BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J11

Length=483
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001275225.1|  uncharacterized protein LOC102577570               103   1e-24   Solanum tuberosum [potatoes]
ref|XP_004234217.1|  PREDICTED: copper transport protein CCH            102   4e-24   Solanum lycopersicum
gb|ABA40464.1|  unknown                                                 102   4e-24   Solanum tuberosum [potatoes]
ref|XP_009621673.1|  PREDICTED: uncharacterized protein LOC104113263    102   8e-24   Nicotiana tomentosiformis
ref|XP_006351639.1|  PREDICTED: high mobility group nucleosome-bi...    102   8e-24   Solanum tuberosum [potatoes]
ref|XP_009771983.1|  PREDICTED: putative uncharacterized protein ...    100   2e-23   Nicotiana sylvestris
ref|XP_011076100.1|  PREDICTED: uncharacterized protein LOC105160429  99.0    9e-23   Sesamum indicum [beniseed]
ref|XP_011046036.1|  PREDICTED: putative late blight resistance p...  94.7    2e-21   Populus euphratica
gb|EYU25151.1|  hypothetical protein MIMGU_mgv11b013063mg             95.1    2e-21   Erythranthe guttata [common monkey flower]
gb|AAO63778.1|  unknown                                               91.3    5e-20   Populus tremuloides
ref|XP_002305267.1|  hypothetical protein POPTR_0004s07140g           90.9    6e-20   Populus trichocarpa [western balsam poplar]
gb|KEH26287.1|  heavy metal-associated domain protein                 90.5    8e-20   Medicago truncatula
ref|XP_007218588.1|  hypothetical protein PRUPE_ppa013273mg           90.1    1e-19   Prunus persica
ref|XP_011035351.1|  PREDICTED: FK506-binding protein 4-like isof...  89.7    2e-19   Populus euphratica
gb|AFK43139.1|  unknown                                               89.0    3e-19   Medicago truncatula
gb|KJB52723.1|  hypothetical protein B456_008G274100                  89.0    4e-19   Gossypium raimondii
ref|XP_009377561.1|  PREDICTED: FK506-binding protein 4-like          88.6    5e-19   Pyrus x bretschneideri [bai li]
gb|KJB52722.1|  hypothetical protein B456_008G274100                  88.6    6e-19   Gossypium raimondii
dbj|BAG15861.1|  hypothetical protein                                 88.2    6e-19   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_004516867.1|  PREDICTED: uncharacterized protein LOC101510149  87.8    7e-19   Cicer arietinum [garbanzo]
ref|XP_008362786.1|  PREDICTED: putative late blight resistance p...  87.8    7e-19   
gb|KEH26285.1|  heavy metal-associated domain protein                 87.8    8e-19   Medicago truncatula
ref|XP_007143475.1|  hypothetical protein PHAVU_007G075000g           88.2    9e-19   Phaseolus vulgaris [French bean]
ref|XP_004145901.1|  PREDICTED: uncharacterized protein LOC101215695  88.2    9e-19   Cucumis sativus [cucumbers]
ref|XP_004160362.1|  PREDICTED: uncharacterized protein LOC101225301  88.2    9e-19   
gb|EPS62150.1|  hypothetical protein M569_12645                       88.6    1e-18   Genlisea aurea
ref|XP_008380205.1|  PREDICTED: putative late blight resistance p...  87.4    1e-18   
ref|XP_009375530.1|  PREDICTED: FK506-binding protein 4-like          87.0    1e-18   Pyrus x bretschneideri [bai li]
gb|KHG19695.1|  Putative late blight resistance R1A-3                 87.0    2e-18   Gossypium arboreum [tree cotton]
gb|KEH26288.1|  heavy metal-associated domain protein                 87.4    2e-18   Medicago truncatula
ref|XP_008380151.1|  PREDICTED: FK506-binding protein 4-like          86.7    2e-18   
ref|XP_006360195.1|  PREDICTED: copper transport protein CCH-like...  87.0    3e-18   Solanum tuberosum [potatoes]
ref|XP_007143473.1|  hypothetical protein PHAVU_007G074800g           86.7    3e-18   Phaseolus vulgaris [French bean]
ref|XP_008234832.1|  PREDICTED: FK506-binding protein 4-like          86.3    3e-18   Prunus mume [ume]
ref|XP_006372382.1|  hypothetical protein POPTR_0017s01090g           85.9    5e-18   
emb|CDP05138.1|  unnamed protein product                              86.7    6e-18   Coffea canephora [robusta coffee]
ref|XP_008360723.1|  PREDICTED: uncharacterized protein LOC103424419  85.5    7e-18   
ref|XP_008437534.1|  PREDICTED: uncharacterized protein LOC103482919  85.5    7e-18   Cucumis melo [Oriental melon]
gb|KEH26283.1|  heavy metal-associated domain protein                 84.7    9e-18   Medicago truncatula
ref|XP_010671617.1|  PREDICTED: uncharacterized protein LOC104888366  85.1    9e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011046029.1|  PREDICTED: uncharacterized protein LOC105140...  84.7    1e-17   Populus euphratica
ref|XP_011046030.1|  PREDICTED: uncharacterized protein LOC105140...  84.7    1e-17   Populus euphratica
emb|CAN77999.1|  hypothetical protein VITISV_002984                   84.3    2e-17   Vitis vinifera
emb|CBI22643.3|  unnamed protein product                              84.3    2e-17   Vitis vinifera
ref|XP_011046033.1|  PREDICTED: uncharacterized protein LOC105140...  84.0    2e-17   Populus euphratica
gb|AFK36567.1|  unknown                                               84.0    2e-17   Lotus japonicus
ref|XP_002305266.2|  hypothetical protein POPTR_0004s07150g           84.0    2e-17   Populus trichocarpa [western balsam poplar]
gb|KEH26284.1|  heavy metal-associated domain protein                 84.3    3e-17   Medicago truncatula
ref|XP_003592378.1|  hypothetical protein MTR_1g102240                84.0    3e-17   Medicago truncatula
gb|KEH33280.1|  heavy metal transport/detoxification superfamily ...  83.2    3e-17   Medicago truncatula
ref|XP_003592191.1|  hypothetical protein MTR_1g099800                84.0    3e-17   Medicago truncatula
gb|KEH43672.1|  heavy metal transport/detoxification superfamily ...  83.6    3e-17   Medicago truncatula
ref|XP_011015695.1|  PREDICTED: uncharacterized protein LOC105119269  83.6    4e-17   Populus euphratica
gb|KEH33277.1|  heavy metal transport/detoxification superfamily ...  82.8    4e-17   Medicago truncatula
ref|XP_002278542.1|  PREDICTED: uncharacterized protein LOC100258716  83.6    4e-17   Vitis vinifera
ref|XP_009368729.1|  PREDICTED: FK506-binding protein 4               83.2    4e-17   Pyrus x bretschneideri [bai li]
gb|AFK42627.1|  unknown                                               82.8    4e-17   Medicago truncatula
ref|XP_003592192.1|  hypothetical protein MTR_1g099810                83.6    5e-17   Medicago truncatula
ref|XP_007160106.1|  hypothetical protein PHAVU_002G292900g           83.2    5e-17   Phaseolus vulgaris [French bean]
ref|XP_002274512.1|  PREDICTED: heavy metal-associated isoprenyla...  82.8    5e-17   Vitis vinifera
ref|XP_003535594.1|  PREDICTED: putative late blight resistance p...  83.2    6e-17   Glycine max [soybeans]
ref|XP_002509857.1|  metal ion binding protein, putative              82.8    6e-17   Ricinus communis
gb|KEH22477.1|  heavy metal transport/detoxification superfamily ...  82.4    6e-17   Medicago truncatula
ref|XP_004515154.1|  PREDICTED: uncharacterized protein LOC101499358  82.8    7e-17   Cicer arietinum [garbanzo]
ref|XP_008345258.1|  PREDICTED: FK506-binding protein 4-like          83.6    7e-17   Malus domestica [apple tree]
gb|AFK40989.1|  unknown                                               82.8    7e-17   Medicago truncatula
ref|XP_010105739.1|  hypothetical protein L484_014228                 82.4    9e-17   Morus notabilis
ref|XP_004496520.1|  PREDICTED: uncharacterized protein LOC101510144  82.4    9e-17   Cicer arietinum [garbanzo]
ref|XP_007208886.1|  hypothetical protein PRUPE_ppa026540mg           82.0    1e-16   Prunus persica
ref|XP_008376650.1|  PREDICTED: FK506-binding protein 4-like          82.0    1e-16   Malus domestica [apple tree]
ref|XP_010089046.1|  Putative late blight resistance-like protein     82.0    2e-16   Morus notabilis
ref|XP_007152164.1|  hypothetical protein PHAVU_004G107100g           81.3    2e-16   Phaseolus vulgaris [French bean]
gb|KHN21790.1|  hypothetical protein glysoja_027674                   81.6    2e-16   Glycine soja [wild soybean]
gb|KEH15395.1|  heavy metal transport/detoxification superfamily ...  81.3    2e-16   Medicago truncatula
ref|XP_004308048.1|  PREDICTED: FK506-binding protein 4-like          81.6    2e-16   Fragaria vesca subsp. vesca
ref|NP_001238668.1|  uncharacterized protein LOC100306170             81.6    2e-16   Glycine max [soybeans]
gb|AFK46184.1|  unknown                                               81.6    2e-16   Medicago truncatula
ref|XP_009377565.1|  PREDICTED: uncharacterized protein LOC103966144  81.3    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_009375534.1|  PREDICTED: uncharacterized protein LOC103964331  80.9    3e-16   Pyrus x bretschneideri [bai li]
gb|KHN42451.1|  hypothetical protein glysoja_033919                   80.9    3e-16   Glycine soja [wild soybean]
emb|CBI22646.3|  unnamed protein product                              80.1    3e-16   Vitis vinifera
ref|XP_011073260.1|  PREDICTED: copper transport protein CCH-like     81.3    3e-16   Sesamum indicum [beniseed]
ref|XP_004503674.1|  PREDICTED: uncharacterized protein LOC101514701  81.3    3e-16   Cicer arietinum [garbanzo]
ref|XP_004515151.1|  PREDICTED: uncharacterized protein LOC101498382  80.5    3e-16   Cicer arietinum [garbanzo]
ref|XP_008232983.1|  PREDICTED: FK506-binding protein 4               81.6    4e-16   Prunus mume [ume]
gb|KJB52724.1|  hypothetical protein B456_008G274200                  80.9    4e-16   Gossypium raimondii
ref|XP_011029352.1|  PREDICTED: putative late blight resistance p...  80.5    5e-16   Populus euphratica
ref|XP_009382266.1|  PREDICTED: titin-like                            82.4    5e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK46070.1|  unknown                                               79.7    5e-16   Medicago truncatula
ref|XP_010934499.1|  PREDICTED: uncharacterized protein LOC105054633  80.5    6e-16   Elaeis guineensis
ref|XP_011046028.1|  PREDICTED: uncharacterized protein LOC105140760  80.1    6e-16   Populus euphratica
ref|XP_002273341.2|  PREDICTED: uncharacterized protein LOC100247478  80.1    6e-16   Vitis vinifera
gb|KHN21789.1|  hypothetical protein glysoja_027673                   80.1    7e-16   Glycine soja [wild soybean]
ref|XP_008805584.1|  PREDICTED: putative late blight resistance p...  79.7    8e-16   
ref|XP_006386610.1|  hypothetical protein POPTR_0002s16500g           80.5    1e-15   
gb|AFK37277.1|  unknown                                               79.7    1e-15   Lotus japonicus
emb|CBI22648.3|  unnamed protein product                              78.6    1e-15   Vitis vinifera
gb|KEH21133.1|  heavy metal transport/detoxification superfamily ...  79.3    1e-15   Medicago truncatula
ref|XP_004515167.1|  PREDICTED: uncharacterized protein LOC101502738  79.0    1e-15   
gb|AFK37005.1|  unknown                                               80.1    1e-15   Lotus japonicus
gb|KJB09701.1|  hypothetical protein B456_001G157300                  80.1    1e-15   Gossypium raimondii
gb|KHN09290.1|  hypothetical protein glysoja_029061                   79.0    1e-15   Glycine soja [wild soybean]
ref|XP_004306736.1|  PREDICTED: FK506-binding protein 4               80.1    1e-15   Fragaria vesca subsp. vesca
ref|XP_011035350.1|  PREDICTED: uncharacterized protein LOC105133184  79.0    2e-15   Populus euphratica
gb|AFK47311.1|  unknown                                               79.3    2e-15   Lotus japonicus
ref|XP_007143472.1|  hypothetical protein PHAVU_007G074700g           78.2    2e-15   Phaseolus vulgaris [French bean]
ref|XP_006372383.1|  hypothetical protein POPTR_0017s01100g           79.0    2e-15   
ref|XP_009366561.1|  PREDICTED: FK506-binding protein 4               79.7    2e-15   Pyrus x bretschneideri [bai li]
gb|KHM99946.1|  Putative late blight resistance protein like R1B-19   79.0    2e-15   Glycine soja [wild soybean]
ref|XP_006422043.1|  hypothetical protein CICLE_v10006198mg           78.6    2e-15   Citrus clementina [clementine]
ref|XP_007152161.1|  hypothetical protein PHAVU_004G106900g           78.6    3e-15   Phaseolus vulgaris [French bean]
ref|NP_200086.1|  copper transport family protein                     78.2    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009363395.1|  PREDICTED: putative late blight resistance p...  78.6    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_007143471.1|  hypothetical protein PHAVU_007G074600g           78.6    3e-15   Phaseolus vulgaris [French bean]
ref|XP_002299508.1|  hypothetical protein POPTR_0001s09840g           79.0    3e-15   
ref|XP_004492796.1|  PREDICTED: FK506-binding protein 4-like          79.3    3e-15   Cicer arietinum [garbanzo]
dbj|BAO45868.1|  hypothetical protein                                 78.2    3e-15   Acacia mangium
gb|KJB37518.1|  hypothetical protein B456_006G208600                  78.6    3e-15   Gossypium raimondii
ref|XP_008238952.1|  PREDICTED: putative late blight resistance p...  78.2    3e-15   Prunus mume [ume]
ref|XP_004515153.1|  PREDICTED: uncharacterized protein LOC101499045  77.8    3e-15   Cicer arietinum [garbanzo]
ref|XP_007040346.1|  Heavy metal transport/detoxification superfa...  78.2    3e-15   Theobroma cacao [chocolate]
ref|XP_007135133.1|  hypothetical protein PHAVU_010G103800g           79.0    3e-15   Phaseolus vulgaris [French bean]
ref|XP_002303608.1|  hypothetical protein POPTR_0003s13210g           78.6    3e-15   Populus trichocarpa [western balsam poplar]
gb|KJB09699.1|  hypothetical protein B456_001G157300                  79.0    4e-15   Gossypium raimondii
gb|KHG10757.1|  Putative late blight resistance R1A-3                 79.0    4e-15   Gossypium arboreum [tree cotton]
ref|XP_003549023.1|  PREDICTED: uncharacterized protein LOC100800537  77.8    4e-15   Glycine max [soybeans]
ref|XP_010279042.1|  PREDICTED: FK506-binding protein 4-like          77.8    5e-15   Nelumbo nucifera [Indian lotus]
ref|XP_003549022.1|  PREDICTED: uncharacterized protein LOC100800008  77.8    5e-15   Glycine max [soybeans]
ref|XP_011022620.1|  PREDICTED: uncharacterized protein LOC105124334  78.2    5e-15   Populus euphratica
ref|NP_001235718.1|  uncharacterized protein LOC100527669             77.8    5e-15   Glycine max [soybeans]
ref|XP_007040347.1|  Heavy metal transport/detoxification superfa...  77.8    5e-15   
ref|XP_007152163.1|  hypothetical protein PHAVU_004G107000g           79.0    6e-15   Phaseolus vulgaris [French bean]
ref|XP_010537144.1|  PREDICTED: uncharacterized protein LOC104811951  77.4    6e-15   Tarenaya hassleriana [spider flower]
ref|XP_006372386.1|  hypothetical protein POPTR_0017s01120g           77.8    6e-15   
gb|KDP25385.1|  hypothetical protein JCGZ_20541                       78.6    6e-15   Jatropha curcas
ref|XP_003619372.1|  hypothetical protein MTR_6g051680                77.0    6e-15   Medicago truncatula
ref|XP_010055082.1|  PREDICTED: FK506-binding protein 4 isoform X1    78.2    6e-15   Eucalyptus grandis [rose gum]
gb|AFK44478.1|  unknown                                               77.8    6e-15   Lotus japonicus
ref|XP_009393939.1|  PREDICTED: uncharacterized protein LOC103979...  77.4    7e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006387357.1|  hypothetical protein POPTR_1177s00200g           77.4    7e-15   Populus trichocarpa [western balsam poplar]
gb|EYU40062.1|  hypothetical protein MIMGU_mgv11b021772mg             77.0    7e-15   Erythranthe guttata [common monkey flower]
ref|XP_009387649.1|  PREDICTED: FK506-binding protein 4-like isof...  78.6    8e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003592187.1|  hypothetical protein MTR_1g099640                77.4    8e-15   Medicago truncatula
ref|NP_001236092.1|  uncharacterized protein LOC100306254             77.0    8e-15   
ref|XP_007139783.1|  hypothetical protein PHAVU_008G058500g           77.8    9e-15   Phaseolus vulgaris [French bean]
ref|XP_008375969.1|  PREDICTED: FK506-binding protein 4-like          77.8    1e-14   Malus domestica [apple tree]
ref|XP_006582848.1|  PREDICTED: uncharacterized protein LOC100499...  77.4    1e-14   
ref|XP_003533976.1|  PREDICTED: putative late blight resistance p...  76.6    1e-14   Glycine max [soybeans]
gb|KHN40433.1|  hypothetical protein glysoja_000931                   77.4    1e-14   Glycine soja [wild soybean]
gb|AFK38658.1|  unknown                                               75.9    1e-14   Lotus japonicus
ref|NP_001236802.1|  uncharacterized protein LOC100305540             77.4    1e-14   Glycine max [soybeans]
ref|XP_003548155.1|  PREDICTED: uncharacterized protein LOC100783411  76.3    1e-14   Glycine max [soybeans]
ref|XP_003556127.1|  PREDICTED: uncharacterized protein LOC100803831  76.6    1e-14   Glycine max [soybeans]
ref|NP_001236712.1|  uncharacterized protein LOC100499838             77.0    1e-14   Glycine max [soybeans]
ref|XP_010060392.1|  PREDICTED: uncharacterized protein LOC104448...  76.6    1e-14   Eucalyptus grandis [rose gum]
ref|XP_006401784.1|  hypothetical protein EUTSA_v10015053mg           76.3    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_008437333.1|  PREDICTED: putative late blight resistance p...  76.3    2e-14   Cucumis melo [Oriental melon]
ref|XP_009387648.1|  PREDICTED: nucleolar protein 58-like isoform X1  77.4    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN29315.1|  hypothetical protein glysoja_005039                   77.0    2e-14   Glycine soja [wild soybean]
ref|NP_001236738.1|  uncharacterized protein LOC100527231             77.0    2e-14   Glycine max [soybeans]
ref|XP_011023277.1|  PREDICTED: actin-binding protein-like isofor...  77.0    2e-14   Populus euphratica
ref|XP_010671619.1|  PREDICTED: uncharacterized protein LOC104888368  75.9    2e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG19693.1|  Putative late blight resistance R1A-3                 76.3    2e-14   Gossypium arboreum [tree cotton]
gb|EYU40061.1|  hypothetical protein MIMGU_mgv1a020391mg              75.9    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_003533149.1|  PREDICTED: uncharacterized protein LOC100792434  75.9    2e-14   Glycine max [soybeans]
gb|KEH33282.1|  heavy metal transport/detoxification superfamily ...  75.5    2e-14   Medicago truncatula
gb|KDP28565.1|  hypothetical protein JCGZ_14336                       77.0    2e-14   Jatropha curcas
emb|CBI22645.3|  unnamed protein product                              76.6    2e-14   Vitis vinifera
ref|XP_009393938.1|  PREDICTED: uncharacterized protein LOC103979...  75.9    3e-14   
ref|XP_004298831.1|  PREDICTED: uncharacterized protein LOC101291624  75.9    3e-14   Fragaria vesca subsp. vesca
ref|NP_001240260.1|  uncharacterized protein LOC100819572             76.3    3e-14   Glycine max [soybeans]
ref|XP_008348575.1|  PREDICTED: heavy metal-associated isoprenyla...  75.9    3e-14   Malus domestica [apple tree]
ref|XP_008376012.1|  PREDICTED: uncharacterized protein LOC103439249  76.6    3e-14   
ref|XP_010273988.1|  PREDICTED: formin-like protein 8                 78.6    4e-14   
ref|NP_001238604.1|  uncharacterized protein LOC100306678             74.7    4e-14   Glycine max [soybeans]
ref|XP_002321040.2|  hypothetical protein POPTR_0014s08550g           76.3    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011080908.1|  PREDICTED: putative late blight resistance p...  75.1    5e-14   Sesamum indicum [beniseed]
ref|XP_008803335.1|  PREDICTED: FK506-binding protein 4               75.1    5e-14   
ref|XP_003624087.1|  hypothetical protein MTR_7g079110                75.9    5e-14   Medicago truncatula
gb|KHN42453.1|  hypothetical protein glysoja_033921                   74.7    6e-14   Glycine soja [wild soybean]
ref|XP_009773147.1|  PREDICTED: uncharacterized protein LOC104223411  74.3    6e-14   Nicotiana sylvestris
ref|XP_002864190.1|  predicted protein                                74.3    7e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_003619373.1|  hypothetical protein MTR_6g051690                74.3    8e-14   Medicago truncatula
ref|XP_002447286.1|  hypothetical protein SORBIDRAFT_06g032110        74.7    8e-14   Sorghum bicolor [broomcorn]
ref|XP_006849251.1|  hypothetical protein AMTR_s00027p00240310        74.7    8e-14   Amborella trichopoda
ref|XP_007051711.1|  Heavy metal transport/detoxification superfa...  75.1    8e-14   Theobroma cacao [chocolate]
ref|XP_008458169.1|  PREDICTED: protein PXR1-like isoform X2          75.5    9e-14   
ref|XP_010941026.1|  PREDICTED: FK506-binding protein 4-like          74.3    9e-14   Elaeis guineensis
ref|XP_004143886.1|  PREDICTED: uncharacterized protein LOC101213529  74.3    9e-14   Cucumis sativus [cucumbers]
ref|XP_010482642.1|  PREDICTED: uncharacterized protein LOC104761283  73.9    9e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010060385.1|  PREDICTED: uncharacterized protein LOC104448...  74.3    1e-13   Eucalyptus grandis [rose gum]
ref|XP_009791152.1|  PREDICTED: putative late blight resistance p...  74.3    1e-13   Nicotiana sylvestris
ref|XP_010092580.1|  hypothetical protein L484_012921                 75.5    1e-13   
ref|XP_002535232.1|  metal ion binding protein, putative              74.3    1e-13   Ricinus communis
ref|XP_009628906.1|  PREDICTED: uncharacterized protein LOC104119179  73.9    1e-13   Nicotiana tomentosiformis
gb|KHN09293.1|  hypothetical protein glysoja_029064                   74.7    1e-13   Glycine soja [wild soybean]
ref|XP_004138486.1|  PREDICTED: uncharacterized protein LOC101218...  75.1    1e-13   Cucumis sativus [cucumbers]
ref|XP_006439474.1|  hypothetical protein CICLE_v10022806mg           73.9    2e-13   Citrus clementina [clementine]
ref|XP_006587269.1|  PREDICTED: uncharacterized protein LOC100793482  73.2    2e-13   Glycine max [soybeans]
emb|CDY15173.1|  BnaC05g00520D                                        75.5    2e-13   Brassica napus [oilseed rape]
ref|XP_006360194.1|  PREDICTED: uncharacterized protein LOC102580906  73.9    2e-13   Solanum tuberosum [potatoes]
ref|XP_006599548.1|  PREDICTED: uncharacterized protein LOC100801...  73.2    2e-13   
ref|XP_006476499.1|  PREDICTED: putative late blight resistance p...  73.6    2e-13   Citrus sinensis [apfelsine]
ref|XP_008458168.1|  PREDICTED: protein PXR1-like isoform X1          74.7    2e-13   Cucumis melo [Oriental melon]
ref|XP_002301372.1|  hypothetical protein POPTR_0002s16500g           73.6    2e-13   
gb|KJB24782.1|  hypothetical protein B456_004G160000                  74.3    2e-13   Gossypium raimondii
ref|XP_004515152.1|  PREDICTED: uncharacterized protein LOC101498723  72.8    2e-13   Cicer arietinum [garbanzo]
gb|KDP22219.1|  hypothetical protein JCGZ_26050                       73.2    2e-13   Jatropha curcas
gb|KJB49430.1|  hypothetical protein B456_008G119800                  73.9    2e-13   Gossypium raimondii
ref|XP_010669862.1|  PREDICTED: FK506-binding protein 4               73.9    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010919138.1|  PREDICTED: microtubule-associated protein 1B     73.9    2e-13   Elaeis guineensis
ref|XP_010662796.1|  PREDICTED: uncharacterized protein LOC100854849  73.9    3e-13   
ref|XP_003549024.1|  PREDICTED: uncharacterized protein LOC100801...  73.2    3e-13   Glycine max [soybeans]
ref|XP_010041259.1|  PREDICTED: uncharacterized protein LOC104430...  72.8    3e-13   Eucalyptus grandis [rose gum]
gb|ABK25811.1|  unknown                                               72.8    3e-13   Picea sitchensis
gb|KJB20592.1|  hypothetical protein B456_003G155200                  72.8    3e-13   Gossypium raimondii
ref|XP_010058254.1|  PREDICTED: uncharacterized protein LOC104446039  73.6    3e-13   
ref|XP_002889363.1|  hypothetical protein ARALYDRAFT_887301           73.6    4e-13   Arabidopsis lyrata subsp. lyrata
ref|NP_171656.1|  heavy-metal-associated domain-containing protein    73.6    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010055772.1|  PREDICTED: uncharacterized protein LOC104443...  72.4    4e-13   Eucalyptus grandis [rose gum]
ref|XP_007143476.1|  hypothetical protein PHAVU_007G075100g           72.4    4e-13   Phaseolus vulgaris [French bean]
ref|XP_010055771.1|  PREDICTED: uncharacterized protein LOC104443917  72.4    4e-13   Eucalyptus grandis [rose gum]
gb|KFK26877.1|  hypothetical protein AALP_AA8G305000                  72.0    5e-13   Arabis alpina [alpine rockcress]
ref|XP_010053219.1|  PREDICTED: FK506-binding protein 4-like isof...  72.4    6e-13   Eucalyptus grandis [rose gum]
gb|KJB24781.1|  hypothetical protein B456_004G160000                  72.8    6e-13   Gossypium raimondii
ref|XP_010058287.1|  PREDICTED: uncharacterized protein LOC104446079  72.4    6e-13   
ref|XP_006599547.1|  PREDICTED: uncharacterized protein LOC100801...  72.0    7e-13   Glycine max [soybeans]
