGVENSCTIGSTLSKAALGFGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +E+ERGNLLKALGTQVAEPLRAMV+GAPL DAR LAQRY+RMRQE
Sbjct  121  IEQERGNLLKALGTQVAEPLRAMVVGAPLGDARELAQRYERMRQE  165



>ref|XP_002448249.1| hypothetical protein SORBIDRAFT_06g023950 [Sorghum bicolor]
 gb|EES12577.1| hypothetical protein SORBIDRAFT_06g023950 [Sorghum bicolor]
Length=368

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 142/164 (87%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL++QVARQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKDQVARQ--GVFKQFGYGN--SDNAFTDESEVKLHQRLEKLYLSTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLS++S+KYG ENTCTSG TLSKAA  F +A  QM
Sbjct  57   HFQRDIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVENTCTSGDTLSKAATYFGKARSQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  117  EKERGNMLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  160



>ref|XP_008366753.1| PREDICTED: uncharacterized protein LOC103430393 [Malus domestica]
Length=180

 Score =   238 bits (608),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 141/165 (85%), Gaps = 5/165 (3%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRK    LR+QVA+QQQAVFKQF GG  G SD V  DE+E  QHQK+EKLYISTRAA
Sbjct  1    MEAIRK----LRDQVAKQQQAVFKQFSGGIFGGSDNVAADENEFQQHQKIEKLYISTRAA  56

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+Q++IVRGVE Y+V GSKQVEIG+KLSE+SRKYG+E TCTSG TLS+AAL F RA  Q
Sbjct  57   KHYQKEIVRGVEGYVVAGSKQVEIGTKLSEDSRKYGAEKTCTSGNTLSRAALSFGRARAQ  116

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERG LLKALGTQVA+PLRAMVMGAPL DARHLAQRY RMRQ+
Sbjct  117  MEKERGLLLKALGTQVAKPLRAMVMGAPLGDARHLAQRYARMRQD  161



>ref|XP_010437002.1| PREDICTED: intersectin-1-like [Camelina sativa]
Length=374

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ--fgggfggSDYVGTDESELHQHQKLEKLYISTRA  230
            M+ IRKQA++LREQVARQQQAV +Q   GGG+GGSD + TDE E H+HQ LEKLYISTR+
Sbjct  1    METIRKQASKLREQVARQQQAVLRQFGGGGGYGGSDTLITDEEEFHRHQNLEKLYISTRS  60

Query  231  AKHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALV  410
            AKHFQRDI RGV+ YIVTGSKQVEIG+KL E+SRKYGS+NTCT G TL++A+L F+ A  
Sbjct  61   AKHFQRDIARGVQGYIVTGSKQVEIGTKLCEDSRKYGSDNTCTIGDTLTRASLSFANARA  120

Query  411  QMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
             MEKER NLLK LGTQVAEPLRAMVMGA LEDARHLAQRYDRMRQE
Sbjct  121  FMEKERANLLKTLGTQVAEPLRAMVMGALLEDARHLAQRYDRMRQE  166



>ref|XP_008652384.1| PREDICTED: uncharacterized protein LOC100191269 isoform X1 [Zea 
mays]
 gb|ACN27350.1| unknown [Zea mays]
 tpg|DAA49322.1| TPA: hypothetical protein ZEAMMB73_082862 [Zea mays]
Length=398

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 149/193 (77%), Gaps = 30/193 (16%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVARQQQAV KQFGGG+G +D V  DE+E  QH KLEKLYISTRAAK
Sbjct  1    MEAIRKQASKLREQVARQQQAVMKQFGGGYG-ADGVFADEAEAQQHSKLEKLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIG-----------------------------SKLSEES  329
            HFQRDIVRGVE YIVTGSKQVEIG                             +KL E+ 
Sbjct  60   HFQRDIVRGVEGYIVTGSKQVEIGGQLKPCCHFGEHINLNFEIVNLMCFVLIGNKLCEDG  119

Query  330  RKYGSENTCTSGATLSKAALCFSRALVQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDA  509
            +KYG+ENTCTSG+TLSKAAL F++A   MEKERGNLLKALGTQVAEPLRAMVMGAPLEDA
Sbjct  120  KKYGTENTCTSGSTLSKAALSFAKARSMMEKERGNLLKALGTQVAEPLRAMVMGAPLEDA  179

Query  510  RHLAQRYDRMRQE  548
            RHLAQRYDRMRQE
Sbjct  180  RHLAQRYDRMRQE  192



>ref|XP_006652590.1| PREDICTED: intersectin-1-like [Oryza brachyantha]
Length=368

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL+EQV+RQ   VFK FG  +G SD   TDESE++ HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKEQVSRQ--GVFKPFGAAYGNSDNAFTDESEVNLHQRLEKLYLSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQV+IG+KLS++S+KYG+ NTCTSG TLSKAA  + RA   M
Sbjct  59   HFQRDIVRGVEGYIVTGSKQVDIGNKLSDDSQKYGTGNTCTSGNTLSKAATYYGRARSMM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+L+A GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNMLRAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  162



>ref|XP_008663421.1| PREDICTED: LOW QUALITY PROTEIN: endophilin-A2-like [Zea mays]
Length=367

 Score =   243 bits (620),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL++QVARQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKDQVARQ--GVFKQFGYGN--SDNAFTDESEVKMHQRLEKLYLSTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRG+E YIVTGSKQVEIG+KLS++S+KYG+ENTCTSG TLSKAA  F +A  QM
Sbjct  57   HFQRDIVRGMEGYIVTGSKQVEIGNKLSDDSQKYGAENTCTSGDTLSKAATYFGKARSQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+L A GTQVAEPLRAMVMGAPLEDARHLAQRYDR RQE
Sbjct  117  EKERGNMLNAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRTRQE  160



>ref|XP_004976396.1| PREDICTED: endophilin-A2-like isoform X7 [Setaria italica]
Length=367

 Score =   243 bits (620),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL++QVARQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKDQVARQ--GVFKQFGYGN--SDNAFTDESEVKLHQRLEKLYLSTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLS++S+KYG ENTCTSG TLSKAA  F +A  QM
Sbjct  57   HFQRDIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVENTCTSGDTLSKAATYFGKARSQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER N+LKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  117  EKERCNMLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  160



>ref|XP_004976395.1| PREDICTED: endophilin-A2-like isoform X6 [Setaria italica]
Length=370

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL++QVARQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKDQVARQ--GVFKQFGYGN--SDNAFTDESEVKLHQRLEKLYLSTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLS++S+KYG ENTCTSG TLSKAA  F +A  QM
Sbjct  57   HFQRDIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVENTCTSGDTLSKAATYFGKARSQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER N+LKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  117  EKERCNMLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  160



>ref|NP_001190913.1| SH3 domain-containing protein [Arabidopsis thaliana]
 gb|AEE86406.1| SH3 domain-containing protein [Arabidopsis thaliana]
Length=345

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 132/164 (80%), Gaps = 25/164 (15%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+RLREQVARQQQ                         HQKLEKLYISTRAAK
Sbjct  1    MDAIRKQASRLREQVARQQQ-------------------------HQKLEKLYISTRAAK  35

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGSENTCT+G  L++AAL + RA  QM
Sbjct  36   HYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALNYGRARAQM  95

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  96   EKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQE  139



>ref|XP_004976392.1| PREDICTED: endophilin-A2-like isoform X3 [Setaria italica]
Length=405

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL++QVARQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKDQVARQ--GVFKQFGYGN--SDNAFTDESEVKLHQRLEKLYLSTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLS++S+KYG ENTCTSG TLSKAA  F +A  QM
Sbjct  57   HFQRDIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVENTCTSGDTLSKAATYFGKARSQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER N+LKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  117  EKERCNMLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  160



>ref|XP_004976394.1| PREDICTED: endophilin-A2-like isoform X5 [Setaria italica]
Length=398

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL++QVARQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKDQVARQ--GVFKQFGYGN--SDNAFTDESEVKLHQRLEKLYLSTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLS++S+KYG ENTCTSG TLSKAA  F +A  QM
Sbjct  57   HFQRDIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVENTCTSGDTLSKAATYFGKARSQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER N+LKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  117  EKERCNMLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  160



>ref|XP_008347090.1| PREDICTED: uncharacterized protein LOC103410106 [Malus domestica]
Length=280

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 139/165 (84%), Gaps = 5/165 (3%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRK    LR+QVA+QQQAVFKQF GG  G SD V +DE+E  QHQKLEKLYISTRAA
Sbjct  1    MDAIRK----LRDQVAKQQQAVFKQFSGGIYGGSDNVASDENEFQQHQKLEKLYISTRAA  56

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+Q++IVRGVE YIV GSK VEIG+KLSE+SRKYGSE TCTSG TLS+AAL F RA  Q
Sbjct  57   KHYQKEIVRGVEGYIVAGSKHVEIGTKLSEDSRKYGSEKTCTSGNTLSRAALSFGRARAQ  116

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            M KE G LLKALGTQVAEPLRAM++GAPL DARHLAQRY RMRQE
Sbjct  117  MXKECGVLLKALGTQVAEPLRAMIVGAPLXDARHLAQRYARMRQE  161



>ref|XP_004976393.1| PREDICTED: endophilin-A2-like isoform X4 [Setaria italica]
Length=401

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL++QVARQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKDQVARQ--GVFKQFGYGN--SDNAFTDESEVKLHQRLEKLYLSTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLS++S+KYG ENTCTSG TLSKAA  F +A  QM
Sbjct  57   HFQRDIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVENTCTSGDTLSKAATYFGKARSQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER N+LKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  117  EKERCNMLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  160



>ref|XP_003580243.1| PREDICTED: endophilin-A2-like [Brachypodium distachyon]
Length=368

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL+EQVARQ   VF+QFGG +G SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKEQVARQ--GVFRQFGGAYGNSDNAFTDESEVKLHQRLEKLYLSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRD+VRGVE YIVTGSKQVEIG+KL ++S+KYG ENTCTSG TLSKAA  + +A   +
Sbjct  59   HFQRDVVRGVEGYIVTGSKQVEIGNKLCDDSQKYGIENTCTSGNTLSKAATYYGKARSLI  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNMLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  162



>ref|XP_004976390.1| PREDICTED: endophilin-A2-like isoform X1 [Setaria italica]
Length=436

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL++QVARQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKDQVARQ--GVFKQFGYGN--SDNAFTDESEVKLHQRLEKLYLSTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLS++S+KYG ENTCTSG TLSKAA  F +A  QM
Sbjct  57   HFQRDIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVENTCTSGDTLSKAATYFGKARSQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER N+LKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  117  EKERCNMLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  160



>gb|ABR16031.1| unknown [Picea sitchensis]
Length=370

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 137/165 (83%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfg-gSDYVGTDESELHQHQKLEKLYISTRAA  233
            MD +RKQAT+ REQVA+QQ AVFKQFGG     SD V TDE E  +HQKLEKLYISTRA 
Sbjct  1    MDTLRKQATKFREQVAKQQHAVFKQFGGSGYGSSDIVSTDEPEFKRHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE  IV GSKQ+EIG+KLSE+ RKYG ENTCTSG TL+KAA  +  A V+
Sbjct  61   KHFQRDIVRGVEGLIVVGSKQLEIGTKLSEDCRKYGVENTCTSGETLAKAASYYGSARVR  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKER  L ++LGTQ+AEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  121  MEKERETLHRSLGTQIAEPLRAMVMGAPLEDARHLAQRYDRMRQE  165



>ref|XP_004976391.1| PREDICTED: endophilin-A2-like isoform X2 [Setaria italica]
Length=433

 Score =   243 bits (620),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL++QVARQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKDQVARQ--GVFKQFGYGN--SDNAFTDESEVKLHQRLEKLYLSTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLS++S+KYG ENTCTSG TLSKAA  F +A  QM
Sbjct  57   HFQRDIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVENTCTSGDTLSKAATYFGKARSQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER N+LKA GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  117  EKERCNMLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  160



>dbj|BAJ88132.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score =   241 bits (614),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL+EQVARQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKEQVARQ--GVFKQFGAGGN-SDNAFTDESEVKLHQRLEKLYLSTRAAK  57

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRD+VRGVE YIVTGSKQ+EIG+KLS++S+KYGSENTCTSG TLS+AA  + +A   +
Sbjct  58   HFQRDVVRGVEGYIVTGSKQIEIGNKLSDDSQKYGSENTCTSGNTLSRAATYYGKARSLI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKA GTQVAEPLRAMVMGAPLEDARHLAQRYDR+RQE
Sbjct  118  EKERGNMLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRIRQE  161



>ref|NP_001141834.1| uncharacterized protein LOC100273976 [Zea mays]
 gb|ACF87143.1| unknown [Zea mays]
 tpg|DAA36650.1| TPA: hypothetical protein ZEAMMB73_792317 [Zea mays]
Length=368

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 140/164 (85%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL++QV+RQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKDQVSRQ--GVFKQFGYGN--SDNAFTDESEVKLHQRLEKLYLSTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQVEIG+KLS++S+KYG  NTCTSG TLSKAA  F +A  QM
Sbjct  57   HFQRDIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVGNTCTSGDTLSKAATYFGKARSQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+LKA GTQVAEPLRAMVMGAPLEDARH+AQRYDR RQE
Sbjct  117  EKERGNMLKAFGTQVAEPLRAMVMGAPLEDARHMAQRYDRTRQE  160



>ref|XP_004291816.1| PREDICTED: src substrate cortactin-like [Fragaria vesca subsp. 
vesca]
Length=366

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 138/164 (84%), Gaps = 4/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+ IRK    LR+QVA+QQQAVFKQF GG  GS     DE+EL QHQKLEKL+ISTRA K
Sbjct  1    METIRK----LRDQVAKQQQAVFKQFAGGMYGSSDNVVDETELQQHQKLEKLFISTRAGK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H+QRDIVRGVE YIVTGSK VEIG+KLSE+SRKYGSE TCT+G TLS+AAL F RA  QM
Sbjct  57   HYQRDIVRGVEGYIVTGSKLVEIGTKLSEDSRKYGSEKTCTTGNTLSRAALSFGRARAQM  116

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKE G LLKALGTQVAEPLRAMV+GAPLEDARHLAQRY RMRQE
Sbjct  117  EKECGILLKALGTQVAEPLRAMVVGAPLEDARHLAQRYSRMRQE  160



>gb|EMT16700.1| hypothetical protein F775_32426 [Aegilops tauschii]
Length=395

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggf-ggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+A+ KQA+RL+EQVARQ   VFKQFG G  G SD   TDESE+  HQ+LEKLY+STRAA
Sbjct  1    MEALWKQASRLKEQVARQ--GVFKQFGAGGYGNSDNAFTDESEVKLHQRLEKLYLSTRAA  58

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRD+VRGVE YIVTGSKQVEIG+KLS++S+KYG ENTCTSG TLS+AA  + +A   
Sbjct  59   KHFQRDVVRGVEGYIVTGSKQVEIGNKLSDDSQKYGIENTCTSGNTLSRAATYYGKARSL  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKERGN+LKA GTQVAEPLRAMVMGAPLEDARHLAQRYDR+RQE
Sbjct  119  IEKERGNMLKAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRIRQE  163



>ref|XP_008221323.1| PREDICTED: intersectin-1-like [Prunus mume]
Length=367

 Score =   238 bits (607),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 143/165 (87%), Gaps = 5/165 (3%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRK    LR+QVA+QQQAVFKQF GG  G SD +  DE+EL QHQKLE+LYISTRAA
Sbjct  1    MEAIRK----LRDQVAKQQQAVFKQFSGGIYGGSDNIVPDETELQQHQKLERLYISTRAA  56

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+Q++IVRGVE YIVTGSKQVEIG+KLSE+SRKYG+E TCTSG TLS+AAL F RA  Q
Sbjct  57   KHYQKEIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAEKTCTSGNTLSRAALSFGRARAQ  116

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE G LLKALGTQVAEPLRAMV+GAPLEDARHLAQRY RM+QE
Sbjct  117  IEKECGILLKALGTQVAEPLRAMVVGAPLEDARHLAQRYARMQQE  161



>ref|XP_010105278.1| hypothetical protein L484_019422 [Morus notabilis]
 gb|EXC04213.1| hypothetical protein L484_019422 [Morus notabilis]
Length=349

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 139/165 (84%), Gaps = 13/165 (8%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LR+QVA+QQQAVFKQF GG  G SD +  DESEL QHQKLEKLYISTRA 
Sbjct  1    MEAIRKQATKLRDQVAKQQQAVFKQFAGGIYGGSDNILADESELQQHQKLEKLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDIVRGVE            G+KLSE+SRKYG+ENTCTSG+TLSKAAL F RA  Q
Sbjct  61   KHYQRDIVRGVE------------GTKLSEDSRKYGTENTCTSGSTLSKAALSFGRARAQ  108

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKERG LLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDRMRQE
Sbjct  109  IEKERGILLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRMRQE  153



>emb|CAE02784.2| OSJNBa0011L07.8 [Oryza sativa Japonica Group]
 emb|CAH67390.1| H0115B09.2 [Oryza sativa Indica Group]
 dbj|BAH00910.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77723.1| hypothetical protein OsI_16815 [Oryza sativa Indica Group]
 gb|EEE61421.1| hypothetical protein OsJ_15623 [Oryza sativa Japonica Group]
Length=369

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL+EQV+RQ   VFK FG  +G S+   TDESE++ HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKEQVSRQ--GVFKPFGAAYGNSENAFTDESEVNLHQRLEKLYLSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YIVTGSKQV+IG+KLS++S+KYG+ NTCTS  TLSKAA+ + +A   M
Sbjct  59   HFQRDIVRGVEGYIVTGSKQVDIGNKLSDDSQKYGTGNTCTSDNTLSKAAMYYGKARSLM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKERGN+L+A GTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE
Sbjct  119  EKERGNMLRAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  162



>ref|XP_007225776.1| hypothetical protein PRUPE_ppa007451mg [Prunus persica]
 gb|EMJ26975.1| hypothetical protein PRUPE_ppa007451mg [Prunus persica]
Length=367

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 142/165 (86%), Gaps = 5/165 (3%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRK    LR+QVA+QQQ VFKQF GG  G SD +  DE+EL QHQKLE+LYISTRAA
Sbjct  1    MEAIRK----LRDQVAKQQQVVFKQFSGGIYGGSDNIVPDETELQQHQKLERLYISTRAA  56

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+Q++IVRGVE YIVTGSKQVEIG+KLSE+SRKYG+E TCT+G TLS+AAL F RA  Q
Sbjct  57   KHYQKEIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAEKTCTTGNTLSRAALSFGRARAQ  116

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE G LLKALGTQVAEPLRAMV+GAPLEDARHLAQRY RMRQE
Sbjct  117  IEKECGILLKALGTQVAEPLRAMVVGAPLEDARHLAQRYARMRQE  161



>ref|XP_009337703.1| PREDICTED: uncharacterized protein LOC103930131 [Pyrus x bretschneideri]
Length=348

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 140/165 (85%), Gaps = 5/165 (3%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRK    LR+QVA+QQQAVFKQF GG  G SD V +DE+E  QHQKLEKLYISTRAA
Sbjct  1    MEAIRK----LRDQVAKQQQAVFKQFSGGIYGGSDNVASDENEFQQHQKLEKLYISTRAA  56

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+Q++IVRGVE YIV GSK VEIG+KLSE+SRKYGSE TCTSG TL++A L F RA  Q
Sbjct  57   KHYQKEIVRGVEGYIVAGSKHVEIGTKLSEDSRKYGSEKTCTSGNTLARAVLSFGRARAQ  116

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            ME+E G LLKALGTQVAEPLRAM++GAPLEDARHLAQRY RMRQE
Sbjct  117  MERECGVLLKALGTQVAEPLRAMIVGAPLEDARHLAQRYARMRQE  161



>ref|XP_009382718.1| PREDICTED: endophilin-A3-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=354

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfg-gSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQAT+LREQVARQQQAV KQFGGG    SD V TDE+EL Q++++E+LYISTR++
Sbjct  1    MDAIRKQATKLREQVARQQQAVLKQFGGGGYGISDNVITDEAELQQYRRIEQLYISTRSS  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE +IVTGSKQVEIG+KLS++SRKYG EN+CTS  TLSKAAL FS+A   
Sbjct  61   KHFQRDIVRGVEGFIVTGSKQVEIGTKLSDDSRKYGVENSCTSDHTLSKAALIFSQARSH  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKER NLLK+L + V EPLRAMV+GA LEDARHLAQRY++MRQE
Sbjct  121  MEKERENLLKSLSSLVVEPLRAMVVGAQLEDARHLAQRYEKMRQE  165



>ref|XP_009382717.1| PREDICTED: endophilin-A3-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=371

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfg-gSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQAT+LREQVARQQQAV KQFGGG    SD V TDE+EL Q++++E+LYISTR++
Sbjct  1    MDAIRKQATKLREQVARQQQAVLKQFGGGGYGISDNVITDEAELQQYRRIEQLYISTRSS  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE +IVTGSKQVEIG+KLS++SRKYG EN+CTS  TLSKAAL FS+A   
Sbjct  61   KHFQRDIVRGVEGFIVTGSKQVEIGTKLSDDSRKYGVENSCTSDHTLSKAALIFSQARSH  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKER NLLK+L + V EPLRAMV+GA LEDARHLAQRY++MRQE
Sbjct  121  MEKERENLLKSLSSLVVEPLRAMVVGAQLEDARHLAQRYEKMRQE  165



>ref|XP_010906308.1| PREDICTED: endophilin-A1-like isoform X1 [Elaeis guineensis]
Length=396

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 146/190 (77%), Gaps = 26/190 (14%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQATR REQVARQQQAV KQ  GGG+GGS+ V  DE EL QHQ+LEKLYISTR+ 
Sbjct  1    MDALRKQATRFREQVARQQQAVLKQFGGGGYGGSENVLMDELELQQHQRLEKLYISTRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIG-------------------------SKLSEESRKY  338
            KHFQRDIVRGVE Y+VTGSKQVEIG                         +KLSE+S++Y
Sbjct  61   KHFQRDIVRGVEGYVVTGSKQVEIGNFANFIVSFHLKNLSSANLKIYFTGTKLSEDSKRY  120

Query  339  GSENTCTSGATLSKAALCFSRALVQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHL  518
            G EN+CT G+TLSKAAL F RA  Q+E+ERGNLLKALGTQVAEPLRAMV+GAPL DAR L
Sbjct  121  GVENSCTIGSTLSKAALGFGRARAQIEQERGNLLKALGTQVAEPLRAMVVGAPLGDAREL  180

Query  519  AQRYDRMRQE  548
            AQRY+RMRQE
Sbjct  181  AQRYERMRQE  190



>ref|XP_009335566.1| PREDICTED: endophilin-A1-like [Pyrus x bretschneideri]
Length=365

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 142/165 (86%), Gaps = 7/165 (4%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRK    LR+QVA+QQQAVFKQF GG  G SD V  DE+E  QHQK+EKLYISTR+A
Sbjct  1    MEAIRK----LRDQVAKQQQAVFKQFSGGIFGGSDNVAADENE--QHQKIEKLYISTRSA  54

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+Q++IVRGVE Y+V GSKQVEIG+KLSE+SRKYG+E TCTSG TLS+AAL F RA  Q
Sbjct  55   KHYQKEIVRGVEGYVVAGSKQVEIGTKLSEDSRKYGAEKTCTSGNTLSRAALSFGRARAQ  114

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERG LL+ALGTQVAEPLRAMV+GAPLEDARHLAQRY RMRQ+
Sbjct  115  MEKERGVLLRALGTQVAEPLRAMVVGAPLEDARHLAQRYARMRQD  159



>ref|XP_007135931.1| hypothetical protein PHAVU_009G004000g [Phaseolus vulgaris]
 gb|ESW07925.1| hypothetical protein PHAVU_009G004000g [Phaseolus vulgaris]
Length=352

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  153  SDYVGTDESELHQHQKLEKLYISTRAAKHFQRDIVRGVENYIVTGSKQVEIGSKLSEESR  332
            SD + TDE EL QHQKLEKLYISTRA KH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SR
Sbjct  15   SDNMVTDEVELQQHQKLEKLYISTRAGKHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSR  74

Query  333  KYGSENTCTSGATLSKAALCFSRALVQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDAR  512
            KYG++NTCTSG+TLS+AAL ++RA  QMEKERG+LLKALGTQVAEPLRAMVMGAPLEDAR
Sbjct  75   KYGADNTCTSGSTLSRAALNYARARAQMEKERGSLLKALGTQVAEPLRAMVMGAPLEDAR  134

Query  513  HLAQRYDRMRQE  548
            HLAQRYDRMRQE
Sbjct  135  HLAQRYDRMRQE  146



>ref|XP_008350497.1| PREDICTED: uncharacterized protein LOC103413834 [Malus domestica]
Length=372

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 141/165 (85%), Gaps = 7/165 (4%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRK    LR+QVA+QQQAVFKQF GG  G SD V  DE+E  QHQK+EKLYISTRAA
Sbjct  1    MEAIRK----LRDQVAKQQQAVFKQFSGGIFGGSDNVAADENE--QHQKIEKLYISTRAA  54

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+Q++IVRGVE Y+V GSKQVEIG+KLSE+SRKYG+E TCTSG TLS+AAL F RA  Q
Sbjct  55   KHYQKEIVRGVEGYVVAGSKQVEIGTKLSEDSRKYGAEKTCTSGNTLSRAALSFGRARAQ  114

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKERG LLKALGTQVA+PLRAMVMGAPL DARHLAQRY RMRQ+
Sbjct  115  MEKERGLLLKALGTQVAKPLRAMVMGAPLGDARHLAQRYARMRQD  159



>ref|XP_010647674.1| PREDICTED: endophilin-A3 isoform X1 [Vitis vinifera]
Length=413

 Score =   232 bits (592),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  153  SDYVGTDESELHQHQKLEKLYISTRAAKHFQRDIVRGVENYIVTGSKQVEIGSKLSEESR  332
            SD V TDE+EL QHQKLEKLYISTRA KHFQRDIVRGVE +IVTGSKQVEIG+KLSE+ R
Sbjct  76   SDNVITDEAELQQHQKLEKLYISTRAGKHFQRDIVRGVEGFIVTGSKQVEIGTKLSEDCR  135

Query  333  KYGSENTCTSGATLSKAALCFSRALVQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDAR  512
            KYG ENTCTSG TLSKAAL + RA  Q+EKERGNLLKALGTQVAEPLRAMVMGAPLEDAR
Sbjct  136  KYGVENTCTSGNTLSKAALNYGRARAQIEKERGNLLKALGTQVAEPLRAMVMGAPLEDAR  195

Query  513  HLAQRYDRMRQE  548
            HLAQRY+RMRQE
Sbjct  196  HLAQRYERMRQE  207



>ref|XP_010028641.1| PREDICTED: uncharacterized protein LOC104418872 [Eucalyptus grandis]
 gb|KCW55408.1| hypothetical protein EUGRSUZ_I01316 [Eucalyptus grandis]
Length=274

 Score =   228 bits (580),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  168  TDESELHQHQKLEKLYISTRAAKHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSE  347
             DE+E  QHQKLEKLYISTRA KHFQ+DIVRG E YIVTGSKQVEIG+KLSE+SRKYGSE
Sbjct  3    NDEAEFQQHQKLEKLYISTRAGKHFQKDIVRGAEGYIVTGSKQVEIGTKLSEDSRKYGSE  62

Query  348  NTCTSGATLSKAALCFSRALVQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQR  527
            NTCTSG+TL+KAAL + RA  Q+EKERGNLLKALGTQVAEPLRAMV GAPLE+ARHLAQR
Sbjct  63   NTCTSGSTLTKAALSYGRAWAQIEKERGNLLKALGTQVAEPLRAMVTGAPLEEARHLAQR  122

Query  528  YDRMRQE  548
            YDRMRQE
Sbjct  123  YDRMRQE  129



>ref|XP_006412199.1| hypothetical protein EUTSA_v10025594mg [Eutrema salsugineum]
 gb|ESQ53652.1| hypothetical protein EUTSA_v10025594mg [Eutrema salsugineum]
Length=351

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  168  TDESELHQHQKLEKLYISTRAAKHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSE  347
            +D++E+HQHQKLEKLYISTRAAKH+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGS+
Sbjct  19   SDDAEIHQHQKLEKLYISTRAAKHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSD  78

Query  348  NTCTSGATLSKAALCFSRALVQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQR  527
            NTCT+G  L++AAL + RA  QMEKERGN+LKALGTQVAEPLRAMV+GAPLEDARHLAQR
Sbjct  79   NTCTNGNVLTRAALSYGRARAQMEKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQR  138

Query  528  YDRMRQE  548
            YDRMRQE
Sbjct  139  YDRMRQE  145



>tpg|DAA49323.1| TPA: hypothetical protein ZEAMMB73_082862 [Zea mays]
Length=347

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  153  SDYVGTDESELHQHQKLEKLYISTRAAKHFQRDIVRGVENYIVTGSKQVEIGSKLSEESR  332
            +D V  DE+E  QH KLEKLYISTRAAKHFQRDIVRGVE YIVTGSKQVEIG+KL E+ +
Sbjct  10   ADGVFADEAEAQQHSKLEKLYISTRAAKHFQRDIVRGVEGYIVTGSKQVEIGNKLCEDGK  69

Query  333  KYGSENTCTSGATLSKAALCFSRALVQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDAR  512
            KYG+ENTCTSG+TLSKAAL F++A   MEKERGNLLKALGTQVAEPLRAMVMGAPLEDAR
Sbjct  70   KYGTENTCTSGSTLSKAALSFAKARSMMEKERGNLLKALGTQVAEPLRAMVMGAPLEDAR  129

Query  513  HLAQRYDRMRQE  548
            HLAQRYDRMRQE
Sbjct  130  HLAQRYDRMRQE  141



>ref|XP_006423446.1| hypothetical protein CICLE_v10029446mg [Citrus clementina]
 gb|ESR36686.1| hypothetical protein CICLE_v10029446mg [Citrus clementina]
Length=161