ref|XP_006589521.1|  PREDICTED: uncharacterized protein LOC100793876  72.0    7e-13   
gb|AAF81309.1|AC061957_5  Contains a weak similarity to a farnesy...  73.2    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511203.1|  PREDICTED: uncharacterized protein LOC101508098  75.9    7e-13   
ref|XP_009127221.1|  PREDICTED: uncharacterized protein LOC103852083  71.2    8e-13   Brassica rapa
ref|XP_004240715.1|  PREDICTED: uncharacterized protein LOC101259546  72.0    8e-13   Solanum lycopersicum
ref|XP_010261350.1|  PREDICTED: FK506-binding protein 4-like          72.0    8e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010442814.1|  PREDICTED: uncharacterized protein LOC104725786  70.9    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002276701.1|  PREDICTED: FK506-binding protein 4               71.6    1e-12   Vitis vinifera
ref|NP_001183498.1|  hypothetical protein                             71.6    1e-12   Zea mays [maize]
ref|XP_010055693.1|  PREDICTED: uncharacterized protein LOC104443849  70.9    1e-12   Eucalyptus grandis [rose gum]
gb|KJB24305.1|  hypothetical protein B456_004G138000                  71.2    1e-12   Gossypium raimondii
ref|XP_009119699.1|  PREDICTED: uncharacterized protein LOC103844...  72.0    1e-12   
ref|XP_010055691.1|  PREDICTED: uncharacterized protein LOC104443848  70.9    1e-12   Eucalyptus grandis [rose gum]
ref|XP_010053218.1|  PREDICTED: FK506-binding protein 4-like isof...  71.2    2e-12   Eucalyptus grandis [rose gum]
ref|XP_011015798.1|  PREDICTED: FK506-binding protein 4 isoform X1    71.6    2e-12   Populus euphratica
ref|XP_011037035.1|  PREDICTED: FK506-binding protein 4-like          71.6    2e-12   Populus euphratica
gb|KHN42457.1|  hypothetical protein glysoja_033925                   70.9    2e-12   Glycine soja [wild soybean]
ref|NP_001235140.1|  uncharacterized protein LOC100306444             70.9    2e-12   
gb|KJB49431.1|  hypothetical protein B456_008G119800                  71.2    2e-12   Gossypium raimondii
ref|XP_011035352.1|  PREDICTED: FK506-binding protein 4-like isof...  70.1    2e-12   Populus euphratica
ref|XP_008668086.1|  PREDICTED: metal ion binding protein isoform X1  70.9    2e-12   Zea mays [maize]
gb|AEW09330.1|  hypothetical protein UMN_4898_01                      69.3    2e-12   Pinus radiata
gb|ABK26790.1|  unknown                                               70.1    3e-12   Picea sitchensis
ref|XP_010055776.1|  PREDICTED: uncharacterized protein LOC104443920  70.1    3e-12   Eucalyptus grandis [rose gum]
ref|XP_008452009.1|  PREDICTED: putative late blight resistance p...  70.1    3e-12   Cucumis melo [Oriental melon]
emb|CDP09763.1|  unnamed protein product                              69.3    3e-12   Coffea canephora [robusta coffee]
gb|ACF85341.1|  unknown                                               70.1    3e-12   Zea mays [maize]
gb|EMS65281.1|  hypothetical protein TRIUR3_32617                     70.5    3e-12   Triticum urartu
ref|XP_009118812.1|  PREDICTED: FK506-binding protein 4-like          70.9    3e-12   Brassica rapa
ref|NP_001151013.1|  metal ion binding protein                        70.1    3e-12   Zea mays [maize]
emb|CDY38009.1|  BnaCnng08700D                                        70.9    3e-12   Brassica napus [oilseed rape]
ref|XP_010474748.1|  PREDICTED: transcription initiation factor T...  70.9    4e-12   
ref|XP_004143971.1|  PREDICTED: uncharacterized protein LOC101213835  69.7    5e-12   Cucumis sativus [cucumbers]
emb|CDX90036.1|  BnaA10g00460D                                        70.5    5e-12   
ref|XP_006586623.1|  PREDICTED: uncharacterized protein LOC100306...  70.1    5e-12   
dbj|BAK07313.1|  predicted protein                                    70.1    5e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010457118.1|  PREDICTED: transcription initiation factor T...  70.1    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009119700.1|  PREDICTED: pinin isoform X2                      70.1    6e-12   Brassica rapa
ref|XP_002320154.2|  hypothetical protein POPTR_0014s08550g           69.3    8e-12   
ref|XP_010055705.1|  PREDICTED: uncharacterized protein LOC104443...  68.9    8e-12   Eucalyptus grandis [rose gum]
gb|KCW72214.1|  hypothetical protein EUGRSUZ_E00659                   68.9    8e-12   Eucalyptus grandis [rose gum]
gb|EMT27978.1|  hypothetical protein F775_17443                       68.9    1e-11   
ref|XP_010445226.1|  PREDICTED: uncharacterized protein LOC104727856  68.2    1e-11   Camelina sativa [gold-of-pleasure]
gb|KCW72229.1|  hypothetical protein EUGRSUZ_E00672                   68.6    1e-11   Eucalyptus grandis [rose gum]
gb|KCW72297.1|  hypothetical protein EUGRSUZ_E00765                   68.2    1e-11   Eucalyptus grandis [rose gum]
ref|XP_003619366.1|  hypothetical protein MTR_6g051550                68.6    1e-11   
gb|EMT27975.1|  hypothetical protein F775_17442                       68.2    1e-11   
ref|XP_010480225.1|  PREDICTED: transcription initiation factor T...  69.3    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010055703.1|  PREDICTED: uncharacterized protein LOC104443...  68.2    1e-11   Eucalyptus grandis [rose gum]
ref|XP_006281315.1|  hypothetical protein CARUB_v10027368mg           68.2    1e-11   Capsella rubella
ref|XP_006281300.1|  hypothetical protein CARUB_v10027350mg           68.6    1e-11   Capsella rubella
dbj|BAJ92740.1|  predicted protein                                    68.6    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008437334.1|  PREDICTED: putative late blight resistance p...  67.8    2e-11   
gb|EMT27979.1|  hypothetical protein F775_30186                       68.6    2e-11   
ref|NP_200088.1|  copper transport family protein                     68.2    2e-11   
dbj|BAJ95433.1|  predicted protein                                    68.6    2e-11   
ref|XP_006358656.1|  PREDICTED: nucleolin-like                        68.9    2e-11   
ref|XP_004960214.1|  PREDICTED: uncharacterized protein LOC101754963  68.2    2e-11   
ref|XP_009624204.1|  PREDICTED: FK506-binding protein 4-like          68.2    2e-11   
dbj|BAJ90592.1|  predicted protein                                    67.8    2e-11   
ref|XP_008437332.1|  PREDICTED: putative late blight resistance p...  67.4    2e-11   
ref|XP_006281568.1|  hypothetical protein CARUB_v10027675mg           67.8    3e-11   
ref|XP_010055702.1|  PREDICTED: uncharacterized protein LOC104443...  67.4    3e-11   
ref|XP_010041257.1|  PREDICTED: uncharacterized protein LOC104430201  67.4    3e-11   
gb|KGN53352.1|  hypothetical protein Csa_4G049110                     67.0    3e-11   
ref|XP_009400726.1|  PREDICTED: uncharacterized protein LOC103984883  67.4    3e-11   
ref|XP_010474749.1|  PREDICTED: transcription initiation factor T...  67.8    3e-11   
ref|XP_010055783.1|  PREDICTED: uncharacterized protein LOC104443...  67.0    3e-11   
ref|XP_008803071.1|  PREDICTED: uncharacterized protein LOC103716...  66.6    4e-11   
ref|XP_010055775.1|  PREDICTED: uncharacterized protein LOC104443919  66.6    5e-11   
ref|XP_006281289.1|  hypothetical protein CARUB_v10027339mg           67.0    5e-11   
ref|XP_010055701.1|  PREDICTED: uncharacterized protein LOC104443...  66.6    6e-11   
ref|XP_010055782.1|  PREDICTED: uncharacterized protein LOC104443...  66.2    6e-11   
ref|XP_010522947.1|  PREDICTED: uncharacterized protein LOC104801392  67.0    6e-11   
gb|KCW72319.1|  hypothetical protein EUGRSUZ_E00775                   66.6    6e-11   
ref|XP_011093080.1|  PREDICTED: uncharacterized protein LOC105173122  66.6    8e-11   
ref|XP_004248061.1|  PREDICTED: pollen-specific leucine-rich repe...  67.0    8e-11   
ref|XP_011076466.1|  PREDICTED: uncharacterized protein LOC105160683  66.6    9e-11   
gb|EMT08955.1|  hypothetical protein F775_23249                       65.9    9e-11   
gb|EMT27976.1|  hypothetical protein F775_43817                       65.9    1e-10   
ref|XP_010676417.1|  PREDICTED: UPF0329 protein ECU05_1680/ECU11_...  65.9    1e-10   
dbj|BAJ91437.1|  predicted protein                                    65.9    1e-10   
ref|XP_010055778.1|  PREDICTED: putative late blight resistance p...  65.1    1e-10   
ref|XP_010055789.1|  PREDICTED: uncharacterized protein LOC104443929  65.1    2e-10   
ref|XP_006380158.1|  hypothetical protein POPTR_0008s22440g           65.1    2e-10   
ref|XP_009617754.1|  PREDICTED: FK506-binding protein 4-like          65.9    2e-10   
ref|XP_011046035.1|  PREDICTED: uncharacterized protein LOC105140765  64.3    2e-10   
ref|XP_010055698.1|  PREDICTED: uncharacterized protein LOC104443...  64.3    2e-10   
ref|XP_010482643.1|  PREDICTED: uncharacterized protein LOC104761284  64.7    3e-10   
ref|XP_010445234.1|  PREDICTED: uncharacterized protein LOC104727868  64.7    3e-10   
ref|XP_009588735.1|  PREDICTED: pollen-specific leucine-rich repe...  65.5    3e-10   
ref|XP_010058285.1|  PREDICTED: uncharacterized protein LOC104446076  64.7    3e-10   
gb|ABR17371.1|  unknown                                               63.2    3e-10   
ref|XP_009398013.1|  PREDICTED: uncharacterized protein LOC103982...  63.5    3e-10   
ref|XP_009776263.1|  PREDICTED: pollen-specific leucine-rich repe...  65.5    3e-10   
ref|XP_011015693.1|  PREDICTED: putative late blight resistance p...  64.3    3e-10   
ref|XP_010087564.1|  hypothetical protein L484_001022                 63.9    3e-10   
ref|XP_009398014.1|  PREDICTED: uncharacterized protein LOC103982...  63.5    3e-10   
ref|XP_009398015.1|  PREDICTED: uncharacterized protein LOC103982...  63.5    4e-10   
ref|XP_008775356.1|  PREDICTED: FK506-binding protein 4-like          64.3    4e-10   
gb|EMT27977.1|  hypothetical protein F775_30185                       64.3    4e-10   
ref|XP_006422046.1|  hypothetical protein CICLE_v10006246mg           63.9    4e-10   
ref|XP_010671618.1|  PREDICTED: uncharacterized protein LOC104888367  63.9    4e-10   
gb|KEH43671.1|  heavy metal transport/detoxification superfamily ...  63.9    4e-10   
ref|XP_007038831.1|  Uncharacterized protein TCM_015260               64.3    4e-10   
gb|EPS62905.1|  hypothetical protein M569_11884                       64.7    4e-10   
gb|EAZ25325.1|  hypothetical protein OsJ_09136                        63.5    5e-10   
ref|XP_011022722.1|  PREDICTED: uncharacterized protein LOC105124404  63.2    5e-10   
ref|XP_004143887.1|  PREDICTED: putative late blight resistance p...  63.5    5e-10   
ref|XP_010909580.1|  PREDICTED: microtubule-associated protein 1B...  63.2    5e-10   
gb|KJB52082.1|  hypothetical protein B456_008G245900                  63.5    5e-10   
gb|ABF93600.1|  heavy-metal-associated domain-containing protein,...  63.2    5e-10   
emb|CDP08762.1|  unnamed protein product                              64.3    6e-10   
ref|NP_001048724.2|  Os03g0111400                                     63.5    6e-10   
ref|XP_008380709.1|  PREDICTED: uncharacterized protein LOC103443610  62.8    6e-10   
ref|XP_004166578.1|  PREDICTED: putative late blight resistance p...  63.5    6e-10   
ref|XP_002864192.1|  hypothetical protein ARALYDRAFT_331636           63.5    6e-10   
ref|XP_009615168.1|  PREDICTED: patellin-2-like                       63.2    6e-10   
ref|XP_008813819.1|  PREDICTED: uncharacterized protein LOC103724367  62.8    7e-10   
ref|XP_008794190.1|  PREDICTED: uncharacterized protein LOC103710302  62.8    7e-10   
ref|XP_009776262.1|  PREDICTED: pollen-specific leucine-rich repe...  64.3    7e-10   
ref|XP_006401786.1|  hypothetical protein EUTSA_v10014994mg           63.5    7e-10   
ref|XP_010055780.1|  PREDICTED: uncharacterized protein LOC104443...  63.2    8e-10   
ref|XP_010055779.1|  PREDICTED: uncharacterized protein LOC104443923  63.2    8e-10   
ref|XP_009760311.1|  PREDICTED: patellin-2                            63.2    8e-10   
ref|XP_010058283.1|  PREDICTED: uncharacterized protein LOC104446074  63.2    8e-10   
gb|KCW72225.1|  hypothetical protein EUGRSUZ_E00668                   63.2    8e-10   
ref|XP_004229951.1|  PREDICTED: pollen-specific leucine-rich repe...  63.9    8e-10   
ref|XP_011030112.1|  PREDICTED: uncharacterized protein LOC105129...  62.8    8e-10   
gb|EMS56997.1|  Disease resistance RPP13-like protein 4               67.0    9e-10   
ref|XP_011030113.1|  PREDICTED: uncharacterized protein LOC105129...  62.4    9e-10   
emb|CDP12071.1|  unnamed protein product                              63.2    9e-10   
ref|XP_010055700.1|  PREDICTED: uncharacterized protein LOC104443855  62.8    1e-09   
gb|KCW72216.1|  hypothetical protein EUGRSUZ_E00660                   62.4    1e-09   
gb|EMT27980.1|  hypothetical protein F775_17444                       63.5    1e-09   
gb|KDO64068.1|  hypothetical protein CISIN_1g0009451mg                67.0    1e-09   
gb|KDO64067.1|  hypothetical protein CISIN_1g0009451mg                67.0    1e-09   
ref|XP_009384516.1|  PREDICTED: uncharacterized protein LOC103972049  62.8    1e-09   
ref|XP_006339628.1|  PREDICTED: FK506-binding protein 4-like          63.9    1e-09   
ref|XP_010060398.1|  PREDICTED: uncharacterized protein LOC104448288  63.2    1e-09   
ref|XP_010442815.1|  PREDICTED: uncharacterized protein LOC104725787  63.2    1e-09   
gb|KCW72301.1|  hypothetical protein EUGRSUZ_E00767                   62.8    1e-09   
gb|EMT06940.1|  hypothetical protein F775_06638                       62.4    1e-09   
ref|XP_010055697.1|  PREDICTED: uncharacterized protein LOC104443...  62.4    1e-09   
ref|XP_002318220.1|  hypothetical protein POPTR_0012s13160g           62.4    1e-09   
ref|XP_006353303.1|  PREDICTED: microtubule-associated protein 1B...  62.4    1e-09   
ref|XP_010317603.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  62.4    1e-09   
ref|XP_010060401.1|  PREDICTED: uncharacterized protein LOC104448299  63.2    1e-09   
gb|EAY88246.1|  hypothetical protein OsI_09697                        62.4    1e-09   
gb|KDO64073.1|  hypothetical protein CISIN_1g0009451mg                66.2    1e-09   
ref|XP_008437990.1|  PREDICTED: polyadenylate-binding protein, cy...  62.8    2e-09   
ref|XP_010058252.1|  PREDICTED: uncharacterized protein LOC104446036  62.4    2e-09   
ref|XP_006422042.1|  hypothetical protein CICLE_v10006198mg           62.0    2e-09   
ref|XP_009772677.1|  PREDICTED: pollen-specific leucine-rich repe...  63.2    2e-09   
ref|XP_011046031.1|  PREDICTED: uncharacterized protein LOC105140...  62.0    2e-09   
ref|XP_010905100.1|  PREDICTED: uncharacterized protein LOC105032359  61.6    2e-09   
ref|XP_002864191.1|  hypothetical protein ARALYDRAFT_495340           62.4    2e-09   
ref|XP_010055694.1|  PREDICTED: uncharacterized protein LOC104443...  62.0    2e-09   
gb|KCW72307.1|  hypothetical protein EUGRSUZ_E007711                  62.0    2e-09   
ref|XP_010058282.1|  PREDICTED: uncharacterized protein LOC104446073  62.0    2e-09   
ref|XP_011092947.1|  PREDICTED: FK506-binding protein 4-like          62.8    2e-09   
gb|KCW72224.1|  hypothetical protein EUGRSUZ_E00667                   62.0    2e-09   
ref|XP_004133846.1|  PREDICTED: uncharacterized protein LOC101218112  62.4    2e-09   
ref|XP_004138485.1|  PREDICTED: uncharacterized protein LOC101218...  63.2    2e-09   
ref|XP_003580773.1|  PREDICTED: uncharacterized protein LOC100833849  62.0    2e-09   
ref|NP_001238249.1|  uncharacterized protein LOC100527327             61.6    3e-09   
gb|EMT22474.1|  hypothetical protein F775_26296                       60.8    3e-09   
gb|KCW72304.1|  hypothetical protein EUGRSUZ_E00770                   61.2    3e-09   
ref|XP_010255437.1|  PREDICTED: UPF0329 protein ECU05_1680/ECU11_...  61.6    3e-09   
ref|XP_009621979.1|  PREDICTED: nucleolar protein 9-like              61.6    3e-09   
ref|XP_010055699.1|  PREDICTED: uncharacterized protein LOC104443853  61.6    3e-09   
ref|XP_006345626.1|  PREDICTED: putative late blight resistance p...  60.8    3e-09   
ref|XP_006491467.1|  PREDICTED: transcription initiation factor T...  62.4    3e-09   
ref|NP_200087.1|  heavy metal transport/detoxification domain-con...  62.0    3e-09   
ref|XP_006584733.1|  PREDICTED: putative late blight resistance p...  61.6    3e-09   
ref|XP_002465028.1|  hypothetical protein SORBIDRAFT_01g030730        62.0    3e-09   
gb|EMS65620.1|  hypothetical protein TRIUR3_16636                     61.6    3e-09   
ref|XP_007040186.1|  Copper transport protein family                  60.8    3e-09   
gb|ABK23861.1|  unknown                                               61.2    3e-09   
ref|XP_011038421.1|  PREDICTED: uncharacterized protein LOC105135...  61.6    3e-09   
ref|XP_003580221.1|  PREDICTED: uncharacterized protein LOC100842919  60.8    3e-09   
gb|EMS50209.1|  hypothetical protein TRIUR3_19269                     62.0    4e-09   
ref|XP_011038420.1|  PREDICTED: uncharacterized protein LOC105135...  61.6    4e-09   
gb|KHN12934.1|  hypothetical protein glysoja_042192                   60.8    4e-09   
gb|AAM63117.1|  unknown                                               61.2    4e-09   
dbj|BAK02304.1|  predicted protein                                    60.5    4e-09   
ref|XP_006842985.1|  hypothetical protein AMTR_s00076p00094880        60.5    4e-09   
dbj|BAJ88536.1|  predicted protein                                    61.2    5e-09   
dbj|BAJ85214.1|  predicted protein                                    62.0    5e-09   
gb|KJB52077.1|  hypothetical protein B456_008G245700                  60.5    5e-09   
ref|XP_006401789.1|  hypothetical protein EUTSA_v10015441mg           60.5    5e-09   
ref|XP_006372384.1|  hypothetical protein POPTR_0017s01110g           60.8    5e-09   
dbj|BAJ95930.1|  predicted protein                                    60.8    5e-09   
ref|NP_001048827.1|  Os03g0126700                                     61.6    6e-09   
ref|XP_010055696.1|  PREDICTED: uncharacterized protein LOC104443...  60.8    6e-09   
ref|XP_010229322.1|  PREDICTED: uncharacterized protein LOC100827345  60.5    6e-09   
ref|XP_010485087.1|  PREDICTED: uncharacterized protein LOC104763410  60.5    7e-09   
gb|EAY88354.1|  hypothetical protein OsI_09812                        61.6    7e-09   
gb|EPS57951.1|  hypothetical protein M569_16867                       59.7    9e-09   
gb|KHN09294.1|  hypothetical protein glysoja_029065                   59.3    9e-09   
gb|KDP22280.1|  hypothetical protein JCGZ_26111                       59.7    9e-09   
ref|XP_009626694.1|  PREDICTED: uncharacterized protein LOC104117354  59.7    1e-08   
ref|XP_010060406.1|  PREDICTED: uncharacterized protein LOC104448308  60.1    1e-08   
ref|XP_011076048.1|  PREDICTED: uncharacterized protein LOC105160...  60.8    1e-08   
ref|XP_007143474.1|  hypothetical protein PHAVU_007G074900g           59.7    1e-08   
ref|XP_009779014.1|  PREDICTED: uncharacterized protein LOC104228...  59.3    1e-08   
ref|XP_006649256.1|  PREDICTED: nucleolar protein 58-like isoform X2  59.7    1e-08   
ref|XP_009767437.1|  PREDICTED: uncharacterized protein LOC104218602  60.5    1e-08   
ref|XP_006649255.1|  PREDICTED: nucleolar protein 58-like isoform X1  59.7    1e-08   
gb|KFK26874.1|  hypothetical protein AALP_AA8G304700                  59.7    1e-08   
ref|XP_003572002.1|  PREDICTED: uncharacterized protein LOC100827173  60.1    1e-08   
ref|XP_010055777.1|  PREDICTED: uncharacterized protein LOC104443921  59.7    1e-08   
gb|KDO76198.1|  hypothetical protein CISIN_1g036889mg                 58.9    1e-08   
ref|XP_006439565.1|  hypothetical protein CICLE_v10023788mg           58.9    1e-08   
emb|CAE04580.1|  OSJNBb0039L24.19                                     58.9    1e-08   
ref|XP_008660564.1|  PREDICTED: uncharacterized protein LOC103639...  59.3    1e-08   
ref|XP_008657849.1|  PREDICTED: uncharacterized protein LOC103637...  60.1    2e-08   
ref|XP_007152162.1|  hypothetical protein PHAVU_004G106900g           59.3    2e-08   
ref|XP_011076047.1|  PREDICTED: uncharacterized protein LOC105160...  60.8    2e-08   
ref|XP_006664003.1|  PREDICTED: high mobility group nucleosome-bi...  60.8    2e-08   
ref|NP_001053411.2|  Os04g0533900                                     58.5    2e-08   
ref|XP_004240096.1|  PREDICTED: uncharacterized protein LOC101255...  59.7    2e-08   
ref|XP_009119812.1|  PREDICTED: uncharacterized protein LOC103844753  59.7    2e-08   
ref|XP_010053286.1|  PREDICTED: uncharacterized protein LOC104441767  58.9    2e-08   
ref|XP_011076046.1|  PREDICTED: uncharacterized protein LOC105160...  61.2    2e-08   
ref|XP_009779015.1|  PREDICTED: uncharacterized protein LOC104228...  58.5    2e-08   
gb|KCW90627.1|  hypothetical protein EUGRSUZ_A02731                   59.3    2e-08   
ref|XP_009119810.1|  PREDICTED: uncharacterized protein LOC103844752  59.7    2e-08   
ref|NP_001065148.1|  Os10g0532300                                     60.1    2e-08   
ref|XP_004985891.1|  PREDICTED: protein ycf2-like                     60.5    2e-08   
ref|NP_001065011.1|  Os10g0506100                                     59.3    2e-08   
ref|XP_002510790.1|  metal ion binding protein, putative              58.9    2e-08   
emb|CAH67460.1|  OSIGBa0159I10.5                                      58.5    2e-08   
ref|XP_008660565.1|  PREDICTED: uncharacterized protein LOC103639...  58.9    2e-08   
gb|EPS64110.1|  hypothetical protein M569_10677                       58.5    2e-08   
ref|XP_010933953.1|  PREDICTED: putative late blight resistance p...  59.7    2e-08   
ref|XP_002468595.1|  hypothetical protein SORBIDRAFT_01g048760        60.5    2e-08   
ref|XP_010321526.1|  PREDICTED: uncharacterized protein LOC101255...  59.7    2e-08   
ref|XP_004148353.1|  PREDICTED: uncharacterized protein LOC101208339  58.9    2e-08   
ref|XP_009782810.1|  PREDICTED: uncharacterized protein LOC104231499  60.8    2e-08   
gb|KFK26873.1|  hypothetical protein AALP_AA8G304600                  59.3    2e-08   
ref|XP_003592189.1|  Metal ion binding protein                        59.7    2e-08   
gb|KFK26875.1|  hypothetical protein AALP_AA8G304800                  58.9    2e-08   
gb|ABG66175.1|  heavy-metal-associated domain-containing protein,...  58.5    3e-08   
ref|XP_010058286.1|  PREDICTED: uncharacterized protein LOC104446078  59.3    3e-08   
gb|EAY82913.1|  hypothetical protein OsI_38128                        60.1    3e-08   
ref|XP_004171400.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.5    3e-08   
gb|KEH21134.1|  heavy metal transport/detoxification superfamily ...  58.5    3e-08   
ref|XP_002464406.1|  hypothetical protein SORBIDRAFT_01g017680        58.5    3e-08   
ref|XP_004983835.1|  PREDICTED: glutamic acid-rich protein-like       59.3    3e-08   
gb|ABL97978.1|  metal ion binding                                     58.9    3e-08   
gb|KCW72300.1|  hypothetical protein EUGRSUZ_E00766                   58.5    3e-08   
gb|ABA97633.1|  heavy metal-associated domain containing protein,...  59.7    3e-08   
ref|XP_010229281.1|  PREDICTED: cylicin-1-like isoform X2             59.7    3e-08   
ref|XP_006281328.1|  hypothetical protein CARUB_v10027383mg           58.5    3e-08   
ref|XP_010273078.1|  PREDICTED: UPF0329 protein ECU05_1680/ECU11_...  58.5    3e-08   
ref|XP_009414095.1|  PREDICTED: uncharacterized protein LOC103995269  58.5    3e-08   
gb|KFK26860.1|  hypothetical protein AALP_AA8G302900                  58.5    4e-08   
ref|NP_001066660.1|  Os12g0421000                                     59.7    4e-08   
gb|EMS63438.1|  hypothetical protein TRIUR3_34300                     58.9    4e-08   
emb|CDP05255.1|  unnamed protein product                              58.5    4e-08   
ref|XP_010555694.1|  PREDICTED: uncharacterized protein LOC104825116  58.5    4e-08   
ref|XP_004982665.1|  PREDICTED: UPF0329 protein ECU05_1680/ECU11_...  58.2    4e-08   
ref|XP_006661929.1|  PREDICTED: UPF0329 protein ECU05_1680/ECU11_...  57.8    4e-08   
ref|XP_004982666.1|  PREDICTED: UPF0329 protein ECU05_1680/ECU11_...  57.8    5e-08   
ref|XP_006661930.1|  PREDICTED: UPF0329 protein ECU05_1680/ECU11_...  57.8    5e-08   
gb|EMT23664.1|  hypothetical protein F775_25280                       60.5    5e-08   
ref|XP_010055083.1|  PREDICTED: FK506-binding protein 4 isoform X2    58.5    5e-08   
ref|XP_006649309.1|  PREDICTED: histone-lysine N-methyltransferas...  58.9    5e-08   
ref|XP_002864193.1|  hypothetical protein ARALYDRAFT_357513           58.2    5e-08   
gb|EMT25054.1|  hypothetical protein F775_18259                       57.8    6e-08   
gb|KJB52078.1|  hypothetical protein B456_008G245700                  57.4    6e-08   
ref|XP_004986019.1|  PREDICTED: nucleolar protein 58-like isoform X1  57.4    6e-08   