 Score =   218 bits (556),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 133/159 (84%), Gaps = 6/159 (4%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LREQVARQQQAVFKQ  GGG+GGSD V TDE+ELHQHQ+LE+LYISTRA 
Sbjct  1    MEAIRKQATKLREQVARQQQAVFKQFGGGGYGGSDNVVTDEAELHQHQRLERLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGS+NTCTSG TLSKAAL + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSDNTCTSGNTLSKAALSYGRARAQ  120

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRY  530
            MEKERGNLLKALGTQV  P   +V+   L    H   RY
Sbjct  121  MEKERGNLLKALGTQVC-PNNIVVVNLKL----HAWARY  154



>gb|KDO43878.1| hypothetical protein CISIN_1g0166992mg, partial [Citrus sinensis]
 gb|KDO43879.1| hypothetical protein CISIN_1g0166992mg, partial [Citrus sinensis]
 gb|KDO43880.1| hypothetical protein CISIN_1g0166992mg, partial [Citrus sinensis]
 gb|KDO43881.1| hypothetical protein CISIN_1g0166992mg, partial [Citrus sinensis]
 gb|KDO43882.1| hypothetical protein CISIN_1g0166992mg, partial [Citrus sinensis]
Length=135

 Score =   216 bits (549),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+AIRKQAT+LREQVARQQQAVFKQ  GGG+GGSD V TDE+ELHQHQ+LE+LYISTRA 
Sbjct  1    MEAIRKQATKLREQVARQQQAVFKQFGGGGYGGSDNVVTDEAELHQHQRLERLYISTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KHFQRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYGS+NTCTSG TLSKAAL + RA  Q
Sbjct  61   KHFQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSDNTCTSGNTLSKAALSYGRARAQ  120

Query  414  MEKERGNLLKALGTQ  458
            MEKERGNLLKALGTQ
Sbjct  121  MEKERGNLLKALGTQ  135



>ref|XP_010471129.1| PREDICTED: uncharacterized protein LOC104750968 [Camelina sativa]
Length=210

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  153  SDYVGTDESELHQHQKLEKLYISTRAAKHFQRDIVRGVENYIVTGSKQVEIGSKLSEESR  332
            SD + TDE ELH+HQ LEKLYIST +AKHFQRDIVRGV+ YI+TGSKQV+IG KL E+SR
Sbjct  51   SDTLITDEEELHRHQNLEKLYISTHSAKHFQRDIVRGVQGYIITGSKQVKIGIKLCEDSR  110

Query  333  KYGSENTCTSGATLSKAALCFSRALVQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDAR  512
            KYGS+NTCTSG TL++A+L F+ A   MEKERGNLLK LGTQVAEPLR+MVMGAPLEDAR
Sbjct  111  KYGSDNTCTSGNTLTRASLSFANARALMEKERGNLLKTLGTQVAEPLRSMVMGAPLEDAR  170

Query  513  HLAQRYDRMRQE  548
            HLAQ YD MRQE
Sbjct  171  HLAQWYDGMRQE  182



>gb|EMS57971.1| Nostrin [Triticum urartu]
Length=350

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = +3

Query  114  QAVFKQfgggf-ggSDYVGTDESELHQHQKLEKLYISTRAAKHFQRDIVRGVENYIVTGS  290
            Q VFKQFG G  G SD   TDESE+  HQ+LEKLY+STRAAKHFQRD+VRGVE YIVTGS
Sbjct  19   QGVFKQFGAGGYGNSDNAFTDESEVKLHQRLEKLYLSTRAAKHFQRDVVRGVEGYIVTGS  78

Query  291  KQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQMEKERGNLLKALGTQVAEP  470
            KQVEIG+KLS++S+KYG ENTCTSG TLS+AA  + +A   +EKERGN+LKA GTQVAEP
Sbjct  79   KQVEIGNKLSDDSQKYGIENTCTSGNTLSRAATYYGKARSLIEKERGNMLKAFGTQVAEP  138

Query  471  LRAMVMGAPLEDARHLAQRYDRMRQE  548
            LRAMVMGAPLEDARHLAQRYDR+RQE
Sbjct  139  LRAMVMGAPLEDARHLAQRYDRVRQE  164



>gb|EYU36758.1| hypothetical protein MIMGU_mgv1a009270mg [Erythranthe guttata]
Length=347

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 134/164 (82%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVA+QQQ V KQF GG   SD V + E+E+ Q  KLEKL ISTRAAK
Sbjct  1    MEAIRKQASKLREQVAKQQQDVLKQFVGG---SDNVESCETEIQQSDKLEKLCISTRAAK  57

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRG+E  IVTGSKQ+EIG++LSE+ +KYGSENTCTSG TLS  AL +S+A  Q+
Sbjct  58   HFQRDIVRGIEGLIVTGSKQIEIGTRLSEDGQKYGSENTCTSGNTLSNVALTYSKARAQI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKE  NLLK L TQV EPLR M++ +PLEDAR LA+RYDR+RQE
Sbjct  118  EKEHENLLKLLRTQVTEPLRDMIVRSPLEDARRLAKRYDRVRQE  161



>gb|AFW59009.1| hypothetical protein ZEAMMB73_187444 [Zea mays]
Length=379

 Score =   213 bits (542),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 134/176 (76%), Gaps = 16/176 (9%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A+ KQA+RL++QVARQ   VFKQFG G   SD   TDESE+  HQ+LEKLY+STRAAK
Sbjct  1    MEALWKQASRLKDQVARQ--GVFKQFGYGN--SDNAFTDESEVKMHQRLEKLYLSTRAAK  56

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRG+E YIVTGSKQVEIG+KLS++S+KYG+ENTCTSG TLSKAA  F +A  QM
Sbjct  57   HFQRDIVRGMEGYIVTGSKQVEIGNKLSDDSQKYGAENTCTSGDTLSKAATYFGKARSQM  116

Query  417  EKERGNLLKALGTQV-------AEPLRAMVMG-----APLEDARHLAQRYDRMRQE  548
            EKERGN+L A GTQV       A P      G     APLEDARHLAQRYDR RQE
Sbjct  117  EKERGNMLNAFGTQVYVPNAGFASPCGRATAGNGNGCAPLEDARHLAQRYDRTRQE  172



>ref|XP_002971082.1| hypothetical protein SELMODRAFT_94776 [Selaginella moellendorffii]
 gb|EFJ27680.1| hypothetical protein SELMODRAFT_94776 [Selaginella moellendorffii]
Length=362

 Score =   210 bits (534),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQAT+ REQVA+QQQAV KQF       +D + TDE+ELH+HQ+LEKL++STRA 
Sbjct  1    MDALRKQATKFREQVAKQQQAVLKQFSNHGPQGADVIITDEAELHRHQQLEKLFVSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDI+RGVE +I TG+KQ+E+ +KL+E+ R+Y  E+T   GA L+KA+L ++ A   
Sbjct  61   KHYQRDIIRGVEGFIATGTKQLELSTKLAEDCRRYSVESTKADGA-LAKASLHYADARFN  119

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKER  L +AL TQV EPLRAMVMGAPLEDARHL QRYDR+RQE
Sbjct  120  MEKERDGLHRALSTQVGEPLRAMVMGAPLEDARHLTQRYDRLRQE  164



>ref|XP_002962005.1| hypothetical protein SELMODRAFT_164821 [Selaginella moellendorffii]
 gb|EFJ37265.1| hypothetical protein SELMODRAFT_164821 [Selaginella moellendorffii]
Length=370

 Score =   210 bits (534),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfgg-SDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQAT+ REQVA+QQQAV KQF       +D + TDE+ELH+HQ+LEKL++STRA 
Sbjct  1    MDALRKQATKFREQVAKQQQAVLKQFSNHGPQGADVIITDEAELHRHQQLEKLFVSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+QRDI+RGVE +I TG+KQ+E+ +KL+E+ R+Y  E+T   GA L+KA+L ++ A   
Sbjct  61   KHYQRDIIRGVEGFIATGTKQLELSTKLAEDCRRYSVESTKADGA-LAKASLHYADARFN  119

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            MEKER  L +AL TQV EPLRAMVMGAPLEDARHL QRYDR+RQE
Sbjct  120  MEKERDGLHRALSTQVGEPLRAMVMGAPLEDARHLTQRYDRLRQE  164



>ref|XP_001758759.1| predicted protein [Physcomitrella patens]
 gb|EDQ76265.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRK+A+  RE VA+QQQAVFK F G     DY+  DE+EL +HQ+LEKLYIST+ AK
Sbjct  1    MDAIRKRASAFRETVAKQQQAVFKTFSGYVSQGDYLIHDEAELQRHQQLEKLYISTKTAK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR+IVR VE  I +G KQ+EI +KL+E+ RKY +E     GA L++AA+ F  A  QM
Sbjct  61   HFQREIVRAVEGIISSGVKQLEIVNKLAEDCRKYATEGPSNGGA-LARAAMQFGTARTQM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E+ER N+ +++GTQVAEPLRAMVMGAPLEDARHLAQRYDR+RQE
Sbjct  120  ERERDNMHRSIGTQVAEPLRAMVMGAPLEDARHLAQRYDRLRQE  163



>gb|ABR18100.1| unknown [Picea sitchensis]
Length=374

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQAT+LREQVA+QQQAV KQF G   G+D V TD++EL +HQ LE+LYISTRAAK
Sbjct  1    MDAIRKQATKLREQVAKQQQAVLKQFTGHGIGNDAVITDQAELQRHQHLERLYISTRAAK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE +I  GSKQ+E   KL+++  KY ++    S + LS+A+  F  +   M
Sbjct  61   HFQRDIVRGVEGHISAGSKQMEYAIKLADDCCKYANDGP-NSNSALSRASFYFGSSHNAM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER +L +  G QV EPLRAMV+GAPLEDARHLAQRYDR+RQE
Sbjct  120  EKEREDLHRIFGVQVTEPLRAMVVGAPLEDARHLAQRYDRIRQE  163



>ref|XP_010244214.1| PREDICTED: uncharacterized protein LOC104588092 isoform X1 [Nelumbo 
nucifera]
Length=374

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVA+QQQAV KQ G     S+ V TD+ EL  HQ+L+ LY STRAAK
Sbjct  1    MEAIRKQASKLREQVAKQQQAVLKQLGHFG--SETVMTDDDELQCHQQLQNLYNSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRD+VRGVEN+I T  KQ+EIG KL+E+  +YG+EN   SG +LS+AAL F  + + +
Sbjct  59   HFQRDLVRGVENFITTSLKQMEIGKKLAEDCCRYGNENQ-GSGFSLSRAALQFGTSHISI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER +LL+ LG QV+EPLRA++ GAPLEDARHL  RY+R+RQE
Sbjct  118  EKEREHLLEILGDQVSEPLRALITGAPLEDARHLTHRYERIRQE  161



>ref|XP_001775866.1| predicted protein [Physcomitrella patens]
 gb|EDQ59405.1| predicted protein [Physcomitrella patens]
Length=364

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 125/164 (76%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MD  RK A +LREQV +QQ AV KQ GG   GSD +  DE+E  +HQ+LEKLY STRAAK
Sbjct  1    MDMFRKSANKLREQVVKQQHAVLKQLGGHGSGSDVI-IDEAESQRHQQLEKLYASTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR++VRGVE  + TGSKQ+E+ +KL++E +KYG+E     GA LSKA+L +  A +QM
Sbjct  60   HFQRELVRGVEGIVSTGSKQLEVANKLADECKKYGTEGVGVGGA-LSKASLQYGTAKIQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER ++ + L TQVA+PLRAMV GAPLEDAR L QRYDR+RQE
Sbjct  119  EKERDSMHRVLSTQVADPLRAMVNGAPLEDARQLTQRYDRLRQE  162



>ref|XP_008347383.1| PREDICTED: uncharacterized protein LOC103410459 [Malus domestica]
 ref|XP_008364954.1| PREDICTED: uncharacterized protein LOC103428616 [Malus domestica]
Length=132

 Score =   184 bits (468),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 114/136 (84%), Gaps = 5/136 (4%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRK    LR+QVA+QQQAVFKQ  GG +GGSD V +DE+E  QHQKLEKLYISTRAA
Sbjct  1    MDAIRK----LRDQVAKQQQAVFKQFSGGIYGGSDNVASDENEFQQHQKLEKLYISTRAA  56

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            KH+Q++IVRGVE YIV GSK VEIG++LSE+SRKYGSE TCTSG TLS+AAL F RA  Q
Sbjct  57   KHYQKEIVRGVEGYIVAGSKHVEIGTRLSEDSRKYGSEKTCTSGNTLSRAALSFGRARAQ  116

Query  414  MEKERGNLLKALGTQV  461
            MEKE G LLKALGTQV
Sbjct  117  MEKECGVLLKALGTQV  132



>ref|XP_002960199.1| hypothetical protein SELMODRAFT_163731 [Selaginella moellendorffii]
 gb|EFJ37738.1| hypothetical protein SELMODRAFT_163731 [Selaginella moellendorffii]
Length=396

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 136/186 (73%), Gaps = 24/186 (13%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQA-------------------VFKQfgggfggS---DYVGT  170
            MDAIRKQA++ REQVA+QQQA                   VFKQF  G+GGS   D V T
Sbjct  1    MDAIRKQASKFREQVAKQQQARFHPGLGDLLTIWIGGSQAVFKQFSQGYGGSQGTDIV-T  59

Query  171  DESELHQHQKLEKLYISTRAAKHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSEN  350
            +E+E  +HQ+LE+L+ISTRA KHFQR+IVRG E  I TGSKQ+++ +KL+E+ RKY +E 
Sbjct  60   NEAEQQRHQQLERLFISTRAGKHFQREIVRGTEGLISTGSKQLDVSTKLAEDCRKYAAEG  119

Query  351  TCTSGATLSKAALCFSRALVQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRY  530
               +GA L+K+A  F  A + +EKER ++ +ALGTQVAEPLRAMVMGAPLEDARHLAQRY
Sbjct  120  PAPNGA-LAKSATYFGNARLNIEKERDSMHRALGTQVAEPLRAMVMGAPLEDARHLAQRY  178

Query  531  DRMRQE  548
            DR+RQE
Sbjct  179  DRLRQE  184



>ref|XP_002967508.1| hypothetical protein SELMODRAFT_169133 [Selaginella moellendorffii]
 gb|EFJ32107.1| hypothetical protein SELMODRAFT_169133 [Selaginella moellendorffii]
Length=396

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 136/186 (73%), Gaps = 24/186 (13%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQA-------------------VFKQfgggfggS---DYVGT  170
            MDAIRKQA++ REQVA+QQQA                   VFKQF  G+GGS   D V T
Sbjct  1    MDAIRKQASKFREQVAKQQQARFHPGLGDLLTIWIGGSQAVFKQFSQGYGGSQGTDIV-T  59

Query  171  DESELHQHQKLEKLYISTRAAKHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSEN  350
            +E+E  +HQ+LE+L+ISTRA KHFQR+IVRG E  I TGSKQ+++ +KL+E+ RKY +E 
Sbjct  60   NEAEQQRHQQLERLFISTRAGKHFQREIVRGTEGLISTGSKQLDVSTKLAEDCRKYAAEG  119