>ref|NP_001275225.1| uncharacterized protein LOC102577570 [Solanum tuberosum]
 gb|ABC01906.1| unknown [Solanum tuberosum]
Length=159

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV+LKL+Y DEK KQKAMKKVS L+GVESISID KDKKLT+TG+ID VS+V KLRK+C
Sbjct  1    MKKVILKLEYFDEKIKQKAMKKVSGLEGVESISIDSKDKKLTITGNIDPVSLVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +TDIVSVGP
Sbjct  61   HTDIVSVGP  69



>ref|XP_004234217.1| PREDICTED: copper transport protein CCH [Solanum lycopersicum]
Length=161

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV+LKL+Y DEK KQKAMKKVS L+GVESISID K+KKLT+TG+ID VS+V KLRK+C
Sbjct  1    MKKVILKLEYFDEKIKQKAMKKVSGLEGVESISIDSKEKKLTITGNIDPVSLVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +TDIVSVGP
Sbjct  61   HTDIVSVGP  69



>gb|ABA40464.1| unknown [Solanum tuberosum]
Length=160

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV+LKL+Y DEK KQKAMKKVS L+GVESISID KDKKLT+TG+ID VS+V KLRK+C
Sbjct  1    MKKVILKLEYFDEKIKQKAMKKVSGLEGVESISIDSKDKKLTITGNIDPVSLVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +TDI+SVGP
Sbjct  61   HTDIISVGP  69



>ref|XP_009621673.1| PREDICTED: uncharacterized protein LOC104113263 [Nicotiana tomentosiformis]
Length=164

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+Y DEK KQKAMKKVS L+GVESI+ID KDKKLT+TG++D VS+V KLRK+C
Sbjct  1    MKKVVLKLEYFDEKVKQKAMKKVSGLEGVESIAIDTKDKKLTITGNVDPVSLVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +TDI+SVGP
Sbjct  61   HTDILSVGP  69



>ref|XP_006351639.1| PREDICTED: high mobility group nucleosome-binding domain-containing 
protein 5-like [Solanum tuberosum]
 ref|XP_006362663.1| PREDICTED: high mobility group nucleosome-binding domain-containing 
protein 5 [Solanum tuberosum]
Length=159

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV+LKL+Y DEK KQKAMKKVS L+GVESISID K+KKLT+TG+ID VS+V KLRK+C
Sbjct  1    MKKVILKLEYFDEKIKQKAMKKVSGLEGVESISIDSKEKKLTITGNIDPVSLVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +TDIVSVGP
Sbjct  61   HTDIVSVGP  69



>ref|XP_009771983.1| PREDICTED: putative uncharacterized protein DDB_G0292636 [Nicotiana 
sylvestris]
Length=162

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 62/69 (90%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+Y DEK KQKAMKKVS L+GVESI+ID K+KKLT+TG++D VS+V KLRK+C
Sbjct  1    MKKVVLKLEYFDEKVKQKAMKKVSGLEGVESIAIDSKEKKLTITGNVDPVSLVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +TDI+SVGP
Sbjct  61   HTDILSVGP  69



>ref|XP_011076100.1| PREDICTED: uncharacterized protein LOC105160429 [Sesamum indicum]
Length=155

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD+ DEKTKQKAM KVS L G+ESI++D KDKKLTVTG ID V++V KLRK+C
Sbjct  1    MKKVVLKLDFADEKTKQKAMMKVSGLSGLESIALDPKDKKLTVTGDIDPVAVVAKLRKLC  60

Query  276  NTDIVSVGP  302
            N DI+SVGP
Sbjct  61   NADILSVGP  69



>ref|XP_011046036.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
[Populus euphratica]
Length=125

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMK VLKLD  D+K K+KAMK+VS L GV+SI++D KDKKLTV G IDA SIVG+LRKIC
Sbjct  1    MMKAVLKLDLHDDKYKKKAMKRVSGLPGVDSIAMDMKDKKLTVVGDIDAASIVGELRKIC  60

Query  276  NTDIVSVGP  302
            +TDI+SVGP
Sbjct  61   HTDIISVGP  69



>gb|EYU25151.1| hypothetical protein MIMGU_mgv11b013063mg [Erythranthe guttata]
Length=151

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD+ DEK KQKAMKKVS + G+ESI++D KDKKLTVTG ID V++V +LRKIC
Sbjct  1    MKKVVLKLDFADEKIKQKAMKKVSGISGLESIALDPKDKKLTVTGDIDPVAVVARLRKIC  60

Query  276  NTDIVSVGP  302
             T+IVSVGP
Sbjct  61   YTEIVSVGP  69



>gb|AAO63778.1| unknown [Populus tremuloides]
Length=132

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  DEK K KAMKKVSSL GV+SIS+D KDKKLTV G +D V IV KLRK+C
Sbjct  1    MKKAVLKLDLHDEKAKTKAMKKVSSLSGVDSISMDMKDKKLTVIGDVDPVHIVSKLRKLC  60

Query  276  NTDIVSVGP  302
            NT+I++VGP
Sbjct  61   NTEIITVGP  69



>ref|XP_002305267.1| hypothetical protein POPTR_0004s07140g [Populus trichocarpa]
 gb|ABK95093.1| unknown [Populus trichocarpa]
 gb|EEE85778.1| hypothetical protein POPTR_0004s07140g [Populus trichocarpa]
Length=132

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  DEK K KAMKKVSSL GV+SIS+D KDKKLTV G +D V IV KLRK+C
Sbjct  1    MKKAVLKLDLHDEKAKTKAMKKVSSLSGVDSISMDMKDKKLTVIGDVDPVDIVSKLRKLC  60

Query  276  NTDIVSVGP  302
            NT+I++VGP
Sbjct  61   NTEIITVGP  69



>gb|KEH26287.1| heavy metal-associated domain protein [Medicago truncatula]
Length=124

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMK+VLK+D  D++TKQKAMK VS L GVES+S+D KDKKLT+TG  D V +V KLRK C
Sbjct  1    MMKLVLKVDIYDDRTKQKAMKTVSGLSGVESVSVDMKDKKLTLTGDTDPVHVVSKLRKWC  60

Query  276  NTDIVSVGP  302
            N +IVSVGP
Sbjct  61   NAEIVSVGP  69



>ref|XP_007218588.1| hypothetical protein PRUPE_ppa013273mg [Prunus persica]
 gb|EMJ19787.1| hypothetical protein PRUPE_ppa013273mg [Prunus persica]
Length=131

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  DEK K+KAM+ VS L+G++SIS+D KDKKLTVTG ID V++V KLRK+C
Sbjct  1    MKKVVLKLELYDEKVKKKAMRAVSGLEGLDSISMDMKDKKLTVTGDIDPVNLVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +TDIVSVGP
Sbjct  61   HTDIVSVGP  69



>ref|XP_011035351.1| PREDICTED: FK506-binding protein 4-like isoform X1 [Populus euphratica]
Length=129

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K K KAMKKVSSL GV+SIS+D KDKKLTV G +D V IV KLRK+C
Sbjct  1    MKKAVLKLDLHDDKAKTKAMKKVSSLSGVDSISMDMKDKKLTVIGDVDPVHIVSKLRKLC  60

Query  276  NTDIVSVGP  302
            NT+I++VGP
Sbjct  61   NTEIITVGP  69



>gb|AFK43139.1| unknown [Medicago truncatula]
Length=124

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMK+VLK+D  D++TKQKAMK VS L GVES+S+D KDKKLT+TG  D V +V KLRK C
Sbjct  1    MMKLVLKVDIHDDRTKQKAMKTVSGLSGVESVSVDMKDKKLTLTGDTDPVHVVSKLRKWC  60

Query  276  NTDIVSVGP  302
            + +IVSVGP
Sbjct  61   HAEIVSVGP  69



>gb|KJB52723.1| hypothetical protein B456_008G274100 [Gossypium raimondii]
Length=135

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M KVVLKL+  D K +QKAMK  S L GVES+++DKD+KLT+TG IDAV  V KLRK+C 
Sbjct  1    MKKVVLKLELHDNKCRQKAMKTASGLSGVESVALDKDQKLTLTGDIDAVVAVRKLRKVCY  60

Query  279  TDIVSVGP  302
            T+IVSVGP
Sbjct  61   TEIVSVGP  68



>ref|XP_009377561.1| PREDICTED: FK506-binding protein 4-like [Pyrus x bretschneideri]
 ref|XP_009377562.1| PREDICTED: FK506-binding protein 4-like [Pyrus x bretschneideri]
 ref|XP_009377564.1| PREDICTED: FK506-binding protein 4-like [Pyrus x bretschneideri]
 ref|XP_009377593.1| PREDICTED: FK506-binding protein 4-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009377594.1| PREDICTED: FK506-binding protein 4-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009377595.1| PREDICTED: FK506-binding protein 4-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009377596.1| PREDICTED: FK506-binding protein 4-like isoform X1 [Pyrus x bretschneideri]
Length=126

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  DEK K+KAM+ VS L+G++SISID KDKKLTVTG ID V +VG+L+K+C
Sbjct  1    MKKVVLKLELYDEKGKKKAMRAVSGLEGLDSISIDMKDKKLTVTGDIDPVDLVGRLKKLC  60

Query  276  NTDIVSVGP  302
             T+IVSVGP
Sbjct  61   RTEIVSVGP  69



>gb|KJB52722.1| hypothetical protein B456_008G274100 [Gossypium raimondii]
Length=144

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            + KVVLKL+  D K +QKAMK  S L GVES+++DKD+KLT+TG IDAV  V KLRK+C 
Sbjct  10   LQKVVLKLELHDNKCRQKAMKTASGLSGVESVALDKDQKLTLTGDIDAVVAVRKLRKVCY  69

Query  279  TDIVSVGP  302
            T+IVSVGP
Sbjct  70   TEIVSVGP  77



>dbj|BAG15861.1| hypothetical protein [Bruguiera gymnorhiza]
Length=131

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV+LKLD +D+K KQKAM+ VS L GV+S+++D K+KKLTVTG +D V +V KLRK+C
Sbjct  1    MKKVILKLDPRDDKIKQKAMRTVSGLSGVDSVAMDMKEKKLTVTGDVDPVHVVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +TDIVSVGP
Sbjct  61   HTDIVSVGP  69



>ref|XP_004516867.1| PREDICTED: uncharacterized protein LOC101510149 [Cicer arietinum]
Length=123

 Score = 87.8 bits (216),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMKVVLK++  DE+ KQKAM+ VS L GVESIS+D KDKKLT+ G ID + +V KLRK C
Sbjct  1    MMKVVLKVNLYDERIKQKAMRTVSGLSGVESISVDMKDKKLTLIGDIDPLHVVNKLRKWC  60

Query  276  NTDIVSVGP  302
            NT+IV VGP
Sbjct  61   NTEIVFVGP  69



>ref|XP_008362786.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
[Malus domestica]
Length=126

 Score = 87.8 bits (216),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  DEK K+KAM+ VS L+G++SIS+D KDKKLTVTG ID V +VG+LRK+C
Sbjct  1    MKKVVLKLELHDEKGKKKAMRAVSGLEGLDSISMDMKDKKLTVTGDIDPVDLVGRLRKLC  60

Query  276  NTDIVSVGP  302
              +IVSVGP
Sbjct  61   RAEIVSVGP  69



>gb|KEH26285.1| heavy metal-associated domain protein [Medicago truncatula]
Length=124

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMK+VLK+D  D++TKQKAMK VS L GVES+S+D KDKKLT+TG  D V ++ KLRK C
Sbjct  1    MMKLVLKVDIHDDRTKQKAMKTVSGLSGVESVSVDMKDKKLTLTGDTDPVHVLSKLRKWC  60

Query  276  NTDIVSVGP  302
            + +IVSVGP
Sbjct  61   HAEIVSVGP  69



>ref|XP_007143475.1| hypothetical protein PHAVU_007G075000g [Phaseolus vulgaris]
 gb|ESW15469.1| hypothetical protein PHAVU_007G075000g [Phaseolus vulgaris]
Length=136

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D  ++K KQKAMK VS + GVES+S+D KDKKLT+TG ID V +V KLRK C
Sbjct  1    MKKVVLKVDVHEDKIKQKAMKAVSGISGVESVSVDMKDKKLTLTGDIDPVQVVAKLRKFC  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_004145901.1| PREDICTED: uncharacterized protein LOC101215695 [Cucumis sativus]
 gb|KGN49919.1| hypothetical protein Csa_5G140450 [Cucumis sativus]
Length=144

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV++KLD  DEK+KQKAM  VSSL GV SIS+D K+KKLTVTG +D V IVGKLRKIC
Sbjct  1    MKKVIVKLDVSDEKSKQKAMSVVSSLSGVNSISMDMKEKKLTVTGDVDPVVIVGKLRKIC  60

Query  276  NTDIVSVG  299
            +T IVSVG
Sbjct  61   HTTIVSVG  68



>ref|XP_004160362.1| PREDICTED: uncharacterized protein LOC101225301 [Cucumis sativus]
Length=144

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV++KLD  DEK+KQKAM  VSSL GV SIS+D K+KKLTVTG +D V IVGKLRKIC
Sbjct  1    MKKVIVKLDVSDEKSKQKAMSVVSSLSGVNSISMDMKEKKLTVTGDVDPVVIVGKLRKIC  60

Query  276  NTDIVSVG  299
            +T IVSVG
Sbjct  61   HTTIVSVG  68



>gb|EPS62150.1| hypothetical protein M569_12645 [Genlisea aurea]
Length=167

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD+ D+K KQKAM+++S L G+ESI+ D KDKKLT+TG ID V  V KLRK+C
Sbjct  1    MKKVVLKLDFSDDKIKQKAMQRISGLPGLESIAFDQKDKKLTITGDIDPVEAVDKLRKLC  60

Query  276  NTDIVSVGP  302
              +IVSVGP
Sbjct  61   RAEIVSVGP  69



>ref|XP_008380205.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
[Malus domestica]
Length=126

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  DEK K+KAM+ VS L+G++SIS+D KDKKLTVTG ID V +VG+LRK+C
Sbjct  1    MKKVVLKLELHDEKGKKKAMRAVSGLEGLDSISMDMKDKKLTVTGDIDPVDLVGRLRKLC  60

Query  276  NTDIVSVGP  302
              +IVSVGP
Sbjct  61   RXEIVSVGP  69



>ref|XP_009375530.1| PREDICTED: FK506-binding protein 4-like [Pyrus x bretschneideri]
 ref|XP_009375531.1| PREDICTED: FK506-binding protein 4-like [Pyrus x bretschneideri]
 ref|XP_009375532.1| PREDICTED: FK506-binding protein 4-like [Pyrus x bretschneideri]
Length=126

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  DEK K+KAM+ VS L+G++SISID KDKKLT TG ID V +VG+L+K+C
Sbjct  1    MKKVVLKLELYDEKGKKKAMRAVSGLEGLDSISIDMKDKKLTATGDIDPVDLVGRLKKLC  60

Query  276  NTDIVSVGP  302
             T+IVSVGP
Sbjct  61   RTEIVSVGP  69



>gb|KHG19695.1| Putative late blight resistance R1A-3 [Gossypium arboreum]
Length=125

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M KVVLKL+  +EK KQKAMK  S L GVES+SIDKD KLTVTG +D V    KL K+C+
Sbjct  1    MKKVVLKLELHNEKCKQKAMKIASGLSGVESVSIDKDHKLTVTGDVDPVKAAQKLGKLCH  60

Query  279  TDIVSVGP  302
            T+IVSVGP
Sbjct  61   TEIVSVGP  68



>gb|KEH26288.1| heavy metal-associated domain protein [Medicago truncatula]
Length=154

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            + K+VLK+D  D++TKQKAMK VS L GVES+S+D KDKKLT+TG  D V +V KLRK C
Sbjct  31   LQKLVLKVDIYDDRTKQKAMKTVSGLSGVESVSVDMKDKKLTLTGDTDPVHVVSKLRKWC  90

Query  276  NTDIVSVGP  302
            N +IVSVGP
Sbjct  91   NAEIVSVGP  99



>ref|XP_008380151.1| PREDICTED: FK506-binding protein 4-like [Malus domestica]
 ref|XP_008343770.1| PREDICTED: FK506-binding protein 4-like [Malus domestica]
Length=126

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  DEK K+K M+ VS L+G++SIS+D KDKKLT TG ID V +VG+LRK+C
Sbjct  1    MKKVVLKLELYDEKCKKKVMRAVSGLEGLDSISMDMKDKKLTATGDIDPVHLVGRLRKLC  60

Query  276  NTDIVSVGP  302
             T+IVSVGP
Sbjct  61   RTEIVSVGP  69



>ref|XP_006360195.1| PREDICTED: copper transport protein CCH-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006360196.1| PREDICTED: copper transport protein CCH-like isoform X2 [Solanum 
tuberosum]
Length=142

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMKVVLKL+Y D+K KQ+ MKKVS ++GV+S+SI+ KDKKLTVTG++D V +V KL+K+C
Sbjct  1    MMKVVLKLEYLDDKVKQRVMKKVSGVEGVDSVSIETKDKKLTVTGNVDPVVLVTKLKKLC  60

Query  276  NTDIVSVG  299
            +T+I+SVG
Sbjct  61   HTEILSVG  68



>ref|XP_007143473.1| hypothetical protein PHAVU_007G074800g [Phaseolus vulgaris]
 gb|ESW15467.1| hypothetical protein PHAVU_007G074800g [Phaseolus vulgaris]
Length=136

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D  ++K KQKAMK VS + GVES+S+D KDKKLT+TG ID V +V KLRK C
Sbjct  1    MKKVVLKVDVHEDKIKQKAMKAVSGILGVESVSVDMKDKKLTLTGDIDPVQVVAKLRKFC  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_008234832.1| PREDICTED: FK506-binding protein 4-like [Prunus mume]
Length=127

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  DEK K+KAM+ VS L+G++SIS+D KDKKLTV G +D V++V KLRK+C
Sbjct  1    MKKVVLKLELYDEKAKKKAMRAVSGLEGLDSISMDMKDKKLTVIGDVDPVNLVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_006372382.1| hypothetical protein POPTR_0017s01090g [Populus trichocarpa]
 gb|ERP50179.1| hypothetical protein POPTR_0017s01090g [Populus trichocarpa]
Length=128

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKL+  DEK K+KAMK VS L GV+S+SID KDKKLTV G ID V IV KLRK+C
Sbjct  1    MKKAVLKLELHDEKAKKKAMKTVSGLSGVDSVSIDMKDKKLTVIGGIDPVHIVTKLRKLC  60

Query  276  NTDIVSVGP  302
            +T+IV+VGP
Sbjct  61   HTEIVTVGP  69



>emb|CDP05138.1| unnamed protein product [Coffea canephora]
Length=171

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+++ D+K KQK M+KVS L G+ES++I+ KDKKLTV G ID V IV KLRK+C
Sbjct  1    MKKVVLKVEFHDDKVKQKVMQKVSGLVGIESVAIESKDKKLTVVGDIDPVGIVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_008360723.1| PREDICTED: uncharacterized protein LOC103424419 [Malus domestica]
 ref|XP_008360724.1| PREDICTED: uncharacterized protein LOC103424419 [Malus domestica]
 ref|XP_008360725.1| PREDICTED: uncharacterized protein LOC103424419 [Malus domestica]
Length=125

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  DEK K+KAM+ +S L+G++S S+D KDKKLTVTG ID V +VG+LRK+C
Sbjct  1    MKKVVLKLELYDEKGKKKAMRAISGLEGLDSCSMDMKDKKLTVTGDIDPVELVGRLRKLC  60

Query  276  NTDIVSVGP  302
              +IVSVGP
Sbjct  61   PAEIVSVGP  69



>ref|XP_008437534.1| PREDICTED: uncharacterized protein LOC103482919 [Cucumis melo]
 gb|ADN33773.1| metal ion binding protein [Cucumis melo subsp. melo]
Length=140

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV++KLD  DEK+KQKAM  VSSL GV SIS+D K+KKLTVTG +D V IV KLRKIC
Sbjct  1    MKKVIVKLDVSDEKSKQKAMSVVSSLSGVNSISMDMKEKKLTVTGDVDPVVIVSKLRKIC  60

Query  276  NTDIVSVG  299
            +T IVSVG
Sbjct  61   HTTIVSVG  68



>gb|KEH26283.1| heavy metal-associated domain protein [Medicago truncatula]
Length=110

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D+ +++TKQK MK VSSL GVES+SID  +KKLT+TG +D + +V KLRK+C
Sbjct  1    MKKVVLKVDFYNDRTKQKVMKTVSSLSGVESVSIDTNEKKLTLTGDVDPIKVVSKLRKLC  60

Query  276  NTDIVSVG  299
             T++VS+G
Sbjct  61   QTEVVSIG  68



>ref|XP_010671617.1| PREDICTED: uncharacterized protein LOC104888366 [Beta vulgaris 
subsp. vulgaris]
Length=132

 Score = 85.1 bits (209),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  DEK KQKAMK  S+L G++SIS+D K+KKLT+TG ID V+IV KLRK+ 
Sbjct  1    MKKVVLKLDVHDEKCKQKAMKMASTLSGLDSISMDMKEKKLTLTGDIDPVAIVSKLRKVY  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_011046029.1| PREDICTED: uncharacterized protein LOC105140762 isoform X1 [Populus 
euphratica]
Length=131

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +3

Query  96   NMMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKI  272
             M K VLKL+  DEK K+KAMK VS L GV+S+SID KDKKLTV G +D V IV KLRK+
Sbjct  2    EMKKAVLKLELHDEKAKKKAMKTVSGLSGVDSVSIDMKDKKLTVIGDMDPVHIVAKLRKL  61

Query  273  CNTDIVSVGP  302
            C+T+I +VGP
Sbjct  62   CHTEIATVGP  71



>ref|XP_011046030.1| PREDICTED: uncharacterized protein LOC105140762 isoform X2 [Populus 
euphratica]
Length=129

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKL+  DEK K+KAMK VS L GV+S+SID KDKKLTV G +D V IV KLRK+C
Sbjct  1    MKKAVLKLELHDEKAKKKAMKTVSGLSGVDSVSIDMKDKKLTVIGDMDPVHIVAKLRKLC  60

Query  276  NTDIVSVGP  302
            +T+I +VGP
Sbjct  61   HTEIATVGP  69



>emb|CAN77999.1| hypothetical protein VITISV_002984 [Vitis vinifera]
Length=132

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K++LKL+  D+K KQKAMK VSSL GV SIS+D KDKKLTV G +D V IV KLRK C T
Sbjct  5    KIILKLEVFDDKAKQKAMKNVSSLPGVTSISVDMKDKKLTVIGDVDPVCIVSKLRKFCRT  64

Query  282  DIVSVGP  302
            +I+SVGP
Sbjct  65   EILSVGP  71



>emb|CBI22643.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K++LKL+  D+K KQKAMK VSSL GV SIS+D KDKKLTV G +D V IV KLRK C T
Sbjct  5    KIILKLEVFDDKAKQKAMKNVSSLPGVTSISVDMKDKKLTVIGDVDPVCIVSKLRKFCRT  64

Query  282  DIVSVGP  302
            +I+SVGP
Sbjct  65   EILSVGP  71



>ref|XP_011046033.1| PREDICTED: uncharacterized protein LOC105140764 isoform X3 [Populus 
euphratica]
Length=118

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VL+LD  DEK K+KAMK VSSL GV SIS++ K++KLTV G ID V IV KLRK+C
Sbjct  1    MKKAVLRLDLHDEKAKKKAMKTVSSLSGVHSISMEMKEQKLTVIGDIDPVHIVAKLRKLC  60

Query  276  NTDIVSVGP  302
             T+IV+VGP
Sbjct  61   CTEIVTVGP  69



>gb|AFK36567.1| unknown [Lotus japonicus]
Length=127

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMK+VLK++  D+K KQKAMK VS + GVES+S+D   KKLT+TG ID V +V KLRK C
Sbjct  1    MMKLVLKVELHDDKIKQKAMKSVSGISGVESVSVDMGSKKLTLTGDIDPVHVVSKLRKWC  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_002305266.2| hypothetical protein POPTR_0004s07150g [Populus trichocarpa]
 gb|EEE85777.2| hypothetical protein POPTR_0004s07150g [Populus trichocarpa]
Length=127

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K +LKLD  DEKTK+KAMK VS   GV+SIS+D  DKKLTVTG ID V+IV KLRK C
Sbjct  1    MQKAMLKLDMHDEKTKKKAMKTVSGFSGVDSISMDWNDKKLTVTGDIDPVNIVKKLRKFC  60

Query  276  NTDIVSVG  299
            + +IVSVG
Sbjct  61   HVEIVSVG  68



>gb|KEH26284.1| heavy metal-associated domain protein [Medicago truncatula]
Length=154

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            + K+VLK+D  D++TKQKAMK VS L GVES+S+D KDKKLT+TG  D V ++ KLRK C
Sbjct  31   LQKLVLKVDIHDDRTKQKAMKTVSGLSGVESVSVDMKDKKLTLTGDTDPVHVLSKLRKWC  90

Query  276  NTDIVSVGP  302
            + +IVSVGP
Sbjct  91   HAEIVSVGP  99



>ref|XP_003592378.1| hypothetical protein MTR_1g102240 [Medicago truncatula]
 gb|AES62629.1| metal ion-binding protein, putative [Medicago truncatula]
Length=132

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M K+VLKL+  ++K KQKAMK VS L GVES+ +DKDKK+T+ G  D V IV KLRK+C+
Sbjct  1    MKKIVLKLEIHEDKIKQKAMKAVSGLSGVESVEVDKDKKMTLVGDTDPVLIVAKLRKLCH  60

Query  279  TDIVSVGP  302
             +I+SVGP
Sbjct  61   AEILSVGP  68



>gb|KEH33280.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=110

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV+LK+D+ +++ KQK MK  SSL G ES+SID K+KKLTV+G ID V +V KLRK+C
Sbjct  1    MKKVLLKVDFYNDRIKQKVMKTASSLPGFESLSIDSKEKKLTVSGDIDPVKVVCKLRKLC  60

Query  276  NTDIVSVGP  302
             T+IVS+GP
Sbjct  61   QTEIVSIGP  69



>ref|XP_003592191.1| hypothetical protein MTR_1g099800 [Medicago truncatula]
 gb|AES62442.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
 gb|AFK37756.1| unknown [Medicago truncatula]
Length=136

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  ++K KQKAMK VS L GVES+SID KDKK+T+ G ID + +V KLRK+C
Sbjct  1    MKKVVLKLEINEDKIKQKAMKAVSGLSGVESVSIDMKDKKMTLIGDIDPIRVVAKLRKLC  60

Query  276  NTDIVSVGP  302
            + +I+SVGP
Sbjct  61   HAEILSVGP  69



>gb|KEH43672.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=132

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M K+VLKL+  ++K KQKAMK VS L GVES+ +DKDKK+T+ G  D V +V KLRK+C+
Sbjct  1    MKKIVLKLEIHEDKIKQKAMKAVSGLSGVESVEVDKDKKMTLVGDTDPVLVVAKLRKLCH  60

Query  279  TDIVSVGP  302
             +I+SVGP
Sbjct  61   AEILSVGP  68



>ref|XP_011015695.1| PREDICTED: uncharacterized protein LOC105119269, partial [Populus 
euphratica]
Length=131

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            + K VLK++  DEK K+KAMK VS L GV+++SID KDKK+TVTG ID V IV KLRK+C
Sbjct  9    LQKAVLKVELHDEKAKKKAMKIVSGLSGVDTVSIDMKDKKMTVTGDIDPVCIVAKLRKLC  68

Query  276  NTDIVSVGP  302
             T+IV+VGP
Sbjct  69   CTEIVTVGP  77



>gb|KEH33277.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=110

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV+LK+D+ +++ KQK MK  SSL G ES+SID K+KKLTV+G ID V +V KLRK+C
Sbjct  1    MKKVLLKVDFYNDRIKQKVMKTASSLPGFESLSIDSKEKKLTVSGDIDPVKVVCKLRKLC  60

Query  276  NTDIVSVGP  302
             T+IVS+GP
Sbjct  61   QTEIVSIGP  69



>ref|XP_002278542.1| PREDICTED: uncharacterized protein LOC100258716 [Vitis vinifera]
 emb|CBI34387.3| unnamed protein product [Vitis vinifera]
Length=134

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K KQKAMK VSSL GV SI++D KDKKLTV G +D V IV KLRK  
Sbjct  1    MKKVVLKLDLHDDKAKQKAMKAVSSLSGVNSIAMDMKDKKLTVVGDVDPVDIVSKLRKGW  60

Query  276  NTDIVSVGP  302
            +TDI++VGP
Sbjct  61   HTDILTVGP  69



>ref|XP_009368729.1| PREDICTED: FK506-binding protein 4 [Pyrus x bretschneideri]
Length=131

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  +EK+K+KAMK VS L+G++SIS+D KDKKLTVTG ID V +V +LRK+ 
Sbjct  1    MKKVVLKLEVYNEKSKKKAMKAVSGLEGLDSISMDMKDKKLTVTGDIDPVELVARLRKLY  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>gb|AFK42627.1| unknown [Medicago truncatula]
Length=110

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV+LK+D+ +++ KQK MK  SSL G ES+SID K+KKLTV+G ID V +V KLRK+C
Sbjct  1    MKKVLLKVDFYNDRIKQKVMKTASSLPGFESLSIDSKEKKLTVSGDIDPVKVVCKLRKLC  60

Query  276  NTDIVSVGP  302
             T+IVS+GP
Sbjct  61   QTEIVSIGP  69



>ref|XP_003592192.1| hypothetical protein MTR_1g099810 [Medicago truncatula]
 gb|AES62443.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=139

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  +++ KQKAMK VS L GVES+SID KDKK+T+ G ID V +V KLRKIC
Sbjct  1    MKKVVLKLEINEDRIKQKAMKAVSGLSGVESVSIDMKDKKMTLIGDIDPVRVVAKLRKIC  60