Query  351  TCTSGATLSKAALCFSRALVQMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRY  530
               +GA L+K+A  F  A + +EKER ++ +ALGTQVAEPLRAMVMGAPLEDARHLAQRY
Sbjct  120  PAPNGA-LAKSATYFGNARLNIEKERDSMHRALGTQVAEPLRAMVMGAPLEDARHLAQRY  178

Query  531  DRMRQE  548
            DR+RQE
Sbjct  179  DRLRQE  184



>ref|XP_007131766.1| hypothetical protein PHAVU_011G040000g [Phaseolus vulgaris]
 gb|ESW03760.1| hypothetical protein PHAVU_011G040000g [Phaseolus vulgaris]
Length=329

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +3

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            +H+QRDIVRGVE YIVTGSKQVEIG+KLSE+SRKYG+ENTCTSG TLS+AAL F++A  Q
Sbjct  19   QHYQRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGAENTCTSGNTLSRAALSFAQARAQ  78

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
             EKERGNLLKALGTQVAEPLRAMV+GAPLEDARHLAQRYDR+RQE
Sbjct  79   TEKERGNLLKALGTQVAEPLRAMVVGAPLEDARHLAQRYDRIRQE  123



>ref|XP_001774854.1| predicted protein [Physcomitrella patens]
 gb|EDQ60266.1| predicted protein [Physcomitrella patens]
Length=369

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 121/164 (74%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRK+A+  R+ VA+QQQAVFK      G  D +  DE+EL +H +LE+LY ST+ AK
Sbjct  1    MDAIRKRASAFRDSVAKQQQAVFK-SFSSHGSGDQLIIDEAELQRHHQLERLYTSTKIAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR+IVRGVE  I TG KQ E+ +KL+++ RKY +E   +SG  L+KA+  F  A  QM
Sbjct  60   HFQREIVRGVEGIISTGVKQYEVANKLADDCRKYATEGPSSSG-VLAKASFHFGSARKQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER N+ + +GTQVAEPLR+MVMGAPLEDAR L QRY+R+RQE
Sbjct  119  ENERDNMHRFIGTQVAEPLRSMVMGAPLEDARLLTQRYERLRQE  162



>ref|XP_006849407.1| hypothetical protein AMTR_s00160p00065370 [Amborella trichopoda]
 gb|ERN10988.1| hypothetical protein AMTR_s00160p00065370 [Amborella trichopoda]
Length=314

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 118/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++ REQVA+QQQAV KQF    +  SD + TDE+EL +HQ+LEKLY STR  
Sbjct  1    MDALRKQASKFREQVAKQQQAVIKQFTSSGYESSDVMVTDEAELQRHQQLEKLYSSTRTG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K+FQRD++R  E ++  G KQ+EIG KL+E+ RKYG E  C     L KAA  ++ A   
Sbjct  61   KNFQRDVLRAAEGFMANGLKQIEIGMKLAEDCRKYGVE--CNDNGMLLKAASLYASARAH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+    + L +QV EPLR+MV GAPLEDARHLAQRY RMR E
Sbjct  119  VEKEQEEFNRTLSSQVLEPLRSMVTGAPLEDARHLAQRYSRMRHE  163



>ref|XP_009626330.1| PREDICTED: uncharacterized protein LOC104117058 isoform X1 [Nicotiana 
tomentosiformis]
Length=362

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQAT+LREQVA+QQQA+ +Q G     S  V  DE+EL  HQ+L+ LY+STRAAK
Sbjct  1    MEAIKKQATKLREQVAKQQQAILRQLGHLGHES--VMVDEAELEIHQRLQDLYMSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE Y+ T  KQ+EI  KLSE   KYGSEN     +TL + A+ F  +   M
Sbjct  59   HFQRDIVRGVEGYLSTSKKQMEIARKLSENCCKYGSENQ-NGPSTLPRIAVEFGTSHAAM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E +R  +L   G QV EPLRA++ GAPLEDARHL  RYDRMRQE
Sbjct  118  EDQREIMLGVFGQQVCEPLRALIHGAPLEDARHLTHRYDRMRQE  161



>ref|XP_009793728.1| PREDICTED: endophilin-A2-like isoform X1 [Nicotiana sylvestris]
Length=362

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQAT+LREQVA+QQQA+ +Q G     S  V  DE+EL  HQ+L+ LY+STRAAK
Sbjct  1    MEAIKKQATKLREQVAKQQQAILRQLGHLGHES--VMVDEAELEIHQRLQDLYMSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE Y+ T  KQ+EI  KLSE   KYG EN     +TL + A+ F  +   M
Sbjct  59   HFQRDIVRGVEGYLSTSKKQMEIARKLSENCYKYGCENQ-NGPSTLPRIAVEFGTSHAAM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E +R  +L  LG QV EPLRA + GAPLEDARHL  RYDRMRQE
Sbjct  118  EDQREIMLGVLGQQVCEPLRASIHGAPLEDARHLTHRYDRMRQE  161



>ref|XP_010273384.1| PREDICTED: endophilin-A1 [Nelumbo nucifera]
Length=348

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 123/165 (75%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MD +RKQA++L+EQVA+QQQAV KQF G  +  SD + TDE E+ +HQ+LEKLY STRA 
Sbjct  1    MDVLRKQASKLKEQVAKQQQAVIKQFSGTGYERSDIMVTDEVEMQRHQQLEKLYKSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            + FQ+D++R  E +   G KQ+E G+KLSE+  KYGSEN+  +   L+KAA  +  A V 
Sbjct  61   RDFQKDVIRAAETFTAIGCKQIEAGTKLSEDCCKYGSENSHDN--ILAKAASLYGEARVH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +L K LG+Q+ EPLRAM +GAPLEDARHLAQRY RMR E
Sbjct  119  IEKEQEDLNKLLGSQILEPLRAMSIGAPLEDARHLAQRYSRMRHE  163



>ref|XP_007040922.1| Intersectin-2 [Theobroma cacao]
 gb|EOY25423.1| Intersectin-2 [Theobroma cacao]
Length=368

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 123/164 (75%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQAT+LREQVA+QQQAV +  G     ++ +  DE+EL  HQKL+ LYIST+AAK
Sbjct  1    MEAIKKQATKLREQVAKQQQAVLRHLGHFS--NEDITVDEAELQCHQKLQDLYISTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H QR+IVRG+E +I T SK +EI  KL+++  KYG+E+  +S + L++AAL F ++   M
Sbjct  59   HLQRNIVRGIEGFIATSSKLLEIARKLADDCCKYGAESQ-SSDSFLARAALQFGKSHKSM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  LG QV+EPLRA++ GAPLEDARHL  RYDR+RQE
Sbjct  118  EDERETLLGILGEQVSEPLRALITGAPLEDARHLTHRYDRLRQE  161



>ref|XP_006365386.1| PREDICTED: endophilin-A-like isoform X1 [Solanum tuberosum]
 ref|XP_006365387.1| PREDICTED: endophilin-A-like isoform X2 [Solanum tuberosum]
Length=362

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQAT+LREQVA+QQQA+ +Q G     S  V  DE+EL  HQ+L++LY+STRAAK
Sbjct  1    MEAIKKQATKLREQVAKQQQAILRQLGHLGHES--VMVDEAELEIHQRLQELYMSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YI T  KQVEI  KL +   KYGSE      +TL K A+ F  +   M
Sbjct  59   HFQRDIVRGVEGYISTSKKQVEIARKLVDNCYKYGSE-IQNGPSTLPKVAVEFGTSHAAM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E +R  +L  LG+QV EPLRA + GAPLEDARHL   YDRMRQE
Sbjct  118  EDQREIMLGVLGSQVCEPLRASIHGAPLEDARHLTHSYDRMRQE  161



>ref|XP_004246038.1| PREDICTED: endophilin-A-like [Solanum lycopersicum]
 ref|XP_010325644.1| PREDICTED: endophilin-A-like [Solanum lycopersicum]
Length=362

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 115/164 (70%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQAT+LREQVA+QQQA+ +Q G     S  V  DE+EL  HQ+L++LY+STRAAK
Sbjct  1    MEAIKKQATKLREQVAKQQQAILRQLGHLGHES--VMVDEAELEIHQRLQELYMSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRGVE YI T  KQVEI  KL +   KYGSE      +TL K A+ F      M
Sbjct  59   HFQRDIVRGVEGYISTSKKQVEIARKLVDNCYKYGSE-IQNGPSTLPKVAVEFGTTHAAM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E +R  +L  LG+QV EPLRA + GAPLEDARHL   YDRMRQE
Sbjct  118  EDQREIMLGVLGSQVCEPLRASIHGAPLEDARHLTHSYDRMRQE  161



>ref|XP_010933056.1| PREDICTED: intersectin-2-like isoform X2 [Elaeis guineensis]
Length=426

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 122/164 (74%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA+RLREQVA+QQQAV KQF G FG  D    DE+EL  HQKL+ LY STRAAK
Sbjct  2    MEAIRKQASRLREQVAKQQQAVLKQFSGRFGH-DSGLVDEAELQCHQKLQMLYTSTRAAK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H QRDIVRGVE ++    KQ+EI  +L+E   KYG+EN  +SG  L+ A+L F  + + M
Sbjct  61   HLQRDIVRGVEAFVAISLKQMEIVKRLAENCCKYGNENQ-SSGFALAMASLDFGTSHILM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER NLL  LG QV EPLRAM++GAPLEDAR L  RY+R+RQ+
Sbjct  120  EKERENLLNTLGDQVFEPLRAMIIGAPLEDARLLTYRYERIRQD  163



>gb|KJB60142.1| hypothetical protein B456_009G291600 [Gossypium raimondii]
Length=256

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQAT+LREQVA+QQQAV +  G     ++ V  DE++L  HQKL+ LY ST+AAK
Sbjct  1    MEAIKKQATKLREQVAKQQQAVLRHLGHFS--NEDVTVDEADLQCHQKLQDLYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H QR+IVRG+E +I T SK +EI  KL+++  K+G E+  T G++L+KAAL F  +   +
Sbjct  59   HLQRNIVRGIEGFIATSSKLIEISRKLADDCCKFGVEDQNT-GSSLAKAALHFGNSHKSI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  LG +V+EPLRA++ GAPLEDARHL  RYDR RQE
Sbjct  118  EDERETLLGILGERVSEPLRALITGAPLEDARHLTHRYDRFRQE  161



>ref|XP_010933055.1| PREDICTED: intersectin-2-like isoform X1 [Elaeis guineensis]
Length=504

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 122/164 (74%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA+RLREQVA+QQQAV KQF G FG  D    DE+EL  HQKL+ LY STRAAK
Sbjct  2    MEAIRKQASRLREQVAKQQQAVLKQFSGRFGH-DSGLVDEAELQCHQKLQMLYTSTRAAK  60

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H QRDIVRGVE ++    KQ+EI  +L+E   KYG+EN  +SG  L+ A+L F  + + M
Sbjct  61   HLQRDIVRGVEAFVAISLKQMEIVKRLAENCCKYGNENQ-SSGFALAMASLDFGTSHILM  119

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER NLL  LG QV EPLRAM++GAPLEDAR L  RY+R+RQ+
Sbjct  120  EKERENLLNTLGDQVFEPLRAMIIGAPLEDARLLTYRYERIRQD  163



>gb|KJB60143.1| hypothetical protein B456_009G291600 [Gossypium raimondii]
Length=305

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQAT+LREQVA+QQQAV +  G     ++ V  DE++L  HQKL+ LY ST+AAK
Sbjct  1    MEAIKKQATKLREQVAKQQQAVLRHLGHFS--NEDVTVDEADLQCHQKLQDLYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H QR+IVRG+E +I T SK +EI  KL+++  K+G E+  T G++L+KAAL F  +   +
Sbjct  59   HLQRNIVRGIEGFIATSSKLIEISRKLADDCCKFGVEDQNT-GSSLAKAALHFGNSHKSI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  LG +V+EPLRA++ GAPLEDARHL  RYDR RQE
Sbjct  118  EDERETLLGILGERVSEPLRALITGAPLEDARHLTHRYDRFRQE  161



>ref|XP_001777056.1| predicted protein [Physcomitrella patens]
 gb|EDQ58170.1| predicted protein [Physcomitrella patens]
Length=364

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 120/164 (73%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MD  RK A +LR+QV +QQ AV KQ GG   GSD +  DE EL +HQ+LEK Y STRAAK
Sbjct  1    MDRFRKSANKLRDQVVKQQHAVLKQLGGHASGSDII-IDEVELLRHQQLEKAYASTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR++VR VE  I  G+KQ+E+ +KL++E +KYG+E     G  LSK +L +  A +QM
Sbjct  60   HFQREVVRCVEGIISNGNKQLEVANKLADECKKYGTEGP-EIGMVLSKPSLQYGTAKIQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +KE+ ++L AL T+VAEPLRAM  G+PLEDAR L QRYDR+RQE
Sbjct  119  DKEQDSMLLALNTEVAEPLRAMFNGSPLEDARQLTQRYDRLRQE  162



>ref|XP_008802987.1| PREDICTED: uncharacterized protein LOC103716668 [Phoenix dactylifera]
Length=504

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 122/164 (74%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+ IRKQA+RLREQVA+QQQAV KQF G FG  D    DE+EL  HQKL+ LY STRAAK
Sbjct  1    METIRKQASRLREQVAKQQQAVLKQFSGRFGH-DSGLVDEAELQCHQKLQMLYSSTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H QRDIVRG+E +I    KQ+EI  KL+E   KYG+EN  +SG  L++A+L F  + + M
Sbjct  60   HLQRDIVRGMEAFIAISLKQMEIVKKLAENCCKYGNENQ-SSGFALARASLDFGTSHILM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER NLL  LG QV EPLRAM++GAPLEDAR L  RY+R+RQ+
Sbjct  119  EKERENLLNTLGDQVFEPLRAMIVGAPLEDARLLTYRYERIRQD  162



>gb|KJB60141.1| hypothetical protein B456_009G291600 [Gossypium raimondii]
Length=337

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQAT+LREQVA+QQQAV +  G     ++ V  DE++L  HQKL+ LY ST+AAK
Sbjct  1    MEAIKKQATKLREQVAKQQQAVLRHLGHFS--NEDVTVDEADLQCHQKLQDLYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H QR+IVRG+E +I T SK +EI  KL+++  K+G E+  T G++L+KAAL F  +   +
Sbjct  59   HLQRNIVRGIEGFIATSSKLIEISRKLADDCCKFGVEDQNT-GSSLAKAALHFGNSHKSI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  LG +V+EPLRA++ GAPLEDARHL  RYDR RQE
Sbjct  118  EDERETLLGILGERVSEPLRALITGAPLEDARHLTHRYDRFRQE  161



>ref|XP_010518975.1| PREDICTED: endophilin-A-like [Tarenaya hassleriana]
Length=372

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 112/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA + REQVARQQQAV K  G     +D V  DE ELH HQKL+ LY ST+AAK
Sbjct  1    MEAIRKQAAKFREQVARQQQAVLKHLGHVN--ADAVVVDEEELHCHQKLQDLYTSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR IVRG+E +I T +K +EIG KL+E+ ++YG EN       L++AAL F  +   M
Sbjct  59   RLQRSIVRGLEVFIATSTKLLEIGRKLAEDCKRYGDENQ-NGNTPLARAALHFGDSYKSM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  LG QV EP+R MV  APLEDARHL  RYDR+RQE
Sbjct  118  EDERETLLGFLGEQVCEPIRTMVYSAPLEDARHLVHRYDRLRQE  161