Query  276  NTDIVSVGP  302
              +I+SVGP
Sbjct  61   YAEILSVGP  69



>ref|XP_007160106.1| hypothetical protein PHAVU_002G292900g [Phaseolus vulgaris]
 gb|ESW32100.1| hypothetical protein PHAVU_002G292900g [Phaseolus vulgaris]
Length=138

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVV+KLD  D+K KQKAMK VSSL G++SIS+D K+KKLTV G ID VS+V KLRK  
Sbjct  1    MKKVVVKLDLHDDKAKQKAMKSVSSLSGIDSISMDMKEKKLTVVGDIDPVSVVSKLRKSW  60

Query  276  NTDIVSVGP  302
            +T+IV+VGP
Sbjct  61   HTEIVTVGP  69



>ref|XP_002274512.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Vitis vinifera]
 emb|CBI22644.3| unnamed protein product [Vitis vinifera]
Length=125

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K +LK++  D+K+KQKAMK V+ L GV S+S+D KDKKLTV G +D VSIVG+LRK+C
Sbjct  3    MKKTILKVELFDDKSKQKAMKNVACLPGVSSVSMDMKDKKLTVIGDVDPVSIVGRLRKLC  62

Query  276  NTDIVSVGP  302
            + +I+SVGP
Sbjct  63   HPEILSVGP  71



>ref|XP_003535594.1| PREDICTED: putative late blight resistance protein homolog R1B-19-like 
[Glycine max]
Length=134

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVL ++  D+K K+KAMK VS+L GVES+S+D K++KLT+ G ID V  VGKLRK+C
Sbjct  1    MNKVVLSVELHDDKIKKKAMKVVSNLSGVESVSVDMKEQKLTLIGDIDPVVAVGKLRKLC  60

Query  276  NTDIVSVGP  302
            +TDIVSVGP
Sbjct  61   HTDIVSVGP  69



>ref|XP_002509857.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF51244.1| metal ion binding protein, putative [Ricinus communis]
Length=129

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K KQKAMK VSSL G++SI++D K++KLTV G +D V++VGKLRK  
Sbjct  1    MKKVVLKLDLHDDKAKQKAMKAVSSLSGIDSIAMDMKERKLTVIGDVDPVTVVGKLRKAF  60

Query  276  NTDIVSVGP  302
            +T I++VGP
Sbjct  61   HTQILTVGP  69



>gb|KEH22477.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=113

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D+ +++ KQK MK  SSL GVES+SID K+KKLT++G ID +  V KLRK+C
Sbjct  1    MKKVVLKVDFYNDRIKQKVMKTASSLSGVESVSIDWKEKKLTISGDIDPIKGVCKLRKLC  60

Query  276  NTDIVSVGP  302
             T+IVS+GP
Sbjct  61   QTEIVSIGP  69



>ref|XP_004515154.1| PREDICTED: uncharacterized protein LOC101499358 [Cicer arietinum]
Length=132

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMK+VLK++  D+K K+KAMK VS L GVES+S+D KD+K+T+ G IDAV +VGKLRK+C
Sbjct  1    MMKIVLKVELYDDKIKKKAMKAVSGLSGVESVSVDMKDQKMTLIGDIDAVKVVGKLRKLC  60

Query  276  NTDIVSVG  299
            + ++VSVG
Sbjct  61   HAEMVSVG  68



>ref|XP_008345258.1| PREDICTED: FK506-binding protein 4-like [Malus domestica]
 ref|XP_008362634.1| PREDICTED: FK506-binding protein 4-like [Malus domestica]
Length=166

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K KQKA+K VS+L G++SI++D KDKKLTV GS+D V++V KLRK  
Sbjct  1    MKKFVLKLDLPDDKAKQKALKTVSTLSGIDSIAMDMKDKKLTVIGSVDPVTVVSKLRKYW  60

Query  276  NTDIVSVGP  302
             TDI+SVGP
Sbjct  61   QTDIISVGP  69



>gb|AFK40989.1| unknown [Medicago truncatula]
Length=132

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M K+VLKL+  ++K KQKAMK VS L GVES+ +D+DKK+T+ G  D V IV KLRK+C+
Sbjct  1    MKKIVLKLEIHEDKIKQKAMKAVSGLSGVESVEVDEDKKMTLVGDTDPVLIVAKLRKLCH  60

Query  279  TDIVSVGP  302
             +I+SVGP
Sbjct  61   AEILSVGP  68



>ref|XP_010105739.1| hypothetical protein L484_014228 [Morus notabilis]
 ref|XP_010105740.1| hypothetical protein L484_014229 [Morus notabilis]
 gb|EXC05959.1| hypothetical protein L484_014228 [Morus notabilis]
 gb|EXC05960.1| hypothetical protein L484_014229 [Morus notabilis]
Length=132

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M  VVLK+DY DEK ++K MK VS   GV SI++D KDKKLTVTG ID VS+V KLRK+C
Sbjct  1    MKVVVLKIDYYDEKCQKKVMKTVSGHSGVVSIALDTKDKKLTVTGDIDPVSLVSKLRKLC  60

Query  276  NTDIVSVG  299
            NT+IVSVG
Sbjct  61   NTEIVSVG  68



>ref|XP_004496520.1| PREDICTED: uncharacterized protein LOC101510144 [Cicer arietinum]
Length=131

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VL++D  D+KTK+KAMK +S++ GVES+S+D K++KLT+TG ID V +VGKLRK+C
Sbjct  1    MNKIVLQVDVHDDKTKKKAMKAISNISGVESVSMDLKEQKLTLTGDIDPVHVVGKLRKLC  60

Query  276  NTDIVSVG  299
            N  I+SVG
Sbjct  61   NPKILSVG  68



>ref|XP_007208886.1| hypothetical protein PRUPE_ppa026540mg [Prunus persica]
 gb|EMJ10085.1| hypothetical protein PRUPE_ppa026540mg [Prunus persica]
Length=127

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D++ KQKA+K VSSL G++SI++D K++KLTVTG ID V +V KLRK  
Sbjct  1    MKKVVLKLDLHDDRQKQKALKSVSSLTGIDSIAMDMKERKLTVTGDIDPVDVVAKLRKCW  60

Query  276  NTDIVSVGP  302
            +TDI++VGP
Sbjct  61   HTDILTVGP  69



>ref|XP_008376650.1| PREDICTED: FK506-binding protein 4-like [Malus domestica]
Length=131

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  +EK+K+KAMK VS L+G++SIS+D KDKKLTVTG ID V +V +LRK+ 
Sbjct  1    MKKVVLKLEVYNEKSKKKAMKAVSGLEGLDSISMDMKDKKLTVTGDIDPVELVARLRKLY  60

Query  276  NTDIVSVGP  302
            +T+I+SVGP
Sbjct  61   HTEILSVGP  69



>ref|XP_010089046.1| Putative late blight resistance-like protein [Morus notabilis]
 gb|EXB37293.1| Putative late blight resistance-like protein [Morus notabilis]
Length=134

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVV+KLD  D+K KQKA+KKVS+L G++SIS+D K+KKLTV G +D V IV KLRK  
Sbjct  1    MKKVVVKLDLHDDKAKQKALKKVSTLTGIDSISMDMKEKKLTVVGDVDPVEIVNKLRKTW  60

Query  276  NTDIVSVGP  302
             T+IVSVGP
Sbjct  61   FTEIVSVGP  69



>ref|XP_007152164.1| hypothetical protein PHAVU_004G107100g [Phaseolus vulgaris]
 gb|ESW24158.1| hypothetical protein PHAVU_004G107100g [Phaseolus vulgaris]
Length=107

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D  D+K K+KAMK  S L G+ESIS+D KD KL + G ID VS V KLRK C
Sbjct  1    MKKVVLKMDLHDDKIKRKAMKTASGLSGIESISVDLKDMKLVLFGEIDPVSAVSKLRKWC  60

Query  276  NTDIVSVGP  302
            +T++VSVGP
Sbjct  61   HTELVSVGP  69



>gb|KHN21790.1| hypothetical protein glysoja_027674, partial [Glycine soja]
Length=133

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KVVL ++  D+K K+KAMK VS+L GVES+S+D K++KLT+ G ID V  VGKLRK+C+T
Sbjct  2    KVVLSVELHDDKIKKKAMKVVSNLSGVESVSVDMKEQKLTLIGDIDPVVAVGKLRKLCHT  61

Query  282  DIVSVGP  302
            DIVSVGP
Sbjct  62   DIVSVGP  68



>gb|KEH15395.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=110

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV+LK+D+ +++ KQK MK  SSL GVES++ID K+KKLT++G ID V  V KLRK+C
Sbjct  1    MKKVLLKVDFYNDRIKQKVMKTASSLPGVESVAIDSKEKKLTLSGDIDPVKAVCKLRKLC  60

Query  276  NTDIVSVGP  302
             T+IVS+GP
Sbjct  61   QTEIVSIGP  69



>ref|XP_004308048.1| PREDICTED: FK506-binding protein 4-like [Fragaria vesca subsp. 
vesca]
Length=131

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K+K+KAM+ VS L+G++SIS+D KD+KLTVTG ID V +V KLRK+C
Sbjct  1    MKKVVLKLDVHDDKSKKKAMRAVSGLEGLDSISMDMKDQKLTVTGDIDPVGLVSKLRKLC  60

Query  276  NTDIVSV  296
             T+IVSV
Sbjct  61   RTEIVSV  67



>ref|NP_001238668.1| uncharacterized protein LOC100306170 [Glycine max]
 gb|ACU14223.1| unknown [Glycine max]
Length=136

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK++  ++K KQKAMK VS + GVES+S+D KDKKLTV G ID V +  KLRK+C
Sbjct  1    MKKVVLKVEVHEDKIKQKAMKVVSGISGVESVSVDMKDKKLTVIGDIDPVKVAAKLRKLC  60

Query  276  NTDIVSVGP  302
            + +IVSVGP
Sbjct  61   HAEIVSVGP  69



>gb|AFK46184.1| unknown [Medicago truncatula]
Length=133

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLK +  D++ K+KAMK VS L GVES+S+D KD+KLT+ G ID V +VGKLRK+C
Sbjct  1    MQKIVLKGELYDDRIKKKAMKTVSGLSGVESVSVDMKDQKLTLVGDIDTVDVVGKLRKLC  60

Query  276  NTDIVSVGP  302
            + +IVSVGP
Sbjct  61   HAEIVSVGP  69



>ref|XP_009377565.1| PREDICTED: uncharacterized protein LOC103966144 [Pyrus x bretschneideri]
Length=122

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+   +K K++AMK VS L+G++SIS+D KDKKLT TG ID V +V +LRK+C
Sbjct  1    MKKVVLKLELYGDKCKKRAMKAVSGLEGLDSISLDMKDKKLTATGDIDPVDLVERLRKLC  60

Query  276  NTDIVSVGP  302
             T+IVSVGP
Sbjct  61   RTEIVSVGP  69



>ref|XP_009375534.1| PREDICTED: uncharacterized protein LOC103964331 [Pyrus x bretschneideri]
 ref|XP_009375535.1| PREDICTED: uncharacterized protein LOC103964331 [Pyrus x bretschneideri]
Length=121

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+   +K K++AMK VS L+G++SIS+D KDKKLT TG ID V +V +LRK+C
Sbjct  1    MKKVVLKLELYGDKCKKRAMKAVSGLEGLDSISLDMKDKKLTATGDIDPVDLVERLRKLC  60

Query  276  NTDIVSVGP  302
             T+IVSVGP
Sbjct  61   RTEIVSVGP  69



>gb|KHN42451.1| hypothetical protein glysoja_033919 [Glycine soja]
Length=113

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK++  D+K K+KAMK VS + G ES+S+D KD+K+T+ G  D V+ VGKLRK C
Sbjct  1    MKKVVLKVELHDDKIKKKAMKAVSGISGAESVSVDMKDQKMTIIGDFDPVTAVGKLRKFC  60

Query  276  NTDIVSVGP  302
            N +I+SVGP
Sbjct  61   NAEILSVGP  69



>emb|CBI22646.3| unnamed protein product [Vitis vinifera]
Length=87

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K++LK++  D+K K KA+K VS L GV SIS+D KDKK+TV G +D VSIVG+LRK+C
Sbjct  2    MQKIILKVEVFDDKAKTKALKNVSCLPGVRSISMDMKDKKMTVIGDVDPVSIVGRLRKLC  61

Query  276  NTDIVSVGP  302
            + +I+SVGP
Sbjct  62   HPEILSVGP  70



>ref|XP_011073260.1| PREDICTED: copper transport protein CCH-like [Sesamum indicum]
Length=133

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KVVLKL  +DEK KQKAMK VS L G+ES++ID K+KKLTV G +D V IVGKLRK    
Sbjct  4    KVVLKLGVRDEKHKQKAMKAVSGLSGIESLTIDMKEKKLTVVGDVDPVQIVGKLRKYWQP  63

Query  282  DIVSVGP  302
            +IV+VGP
Sbjct  64   EIVTVGP  70



>ref|XP_004503674.1| PREDICTED: uncharacterized protein LOC101514701 [Cicer arietinum]
Length=134

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+V+KLD  D+K KQKAMK VSSL G++SI++D K+KKLTV G ID V +V KLRK  
Sbjct  1    MRKIVVKLDLHDDKAKQKAMKSVSSLTGIDSIAMDMKEKKLTVIGDIDPVDVVSKLRKTW  60

Query  276  NTDIVSVGP  302
            +TDI++VGP
Sbjct  61   HTDILTVGP  69



>ref|XP_004515151.1| PREDICTED: uncharacterized protein LOC101498382 [Cicer arietinum]
Length=107

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D+ ++K KQK MK  S L GVES+SI+ K+KKLT++G ID V  V KLRK+C
Sbjct  1    MKKVVLKVDFYNDKIKQKMMKTASGLLGVESVSIELKEKKLTLSGDIDPVKAVSKLRKVC  60

Query  276  NTDIVSVGP  302
             T+IVSVGP
Sbjct  61   QTEIVSVGP  69



>ref|XP_008232983.1| PREDICTED: FK506-binding protein 4 [Prunus mume]
Length=165

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D++ KQKA+K VS+L G++SIS+D K+KKLTV GS+D V++V KLRK  
Sbjct  1    MKKFVLKLDLHDDRAKQKALKTVSTLSGIDSISMDMKEKKLTVIGSVDPVNVVSKLRKYW  60

Query  276  NTDIVSVGP  302
             TDI+SVGP
Sbjct  61   QTDILSVGP  69



>gb|KJB52724.1| hypothetical protein B456_008G274200 [Gossypium raimondii]
Length=129

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M K+VLKLD  ++K +QK MK  S L GVES++IDKD+KLTV G +D V    KL K+C+
Sbjct  1    MKKIVLKLDLHNDKCRQKGMKMASGLSGVESVAIDKDQKLTVIGDVDPVKAAKKLGKLCH  60

Query  279  TDIVSVGP  302
            T+IVSVGP
Sbjct  61   TEIVSVGP  68



>ref|XP_011029352.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
[Populus euphratica]
 ref|XP_011029353.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
[Populus euphratica]
Length=126

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K KQKAMK VS L G++SI++D K+KKLTV G ID V +V KLRKI 
Sbjct  1    MKKVVLKLDLHDDKGKQKAMKAVSGLSGIDSIAMDMKEKKLTVIGDIDPVDVVSKLRKIW  60

Query  276  NTDIVSVGP  302
            +T+I++VGP
Sbjct  61   HTEILAVGP  69



>ref|XP_009382266.1| PREDICTED: titin-like [Musa acuminata subsp. malaccensis]
Length=262

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLKLD  D+K KQKAMK VS+L G++SI++D K+KK+TV GS+D VS+V KLRK  
Sbjct  89   MKKIVLKLDLHDDKEKQKAMKTVSTLQGIDSIAMDMKEKKMTVIGSVDPVSVVSKLRKFW  148

Query  276  NTDIVSVG  299
            +T++VSVG
Sbjct  149  HTNLVSVG  156



>gb|AFK46070.1| unknown [Medicago truncatula]
 gb|KEH22476.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=110

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV+LK+D+ +++ KQK MK  SSL G ES++ID K+KKLT++G ID V  V KLRK+C
Sbjct  1    MKKVLLKVDFYNDRIKQKVMKTASSLPGAESVAIDSKEKKLTLSGDIDPVKAVCKLRKLC  60

Query  276  NTDIVSVGP  302
             T+IVS+GP
Sbjct  61   QTEIVSIGP  69



>ref|XP_010934499.1| PREDICTED: uncharacterized protein LOC105054633 [Elaeis guineensis]
Length=138

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  96   NMMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKI  272
            +M KVVLKL+  D+K K++AMK VSSL GV+S+S+D KDKKLTV G++D V IV KLRK 
Sbjct  4    DMKKVVLKLEVHDDKAKKRAMKAVSSLQGVDSLSMDMKDKKLTVIGAVDPVDIVKKLRKF  63

Query  273  CNTDIVSVGP  302
              T+I+SVGP
Sbjct  64   WFTEILSVGP  73



>ref|XP_011046028.1| PREDICTED: uncharacterized protein LOC105140760 [Populus euphratica]
Length=125

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMK VLKLD  D+K K+KAMK+VS L GV SIS+D KDKKLTV G IDAVSIVGKLRKIC
Sbjct  1    MMKAVLKLDLHDDKDKKKAMKRVSGLTGVHSISMDMKDKKLTVVGDIDAVSIVGKLRKIC  60

Query  276  NTDIVSVGP  302
            +TDI+SVGP
Sbjct  61   HTDIISVGP  69



>ref|XP_002273341.2| PREDICTED: uncharacterized protein LOC100247478 [Vitis vinifera]
Length=131

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K++LKL+  D+K K+KAM+ VS L GV SIS+D KDKKLTV G +D V IV KLRK C T
Sbjct  5    KIILKLEVFDDKAKRKAMRNVSCLLGVTSISVDMKDKKLTVIGDVDPVCIVSKLRKFCRT  64

Query  282  DIVSVGP  302
            +I+SVGP
Sbjct  65   EILSVGP  71



>gb|KHN21789.1| hypothetical protein glysoja_027673, partial [Glycine soja]
Length=135

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KVVLK++  ++K KQKAMK VS + GVES+S+D KDKKLTV G ID V +  KLRK+C+ 
Sbjct  2    KVVLKVEVHEDKIKQKAMKVVSGISGVESVSVDMKDKKLTVIGDIDPVKVAAKLRKLCHA  61

Query  282  DIVSVGP  302
            +IVSVGP
Sbjct  62   EIVSVGP  68



>ref|XP_008805584.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
[Phoenix dactylifera]
Length=112

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVV+KLD  D+K KQKA+K VS+L G++SIS+D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKVVVKLDLHDDKDKQKALKTVSTLPGIDSISMDMKEKKLTVVGAVDPVNVVSKLRKFW  60

Query  276  NTDIVSVGP  302
             TD+ SVGP
Sbjct  61   PTDMFSVGP  69



>ref|XP_006386610.1| hypothetical protein POPTR_0002s16500g [Populus trichocarpa]
 gb|ERP64407.1| hypothetical protein POPTR_0002s16500g [Populus trichocarpa]
Length=167

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K+KQKAMK VS+L G++SI++D K KKLTV G++D VS+V KLRK  
Sbjct  1    MKKFVLKLDLHDDKSKQKAMKTVSTLSGIDSIAMDMKAKKLTVIGTVDPVSVVSKLRKYW  60

Query  276  NTDIVSVGP  302
              DI+SVGP
Sbjct  61   QADIISVGP  69



>gb|AFK37277.1| unknown [Lotus japonicus]
Length=133

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK++  D+K K+KAMK V  L GVES+S+D K++K+T+ G ID V +VGKLRK+C
Sbjct  1    MKKVVLKVELYDDKIKKKAMKAVFGLSGVESVSVDVKEQKMTLIGDIDPVKVVGKLRKLC  60

Query  276  NTDIVSVGP  302
            + DI+SVGP
Sbjct  61   HADILSVGP  69



>emb|CBI22648.3| unnamed protein product [Vitis vinifera]
Length=92

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K++LKL+  D+K K+KAM+ VS L GV SIS+D KDKKLTV G +D V IV KLRK C T
Sbjct  5    KIILKLEVFDDKAKRKAMRNVSCLLGVTSISVDMKDKKLTVIGDVDPVCIVSKLRKFCRT  64

Query  282  DIVSVGP  302
            +I+SVGP
Sbjct  65   EILSVGP  71



>gb|KEH21133.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=127

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+V+KLD  D+K KQKAMK VSSL G++SI++D K+KKLTV G ID V +V KLRK  
Sbjct  1    MKKIVVKLDLHDDKAKQKAMKSVSSLSGIDSIAMDMKEKKLTVVGDIDPVDVVSKLRKTW  60

Query  276  NTDIVSVGP  302
            +T+I++VGP
Sbjct  61   HTEILTVGP  69



>ref|XP_004515167.1| PREDICTED: uncharacterized protein LOC101502738 [Cicer arietinum]
Length=108

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D+ ++K K+K MK  S L GVES+SI+ K+KKLT++G ID+V +V KLRK+C
Sbjct  1    MKKVVLKVDFYNDKIKRKMMKTASGLLGVESVSIELKEKKLTLSGDIDSVKVVLKLRKVC  60

Query  276  NTDIVSVGP  302
             T+IVSVGP
Sbjct  61   QTEIVSVGP  69



>gb|AFK37005.1| unknown [Lotus japonicus]
 gb|AFK48228.1| unknown [Lotus japonicus]
Length=165