>ref|XP_006854237.1| hypothetical protein AMTR_s00048p00229110 [Amborella trichopoda]
 gb|ERN15704.1| hypothetical protein AMTR_s00048p00229110 [Amborella trichopoda]
Length=367

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 122/164 (74%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MD +++QA++ REQV++QQQAV +QF    G +D V TDE+E+  H+KLE LYISTRAAK
Sbjct  1    MDTLKRQASKFREQVSKQQQAVLRQFSTHGG-NDTVITDEAEVRCHKKLESLYISTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQ+D+VR +E  I T SKQ+EI +KL+++  KYG+E+  +S  TL+ A+  F  +   M
Sbjct  60   HFQKDVVRSIEGLISTSSKQMEIATKLADDCCKYGNESH-SSNTTLASASRQFGTSRNSM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER NL + L TQV+EPLRAMVMGAPLEDAR L  RYDR+ QE
Sbjct  119  ESERENLRRILSTQVSEPLRAMVMGAPLEDARLLTHRYDRIFQE  162



>ref|XP_009352104.1| PREDICTED: src substrate protein p85-like [Pyrus x bretschneideri]
Length=348

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVA+QQQAV KQF G  +  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDAIRKQASKLREQVAKQQQAVIKQFSGTGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+++V+  E +   G K +E G+KLSE+  +YG+EN  TS   L+K A  +  A   
Sbjct  61   KDFQKEVVKAAEAFTAIGYKHIEAGTKLSEDCSRYGAEN--TSDKILAKGASIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +L K L +Q+ +PLRAM++GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEQEDLNKLLSSQILDPLRAMIVGAPLEDARHLAQRYSRMRQE  163



>ref|XP_008371553.1| PREDICTED: src substrate protein p85 [Malus domestica]
Length=348

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVA+QQQAV KQF G  +  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDAIRKQASKLREQVAKQQQAVIKQFSGTGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+++V+  E +   G K +E G+KLSE+  +YG+EN  TS   L+K A  +  A   
Sbjct  61   KDFQKEVVKAAEAFTAIGYKHIEAGTKLSEDCSRYGAEN--TSDKILAKGASIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +L K L +Q+ +PLRAM++GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEQEDLNKLLSSQILDPLRAMIVGAPLEDARHLAQRYSRMRQE  163



>ref|XP_011005826.1| PREDICTED: intersectin-1 isoform X2 [Populus euphratica]
Length=349

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 122/165 (74%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF G  +  SD +  DE E+H+HQ+LEKLY STR+ 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSGTGYESSDVMVIDEVEMHRHQQLEKLYRSTRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+D+VR  E +   G + +E+G+KLSE+  +YG+EN   +   L+KAA  +  A   
Sbjct  61   KDFQKDVVRAAEAFTTIGYRHIELGTKLSEDCCRYGTENINEN--MLAKAAAIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +E+E+ +L + L +QV EPLRAM+ GAPLEDARHLAQRY RMRQE
Sbjct  119  VEQEQDDLNRLLSSQVLEPLRAMINGAPLEDARHLAQRYSRMRQE  163



>gb|KJB60138.1| hypothetical protein B456_009G291600 [Gossypium raimondii]
 gb|KJB60139.1| hypothetical protein B456_009G291600 [Gossypium raimondii]
Length=370

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQAT+LREQVA+QQQAV +  G     ++ V  DE++L  HQKL+ LY ST+AAK
Sbjct  1    MEAIKKQATKLREQVAKQQQAVLRHLGHFS--NEDVTVDEADLQCHQKLQDLYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H QR+IVRG+E +I T SK +EI  KL+++  K+G E+  T G++L+KAAL F  +   +
Sbjct  59   HLQRNIVRGIEGFIATSSKLIEISRKLADDCCKFGVEDQNT-GSSLAKAALHFGNSHKSI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  LG +V+EPLRA++ GAPLEDARHL  RYDR RQE
Sbjct  118  EDERETLLGILGERVSEPLRALITGAPLEDARHLTHRYDRFRQE  161



>ref|XP_009402970.1| PREDICTED: intersectin-1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402971.1| PREDICTED: intersectin-1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402972.1| PREDICTED: intersectin-1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 117/164 (71%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVA+QQQAVFKQ    F   D    DE+EL   QKL+ LY ST+AAK
Sbjct  1    MEAIRKQASKLREQVAKQQQAVFKQISVRFSH-DSSLVDEAELQCQQKLQMLYASTKAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H QRDIVRGVE +I   SKQ+EI +KL+E+  KYG++     G  L+  AL F  +   M
Sbjct  60   HLQRDIVRGVEAFIAISSKQMEIVNKLAEDCCKYGTKYQ-DFGFPLASGALNFGTSHSMM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER NLL  LG QV EP+RAM++GAPLEDAR L  RYDR+RQ+
Sbjct  119  EKERANLLTILGDQVYEPIRAMIIGAPLEDARFLTYRYDRIRQD  162



>ref|XP_010540699.1| PREDICTED: endophilin-A-like [Tarenaya hassleriana]
Length=373

 Score =   174 bits (440),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA + REQVARQQQAV K  G     +D    DE ELH HQKL+ LY ST+AAK
Sbjct  1    MEAIRKQAAKFREQVARQQQAVLKHLGHVT--ADAAVVDEEELHCHQKLQDLYTSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR+IVRG+E +I T +K +EIG KL+E+ +KYG EN   +   LS+ AL F  +    
Sbjct  59   RLQRNIVRGLEGFITTSTKLLEIGRKLAEDCKKYGDENQ-KANTPLSRVALHFGNSYKSA  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  LG QV EP+R M+  APLEDARHL  RYDR+RQE
Sbjct  118  EDERETLLGFLGDQVCEPIRTMIYSAPLEDARHLVHRYDRLRQE  161



>ref|XP_010929403.1| PREDICTED: uncharacterized protein LOC105050881 isoform X2 [Elaeis 
guineensis]
Length=322

 Score =   172 bits (436),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 121/165 (73%), Gaps = 2/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+A+RKQA++L+EQVA+QQQAV KQFGG  +  SD +  DE+EL +HQ+LEKLY STRA 
Sbjct  1    MEALRKQASKLKEQVAKQQQAVIKQFGGTGYESSDVMVIDEAELQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            + FQ+DI+R  E +   G K +EIG+KLSE+  KYG EN   S   L+K+A  +  AL+ 
Sbjct  61   RDFQKDIIRAAEGFAAIGYKHIEIGTKLSEDCYKYGGENKA-SDEILAKSASLYGGALIN  119

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE  +  K L +Q+ EPLRAM +GAPLEDAR+LAQRY RMR +
Sbjct  120  IEKEHEDFNKLLTSQIMEPLRAMAIGAPLEDARNLAQRYSRMRHD  164



>ref|XP_011005824.1| PREDICTED: intersectin-1 isoform X1 [Populus euphratica]
Length=349

 Score =   172 bits (437),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 121/165 (73%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF G  +  SD +  DE E+H+HQ+LEKLY STR+ 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSGTGYESSDVMVIDEVEMHRHQQLEKLYRSTRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+D+VR  E +   G + +E G+KLSE+  +YG+EN   +   L+KAA  +  A   
Sbjct  61   KDFQKDVVRAAEAFTTIGYRHIEAGTKLSEDCCRYGTENINEN--MLAKAAAIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +E+E+ +L + L +QV EPLRAM+ GAPLEDARHLAQRY RMRQE
Sbjct  119  VEQEQDDLNRLLSSQVLEPLRAMINGAPLEDARHLAQRYSRMRQE  163



>ref|XP_010929395.1| PREDICTED: nostrin isoform X1 [Elaeis guineensis]
Length=347

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 121/165 (73%), Gaps = 2/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+A+RKQA++L+EQVA+QQQAV KQFGG  +  SD +  DE+EL +HQ+LEKLY STRA 
Sbjct  1    MEALRKQASKLKEQVAKQQQAVIKQFGGTGYESSDVMVIDEAELQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            + FQ+DI+R  E +   G K +EIG+KLSE+  KYG EN   S   L+K+A  +  AL+ 
Sbjct  61   RDFQKDIIRAAEGFAAIGYKHIEIGTKLSEDCYKYGGENKA-SDEILAKSASLYGGALIN  119

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE  +  K L +Q+ EPLRAM +GAPLEDAR+LAQRY RMR +
Sbjct  120  IEKEHEDFNKLLTSQIMEPLRAMAIGAPLEDARNLAQRYSRMRHD  164



>gb|ACF88110.1| unknown [Zea mays]
 tpg|DAA36651.1| TPA: hypothetical protein ZEAMMB73_792317 [Zea mays]
Length=334

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  RDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQMEKE  425
            +DIVRGVE YIVTGSKQVEIG+KLS++S+KYG  NTCTSG TLSKAA  F +A  QMEKE
Sbjct  26   KDIVRGVEGYIVTGSKQVEIGNKLSDDSQKYGVGNTCTSGDTLSKAATYFGKARSQMEKE  85

Query  426  RGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            RGN+LKA GTQVAEPLRAMVMGAPLEDARH+AQRYDR RQE
Sbjct  86   RGNMLKAFGTQVAEPLRAMVMGAPLEDARHMAQRYDRTRQE  126



>gb|KCW72749.1| hypothetical protein EUGRSUZ_E01201 [Eucalyptus grandis]
Length=343

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQA++LREQVA+QQQA+ KQ G     +D +  DE EL  +++L+ LY STR AK
Sbjct  1    MEAIKKQASKLREQVAKQQQAILKQLGHFD--ADALMVDEDELQCYRQLQNLYNSTRVAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H QR+IVRGVE +I   SKQ+ I  KL+++   YG EN   SG+ LS+AAL F  +   M
Sbjct  59   HLQRNIVRGVEGFISISSKQMAIVRKLADDCCNYGVENQ-GSGSALSRAALSFGTSHNSM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER NLL  LG QV+EPLR ++ GAPLEDARHL +RYD++RQE
Sbjct  118  ESERANLLGTLGDQVSEPLRVVINGAPLEDARHLTRRYDKLRQE  161



>ref|XP_010113014.1| Myosin heavy chain IB [Morus notabilis]
 gb|EXC35185.1| Myosin heavy chain IB [Morus notabilis]
Length=431

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQAT+LREQVARQQQAV ++ G     ++ V  DE EL  HQ+L+ LY STRAAK
Sbjct  1    MDAIRKQATKLREQVARQQQAVLRRLGTLSNDTEMV--DEDELLCHQQLQNLYNSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR+IVRGVE +I   SKQ+EI  KL+E+  KYG  N     A L++A+  F  +   +
Sbjct  59   HFQRNIVRGVEGFISVSSKQMEIVRKLAEDFCKYGDANQTIHSA-LARASTYFGISHNSI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER  LLK L  QV EPLRA + GAPLEDARHLA RYD++RQ+
Sbjct  118  EKERDALLKILVDQVCEPLRAQINGAPLEDARHLAHRYDKLRQD  161



>ref|XP_004512443.1| PREDICTED: uncharacterized protein LOC101499228 [Cicer arietinum]
Length=478

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+RLREQVA+QQQA+ +Q G     ++++  DESE+  HQKL+KLY ST+ AK
Sbjct  1    MDAIRKQASRLREQVAKQQQAILRQLGQLS--NEHLMADESEVECHQKLQKLYTSTKTAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTC-TSGATLSKAALCFSRALVQ  413
            HFQR IVRG+E +I   SKQ+EI  KL+++  KYG+EN    S   L++ +L FS +   
Sbjct  59   HFQRHIVRGIEGFISVSSKQMEIVRKLAKDCYKYGTENENRGSDYPLARPSLQFSNSYDI  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +E ER  LL  LG Q++EPLRA + GAPLEDARHL   YD++RQE
Sbjct  119  LENERETLLGILGDQISEPLRAQITGAPLEDARHLTHNYDKLRQE  163



>ref|XP_009360818.1| PREDICTED: src substrate protein p85-like [Pyrus x bretschneideri]
 ref|XP_009360819.1| PREDICTED: src substrate protein p85-like [Pyrus x bretschneideri]
Length=348

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVA+QQQAV KQFGG  +  SD +  DE E+ +HQ+LEKLY STR+ 
Sbjct  1    MDAIRKQASKLREQVAKQQQAVIKQFGGTGYESSDVMVIDEVEMQRHQQLEKLYRSTRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+++V+  E +   G K +E G+KLSE+  +YG+EN  TS   L+K A  +  A   
Sbjct  61   KDFQKEVVKAAEAFTAIGYKHIEAGTKLSEDCSRYGAEN--TSDKILAKGASIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +L K L +Q+ +PLRAM+ GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEQEDLNKLLSSQILDPLRAMIAGAPLEDARHLAQRYSRMRQE  163



>ref|XP_010056148.1| PREDICTED: endophilin-A3 isoform X1 [Eucalyptus grandis]
 gb|KCW72750.1| hypothetical protein EUGRSUZ_E01201 [Eucalyptus grandis]
Length=371

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQA++LREQVA+QQQA+ KQ G     +D +  DE EL  +++L+ LY STR AK
Sbjct  1    MEAIKKQASKLREQVAKQQQAILKQLGHFD--ADALMVDEDELQCYRQLQNLYNSTRVAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            H QR+IVRGVE +I   SKQ+ I  KL+++   YG EN   SG+ LS+AAL F  +   M
Sbjct  59   HLQRNIVRGVEGFISISSKQMAIVRKLADDCCNYGVENQ-GSGSALSRAALSFGTSHNSM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER NLL  LG QV+EPLR ++ GAPLEDARHL +RYD++RQE
Sbjct  118  ESERANLLGTLGDQVSEPLRVVINGAPLEDARHLTRRYDKLRQE  161



>ref|XP_008373493.1| PREDICTED: nostrin [Malus domestica]
Length=353

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M++IRKQA++LREQVA+QQQAV K+ G     ++ V  DE EL  HQKL+ LY STRA K
Sbjct  1    MESIRKQASKLREQVAKQQQAVLKRLGNLG--NEAVMIDEEELMCHQKLQDLYNSTRATK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR +VRGVE +I T SKQ+EI  KL+E   KYG+EN  TS   L++ +  F  +   +
Sbjct  59   HFQRSVVRGVEAFISTSSKQMEIVRKLAENCCKYGAENQSTS-THLARGSEYFGTSYNSI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER   LK LG QVAEPLRA + GAPLEDARHL  RYD++RQE
Sbjct  118  EDEREAFLKVLGEQVAEPLRAQIAGAPLEDARHLTHRYDKLRQE  161



>ref|XP_007158110.1| hypothetical protein PHAVU_002G125000g [Phaseolus vulgaris]
 ref|XP_007158111.1| hypothetical protein PHAVU_002G125000g [Phaseolus vulgaris]
 gb|ESW30104.1| hypothetical protein PHAVU_002G125000g [Phaseolus vulgaris]
 gb|ESW30105.1| hypothetical protein PHAVU_002G125000g [Phaseolus vulgaris]
Length=362