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K KQKA+K VS+L G+++IS+D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKFVLKLDLPDDKAKQKALKTVSTLPGIDAISMDMKEKKLTVVGTVDPVTVVSKLRKYW  60

Query  276  NTDIVSVGP  302
              D+VSVGP
Sbjct  61   QADLVSVGP  69



>gb|KJB09701.1| hypothetical protein B456_001G157300 [Gossypium raimondii]
Length=170

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +3

Query  102  MKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICN  278
            MKVVLKLD  D++ KQKA+K VS+L G++SI++D K K+LTV G++D V++V KLRK   
Sbjct  1    MKVVLKLDLHDDRAKQKALKTVSTLSGIDSIAMDMKAKQLTVIGTVDPVNVVSKLRKYWP  60

Query  279  TDIVSVGP  302
            TDIVSVGP
Sbjct  61   TDIVSVGP  68



>gb|KHN09290.1| hypothetical protein glysoja_029061 [Glycine soja]
Length=122

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVL+LD   ++ KQKAMK  S L GVES+S+D KD K+ V G ID VS V KLRK C
Sbjct  1    MKKVVLQLDLHGDRIKQKAMKTASGLSGVESVSVDMKDMKMIVLGDIDPVSAVSKLRKCC  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_004306736.1| PREDICTED: FK506-binding protein 4 [Fragaria vesca subsp. vesca]
Length=179

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K +L+LD  D+K KQKA+K VS+L G++SI++D K+KKLTV GS+D V++V KLRK  
Sbjct  1    MKKFILRLDLHDDKAKQKALKTVSTLSGIDSIAMDMKEKKLTVIGSVDPVNVVSKLRKYW  60

Query  276  NTDIVSVGP  302
             TDI+SVGP
Sbjct  61   PTDIISVGP  69



>ref|XP_011035350.1| PREDICTED: uncharacterized protein LOC105133184 [Populus euphratica]
Length=125

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K  LKLD  DEKTK++AMK VS    V+SIS+D KD KLTVTG ID V+IV KLRK C+ 
Sbjct  6    KATLKLDIHDEKTKKRAMKTVSGFSRVDSISMDRKDNKLTVTGDIDPVNIVNKLRKFCHV  65

Query  282  DIVSVG  299
            +IVSVG
Sbjct  66   EIVSVG  71



>gb|AFK47311.1| unknown [Lotus japonicus]
Length=131

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK++  D+K K+KAMK VS L GVES+S+D KD+K+T+ G ID V +V KLRK+C
Sbjct  1    MKKVVLKVELYDDKIKKKAMKAVSGLSGVESVSVDMKDQKMTLIGDIDPVEVVEKLRKLC  60

Query  276  NTDIVSVGP  302
            + +I+SVGP
Sbjct  61   HAEILSVGP  69



>ref|XP_007143472.1| hypothetical protein PHAVU_007G074700g, partial [Phaseolus vulgaris]
 gb|ESW15466.1| hypothetical protein PHAVU_007G074700g, partial [Phaseolus vulgaris]
Length=93

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KV+LK+D +++K KQKAMK VS + GV+S+S+D KDKK T+TG ID+V +V KLRK  +T
Sbjct  1    KVMLKVDVQEDKIKQKAMKAVSGISGVKSVSVDMKDKKFTLTGDIDSVQVVAKLRKFYHT  60

Query  282  DIVSVGP  302
             IVSVGP
Sbjct  61   GIVSVGP  67



>ref|XP_006372383.1| hypothetical protein POPTR_0017s01100g [Populus trichocarpa]
 gb|ERP50180.1| hypothetical protein POPTR_0017s01100g [Populus trichocarpa]
Length=125

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K VLKL+  D+K K+KAM  VS L GV+S+SID KDKK+TV G ID V IV KLRK+C T
Sbjct  5    KAVLKLELHDKKAKKKAMTIVSGLSGVDSVSIDMKDKKMTVIGDIDPVCIVAKLRKLCGT  64

Query  282  DIVSVGP  302
            +IV+VGP
Sbjct  65   EIVTVGP  71



>ref|XP_009366561.1| PREDICTED: FK506-binding protein 4 [Pyrus x bretschneideri]
Length=165

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K KQKA+K VS+L G++SI++D KDKKLT+ GS+D V++V KLRK  
Sbjct  1    MKKFVLKLDLPDDKAKQKALKTVSTLSGIDSIAMDMKDKKLTLIGSVDPVTVVSKLRKYW  60

Query  276  NTDIVSVGP  302
             T I+SVGP
Sbjct  61   QTHIISVGP  69



>gb|KHM99946.1| Putative late blight resistance protein like R1B-19 [Glycine 
soja]
Length=136

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVV+KL+  D+K KQKAMK VSSL G++SIS+D K+KKLTV G ID V +V KLRK  
Sbjct  1    MKKVVVKLNLHDDKAKQKAMKSVSSLAGIDSISMDMKEKKLTVVGEIDPVDVVSKLRKTW  60

Query  276  NTDIVSVGP  302
            + +IV+VGP
Sbjct  61   HPEIVTVGP  69



>ref|XP_006422043.1| hypothetical protein CICLE_v10006198mg [Citrus clementina]
 ref|XP_006490626.1| PREDICTED: putative late blight resistance protein homolog R1B-19-like 
[Citrus sinensis]
 gb|ESR35283.1| hypothetical protein CICLE_v10006198mg [Citrus clementina]
 gb|KDO56807.1| hypothetical protein CISIN_1g032822mg [Citrus sinensis]
Length=133

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKL   D+K K+KAMK VS L GV+SIS+D K+KKLTV G ID VSIV KLRK+C
Sbjct  1    MKKAVLKLGVHDDKEKKKAMKTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLC  60

Query  276  NTDIVSVG  299
            +T+I+SVG
Sbjct  61   HTEILSVG  68



>ref|XP_007152161.1| hypothetical protein PHAVU_004G106900g [Phaseolus vulgaris]
 gb|ESW24155.1| hypothetical protein PHAVU_004G106900g [Phaseolus vulgaris]
Length=128

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMK+VLK++  D+K K+KAMK VS + GVES+S+D K++K+TVTG +D+V +  KL+K C
Sbjct  1    MMKIVLKVELYDDKIKKKAMKTVSGISGVESVSVDMKNQKMTVTGDVDSVKVAIKLKKFC  60

Query  276  NTDIVSVGP  302
            + DI+SVGP
Sbjct  61   HADILSVGP  69



>ref|NP_200086.1| copper transport family protein [Arabidopsis thaliana]
 dbj|BAA98092.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96255.1| copper transport family protein [Arabidopsis thaliana]
Length=118

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M  VVLKLD   EKTKQKAM  V  L GV S+ + KD KLTVTG IDA  IV KL+KIC+
Sbjct  1    MQVVVLKLDVHCEKTKQKAMSTVCCLSGVNSVEV-KDGKLTVTGEIDAYMIVKKLKKICH  59

Query  279  TDIVSVGP  302
            T+ +SVGP
Sbjct  60   TEFISVGP  67



>ref|XP_009363395.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
[Pyrus x bretschneideri]
 ref|XP_009343885.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
[Pyrus x bretschneideri]
Length=130

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K KQKA+K VSSL G++SI++D K++KLTV G ID V +V KLRK  
Sbjct  1    MKKVVLKLDLHDDKEKQKALKAVSSLSGIDSIAMDMKERKLTVIGDIDPVDVVAKLRKRW  60

Query  276  NTDIVSVGP  302
             TDI++VGP
Sbjct  61   YTDILTVGP  69



>ref|XP_007143471.1| hypothetical protein PHAVU_007G074600g [Phaseolus vulgaris]
 gb|ESW15465.1| hypothetical protein PHAVU_007G074600g [Phaseolus vulgaris]
Length=132

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D  ++K KQK MK  S + GVES+S+D  D+KLT+ G ID V +V KLRK C
Sbjct  1    MKKVVLKVDVHEDKIKQKVMKVASGISGVESVSVDMNDRKLTLIGDIDPVQVVAKLRKFC  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_002299508.1| hypothetical protein POPTR_0001s09840g [Populus trichocarpa]
 gb|EEE84313.1| hypothetical protein POPTR_0001s09840g [Populus trichocarpa]
Length=152

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KVVLKLD  D+K KQKAMK VS L G++SI++D K+KKLTV G ID V +V KLRKI +T
Sbjct  25   KVVLKLDLHDDKGKQKAMKAVSGLSGIDSIAMDLKEKKLTVIGDIDPVDVVSKLRKIWHT  84

Query  282  DIVSVGP  302
            +I++VGP
Sbjct  85   EILAVGP  91



>ref|XP_004492796.1| PREDICTED: FK506-binding protein 4-like [Cicer arietinum]
Length=172

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K KQKA+K VS+L G+++I++D K+KKLTV G++D VS+V KLRK  
Sbjct  1    MKKFVLKLDLADDKAKQKALKAVSTLSGIDAITMDMKEKKLTVVGTVDPVSVVSKLRKYW  60

Query  276  NTDIVSVGP  302
              D++SVGP
Sbjct  61   QADLISVGP  69



>dbj|BAO45868.1| hypothetical protein [Acacia mangium]
Length=120

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLK++  D+K K+KAMK VS + GVES+ +D K+ K+TV G IDAV++ GKLRK+ 
Sbjct  1    MQKIVLKVELHDDKIKKKAMKAVSGMPGVESVEVDMKENKMTVIGGIDAVTVAGKLRKLS  60

Query  276  NTDIVSVGP  302
            + +IVSVGP
Sbjct  61   HAEIVSVGP  69



>gb|KJB37518.1| hypothetical protein B456_006G208600 [Gossypium raimondii]
Length=145

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  + K KQKAMK VS L GV+SIS+D KDKKLTV G +D ++IV KLRK  
Sbjct  1    MKKVVLKLDLHEGKEKQKAMKAVSGLSGVDSISMDMKDKKLTVIGDVDPINIVNKLRKQW  60

Query  276  NTDIVSVGP  302
            +T+I++VGP
Sbjct  61   HTEILTVGP  69



>ref|XP_008238952.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
[Prunus mume]
Length=121

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D++ KQKA+K VSSL G++SI++D K++KLTV G ID V +V KLRK  
Sbjct  1    MKKVVLKLDLHDDRQKQKALKSVSSLTGIDSIAMDMKERKLTVIGDIDPVDVVAKLRKGW  60

Query  276  NTDIVSVGP  302
            +TDI++VGP
Sbjct  61   HTDILTVGP  69



>ref|XP_004515153.1| PREDICTED: uncharacterized protein LOC101499045 [Cicer arietinum]
Length=106

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D+ ++K KQK MK  S L GVES+SI+ K+ KLT+ G ID V  V KLRK+C
Sbjct  1    MKKVVLKVDFYNDKIKQKMMKTASGLLGVESVSIELKENKLTLLGDIDPVKAVSKLRKVC  60

Query  276  NTDIVSVGP  302
             T+I+SVGP
Sbjct  61   QTNIISVGP  69



>ref|XP_007040346.1| Heavy metal transport/detoxification superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY24847.1| Heavy metal transport/detoxification superfamily protein isoform 
1 [Theobroma cacao]
Length=128

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K KQKAMK VS L G++SI++D KDKKLTV G +D V +V KLRK  
Sbjct  1    MKKVVLKLDLHDDKGKQKAMKAVSGLSGIDSIAMDMKDKKLTVIGDVDPVDVVSKLRKQW  60

Query  276  NTDIVSVGP  302
             T+IV+VGP
Sbjct  61   YTEIVTVGP  69



>ref|XP_007135133.1| hypothetical protein PHAVU_010G103800g [Phaseolus vulgaris]
 gb|ESW07127.1| hypothetical protein PHAVU_010G103800g [Phaseolus vulgaris]
Length=157

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K KQKA+K VS+L G+++IS++ K+KKLTV G++D VS+V KLRK  
Sbjct  1    MKKFVLKLDLHDDKDKQKALKTVSTLSGIDAISMNMKEKKLTVIGTVDPVSVVSKLRKYW  60

Query  276  NTDIVSVGP  302
             TDIV VGP
Sbjct  61   QTDIVEVGP  69



>ref|XP_002303608.1| hypothetical protein POPTR_0003s13210g [Populus trichocarpa]
 gb|EEE78587.1| hypothetical protein POPTR_0003s13210g [Populus trichocarpa]
Length=149

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K KQKAMK VS L G++SIS+D K+KK+TV G ID V +V KLRKI 
Sbjct  1    MKKVVLKLDLHDDKGKQKAMKAVSRLSGIDSISMDMKEKKMTVVGDIDPVDVVSKLRKIW  60

Query  276  NTDIVSVGP  302
            + +I++VGP
Sbjct  61   HAEILTVGP  69



>gb|KJB09699.1| hypothetical protein B456_001G157300 [Gossypium raimondii]
Length=171

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D++ KQKA+K VS+L G++SI++D K K+LTV G++D V++V KLRK  
Sbjct  1    MKKVVLKLDLHDDRAKQKALKTVSTLSGIDSIAMDMKAKQLTVIGTVDPVNVVSKLRKYW  60

Query  276  NTDIVSVGP  302
             TDIVSVGP
Sbjct  61   PTDIVSVGP  69



>gb|KHG10757.1| Putative late blight resistance R1A-3 [Gossypium arboreum]
Length=171

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D++ KQKA+K VS+L G++SI++D K K+LTV G++D V++V KLRK  
Sbjct  1    MKKVVLKLDLHDDRAKQKALKTVSTLSGIDSIAMDMKAKQLTVIGTVDPVNVVSKLRKYW  60

Query  276  NTDIVSVGP  302
             TDIVSVGP
Sbjct  61   PTDIVSVGP  69



>ref|XP_003549023.1| PREDICTED: uncharacterized protein LOC100800537 [Glycine max]
 gb|KHN09292.1| hypothetical protein glysoja_029063 [Glycine soja]
Length=123

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M ++VLK++  D++ KQKAMK  SSL GVES+S+D KD+K+ + G+ID VS V KLR+ C
Sbjct  1    MKEIVLKVELHDDRIKQKAMKTASSLSGVESVSVDLKDRKMIILGNIDPVSAVSKLRRCC  60

Query  276  NTDIVSVG  299
            +T+IV+VG
Sbjct  61   HTEIVTVG  68



>ref|XP_010279042.1| PREDICTED: FK506-binding protein 4-like [Nelumbo nucifera]
Length=131

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  D+K KQKAMK VS+L G++SIS+D K+ KLTV G +D V IV KLRK+ 
Sbjct  1    MKKVVLKLNLHDDKAKQKAMKAVSTLQGIDSISVDMKENKLTVVGDVDPVQIVSKLRKLS  60

Query  276  NTDIVSVG  299
              DIVSVG
Sbjct  61   YADIVSVG  68



>ref|XP_003549022.1| PREDICTED: uncharacterized protein LOC100800008 [Glycine max]
Length=123

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D   ++TKQKAMK  S L GVES+S+D KD K+ V G ID VS V KLRK C
Sbjct  1    MKKVVLKVDLHGDRTKQKAMKTASGLSGVESVSVDMKDMKMIVVGDIDPVSAVSKLRKCC  60

Query  276  NTDIVSVG  299
             T+IVSVG
Sbjct  61   RTEIVSVG  68



>ref|XP_011022620.1| PREDICTED: uncharacterized protein LOC105124334 [Populus euphratica]
 ref|XP_011022621.1| PREDICTED: uncharacterized protein LOC105124334 [Populus euphratica]
Length=149

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K KQKAMK VS L G++SIS+D K++KLTV G ID V +V KLRK  
Sbjct  1    MKKVVLKLDLHDDKGKQKAMKAVSGLSGIDSISMDMKERKLTVVGDIDPVDVVSKLRKSW  60

Query  276  NTDIVSVGP  302
            +T+I++VGP
Sbjct  61   HTEILTVGP  69



>ref|NP_001235718.1| uncharacterized protein LOC100527669 [Glycine max]
 gb|ACU16811.1| unknown [Glycine max]
 gb|KHN09289.1| hypothetical protein glysoja_029060 [Glycine soja]
Length=130

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLKL+  D+KTK+KAM+ VS + GVE++S+D  D K+T+ G++DAV +VGKLRK C
Sbjct  1    MKKIVLKLEIHDDKTKKKAMRAVSGISGVETVSVDMNDLKMTIIGNVDAVIVVGKLRKCC  60

Query  276  N-TDIVSVGP  302
            +  DI+SVGP
Sbjct  61   DHADILSVGP  70



>ref|XP_007040347.1| Heavy metal transport/detoxification superfamily protein, putative 
isoform 2, partial [Theobroma cacao]
 gb|EOY24848.1| Heavy metal transport/detoxification superfamily protein, putative 
isoform 2, partial [Theobroma cacao]
Length=134

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +3

Query  102  MKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICN  278
            +KVVLKLD  D+K KQKAMK VS L G++SI++D KDKKLTV G +D V +V KLRK   
Sbjct  8    LKVVLKLDLHDDKGKQKAMKAVSGLSGIDSIAMDMKDKKLTVIGDVDPVDVVSKLRKQWY  67

Query  279  TDIVSVGP  302
            T+IV+VGP
Sbjct  68   TEIVTVGP  75



>ref|XP_007152163.1| hypothetical protein PHAVU_004G107000g [Phaseolus vulgaris]
 gb|ESW24157.1| hypothetical protein PHAVU_004G107000g [Phaseolus vulgaris]
Length=207

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +3

Query  93   SNMMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRK  269
            + M KVVLK+D   ++ KQKAM+  S L G+ES+S+D KD KL + G ID V+ V KLRK
Sbjct  84   TTMKKVVLKVDLHGDRIKQKAMQTASGLSGIESVSVDVKDMKLILLGDIDPVNAVSKLRK  143

Query  270  ICNTDIVSVGP  302
            +C+T+IVSVGP
Sbjct  144  LCHTEIVSVGP  154



>ref|XP_010537144.1| PREDICTED: uncharacterized protein LOC104811951 [Tarenaya hassleriana]
Length=124

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VL L+  DEK KQKA+  V    GVESIS+D KDKKLTV G ID+V IV KLRKIC
Sbjct  1    MQKAVLGLELYDEKIKQKALLTVCGFHGVESISVDMKDKKLTVVGDIDSVIIVKKLRKIC  60

Query  276  NTDIVSVGP  302
            +  I++VGP
Sbjct  61   HATILTVGP  69



>ref|XP_006372386.1| hypothetical protein POPTR_0017s01120g [Populus trichocarpa]
 gb|ERP50183.1| hypothetical protein POPTR_0017s01120g [Populus trichocarpa]
Length=131

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMK VLKLD  D+K K+KAM++VS L GV+SIS+D KDKKLTV G IDAV IVGKLRKIC
Sbjct  1    MMKAVLKLDLHDDKDKKKAMRRVSGLPGVDSISMDMKDKKLTVIGDIDAVCIVGKLRKIC  60

Query  276  NTDIVSVGP  302
            +TDI+SVGP
Sbjct  61   HTDIISVGP  69



>gb|KDP25385.1| hypothetical protein JCGZ_20541 [Jatropha curcas]
Length=170

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KVVLKL+  D+K KQKAMK VSSL G++SI+ID KD KLTV G++D V +V KLRK  +T
Sbjct  48   KVVLKLNLHDDKAKQKAMKAVSSLSGIDSIAIDMKDGKLTVIGAVDPVEVVSKLRKGWHT  107

Query  282  DIVSVGP  302
            +I++VGP
Sbjct  108  EILTVGP  114



>ref|XP_003619372.1| hypothetical protein MTR_6g051680 [Medicago truncatula]
 gb|AES75590.1| heavy metal-associated domain protein [Medicago truncatula]
Length=109

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLK+D  D++ KQKAMK VS L G++++SID KDKK+T+ G +D VS+V KLRK+C
Sbjct  1    MNKLVLKVDLYDDRIKQKAMKAVSGLSGLDAVSIDMKDKKMTLIGDMDPVSVVSKLRKLC  60

Query  276  NTDIVSVGP  302
            + +I+ +GP
Sbjct  61   HAEIIMIGP  69



>ref|XP_010055082.1| PREDICTED: FK506-binding protein 4 isoform X1 [Eucalyptus grandis]
Length=170

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+V+KLD  D+K KQKAMK VS+L G++SIS+D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKLVVKLDLHDDKAKQKAMKTVSTLQGIDSISMDMKEKKLTVIGTVDPVNVVSKLRKYW  60

Query  276  NTDIVSVG  299
             TDI++VG
Sbjct  61   QTDIITVG  68



>gb|AFK44478.1| unknown [Lotus japonicus]
Length=140

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVV+KLD  D+K KQKAMK VSSL G++SI++D K+KKLTV G ID V +V KLRK  
Sbjct  1    MKKVVVKLDLHDDKAKQKAMKTVSSLSGIDSIAMDMKEKKLTVVGDIDPVDVVSKLRKTW  60

Query  276  NTDIVSVG  299
            +T+I+SVG
Sbjct  61   HTEILSVG  68



>ref|XP_009393939.1| PREDICTED: uncharacterized protein LOC103979493 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=131

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLK+D  D K KQKAMK VS+L G++SI++D KD K+TV G+ D + +VGKLRK  
Sbjct  1    MQKIVLKVDLHDNKDKQKAMKAVSTLLGIDSIAMDMKDMKMTVIGAADPIDVVGKLRKCW  60