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA++LREQVARQQQA+ +Q G     ++ + TDESE+  HQ+L+KLY ST+ AK
Sbjct  1    MDAIRKQASKLREQVARQQQAILRQLGQIS--NEPLMTDESEIECHQQLQKLYTSTKTAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR IVR +E +I   SKQ+ I  KL+ +  +YG+EN  +S   L++A+L F  +   M
Sbjct  59   HFQRHIVRAIEGFISVSSKQMAIARKLARDCCRYGTENLGSS-FPLARASLQFGNSYDMM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  LG Q++EPLRA + GAPLEDARHL  RYD++ QE
Sbjct  118  ENERETLLGILGDQISEPLRAQITGAPLEDARHLTHRYDKLHQE  161



>ref|XP_008349180.1| PREDICTED: src substrate protein p85-like [Malus domestica]
Length=348

 Score =   171 bits (432),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQ-fgggfggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDAIRKQA++LREQVA+QQQAV KQ  G G+  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDAIRKQASKLREQVAKQQQAVIKQFGGTGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+++V+  E +   G K +E G+KLSE+  +YG+EN  +S   L+K A  +  A   
Sbjct  61   KDFQKEVVKAAEAFTXIGYKHIEAGTKLSEDCSRYGAEN--SSDKILAKGASIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +L K L +Q+ +PLRAM+ GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEQEDLNKLLSSQILDPLRAMIAGAPLEDARHLAQRYSRMRQE  163



>gb|KDP21190.1| hypothetical protein JCGZ_21661 [Jatropha curcas]
Length=353

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF G  +  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSGTGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+DIV+  E +   G K +E G+KLSE+  +YG+EN   +   L+KAA  +  A   
Sbjct  61   KDFQKDIVKAAETFTAIGYKHIEAGTKLSEDCCRYGTEN--VNDNILAKAAAIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+  L + L +QV +PLRAM+ GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEQEELNQTLLSQVLDPLRAMITGAPLEDARHLAQRYSRMRQE  163



>ref|XP_002519756.1| vav3, putative [Ricinus communis]
 gb|EEF42729.1| vav3, putative [Ricinus communis]
Length=347

 Score =   170 bits (431),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 118/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA +LREQVA+QQQAV KQF G  +  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDALRKQAFKLREQVAKQQQAVIKQFSGTGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+DIV+  E +   G K +E G+KLSE+  +YG+EN   +   LSK A  +  A   
Sbjct  61   KDFQKDIVKAAETFTAIGYKHIEAGTKLSEDCCRYGTEN--ANDNILSKGAGIYGEARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +L++ L +QV +PLR M+ GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEQEDLIRLLSSQVLDPLRTMINGAPLEDARHLAQRYSRMRQE  163



>ref|XP_007211515.1| hypothetical protein PRUPE_ppa008017mg [Prunus persica]
 gb|EMJ12714.1| hypothetical protein PRUPE_ppa008017mg [Prunus persica]
Length=348

 Score =   170 bits (431),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF G  +  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSGTGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+++VR  E +   G K +E G+KLSE+  +YG+EN  T+   L+K A  +  A   
Sbjct  61   KDFQKEVVRAAEVFTAIGYKHIEAGTKLSEDCSRYGAEN--TNDKILAKGASIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +  K L +Q+ +PLRAM+ GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEQEDFNKLLSSQILDPLRAMIAGAPLEDARHLAQRYSRMRQE  163



>ref|XP_010644764.1| PREDICTED: uncharacterized protein LOC100249391 isoform X2 [Vitis 
vinifera]
Length=303

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 117/164 (71%), Gaps = 6/164 (4%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVARQQQAV KQ G     +  V  DE+E  Q   L+ LY STR AK
Sbjct  1    MEAIRKQASKLREQVARQQQAVLKQLGHFGIET--VVVDEAEQRQ---LQNLYNSTRTAK  55

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQ+DIVRG+E ++ T SKQ+EI  +++E+  KYG+EN  T G+ L++AAL F  +   M
Sbjct  56   HFQKDIVRGIEGFVSTSSKQMEIVRRMAEDCCKYGTENQST-GSPLARAALYFGNSHSSM  114

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER  LL     QV+EPLR ++ GAPLEDARHL  RY+R+RQE
Sbjct  115  EKERETLLGVFCDQVSEPLRVLITGAPLEDARHLTHRYERLRQE  158



>ref|XP_008789814.1| PREDICTED: src substrate protein p85 [Phoenix dactylifera]
Length=348

 Score =   170 bits (431),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+A+RKQA++L+EQVA+QQQAV KQF G  +  S  +  DE+EL +HQ+LEKLY STR+ 
Sbjct  1    MEALRKQASKLKEQVAKQQQAVIKQFSGTGYESSGAMVIDEAELQRHQQLEKLYRSTRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            + FQ+DI+R  E +   G K +EIG+KLSE+  KYG EN   S A L+KAA  +  AL+ 
Sbjct  61   RDFQKDIIRAAEGFATIGYKHIEIGTKLSEDCYKYGGENKA-SDAILAKAASLYGGALIN  119

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE  +  K L +Q+ EPLRAM +G PLEDAR+LAQRY RMR +
Sbjct  120  IEKEHEDFNKLLTSQIMEPLRAMAIGGPLEDARNLAQRYSRMRHD  164



>ref|XP_006369865.1| SH3 domain-containing protein 3 [Populus trichocarpa]
 gb|ERP66434.1| SH3 domain-containing protein 3 [Populus trichocarpa]
Length=349

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF G  +  SD +  DE E+H+HQ+LEKLY STR+ 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSGTGYESSDVMVIDEVEMHRHQQLEKLYRSTRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+D+V+  E +   G + +E G+KLSE+  +YG+EN   +   L+KAA  +  A   
Sbjct  61   KDFQKDVVKAAEAFTTIGYRHIEAGTKLSEDCCRYGTENINEN--MLAKAAAIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +E+E+ +L + L +QV EPLRAM+ G PLEDARHLAQRY RMRQE
Sbjct  119  VEQEQDDLNRLLSSQVLEPLRAMINGGPLEDARHLAQRYSRMRQE  163



>ref|XP_008225382.1| PREDICTED: src substrate protein p85 isoform X1 [Prunus mume]
Length=348

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF G  +  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSGTGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ++++R  E +   G K +E G+KLSE+  +YG+EN  T+   L+K A  +  A   
Sbjct  61   KDFQKEVLRAAEAFTAIGYKHIEAGTKLSEDCSRYGAEN--TNDKILAKGASIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +  K L +Q+ +PLRAM+ GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEQEDFNKLLSSQILDPLRAMIAGAPLEDARHLAQRYSRMRQE  163



>ref|XP_010460973.1| PREDICTED: intersectin-2-like [Camelina sativa]
Length=437

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA +LREQVARQQQAV K  G     +D V  DE ELH HQKL+ LY ST+AAK
Sbjct  1    MEAIRKQAAKLREQVARQQQAVLKHLGHVN--ADAVVVDEEELHCHQKLQDLYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR+IVRG+E +I TG+K VEIG K +E+ +KYG EN   +   LS+ A  F  +   +
Sbjct  59   RLQRNIVRGLEGFIATGTKVVEIGLKFAEDFKKYGDENP-DANTPLSRVAHHFGTSYKSV  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  L  QV EP+R M+  APLEDARHL   YDR+RQE
Sbjct  118  EGERETLLGVLSEQVCEPIRTMIYSAPLEDARHLVNHYDRLRQE  161



>ref|XP_010499689.1| PREDICTED: intersectin-2-like [Camelina sativa]
Length=437

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA +LREQVARQQQAV K  G     +D V  DE ELH HQKL+ LY ST+AAK
Sbjct  1    MEAIRKQAAKLREQVARQQQAVLKHLGHVN--ADAVVVDEEELHCHQKLQDLYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR+IVRG+E +I TG+K VEIG K +E+ +KYG EN   +   LS+ A  F  +   +
Sbjct  59   RLQRNIVRGLEGFIATGTKVVEIGLKFAEDFKKYGDENP-DANTPLSRVAHHFGTSYKSV  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  L  QV EP+R M+  APLEDARHL   YDR+RQE
Sbjct  118  EGERETLLGVLSEQVCEPIRTMIYSAPLEDARHLVNHYDRLRQE  161



>ref|XP_006415327.1| hypothetical protein EUTSA_v10007690mg [Eutrema salsugineum]
 gb|ESQ33680.1| hypothetical protein EUTSA_v10007690mg [Eutrema salsugineum]
Length=431

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA +LREQVARQQQAV K  G     +D V  DE ELH HQKL+ LY ST+AAK
Sbjct  1    MEAIRKQAAKLREQVARQQQAVLKHLGHVN--ADAVIVDEEELHCHQKLQDLYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR+IVRG+E +I TG+K VEIG K +E+ +KYG EN   +   LS+ A  F  +   +
Sbjct  59   RLQRNIVRGLEGFIATGTKVVEIGLKFAEDFKKYGDENP-DANTPLSRIAHHFGTSYKSV  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  L  QV EP+R M+  APLEDARHL   YDR+RQE
Sbjct  118  EDERETLLGTLSEQVCEPIRTMIYSAPLEDARHLVNHYDRLRQE  161



>ref|NP_174429.1| SH3 domain-containing protein [Arabidopsis thaliana]
 gb|AAG51264.1|AC027135_5 unknown protein [Arabidopsis thaliana]
 gb|AAL32438.1|AF367773_1 SH3 domain-containing protein 1 [Arabidopsis thaliana]
 gb|AAL87310.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45032.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31356.1| SH3 domain-containing protein [Arabidopsis thaliana]
Length=439

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA +LREQVARQQQAV K  G     +D V  DE ELH HQKL+ LY ST+AAK
Sbjct  1    MEAIRKQAAKLREQVARQQQAVLKHLGHVN--ADAVVVDEEELHCHQKLQDLYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR+IVRG+E +I TG+K VEIG K +E+ +KYG EN   +   LS+ A  F  +   +
Sbjct  59   RLQRNIVRGLEGFIATGTKVVEIGLKFAEDFKKYGDENP-DANTPLSRVAHHFGTSYKSV  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  L  QV EP+R M+  APLEDARHL   YDR+RQE
Sbjct  118  EGERETLLGVLSEQVCEPIRTMIYSAPLEDARHLVNHYDRLRQE  161



>ref|XP_002267588.1| PREDICTED: endophilin-A isoform X1 [Vitis vinifera]
 emb|CBI29233.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 117/164 (71%), Gaps = 6/164 (4%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA++LREQVARQQQAV KQ G     +  V  DE+E  Q   L+ LY STR AK
Sbjct  1    MEAIRKQASKLREQVARQQQAVLKQLGHFGIET--VVVDEAEQRQ---LQNLYNSTRTAK  55

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQ+DIVRG+E ++ T SKQ+EI  +++E+  KYG+EN  T G+ L++AAL F  +   M
Sbjct  56   HFQKDIVRGIEGFVSTSSKQMEIVRRMAEDCCKYGTENQST-GSPLARAALYFGNSHSSM  114

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER  LL     QV+EPLR ++ GAPLEDARHL  RY+R+RQE
Sbjct  115  EKERETLLGVFCDQVSEPLRVLITGAPLEDARHLTHRYERLRQE  158



>ref|XP_002272365.1| PREDICTED: src substrate cortactin [Vitis vinifera]
 emb|CBI30806.3| unnamed protein product [Vitis vinifera]
Length=348

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++ REQVA+QQQAV KQFGG  +  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDALRKQASKFREQVAKQQQAVIKQFGGTGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+DIVR  E +   G KQ+E G+KLSE+  +YG+EN   +   L++AA  +   L  
Sbjct  61   KDFQKDIVRAGEAFTAIGYKQIETGTKLSEDCCRYGAENINDN--ILARAASIYGDGLKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            + KE+ +L K L +Q+ +PLRAMV GAPLEDARHLAQRY RMR E
Sbjct  119  IAKEQEDLNKLLSSQILDPLRAMVTGAPLEDARHLAQRYSRMRHE  163



>ref|XP_008225384.1| PREDICTED: src substrate protein p85 isoform X2 [Prunus mume]
Length=348

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF G  +  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSGTGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ++++R  E +   G K +E G+KLSE+  +YG+EN  T+   L+K A  +  A   
Sbjct  61   KDFQKEVLRAAEAFTAIGYKHIESGTKLSEDCSRYGAEN--TNDKILAKGASIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +  K L +Q+ +PLRAM+ GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEQEDFNKLLSSQILDPLRAMIAGAPLEDARHLAQRYSRMRQE  163



>ref|XP_010478895.1| PREDICTED: intersectin-2 [Camelina sativa]
Length=438

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA +LREQVARQQQAV K  G     +D V  DE ELH HQKL+ LY ST+AAK
Sbjct  1    MEAIRKQAAKLREQVARQQQAVLKHLGHVN--ADAVVVDEEELHCHQKLQDLYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR+IVRG+E +I TG+K VEIG K +E+ +KYG EN   +   LS+ A  F  +   +
Sbjct  59   RLQRNIVRGLEGFIATGTKVVEIGLKFAEDFKKYGDENP-DANTPLSRVAHHFGTSYKSV  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  L  QV EP+R M+  APLEDARHL   YDR+RQE
Sbjct  118  EGERETLLVVLSEQVCEPIRTMIYSAPLEDARHLVNHYDRLRQE  161



>ref|XP_006307311.1| hypothetical protein CARUB_v10008931mg, partial [Capsella rubella]
 gb|EOA40209.1| hypothetical protein CARUB_v10008931mg, partial [Capsella rubella]
Length=468

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA +LREQVARQQQAV K  G     +D V  DE ELH HQKL+ LY ST+AAK
Sbjct  64   MEAIRKQAAKLREQVARQQQAVLKHLGHVN--ADAVVVDEEELHCHQKLQDLYSSTKAAK  121

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR+IVRG+E +I TG+K VEIG K +E+ +KYG EN   +   LS+ A  F  +   +
Sbjct  122  RLQRNIVRGLEGFIATGTKVVEIGLKFAEDFKKYGDENP-DANTPLSRVAHHFGTSYKSV  180

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  L  QV EP+R M+  APLEDARHL   YDR+RQE
Sbjct  181  EGERETLLGVLSEQVCEPIRTMIYSAPLEDARHLVNHYDRLRQE  224



>ref|NP_001242725.1| uncharacterized protein LOC100802256 [Glycine max]
 gb|ACU20780.1| unknown [Glycine max]
Length=348

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 114/165 (69%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF    +  SD V  DE E+ +H +LEKLY +TRA 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSSSGYESSDVVVIDEVEMQRHHQLEKLYRATRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ++IV+  E +   G K +E G+KLSE+  KYG+EN   S   LSKAA  +  A   
Sbjct  61   KDFQKEIVKAAETFTAIGYKHIETGTKLSEDCCKYGAEN--NSDNILSKAASVYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE   L + L TQV +PLR M+ G PLEDARHLAQRY RMRQE
Sbjct  119  VEKEHEELNRLLSTQVLDPLRQMINGVPLEDARHLAQRYSRMRQE  163