Query  276  NTDIVSVGP  302
             TDIVS+GP
Sbjct  61   PTDIVSIGP  69



>ref|XP_006387357.1| hypothetical protein POPTR_1177s00200g [Populus trichocarpa]
 gb|ERP46271.1| hypothetical protein POPTR_1177s00200g [Populus trichocarpa]
Length=131

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMK VLKLD  D+K K+KAM++VS L GV+SIS+D KD+KLTV G IDAV IVGKLRKIC
Sbjct  1    MMKAVLKLDLHDDKDKKKAMRRVSGLPGVDSISMDMKDRKLTVIGDIDAVCIVGKLRKIC  60

Query  276  NTDIVSVGP  302
            +TDI+SVGP
Sbjct  61   HTDIISVGP  69



>gb|EYU40062.1| hypothetical protein MIMGU_mgv11b021772mg [Erythranthe guttata]
Length=122

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +3

Query  102  MKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICN  278
            MKVVLKL   DEK K+KAMK VSSL G+ S+++D K+KKLTV G  D + IVGKL+K C+
Sbjct  1    MKVVLKLHVHDEKEKKKAMKSVSSLSGILSLAMDMKEKKLTVVGDADPIKIVGKLKKYCH  60

Query  279  TDIVSVGP  302
             ++++VGP
Sbjct  61   VELLTVGP  68



>ref|XP_009387649.1| PREDICTED: FK506-binding protein 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=193

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +3

Query  102  MKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICN  278
            MK+VLKL+  D K KQKAMK VS+L G+ SI+ID K+KK+TV GS+D +++V KLRK   
Sbjct  1    MKIVLKLELHDYKDKQKAMKAVSTLRGINSIAIDIKEKKMTVIGSVDPINVVSKLRKQLQ  60

Query  279  TDIVSVG  299
            TD+VS+G
Sbjct  61   TDVVSIG  67



>ref|XP_003592187.1| hypothetical protein MTR_1g099640 [Medicago truncatula]
 gb|AES62438.1| metal ion-binding protein, putative [Medicago truncatula]
Length=130

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VL+++  D+K K+KA+K VS++ GVES+S+D KD+KLT+TG ID V +VGKLRK+C
Sbjct  1    MNKIVLQVELHDDKIKKKALKAVSNISGVESVSLDMKDQKLTLTGDIDVVHVVGKLRKLC  60

Query  276  NTDIVSVG  299
            +  I+SVG
Sbjct  61   HPKILSVG  68



>ref|NP_001236092.1| uncharacterized protein LOC100306254 [Glycine max]
 gb|ACU14350.1| unknown [Glycine max]
Length=122

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVL+LD   ++ KQKAMK  S L GVES+S+  KD K+ V G ID VS V KLRK C
Sbjct  1    MKKVVLQLDLHGDRIKQKAMKTASGLSGVESVSVHMKDMKMIVLGDIDPVSAVSKLRKCC  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_007139783.1| hypothetical protein PHAVU_008G058500g [Phaseolus vulgaris]
 gb|ESW11777.1| hypothetical protein PHAVU_008G058500g [Phaseolus vulgaris]
Length=174

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K KQKA+K VS+L G+++IS+D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKFVLKLDLPDDKAKQKALKTVSTLPGIDAISMDMKEKKLTVIGTVDPVNVVSKLRKYW  60

Query  276  NTDIVSVG  299
             TDIVSVG
Sbjct  61   QTDIVSVG  68



>ref|XP_008375969.1| PREDICTED: FK506-binding protein 4-like [Malus domestica]
Length=160

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VL LD  D+K KQKA+K VS++ G++SI++D KDKKLTV GS+D V++V KLRK  
Sbjct  1    MKKFVLNLDLPDDKAKQKALKTVSTVSGIDSIAMDMKDKKLTVIGSVDPVTVVSKLRKYW  60

Query  276  NTDIVSVGP  302
             T I+SVGP
Sbjct  61   QTHIISVGP  69



>ref|XP_006582848.1| PREDICTED: uncharacterized protein LOC100499838 isoform X1 [Glycine 
max]
Length=152

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            ++K VLKLD  D+K KQKA+K VS+L G+++I++D K+KKLTV G++D V++V KLRK  
Sbjct  2    LLKFVLKLDLHDDKDKQKALKTVSTLSGIDAIAMDMKEKKLTVIGTVDPVTVVSKLRKYW  61

Query  276  NTDIVSVGP  302
              DIV+VGP
Sbjct  62   KADIVAVGP  70



>ref|XP_003533976.1| PREDICTED: putative late blight resistance protein homolog R1B-19-like 
[Glycine max]
 gb|KHN42455.1| hypothetical protein glysoja_033923 [Glycine soja]
Length=122

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD   ++ KQKAMK  S L GVES+S+D KD K+ V G ID VS V KLRK C
Sbjct  1    MKKVVLKLDLHGDRIKQKAMKTASGLSGVESVSVDMKDMKMIVLGDIDPVSAVSKLRKCC  60

Query  276  NTDIVSVG  299
            +T++VSVG
Sbjct  61   HTELVSVG  68



>gb|KHN40433.1| hypothetical protein glysoja_000931 [Glycine soja]
Length=176

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VL+LD  D+K KQKA+K VS+L G+++IS+D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKFVLRLDLPDDKAKQKALKTVSTLSGIDAISMDMKEKKLTVIGTVDPVNVVSKLRKYW  60

Query  276  NTDIVSVG  299
             TDIVSVG
Sbjct  61   QTDIVSVG  68



>gb|AFK38658.1| unknown [Lotus japonicus]
Length=95

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK++  D+K K+K MK VS L GVES+S+D KD+K+T+ G ID V +V KLRK+C
Sbjct  1    MKKVVLKVELYDDKIKKKTMKAVSGLSGVESVSVDMKDQKMTLIGDIDPVEVVEKLRKLC  60

Query  276  NTDIVSVGP  302
            + +I+SVGP
Sbjct  61   HAEILSVGP  69



>ref|NP_001236802.1| uncharacterized protein LOC100305540 [Glycine max]
 gb|ACU13272.1| unknown [Glycine max]
Length=176

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VL+LD  D+K KQKA+K VS+L G+++IS+D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKFVLRLDLPDDKAKQKALKTVSTLSGIDAISMDMKEKKLTVIGTVDPVNVVSKLRKYW  60

Query  276  NTDIVSVG  299
             TDIVSVG
Sbjct  61   QTDIVSVG  68



>ref|XP_003548155.1| PREDICTED: uncharacterized protein LOC100783411 [Glycine max]
 gb|KHN09295.1| hypothetical protein glysoja_029066 [Glycine soja]
Length=108

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLK+D  D++ K+KAMK  S L GV+S+S+D  DKK+T+ G +D VS V KLRK C
Sbjct  1    MKKIVLKVDLHDDRIKRKAMKTASGLSGVQSVSVDINDKKMTLLGDVDPVSAVSKLRKWC  60

Query  276  NTDIVSVG  299
            +T+IVSVG
Sbjct  61   HTEIVSVG  68



>ref|XP_003556127.1| PREDICTED: uncharacterized protein LOC100803831 [Glycine max]
Length=131

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVL ++  D K K+KAMK VS+L GVES+S+D KD+KLT+ G ID V  V KLRK+C
Sbjct  1    MNKVVLHVELHDGKIKKKAMKVVSNLSGVESVSMDMKDQKLTLIGDIDPVVAVEKLRKLC  60

Query  276  NTDIVSVGP  302
            +T IVSVGP
Sbjct  61   DTRIVSVGP  69



>ref|NP_001236712.1| uncharacterized protein LOC100499838 [Glycine max]
 gb|ACU13866.1| unknown [Glycine max]
Length=151

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K KQKA+K VS+L G+++I++D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKFVLKLDLHDDKDKQKALKTVSTLSGIDAIAMDMKEKKLTVIGTVDPVTVVSKLRKYW  60

Query  276  NTDIVSVGP  302
              DIV+VGP
Sbjct  61   KADIVAVGP  69



>ref|XP_010060392.1| PREDICTED: uncharacterized protein LOC104448272 isoform X2 [Eucalyptus 
grandis]
 gb|KCW90621.1| hypothetical protein EUGRSUZ_A02726 [Eucalyptus grandis]
Length=132

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  + K K+KAMK VS   GV+SI I+ KD+KLTV G++D V +VGKLRK+ 
Sbjct  1    MQKAVLKLDVHNNKEKRKAMKIVSGFAGVDSIDINLKDQKLTVAGTVDPVELVGKLRKVF  60

Query  276  NTDIVSVGP  302
             TDI+SVGP
Sbjct  61   ITDIISVGP  69



>ref|XP_006401784.1| hypothetical protein EUTSA_v10015053mg [Eutrema salsugineum]
 gb|ESQ43237.1| hypothetical protein EUTSA_v10015053mg [Eutrema salsugineum]
Length=115

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M K VLKLD   E+TK+KAM+ V  L GVESI + KD KLTV G IDA  IV KL+KIC 
Sbjct  1    MQKAVLKLDVNCERTKKKAMRTVCCLSGVESIDV-KDGKLTVIGEIDAYMIVKKLKKICY  59

Query  279  TDIVSVGP  302
            T+I++VGP
Sbjct  60   TEIITVGP  67



>ref|XP_008437333.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
[Cucumis melo]
Length=129

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMKVV+KLD  D+K KQKA+K VS + G+ESI++D KDKKLTV G +D V +V K+RK  
Sbjct  1    MMKVVMKLDLHDDKGKQKALKSVSVVQGIESIAMDMKDKKLTVIGDVDPVDVVEKVRKHW  60

Query  276  -NTDIVSVGP  302
             N DIVSVGP
Sbjct  61   RNADIVSVGP  70



>ref|XP_009387648.1| PREDICTED: nucleolar protein 58-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=194

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLKL+  D K KQKAMK VS+L G+ SI+ID K+KK+TV GS+D +++V KLRK  
Sbjct  1    MKKIVLKLELHDYKDKQKAMKAVSTLRGINSIAIDIKEKKMTVIGSVDPINVVSKLRKQL  60

Query  276  NTDIVSVG  299
             TD+VS+G
Sbjct  61   QTDVVSIG  68



>gb|KHN29315.1| hypothetical protein glysoja_005039 [Glycine soja]
Length=170

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K KQKA+K VS+L G+++IS+D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKFVLKLDLPDDKAKQKALKTVSTLSGIDAISMDMKEKKLTVIGTVDPVNVVSKLRKYW  60

Query  276  NTDIVSVG  299
             TDI+SVG
Sbjct  61   QTDILSVG  68



>ref|NP_001236738.1| uncharacterized protein LOC100527231 [Glycine max]
 gb|ACU16286.1| unknown [Glycine max]
Length=170

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K KQKA+K VS+L G+++IS+D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKFVLKLDLPDDKAKQKALKTVSTLSGIDAISMDMKEKKLTVIGTVDPVNVVSKLRKYW  60

Query  276  NTDIVSVG  299
             TDI+SVG
Sbjct  61   QTDILSVG  68



>ref|XP_011023277.1| PREDICTED: actin-binding protein-like isoform X1 [Populus euphratica]
Length=167

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VL+LD  D+K+KQKAMK VS+L G++SI++D K KKLTV G++D VS+V KLRK  
Sbjct  1    MKKFVLRLDLPDDKSKQKAMKTVSTLSGIDSIAMDMKAKKLTVIGTVDPVSVVSKLRKYW  60

Query  276  NTDIVSVG  299
              DI+SVG
Sbjct  61   QADIISVG  68



>ref|XP_010671619.1| PREDICTED: uncharacterized protein LOC104888368 [Beta vulgaris 
subsp. vulgaris]
Length=112

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 2/70 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKT-KQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKI  272
            M KVVLKLD  D+K  K+KA+K VSS+ G++SIS+D K+KKLTV G +D V++V KLRKI
Sbjct  1    MQKVVLKLDVHDDKNCKKKALKLVSSVTGLDSISMDMKEKKLTVIGDMDPVAVVTKLRKI  60

Query  273  CNTDIVSVGP  302
             NT+IVSVGP
Sbjct  61   YNTEIVSVGP  70



>gb|KHG19693.1| Putative late blight resistance R1A-3 [Gossypium arboreum]
Length=134

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M K+VLKLD   +K++QK MK  S L GVES++IDKD+KLTV G +D V    KL K+C+
Sbjct  1    MKKIVLKLDLHHDKSRQKGMKIASGLSGVESVAIDKDQKLTVIGDVDPVKAAMKLGKLCH  60

Query  279  TDIVSVG  299
            T+IVSVG
Sbjct  61   TEIVSVG  67



>gb|EYU40061.1| hypothetical protein MIMGU_mgv1a020391mg [Erythranthe guttata]
Length=123

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL   DE+ K+KAMK VSSL G+ S+++D K+KKLTV G  D + IVGKL+K C
Sbjct  1    MSKVVLKLHVHDEREKKKAMKSVSSLSGILSLAMDMKEKKLTVVGDADPIKIVGKLKKYC  60

Query  276  NTDIVSVGP  302
            + ++++VGP
Sbjct  61   HVELLTVGP  69



>ref|XP_003533149.1| PREDICTED: uncharacterized protein LOC100792434 [Glycine max]
Length=123

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D   ++ KQKAMK  S L GVES+ +D KD K+ V G ID VS V KLRK C
Sbjct  1    MKKVVLKVDLHGDRIKQKAMKTASGLSGVESVYVDIKDMKMIVLGDIDPVSAVSKLRKCC  60

Query  276  NTDIVSVGP  302
            +T++VSVGP
Sbjct  61   HTELVSVGP  69



>gb|KEH33282.1| heavy metal transport/detoxification superfamily protein, putative 
[Medicago truncatula]
Length=108

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  114  LKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNTDIV  290
            L +D+ +++ KQK MK VSSL GVESISID K+KKLT++G ID +  V +LRK+C T++V
Sbjct  10   LLVDFYNDRIKQKVMKTVSSLSGVESISIDSKEKKLTLSGDIDPIKAVCELRKLCQTEVV  69

Query  291  SVGP  302
            S+GP
Sbjct  70   SIGP  73



>gb|KDP28565.1| hypothetical protein JCGZ_14336 [Jatropha curcas]
Length=183

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K +LKLD  D+K KQKA+K VS+L G++SI++D K+KKLTV G++D +++V KLRK  
Sbjct  1    MKKFILKLDINDDKAKQKALKTVSTLSGIDSIAVDMKEKKLTVIGTVDPITVVSKLRKYF  60

Query  276  NTDIVSVG  299
             TDI+SVG
Sbjct  61   QTDIISVG  68



>emb|CBI22645.3| unnamed protein product [Vitis vinifera]
Length=163

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K+VLK ++ D+KTKQKAMK V S  GVES S+D K+KKLTV G +D + +V +LRK+C+T
Sbjct  25   KIVLKFEFNDDKTKQKAMKNVCSHSGVESASVDMKEKKLTVVGDVDIIIMVKQLRKLCHT  84

Query  282  DIVSVG  299
            ++V+VG
Sbjct  85   ELVTVG  90



>ref|XP_009393938.1| PREDICTED: uncharacterized protein LOC103979493 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=136

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K+VLK+D  D K KQKAMK VS+L G++SI++D KD K+TV G+ D + +VGKLRK   T
Sbjct  8    KIVLKVDLHDNKDKQKAMKAVSTLLGIDSIAMDMKDMKMTVIGAADPIDVVGKLRKCWPT  67

Query  282  DIVSVGP  302
            DIVS+GP
Sbjct  68   DIVSIGP  74



>ref|XP_004298831.1| PREDICTED: uncharacterized protein LOC101291624 [Fragaria vesca 
subsp. vesca]
Length=139

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 57/70 (81%), Gaps = 2/70 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRK-I  272
            M KVVLKLD  ++K KQKA+K VSSL G++SI++D K++KLTVTG+ID V +V KLRK  
Sbjct  1    MKKVVLKLDLHNDKEKQKALKAVSSLSGIDSIAMDMKERKLTVTGNIDPVDVVNKLRKGN  60

Query  273  CNTDIVSVGP  302
             +T+I++VGP
Sbjct  61   WHTEILTVGP  70



>ref|NP_001240260.1| uncharacterized protein LOC100819572 [Glycine max]
 gb|ACU19022.1| unknown [Glycine max]
 gb|KHN18813.1| hypothetical protein glysoja_045333 [Glycine soja]
Length=153

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K KQKA+K VS+L G+++I++D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKFVLKLDLHDDKDKQKALKTVSTLSGIDAIAMDMKEKKLTVIGTVDPVTVVSKLRKNW  60

Query  276  NTDIVSVGP  302
              DIV+VGP
Sbjct  61   KADIVAVGP  69



>ref|XP_008348575.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Malus domestica]
Length=133

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K KQKA+K VSSL G++SI++D K+KKLTV G +D V +V KLR+  
Sbjct  1    MKKVVLKLDLHDDKEKQKALKAVSSLTGIDSIAMDMKEKKLTVIGDVDPVDVVAKLRRGW  60

Query  276  NTDIVSVGP  302
             T+I++VGP
Sbjct  61   YTEILTVGP  69



>ref|XP_008376012.1| PREDICTED: uncharacterized protein LOC103439249 [Malus domestica]
Length=186

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KVVLKLD  D+K KQKA+K VSSL G++SI++D K++KLTV G +D V +V KLRK   T
Sbjct  55   KVVLKLDLHDDKEKQKALKAVSSLSGIDSIAMDMKERKLTVIGDVDPVDVVAKLRKGWYT  114

Query  282  DIVSVGP  302
            DI++VGP
Sbjct  115  DILTVGP  121



>ref|XP_010273988.1| PREDICTED: formin-like protein 8 [Nelumbo nucifera]
Length=380

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            ++KVVLKLD  D+K KQKAMK VSSL G++SI++D K+KKLTV G +D + +V KL K+ 
Sbjct  36   IIKVVLKLDLHDDKAKQKAMKAVSSLSGIDSITMDMKEKKLTVVGDVDPIDVVSKLCKLW  95

Query  276  NTDIVSVGP  302
            +TDIV VGP
Sbjct  96   HTDIVFVGP  104



>ref|NP_001238604.1| uncharacterized protein LOC100306678 [Glycine max]
 gb|ACU14972.1| unknown [Glycine max]
 gb|KHN42448.1| hypothetical protein glysoja_033916 [Glycine soja]
Length=108

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+   D++ K+K M+  S L GVES+SID KD+K+T+ G+ID V+ V KLRK C
Sbjct  1    MKKVVLKVGLHDDRIKRKVMRTASGLSGVESVSIDMKDEKMTLLGNIDPVNAVCKLRKCC  60

Query  276  NTDIVSVGP  302
             T+IV+VGP
Sbjct  61   QTEIVTVGP  69



>ref|XP_002321040.2| hypothetical protein POPTR_0014s08550g [Populus trichocarpa]
 gb|EEE99355.2| hypothetical protein POPTR_0014s08550g [Populus trichocarpa]
Length=182

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLK+D  D+K KQKAMK VS+L G++S++ID K+KKLTV G++D V+ V KLRK  
Sbjct  1    MKKFVLKVDLHDDKAKQKAMKTVSTLTGIDSMAIDMKEKKLTVIGTVDPVNAVSKLRKYW  60

Query  276  NTDIVSVGP  302
              DI++VGP
Sbjct  61   PADIITVGP  69



>ref|XP_011080908.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
isoform X1 [Sesamum indicum]
Length=142

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KVVLKL+  D+K KQKAMK VSSL G+ES+++D K++KLTV G +D V IV KLRK  +T
Sbjct  5    KVVLKLEVHDDKEKQKAMKAVSSLTGIESLAMDMKERKLTVVGDVDPVQIVSKLRKSWHT  64

Query  282  DIVSVG  299
            +I++VG
Sbjct  65   EILTVG  70



>ref|XP_008803335.1| PREDICTED: FK506-binding protein 4 [Phoenix dactylifera]
Length=137

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+V++LD  D+K KQKA+K VS+L GV+SI+++ K+KKLTV G++D V +V KLRK  
Sbjct  1    MKKIVVQLDLHDDKDKQKALKAVSTLHGVDSIAMNMKEKKLTVVGAVDPVDVVSKLRKFW  60

Query  276  NTDIVSVGP  302
             T I SVGP
Sbjct  61   QTRIFSVGP  69



>ref|XP_003624087.1| hypothetical protein MTR_7g079110 [Medicago truncatula]
 gb|AES80305.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
 gb|AFK40763.1| unknown [Medicago truncatula]
Length=172

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD +D+K KQKA+K VS+L G+++I++D K+KKLTV G++D V IV KLRK  
Sbjct  1    MKKFVLKLDLEDDKAKQKALKTVSTLSGIDAITMDMKEKKLTVVGTVDPVKIVSKLRKYW  60

Query  276  NTDIVSVG  299
              DI+SVG
Sbjct  61   QADIISVG  68



>gb|KHN42453.1| hypothetical protein glysoja_033921, partial [Glycine soja]
Length=122

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KVVLK+D   ++ KQKAMK  S L GVES+ +D KD K+ V G ID VS V KLRK C+T
Sbjct  2    KVVLKVDLHGDRIKQKAMKTASGLSGVESVYVDIKDMKMIVLGDIDPVSAVSKLRKCCHT  61