>ref|XP_006307312.1| hypothetical protein CARUB_v10008931mg, partial [Capsella rubella]
 gb|EOA40210.1| hypothetical protein CARUB_v10008931mg, partial [Capsella rubella]
Length=500

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA +LREQVARQQQAV K  G     +D V  DE ELH HQKL+ LY ST+AAK
Sbjct  64   MEAIRKQAAKLREQVARQQQAVLKHLGHVN--ADAVVVDEEELHCHQKLQDLYSSTKAAK  121

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR+IVRG+E +I TG+K VEIG K +E+ +KYG EN   +   LS+ A  F  +   +
Sbjct  122  RLQRNIVRGLEGFIATGTKVVEIGLKFAEDFKKYGDENP-DANTPLSRVAHHFGTSYKSV  180

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  L  QV EP+R M+  APLEDARHL   YDR+RQE
Sbjct  181  EGERETLLGVLSEQVCEPIRTMIYSAPLEDARHLVNHYDRLRQE  224



>ref|XP_004293651.1| PREDICTED: src substrate cortactin-like [Fragaria vesca subsp. 
vesca]
Length=348

 Score =   168 bits (425),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQFGG  +  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFGGTGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ++IV+  E     G K +E G+KLSE+  +YG+EN       L+K A  +  A   
Sbjct  61   KDFQKEIVKAAEALTAIGYKHIEAGTKLSEDCSRYGAENVHDK--ILAKGASIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +L K L +QV +PLRAM++GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEQEDLNKLLSSQVLDPLRAMILGAPLEDARHLAQRYSRMRQE  163



>emb|CDY12418.1| BnaC08g09070D [Brassica napus]
Length=433

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA +LREQVARQQQAV K  G     +D V  DE ELH HQKL++LY ST+AAK
Sbjct  1    MEAIRKQAAKLREQVARQQQAVLKHLGHVN--ADAVVVDEEELHCHQKLQELYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR+IVRG+E +I TG+K VEIG K +E+ +KYG EN   +   LS+ A  F  +   +
Sbjct  59   RLQRNIVRGLEGFIATGTKVVEIGLKFAEDCKKYGDENP-DANTPLSRVAHHFGTSYKSV  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E  R  LL  L  QV EP+R M+  APLEDARHL   YDR+RQE
Sbjct  118  EDGRETLLGVLSEQVCEPIRTMIYSAPLEDARHLVNHYDRLRQE  161



>ref|XP_008238032.1| PREDICTED: nostrin-like [Prunus mume]
Length=354

 Score =   168 bits (425),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M++IRKQA++LREQVA+QQQAV K+ G     ++ V  DE+EL  HQ L+ LY STRAAK
Sbjct  1    MESIRKQASKLREQVAKQQQAVLKRLGTLG--NEAVMIDEAELLCHQNLQDLYNSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR +VRGVE ++   SKQ+EI  KL+E+  KYG+EN  TS   L  A+  F  +   +
Sbjct  59   HFQRSLVRGVEAFVSISSKQMEIVRKLAEDCCKYGAENQSTS-TPLVIASDYFGTSYNSI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E+ER   LK LG QVAEPLRA + GAPLEDARHL  RYD++RQE
Sbjct  118  EEEREIFLKILGEQVAEPLRAQITGAPLEDARHLTHRYDKLRQE  161



>gb|EYU37462.1| hypothetical protein MIMGU_mgv1a008673mg [Erythranthe guttata]
Length=366

 Score =   168 bits (425),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AI+KQA++LREQVARQQQA+ +Q G    G   +  DE+++  HQ+L+ LY STRAAK
Sbjct  1    MEAIKKQASKLREQVARQQQAILRQLGQLGHGG--IMIDEADVELHQQLQILYKSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQRDIVRG++ Y+ T  KQ+EI  KL+E+  KYG EN   S + L+K A  F  +   M
Sbjct  59   HFQRDIVRGLDGYLSTSKKQMEIARKLAEDCCKYGIENR-ESDSPLAKVASDFGTSHASM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E  R  +L  LG QV+EPLRA + GAPLEDARHL  RYD+MRQE
Sbjct  118  EDHRETMLGILGYQVSEPLRAQISGAPLEDARHLTHRYDKMRQE  161



>ref|XP_004309886.1| PREDICTED: src substrate cortactin-like [Fragaria vesca subsp. 
vesca]
Length=348

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 117/165 (71%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA +LREQVA+QQQAV KQ GG  +  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDALRKQAIKLREQVAKQQQAVIKQLGGSGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ++IV+  E     G K +E G+KLSE+  +YG+EN       L+K A  +  A   
Sbjct  61   KDFQKEIVKAAEALTAIGYKHIEAGTKLSEDCSRYGAENVHDK--ILAKGASIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +L K L +QV +PLRAM++GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEQEDLNKLLSSQVLDPLRAMILGAPLEDARHLAQRYSRMRQE  163



>ref|XP_002462913.1| hypothetical protein SORBIDRAFT_02g034310 [Sorghum bicolor]
 gb|EER99434.1| hypothetical protein SORBIDRAFT_02g034310 [Sorghum bicolor]
Length=348

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 115/165 (70%), Gaps = 2/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+A+RKQA++ +EQVA+QQQAV KQF    +  SD V  DE EL +HQ+LEKLY STR+ 
Sbjct  1    MEALRKQASKFKEQVAKQQQAVIKQFSTTGYERSDSVVIDEVELQRHQQLEKLYTSTRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            + FQ+DIVR  E  +  G+K +E+G+K SE+  +YG ENT +  A L KAA  +  AL  
Sbjct  61   RDFQKDIVRAAEGLVSIGNKHIEVGTKFSEDCYRYGGENTASDEA-LGKAASLYGGALRN  119

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE  +  + L +Q  +PLR+M MGAPLEDAR LAQRY RMR E
Sbjct  120  IEKEYEDFNRILSSQTIDPLRSMAMGAPLEDARGLAQRYSRMRHE  164



>ref|XP_007209300.1| hypothetical protein PRUPE_ppa007834mg [Prunus persica]
 gb|EMJ10499.1| hypothetical protein PRUPE_ppa007834mg [Prunus persica]
Length=354

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M++IRKQA++LREQVA+QQQAV K+ G     ++ V  DE+EL  HQ L+ LY STRAAK
Sbjct  1    MESIRKQASKLREQVAKQQQAVLKRLGSLG--NEAVMIDEAELLCHQNLQDLYNSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR +VRGVE ++   SKQ+EI  KL+E+  KYG+EN  TS   L  A+  F  +   +
Sbjct  59   HFQRSLVRGVEAFVSISSKQMEIVRKLAEDCCKYGAENQSTS-TPLVIASDYFGTSYNSI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER   LK LG QVAEPLRA + GAPLEDARHL  RYD++RQE
Sbjct  118  EVEREIFLKILGEQVAEPLRAQITGAPLEDARHLTHRYDKLRQE  161



>ref|NP_001049658.1| Os03g0266700 [Oryza sativa Japonica Group]
 gb|ABF95153.1| Variant SH3 domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11572.1| Os03g0266700 [Oryza sativa Japonica Group]
 gb|EAZ26376.1| hypothetical protein OsJ_10259 [Oryza sativa Japonica Group]
 dbj|BAG93164.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74928.1| hypothetical protein OsI_10879 [Oryza sativa Indica Group]
Length=394

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 117/164 (71%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+ +RKQA++LRE VA+QQQAV KQF   +   D    DE+EL  HQ L++LY STRAAK
Sbjct  1    METLRKQASKLREHVAKQQQAVRKQFSARYNQ-DPSLVDEAELECHQNLQRLYNSTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR IVRGVE +I   +KQ+EI  KL+E+  +YG++N    G  L++A++ F  +  QM
Sbjct  60   HFQRSIVRGVEGFIAVSTKQMEIVKKLAEDCCRYGNDNQ-NFGFILARASVEFGNSHSQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER NLLK LG QV EPLR M+M APLEDAR L  RY R+RQ+
Sbjct  119  EKERENLLKFLGEQVFEPLREMIMSAPLEDARLLTYRYQRIRQD  162



>ref|XP_004984671.1| PREDICTED: intersectin-1-like [Setaria italica]
Length=380

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 120/164 (73%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A++KQA++LR+ VA+QQQAVFKQF   +   D    DE+EL  HQ L++LY +TRAAK
Sbjct  1    MEALKKQASKLRQHVAKQQQAVFKQFSARYNQ-DPSLVDEAELECHQNLQRLYSTTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR+IVRGVE +I   +KQ+EI  KL+E+  KYG++N    G  L+KA+  F ++  Q+
Sbjct  60   HFQRNIVRGVEGFIAVSTKQMEIVRKLAEDCCKYGNDNH-HFGFALAKASEEFGKSHKQI  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER +LLK LG QV EPLR M+M APLEDAR L  RY R+RQ+
Sbjct  119  EKEREDLLKILGEQVFEPLREMIMSAPLEDARLLTYRYQRIRQD  162



>ref|XP_007159517.1| hypothetical protein PHAVU_002G244100g [Phaseolus vulgaris]
 gb|ESW31511.1| hypothetical protein PHAVU_002G244100g [Phaseolus vulgaris]
Length=348

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 113/165 (68%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++ REQVA+QQQAV KQF    +  SD V  DE E+ +H +LEKLY +TR+ 
Sbjct  1    MDALRKQASKFREQVAKQQQAVIKQFSSSGYESSDVVVIDEVEMQRHHQLEKLYRATRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ++IV+  E +   G K +E G+KLSE+  KYG+EN   S   L+KAA  +  A   
Sbjct  61   KDFQKEIVKAAETFTAIGYKHIETGTKLSEDCSKYGAEN--NSDNILAKAASVYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE   L   L TQV +PLR M+ GAPLEDARHLAQRY RMRQE
Sbjct  119  VEKEHEELNLLLSTQVLDPLRQMINGAPLEDARHLAQRYSRMRQE  163



>tpg|DAA40947.1| TPA: hypothetical protein ZEAMMB73_945312 [Zea mays]
Length=323

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+A+RKQA++ +EQVA+QQQAV KQF    +  SD +  DE EL +HQ+LEKLY STR+ 
Sbjct  1    MEALRKQASKFKEQVAKQQQAVIKQFSTTGYERSDSIVIDEVELQRHQQLEKLYTSTRSV  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            + FQ+DIVR  E  +  G+K +E+G+K SE+  +YGSEN  +  A L KAA  +  AL  
Sbjct  61   RDFQKDIVRAAEGLVSIGNKHIEVGTKFSEDCYRYGSENNASDEA-LRKAASLYGGALRN  119

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE  +  + L +Q  +PLRAM MG PLEDAR LAQRY RMR E
Sbjct  120  IEKEYEDFNRILSSQTIDPLRAMAMGGPLEDARGLAQRYSRMRHE  164



>ref|XP_009108117.1| PREDICTED: intersectin-1 [Brassica rapa]
 emb|CDY27149.1| BnaA08g07870D [Brassica napus]
Length=433

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 111/164 (68%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA +LREQVARQQQAV K  G     +D V  DE ELH HQKL++LY ST+AAK
Sbjct  1    MEAIRKQAAKLREQVARQQQAVLKHLGHVN--ADAVVVDEEELHCHQKLQELYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR+IVRG+E +I TG+K VEIG K +E+ +KYG EN   +   LS+ +  F  +   +
Sbjct  59   RLQRNIVRGLEGFIATGTKVVEIGLKFAEDFKKYGDENP-DANTPLSRVSHHFGTSYKSV  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E  R  LL  L  QV EP+R M+  APLEDARHL   YDR+RQE
Sbjct  118  EDGRETLLGVLSEQVCEPIRTMIYSAPLEDARHLVNHYDRLRQE  161



>ref|XP_003531274.1| PREDICTED: intersectin-2-like [Glycine max]
 gb|KHN48043.1| Rho guanine nucleotide exchange factor 6 [Glycine soja]
Length=348

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 114/165 (69%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF    +  SD V  DE E+ +H +LEKLY +TR+ 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSSSGYESSDVVVIDEVEMQRHHQLEKLYRATRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ++IV+  E +   G K +E G+KLSE+  KYG+EN   S   L+KAA  +  A   
Sbjct  61   KDFQKEIVKAAETFTAIGYKHIETGTKLSEDCCKYGAEN--NSDNILAKAASVYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE   L + L TQV +PLR M+ G PLEDARHLAQRY RMRQE
Sbjct  119  VEKEHEELNRLLSTQVLDPLRQMINGVPLEDARHLAQRYSRMRQE  163



>ref|XP_006573487.1| PREDICTED: uncharacterized protein LOC100816554 [Glycine max]
 gb|KHN41748.1| Intersectin-1 [Glycine soja]
Length=362

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA++LREQVARQQQA+ +Q G     ++ + TDESE+   Q+L+KLY ST+ AK
Sbjct  1    MDAIRKQASKLREQVARQQQAILRQLGQIS--NEPLMTDESEIECLQQLQKLYTSTKTAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR IVR +E +I   SKQ+EI  +++ +  KYG+EN  +S   L++A+L F      M
Sbjct  59   HFQRHIVRAIEGFISVSSKQMEIVRRMARDCCKYGTENLGSS-YPLARASLQFGNTYDTM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  LG Q++EPLRA + GAPLEDARHL  RYD++ QE
Sbjct  118  ENERETLLGILGDQISEPLRAQITGAPLEDARHLTHRYDKLHQE  161



>ref|XP_002891145.1| SH3 domain-containing protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67404.1| SH3 domain-containing protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=439

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 110/164 (67%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+AIRKQA +LREQVARQQQAV K  G     +D V  DE ELH HQKL+ LY ST+AAK
Sbjct  1    MEAIRKQAAKLREQVARQQQAVLKHLGHVN--ADAVVVDEEELHCHQKLQDLYSSTKAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
              QR+IVRG+E +I  G+K VEIG K +E+ +KYG EN   +   LS+ +  F  +   +
Sbjct  59   RLQRNIVRGLEGFIAIGTKVVEIGLKFAEDFKKYGDENP-DANTPLSRVSHHFGTSYKSV  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  L  QV EP+R M+  APLEDARHL   YDR+RQE
Sbjct  118  EGERETLLGVLSEQVCEPIRTMIYSAPLEDARHLVNHYDRLRQE  161



>gb|AAP06881.1| unknown protein [Oryza sativa Japonica Group]
Length=441

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 117/164 (71%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+ +RKQA++LRE VA+QQQAV KQF   +   D    DE+EL  HQ L++LY STRAAK
Sbjct  1    METLRKQASKLREHVAKQQQAVRKQFSARYNQ-DPSLVDEAELECHQNLQRLYNSTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR IVRGVE +I   +KQ+EI  KL+E+  +YG++N    G  L++A++ F  +  QM
Sbjct  60   HFQRSIVRGVEGFIAVSTKQMEIVKKLAEDCCRYGNDNQ-NFGFILARASVEFGNSHSQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER NLLK LG QV EPLR M+M APLEDAR L  RY R+RQ+
Sbjct  119  EKERENLLKFLGEQVFEPLREMIMSAPLEDARLLTYRYQRIRQD  162



>ref|XP_002316744.1| SH3 domain-containing protein 3 [Populus trichocarpa]
 gb|EEE97356.1| SH3 domain-containing protein 3 [Populus trichocarpa]
Length=352

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF    +  SD +  DE E+H+HQ+LEK+Y  TRA 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSSTGYESSDVMVIDEVEMHRHQQLEKMYSLTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ+DI++  E++   G K VE G+KLSE+  +YG+EN   +   L+KAA  +  A   
Sbjct  61   KDFQKDILKAAESFTAIGYKHVEAGTKLSEDCCRYGTENINEN--ILAKAAAIYGDAHKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +E+E+ +L + L +Q+ +PLRAM+  +PLEDARHLAQRY RMRQE
Sbjct  119  VEQEQEDLNRLLFSQILDPLRAMITDSPLEDARHLAQRYSRMRQE  163



>gb|ACG32776.1| clathrin binding protein [Zea mays]
 gb|ACL54112.1| unknown [Zea mays]
 tpg|DAA40948.1| TPA: clathrin binding protein [Zea mays]
Length=348

 Score =   165 bits (418),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+A+RKQA++ +EQVA+QQQAV KQF    +  SD +  DE EL +HQ+LEKLY STR+ 
Sbjct  1    MEALRKQASKFKEQVAKQQQAVIKQFSTTGYERSDSIVIDEVELQRHQQLEKLYTSTRSV  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            + FQ+DIVR  E  +  G+K +E+G+K SE+  +YGSEN  +  A L KAA  +  AL  
Sbjct  61   RDFQKDIVRAAEGLVSIGNKHIEVGTKFSEDCYRYGSENNASDEA-LRKAASLYGGALRN  119

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE  +  + L +Q  +PLRAM MG PLEDAR LAQRY RMR E
Sbjct  120  IEKEYEDFNRILSSQTIDPLRAMAMGGPLEDARGLAQRYSRMRHE  164



>gb|KHG30793.1| Rho guanine nucleotide exchange factor 6 [Gossypium arboreum]
Length=360

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA R+QA++LREQVA+QQQAV KQF G  +  SD V  DE E+ +HQ+L+KLY STR+A
Sbjct  1    MDAFRRQASKLREQVAKQQQAVIKQFSGTGYESSDVVVIDEIEMQRHQQLDKLYKSTRSA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENT-CTSGATLSKAALCFSRALV  410
            + FQ+++++  E +   G K +E G+K SEE  +YG+EN+   +   L+KAA  +     
Sbjct  61   RDFQKEVIKAAEAFTAIGYKHIETGTKFSEECCRYGTENSENINENVLAKAAAIYGDGCK  120

Query  411  QMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
             +EKE+ +L+K L  QV +PLRAM  GAPLEDARHLAQRY RMRQE
Sbjct  121  HVEKEQEDLIKLLSQQVLDPLRAMSAGAPLEDARHLAQRYSRMRQE  166



>ref|XP_002468124.1| hypothetical protein SORBIDRAFT_01g040020 [Sorghum bicolor]
 gb|EER95122.1| hypothetical protein SORBIDRAFT_01g040020 [Sorghum bicolor]
Length=380

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 120/164 (73%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+A++KQA++LRE VA+QQQAV KQF   +   D    DE+EL  HQ L++LY +TRAAK
Sbjct  1    MEALKKQASKLREHVAKQQQAVLKQFSARYNQ-DPSLVDEAELECHQNLQRLYSTTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR+IVRGVE +I   +KQ+EI  KL+E+  KYG++N    G  L++A+  F ++  Q+
Sbjct  60   HFQRNIVRGVEGFIAISTKQMEIVKKLAEDCCKYGNDNQ-HFGFALARASEEFGKSHKQI  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            EKER +LLK+LG QV EPLR M+M APLEDAR L  RY R+RQ+
Sbjct  119  EKEREDLLKSLGEQVFEPLREMIMSAPLEDARLLTYRYQRIRQD  162



>ref|XP_006649811.1| PREDICTED: intersectin-1-like [Oryza brachyantha]
Length=386

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 117/164 (71%), Gaps = 2/164 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M+ +RKQA++LRE VA+QQQAV KQF   +   D    DE+EL  HQ L++LY STRAAK
Sbjct  1    METLRKQASKLREHVAKQQQAVRKQFSARYNQ-DPSLVDEAELECHQNLQRLYNSTRAAK  59

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR IVRGVE +I   +KQ+EI  +L+E+  +YG++N    G  L++A++ F  +  QM
Sbjct  60   HFQRSIVRGVEGFIAVSTKQMEIVKRLAEDCCRYGNDNK-NFGFVLARASVEFGNSHNQM  118

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E+ER NLLK LG QV EPLR M+M APLEDAR L  RY R+RQ+
Sbjct  119  ERERANLLKFLGEQVFEPLREMIMSAPLEDARLLTYRYQRIRQD  162



>gb|KJB66901.1| hypothetical protein B456_010G163900 [Gossypium raimondii]
Length=351

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA R+QA++LREQVA+QQQAV KQF G  +  SD V  DE E+ +HQ+L+KLY STR+A
Sbjct  1    MDAFRRQASKLREQVAKQQQAVIKQFSGTGYESSDVVVIDEIEMQRHQQLDKLYKSTRSA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENT-CTSGATLSKAALCFSRALV  410
            + FQ+++++  E +   G K +E G+K SEE  +YG+EN+   +   L+KAA  +     
Sbjct  61   RDFQKEVIKAAEAFTAIGYKHIETGTKFSEECCRYGTENSENINENILAKAAAIYGDGCK  120

Query  411  QMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
             +EKE+ +L+K L  QV +PLRAM  GAPLEDARHLAQRY RMRQE
Sbjct  121  HVEKEQEDLIKLLSQQVLDPLRAMSAGAPLEDARHLAQRYSRMRQE  166



>ref|XP_010559274.1| PREDICTED: nostrin isoform X1 [Tarenaya hassleriana]
Length=351

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 120/165 (73%), Gaps = 2/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LR+QVA+QQQAV KQFGG  +  SD +  DE E+ +H +LEKLY STR+A
Sbjct  1    MDALRKQASKLRDQVAKQQQAVIKQFGGTGYESSDVMVIDEVEMQRHHQLEKLYRSTRSA  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENT-CTSGATLSKAALCFSRALV  410
            K FQR++++  E +   G K +E G+KLSE+  KYG++N+   +   L+KAA  +  A  
Sbjct  61   KDFQREVIKAAETFTAIGLKHIEAGTKLSEDCCKYGTDNSQNINENILAKAAAIYGDARK  120

Query  411  QMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQ  545
             +EKE+ +  K L +QV +PLRAMV+G PLEDARHLAQRY RMRQ
Sbjct  121  HVEKEQEDFNKLLSSQVMDPLRAMVIGTPLEDARHLAQRYSRMRQ  165



>ref|XP_003534329.1| PREDICTED: endophilin-A3-like isoform X1 [Glycine max]
 ref|XP_006587647.1| PREDICTED: endophilin-A3-like isoform X2 [Glycine max]
 ref|XP_006587648.1| PREDICTED: endophilin-A3-like isoform X3 [Glycine max]
 ref|XP_006587649.1| PREDICTED: endophilin-A3-like isoform X4 [Glycine max]
Length=362

 Score =   165 bits (418),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA++LREQVARQQQ + +Q G     ++ +  DESE+  HQ+L+KLY ST+ AK
Sbjct  1    MDAIRKQASKLREQVARQQQVILRQLGQIS--NEPLMIDESEIECHQQLQKLYTSTKTAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR IVR +E ++   SKQ+EI  +++ +  KYG+EN  +S   L++A+L F      M
Sbjct  59   HFQRHIVRAIEGFVSVCSKQMEIVRRMARDCCKYGTENLGSS-YLLARASLQFGNTYDTM  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E ER  LL  LG Q++EPLRA + GAPLEDARHL +RYD++ QE
Sbjct  118  ENERETLLGILGDQISEPLRAQITGAPLEDARHLTRRYDKLHQE  161



>ref|XP_011096472.1| PREDICTED: src substrate protein p85 [Sesamum indicum]
Length=348

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 115/165 (70%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGT-DESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQFGG    S  V   DE E+  H +LEKLY STR+ 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFGGSGYESSQVMVIDEVEMQMHHQLEKLYRSTRSG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            + FQ++IV+  E +   G K +E G+KLSE+  KYG EN   S   L+KAA  +  A   
Sbjct  61   RDFQKEIVKAAEAFTAVGYKHIEAGTKLSEDCSKYGVENA--SDEILAKAASIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +  + L TQV EPLRAM+ G+PLEDARHLAQRY RMRQE
Sbjct  119  VEKEQDDFNRLLFTQVLEPLRAMITGSPLEDARHLAQRYSRMRQE  163



>ref|NP_001150587.1| clathrin binding protein [Zea mays]
 gb|ACG39657.1| clathrin binding protein [Zea mays]
Length=348

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            M+A+RKQA++ +EQVA+QQQAV KQF    +  SD +  DE EL +HQ+LEKLY STR+ 
Sbjct  1    MEALRKQASKFKEQVAKQQQAVIKQFSTTGYERSDSIVIDEVELQRHQQLEKLYTSTRSV  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            + FQ+DIVR  E  +  G+K +E+G+K SE+  +YGSEN  +  A L KAA  +  AL  
Sbjct  61   RDFQKDIVRAAEGLVSIGNKHIEVGTKFSEDCYRYGSENNASDEA-LRKAASLYGGALRN  119

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE  +  + L +Q  +PLRAM MG PLEDAR LAQRY RMR E
Sbjct  120  IEKEYEDFNRILSSQTIDPLRAMAMGRPLEDARGLAQRYSRMRHE  164



>ref|XP_011465301.1| PREDICTED: nostrin isoform X2 [Fragaria vesca subsp. vesca]
Length=357

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M++IRKQAT+LRE+VA+QQQAV K+ G     ++ V  DE+E+  HQ+L  LY STRAAK
Sbjct  1    MESIRKQATKLREKVAKQQQAVLKRLGSLS--NEAVMVDEAEILCHQQLHDLYTSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR IVRGVE +I   SKQ+EI  KL+E+ RKYG+E   TS   L +A+  F  +   +
Sbjct  59   HFQRSIVRGVEAFISISSKQMEIVRKLAEDCRKYGAEIQNTS-TPLFRASTYFGTSHDSI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E+ER   L+ LG QV EPLR  + G+PLEDARHL  RYD++RQE
Sbjct  118  EEERETFLRILGEQVYEPLRTQLTGSPLEDARHLTHRYDKLRQE  161



>gb|KEH27665.1| clathrin-binding protein [Medicago truncatula]
Length=309

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 116/166 (70%), Gaps = 5/166 (3%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            MDAIRKQA+RLREQVA+QQQ++ +Q G     ++ +  DE EL    KL+KLY ST+ AK
Sbjct  1    MDAIRKQASRLREQVAKQQQSILRQLGQLS--NEPLMADEFELECFHKLQKLYTSTKTAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGAT--LSKAALCFSRALV  410
            HFQR IVRGVE  I   SKQ+EI  KL+++  KYG+EN    G+T  L++A+L F  +  
Sbjct  59   HFQRHIVRGVEGLISVSSKQMEIVRKLAKDCCKYGNENE-NQGSTYPLARASLQFGNSYE  117

Query  411  QMEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
             +E ER  LL  LG Q++EPLRA + GAPLEDARHL   YD++RQE
Sbjct  118  ILENERETLLGILGDQISEPLRAQITGAPLEDARHLTHNYDKLRQE  163



>ref|XP_004504244.1| PREDICTED: intersectin-2-like [Cicer arietinum]
Length=348

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 115/165 (70%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF G  +  SD V  DE E+ +HQ ++KLY +TRA 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSGSGYESSDVVVIDEVEMQRHQHMDKLYRATRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            + FQ++IV+  E +   G K +E G+KLSEE  +YG+EN   S   L+KAA  +  A   
Sbjct  61   RDFQKEIVKAAETFTAIGYKHIETGTKLSEECCRYGAEN--NSDNILAKAASVYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE   L + L +QV +PLR M+ GAPLEDARHLAQRY RMR E
Sbjct  119  VEKEHEELYRLLSSQVLDPLRQMINGAPLEDARHLAQRYSRMRHE  163



>emb|CDP19824.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 118/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF G  +  SD +  DE E+ +HQ+LEKLY STRA 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSGSGYESSDVMVIDEVEMQRHQQLEKLYRSTRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            + FQ++I++  E +   G K +E G+KLSE+  KYG EN       L+KAA  +  A   
Sbjct  61   RDFQKEIIKAAETFTAIGYKHIEAGNKLSEDCCKYGVENGHDE--ILAKAATIYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE+ +L K L ++V EPLRAM+ G+PLE+ARHLAQRY RMRQE
Sbjct  119  VEKEQEDLNKMLFSEVLEPLRAMITGSPLEEARHLAQRYSRMRQE  163



>ref|XP_004300402.1| PREDICTED: nostrin isoform X1 [Fragaria vesca subsp. vesca]
Length=378

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 116/164 (71%), Gaps = 3/164 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfgggfggSDYVGTDESELHQHQKLEKLYISTRAAK  236
            M++IRKQAT+LRE+VA+QQQAV K+ G     ++ V  DE+E+  HQ+L  LY STRAAK
Sbjct  1    MESIRKQATKLREKVAKQQQAVLKRLGSLS--NEAVMVDEAEILCHQQLHDLYTSTRAAK  58

Query  237  HFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQM  416
            HFQR IVRGVE +I   SKQ+EI  KL+E+ RKYG+E   TS   L +A+  F  +   +
Sbjct  59   HFQRSIVRGVEAFISISSKQMEIVRKLAEDCRKYGAEIQNTS-TPLFRASTYFGTSHDSI  117

Query  417  EKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            E+ER   L+ LG QV EPLR  + G+PLEDARHL  RYD++RQE
Sbjct  118  EEERETFLRILGEQVYEPLRTQLTGSPLEDARHLTHRYDKLRQE  161



>gb|KHN06451.1| Rho guanine nucleotide exchange factor 6 [Glycine soja]
Length=348

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 112/165 (68%), Gaps = 3/165 (2%)
 Frame = +3

Query  57   MDAIRKQATRLREQVARQQQAVFKQfggg-fggSDYVGTDESELHQHQKLEKLYISTRAA  233
            MDA+RKQA++LREQVA+QQQAV KQF    +  SD V  DE E+ +H +LEKLY +TRA 
Sbjct  1    MDALRKQASKLREQVAKQQQAVIKQFSSSGYESSDVVVIDEVEMQRHHQLEKLYRATRAG  60

Query  234  KHFQRDIVRGVENYIVTGSKQVEIGSKLSEESRKYGSENTCTSGATLSKAALCFSRALVQ  413
            K FQ++IV+  E +   G K +E G+KLSE+  KYG+EN   S   LSKAA  +  A   
Sbjct  61   KDFQKEIVKAAETFTAIGYKHIETGTKLSEDCCKYGAEN--NSDNILSKAASVYGDARKH  118

Query  414  MEKERGNLLKALGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQE  548
            +EKE   L + L TQV +PLR M+ G PLEDA HL QRY RMRQE
Sbjct  119  VEKEHEELNRLLSTQVLDPLRQMINGVPLEDACHLTQRYSRMRQE  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335