Query  282  DIVSVGP  302
            ++VSVGP
Sbjct  62   ELVSVGP  68



>ref|XP_009773147.1| PREDICTED: uncharacterized protein LOC104223411 [Nicotiana sylvestris]
Length=105

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+V KL+  DE+ KQKA+K VS+L GVESI+ID ++K LTV G +D V+++GKLRK  
Sbjct  1    MKKLVFKLEIYDERDKQKALKVVSALPGVESIAIDMREKTLTVIGYVDPVNVLGKLRKNW  60

Query  276  NTDIVSVGP  302
              D++SVGP
Sbjct  61   YADLLSVGP  69



>ref|XP_002864190.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40449.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=118

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M  VVLKLD   E+TK+KAM  V  L GV S+ ++ D KLTVTG IDA  IV KL+KIC+
Sbjct  1    MQVVVLKLDVHCERTKKKAMSTVCCLSGVNSVDVN-DGKLTVTGEIDAYMIVKKLKKICH  59

Query  279  TDIVSVGP  302
            T+ +SVGP
Sbjct  60   TEFISVGP  67



>ref|XP_003619373.1| hypothetical protein MTR_6g051690 [Medicago truncatula]
 gb|AES75591.1| heavy metal-associated domain protein [Medicago truncatula]
Length=127

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLK+D  D++ KQKAMK VS L GVE +S++ KDKK+T+ G +D V +V KLRK+C
Sbjct  1    MNKLVLKVDLYDDRIKQKAMKMVSGLSGVEGVSMNMKDKKITLIGDMDPVRVVSKLRKLC  60

Query  276  NTDIVSVGP  302
            + +I+ +GP
Sbjct  61   HAEIIMIGP  69



>ref|XP_002447286.1| hypothetical protein SORBIDRAFT_06g032110 [Sorghum bicolor]
 gb|EES11614.1| hypothetical protein SORBIDRAFT_06g032110 [Sorghum bicolor]
Length=142

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KVVLKLD  D K KQK +K VS+L G++SIS+D KD KLTV G +D V +V KLRK+   
Sbjct  5    KVVLKLDLHDNKDKQKVLKAVSTLHGIDSISVDMKDSKLTVVGLVDPVDVVAKLRKVGAA  64

Query  282  DIVSVGP  302
             IVSVGP
Sbjct  65   AIVSVGP  71



>ref|XP_006849251.1| hypothetical protein AMTR_s00027p00240310 [Amborella trichopoda]
 gb|ERN10832.1| hypothetical protein AMTR_s00027p00240310 [Amborella trichopoda]
Length=131

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D  D+++K+K ++ V+SL G++S+S+D KD KLTV G +D V IVGKLRK  
Sbjct  1    MKKVVLKVDLHDDESKRKVLRAVTSLPGIDSVSVDMKDNKLTVVGDVDPVHIVGKLRKTR  60

Query  276  NTDIVSVGP  302
            +T+I++VGP
Sbjct  61   HTEILTVGP  69



>ref|XP_007051711.1| Heavy metal transport/detoxification superfamily protein [Theobroma 
cacao]
 gb|EOX95868.1| Heavy metal transport/detoxification superfamily protein [Theobroma 
cacao]
Length=169

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D  D+K KQKA+K VS+L G++SI++D K K+LTV G++D +++V KLRK  
Sbjct  1    MKKVVLKVDLHDDKAKQKALKTVSTLSGIDSIAMDMKAKQLTVIGTVDPINVVSKLRKYW  60

Query  276  NTDIVSVG  299
             TDIVSVG
Sbjct  61   PTDIVSVG  68



>ref|XP_008458169.1| PREDICTED: protein PXR1-like isoform X2 [Cucumis melo]
Length=200

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  102  MKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICN  278
            MK++LKLD  D+K KQKA+K VS+L G++ I++D K++KLTV G++D V++V KLRK   
Sbjct  1    MKLILKLDLHDDKAKQKALKTVSTLSGIDLIAMDMKERKLTVIGTVDPVNVVSKLRKYWP  60

Query  279  TDIVSVGP  302
            T I+SVGP
Sbjct  61   TQIISVGP  68



>ref|XP_010941026.1| PREDICTED: FK506-binding protein 4-like [Elaeis guineensis]
Length=124

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K+VLKLD  D++ K+KAMK VSS +G+ S+++D K+KKLTVTG++D V++V KLRK    
Sbjct  7    KLVLKLDLHDDRAKKKAMKTVSSFEGINSLTMDMKEKKLTVTGTVDPVAVVRKLRKSWYA  66

Query  282  DIVSVGP  302
            +I SVGP
Sbjct  67   EISSVGP  73



>ref|XP_004143886.1| PREDICTED: uncharacterized protein LOC101213529 [Cucumis sativus]
 ref|XP_004166577.1| PREDICTED: uncharacterized LOC101213529 [Cucumis sativus]
 gb|KGN50060.1| hypothetical protein Csa_5G152250 [Cucumis sativus]
Length=128

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRK-I  272
            M KVV+KLD  D+K KQKA+K VS L G+ESI++D KDKKLTV G +D V +  K+RK  
Sbjct  1    MRKVVVKLDLHDDKGKQKALKSVSGLQGIESIAMDMKDKKLTVIGDVDPVDVADKVRKHW  60

Query  273  CNTDIVSVGP  302
             N DI+SVGP
Sbjct  61   PNADIISVGP  70



>ref|XP_010482642.1| PREDICTED: uncharacterized protein LOC104761283 [Camelina sativa]
Length=115

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M  VVLKLD+  E+ KQKAM  V  L GV+S+ + KD KLTVTG ID   IV KL+K+C 
Sbjct  1    MQVVVLKLDFHCERMKQKAMATVCRLSGVKSVGV-KDDKLTVTGDIDTYIIVKKLKKVCY  59

Query  279  TDIVSVGP  302
            T+I+SVGP
Sbjct  60   TEIISVGP  67



>ref|XP_010060385.1| PREDICTED: uncharacterized protein LOC104448272 isoform X1 [Eucalyptus 
grandis]
 gb|KCW90622.1| hypothetical protein EUGRSUZ_A02726 [Eucalyptus grandis]
Length=134

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K VLKLD  + K K+KAMK VS   GV+SI I+ KD+KLTV G++D V +VGKLRK+  T
Sbjct  5    KAVLKLDVHNNKEKRKAMKIVSGFAGVDSIDINLKDQKLTVAGTVDPVELVGKLRKVFIT  64

Query  282  DIVSVGP  302
            DI+SVGP
Sbjct  65   DIISVGP  71



>ref|XP_009791152.1| PREDICTED: putative late blight resistance protein homolog R1B-19 
[Nicotiana sylvestris]
Length=129

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  D+K KQKAMK VS+L G+E++SID K+KKLTV G ID V +V KL+K  
Sbjct  1    MKKVVLKLEVYDDKGKQKAMKAVSTLSGIENLSIDMKEKKLTVVGDIDPVEVVRKLKKTW  60

Query  276  NTDIVSVGP  302
            + +I++VGP
Sbjct  61   HPEILTVGP  69



>ref|XP_010092580.1| hypothetical protein L484_012921 [Morus notabilis]
 gb|EXB51628.1| hypothetical protein L484_012921 [Morus notabilis]
Length=240

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 56/69 (81%), Gaps = 2/69 (3%)
 Frame = +3

Query  102  MKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICN  278
            +KVVLKLD  D+K KQKA+K VS+L G+++IS++ K+KKLTV G++D V++V KLRK   
Sbjct  59   LKVVLKLDLNDDKAKQKALKTVSTLSGIDAISMNMKEKKLTVVGTVDPVNVVSKLRKYWP  118

Query  279  -TDIVSVGP  302
             TDI+SVGP
Sbjct  119  FTDIISVGP  127



>ref|XP_002535232.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF27151.1| metal ion binding protein, putative [Ricinus communis]
Length=132

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  D+K K+KAMKKVS L GVESI++D KDKKLTVTG +D V IV KLRK+C
Sbjct  1    MKKVVLKLELHDDKDKKKAMKKVSGLSGVESITLDMKDKKLTVTGDVDPVHIVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +TDIVSVGP
Sbjct  61   HTDIVSVGP  69



>ref|XP_009628906.1| PREDICTED: uncharacterized protein LOC104119179 [Nicotiana tomentosiformis]
Length=135

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL+  D+K KQKAMK VS+L G+E++SID K+KKLTV G ID V +V KL+K  
Sbjct  1    MKKVVLKLEVYDDKGKQKAMKAVSTLSGIENLSIDLKEKKLTVVGDIDPVQVVRKLKKTW  60

Query  276  NTDIVSVGP  302
            + +I++VGP
Sbjct  61   HPEILTVGP  69



>gb|KHN09293.1| hypothetical protein glysoja_029064 [Glycine soja]
Length=174

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +3

Query  93   SNMMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRK  269
            + M KVVLK+D  D++ K+KAMK  S + GVE +S+  KDKK+ + G ID VS+V KLRK
Sbjct  40   TTMKKVVLKVDLHDDRMKKKAMKIASGVTGVELVSVKVKDKKMILLGDIDPVSVVSKLRK  99

Query  270  ICNTDIVSVGP  302
             C+T+IVSVGP
Sbjct  100  WCHTEIVSVGP  110



>ref|XP_004138486.1| PREDICTED: uncharacterized protein LOC101218448 isoform 2 [Cucumis 
sativus]
 ref|XP_004159771.1| PREDICTED: uncharacterized LOC101218448 isoform 2 [Cucumis sativus]
Length=205

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K++LKLD  D+K KQKA+K VS+L G++ I++D K++KLTV G++D V++V KLRK  
Sbjct  1    MKKLILKLDLHDDKAKQKALKTVSALSGIDLIAMDMKERKLTVIGTVDPVNVVSKLRKYW  60

Query  276  NTDIVSVGP  302
             T I+SVGP
Sbjct  61   PTHIISVGP  69



>ref|XP_006439474.1| hypothetical protein CICLE_v10022806mg [Citrus clementina]
 gb|ESR52714.1| hypothetical protein CICLE_v10022806mg [Citrus clementina]
Length=135

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLR-KI  272
            M KVVLKLD  D+K KQKAMK VSS+ G+ESI+ID KD KLTV G +D + +V KLR K 
Sbjct  1    MKKVVLKLDLHDDKAKQKAMKAVSSISGIESIAIDMKDNKLTVVGDVDPIDVVKKLRKKQ  60

Query  273  CNTDIVSVGP  302
               +I++VGP
Sbjct  61   WYAEILTVGP  70



>ref|XP_006587269.1| PREDICTED: uncharacterized protein LOC100793482 [Glycine max]
Length=111

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK++  D++ KQKAM   S+L GV+SIS+D KD ++ ++G  D VS+V KLRK C
Sbjct  1    MKKVVLKVELHDDRVKQKAMTTASALSGVKSISVDLKDSQMILSGDTDPVSVVSKLRKCC  60

Query  276  NTDIVSVGP  302
            +T+IVSV P
Sbjct  61   HTEIVSVEP  69



>emb|CDY15173.1| BnaC05g00520D [Brassica napus]
Length=282

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLKLD  D+K KQKA+K VS+L G++SI++D K+KKLTV G++D V++V KLRK  
Sbjct  106  MKKIVLKLDLHDDKAKQKALKTVSTLPGIDSIAMDMKEKKLTVIGTVDPVNVVSKLRKYW  165

Query  276  -NTDIVSVGP  302
              TDI+ VGP
Sbjct  166  PMTDIILVGP  175



>ref|XP_006360194.1| PREDICTED: uncharacterized protein LOC102580906 [Solanum tuberosum]
Length=142

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMKVVLKL+Y D+K KQK MKKVS ++GV+S+SID KDKKLTVTG++D V +V KL+K+C
Sbjct  1    MMKVVLKLEYLDDKVKQKVMKKVSVVEGVDSMSIDTKDKKLTVTGNVDPVVLVSKLKKLC  60

Query  276  NTDIVSVGP  302
            +T+I+SVGP
Sbjct  61   HTEILSVGP  69



>ref|XP_006599548.1| PREDICTED: uncharacterized protein LOC100801079 isoform X3 [Glycine 
max]
Length=121

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D  D++ K+KAMK  S + GVE +S+  KDKK+ + G ID VS+V KLRK C
Sbjct  1    MKKVVLKVDLHDDRMKKKAMKIASGVTGVELVSVKVKDKKMILLGDIDPVSVVSKLRKWC  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_006476499.1| PREDICTED: putative late blight resistance protein homolog R1B-19-like 
[Citrus sinensis]
Length=135

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLR-KI  272
            M KVVLKLD  D+K KQKAMK VSS+ G+ESI+ID KD KLTV G +D + +V KLR K 
Sbjct  1    MKKVVLKLDLHDDKAKQKAMKAVSSISGIESIAIDTKDNKLTVVGDVDPIDVVKKLRKKQ  60

Query  273  CNTDIVSVGP  302
               +I++VGP
Sbjct  61   WYPEILTVGP  70



>ref|XP_008458168.1| PREDICTED: protein PXR1-like isoform X1 [Cucumis melo]
Length=201

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K++LKLD  D+K KQKA+K VS+L G++ I++D K++KLTV G++D V++V KLRK  
Sbjct  1    MKKLILKLDLHDDKAKQKALKTVSTLSGIDLIAMDMKERKLTVIGTVDPVNVVSKLRKYW  60

Query  276  NTDIVSVGP  302
             T I+SVGP
Sbjct  61   PTQIISVGP  69



>ref|XP_002301372.1| hypothetical protein POPTR_0002s16500g [Populus trichocarpa]
 gb|EEE80645.1| hypothetical protein POPTR_0002s16500g [Populus trichocarpa]
Length=135

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLKLD  D+K+KQKAMK VS+L G++SI++D K KKLTV G++D VS+V KLRK  
Sbjct  1    MKKFVLKLDLHDDKSKQKAMKTVSTLSGIDSIAMDMKAKKLTVIGTVDPVSVVSKLRKYW  60

Query  276  NTDIVS  293
              DI+S
Sbjct  61   QADIIS  66



>gb|KJB24782.1| hypothetical protein B456_004G160000 [Gossypium raimondii]
Length=178

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = +3

Query  102  MKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICN  278
            MK+VLKLD  D+K K KA+K VS+L G+++I++D K ++LTV G++D V++V KLRK  +
Sbjct  1    MKIVLKLDLHDDKAKHKALKTVSTLSGIDTIAMDMKAQQLTVIGTVDPVNVVSKLRKNWS  60

Query  279  TDIVSVGP  302
            T IVSVGP
Sbjct  61   TTIVSVGP  68



>ref|XP_004515152.1| PREDICTED: uncharacterized protein LOC101498723 [Cicer arietinum]
Length=105

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+ + +++ KQK MK  S L GVES+SI+ K+KKLT++G ID V  V KLRK+C
Sbjct  1    MKKVVLKVGFYNDRIKQKVMKTASGLLGVESVSIELKEKKLTLSGDIDPVKAVTKLRKLC  60

Query  276  NTDIVSVGP  302
             T++VSV P
Sbjct  61   QTELVSVEP  69



>gb|KDP22219.1| hypothetical protein JCGZ_26050 [Jatropha curcas]
Length=133

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KV+LKL+  D+K K+KAMKKVS+L GV+SIS+D KDKKLTVTG +D V+IV KLRK+C
Sbjct  1    MKKVILKLELNDDKDKKKAMKKVSALSGVDSISLDMKDKKLTVTGDVDPVNIVSKLRKLC  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>gb|KJB49430.1| hypothetical protein B456_008G119800 [Gossypium raimondii]
Length=173

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K KQKA+K VS+L G++SI++D K K+LTV G++D V++V KLRK  
Sbjct  1    MKKVVLKLDLHDDKAKQKALKTVSTLSGIDSIAMDMKAKQLTVVGTVDPVTVVSKLRKHW  60

Query  276  NTDIVSVG  299
             TDIV VG
Sbjct  61   PTDIVLVG  68



>ref|XP_010669862.1| PREDICTED: FK506-binding protein 4 [Beta vulgaris subsp. vulgaris]
Length=167

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 2/69 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLKLD  D+K KQKA+K VS+L G++SI++D K++KLTV GS+D VSIV KLRK  
Sbjct  1    MKKIVLKLDLHDDKAKQKALKTVSTLPGIDSIAMDMKERKLTVIGSVDPVSIVSKLRKYW  60

Query  276  -NTDIVSVG  299
              TDIV VG
Sbjct  61   PTTDIVLVG  69



>ref|XP_010919138.1| PREDICTED: microtubule-associated protein 1B [Elaeis guineensis]
 ref|XP_010919139.1| PREDICTED: microtubule-associated protein 1B [Elaeis guineensis]
Length=177

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = +3

Query  108  VVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNTD  284
            +V+KLD  D+K KQKA+K VS+L G++S+++D K+KKLTV G++D V +V KLRK   T+
Sbjct  4    IVVKLDLHDDKDKQKALKAVSTLPGIDSLAMDMKEKKLTVVGAVDPVKVVSKLRKFWPTN  63

Query  285  IVSVGP  302
            I SVGP
Sbjct  64   IFSVGP  69



>ref|XP_010662796.1| PREDICTED: uncharacterized protein LOC100854849 [Vitis vinifera]
Length=184

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K+VLKL+  D+KTKQKAMK V S  GVES+S+D K+KKLTV G +  +++V +LRK+C+T
Sbjct  64   KIVLKLELHDDKTKQKAMKNVCSHLGVESVSMDMKEKKLTVVGHVGIINMVKQLRKLCHT  123

Query  282  DIVSVG  299
            D+V VG
Sbjct  124  DLVLVG  129



>ref|XP_003549024.1| PREDICTED: uncharacterized protein LOC100801079 isoform X1 [Glycine 
max]
Length=133

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK+D  D++ K+KAMK  S + GVE +S+  KDKK+ + G ID VS+V KLRK C
Sbjct  1    MKKVVLKVDLHDDRMKKKAMKIASGVTGVELVSVKVKDKKMILLGDIDPVSVVSKLRKWC  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_010041259.1| PREDICTED: uncharacterized protein LOC104430202 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010041260.1| PREDICTED: uncharacterized protein LOC104430202 isoform X3 [Eucalyptus 
grandis]
 gb|KCW44485.1| hypothetical protein EUGRSUZ_L020012 [Eucalyptus grandis]
Length=122

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+V+KLD  D+K + KAM+ VS  +G+ S+S+D KD KLTV+G  D V +V KLRK  
Sbjct  1    MKKLVVKLDLHDDKDRSKAMRVVSGFEGIGSLSMDPKDSKLTVSGDFDPVKVVNKLRKSW  60

Query  276  NTDIVSVGP  302
            +TDIVSVGP
Sbjct  61   HTDIVSVGP  69



>gb|ABK25811.1| unknown [Picea sitchensis]
Length=129

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +3

Query  93   SNMMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRK  269
            SNM K+VL++  +DEK+K++AM+ V++++GVES+++D KD+K+TV G  D V +  KLRK
Sbjct  2    SNMKKMVLRVSIEDEKSKRRAMRTVAAVEGVESVAVDMKDRKITVIGDADPVCLTVKLRK  61

Query  270  ICNTDIVSVGP  302
               T+++SVGP
Sbjct  62   FGFTELLSVGP  72



>gb|KJB20592.1| hypothetical protein B456_003G155200 [Gossypium raimondii]
Length=128

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K K+KAMK VS L G++SIS+D KDKK+TV G +D + +  KL+K  
Sbjct  1    MKKVVLKLDLHDDKEKKKAMKAVSGLSGIDSISMDMKDKKMTVIGGVDPIKVASKLKKQW  60

Query  276  NTDIVSVGP  302
            +T I++VGP
Sbjct  61   HTQILTVGP  69



>ref|XP_010058254.1| PREDICTED: uncharacterized protein LOC104446039 [Eucalyptus grandis]
Length=174

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  90   QSNMMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLR  266
            Q N +K+V+K+D  D++ + KAM+ VS  +G+ S+++D KDKKLTV+G  D V +V KLR
Sbjct  38   QDNRLKLVVKVDLHDDRDRSKAMRIVSGFEGIGSLAMDLKDKKLTVSGDFDPVKVVNKLR  97

Query  267  KICNTDIVSVGP  302
            K  +T+IVSVGP
Sbjct  98   KSRHTEIVSVGP  109



>ref|XP_002889363.1| hypothetical protein ARALYDRAFT_887301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65622.1| hypothetical protein ARALYDRAFT_887301 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLKLD  D+K KQKA+K VS+L G++SI++D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKIVLKLDLHDDKAKQKALKTVSTLPGIDSIAMDMKEKKLTVIGTVDPVNVVSKLRKYW  60

Query  276  N-TDIVSVGP  302
              TDI+ VGP
Sbjct  61   PMTDIILVGP  70



>ref|NP_171656.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
 ref|NP_001030928.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
 emb|CAA71173.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL36161.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14215.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27295.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE27296.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
Length=177

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLKLD  D++ KQKA+K VS+L G++SI++D K+KKLTV G++D V++V KLRK  
Sbjct  1    MKKIVLKLDLHDDRAKQKALKTVSTLPGIDSIAMDMKEKKLTVIGTVDPVNVVSKLRKYW  60

Query  276  N-TDIVSVGP  302
              TDIV VGP
Sbjct  61   PMTDIVLVGP  70



>ref|XP_010055772.1| PREDICTED: uncharacterized protein LOC104443918 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010055774.1| PREDICTED: uncharacterized protein LOC104443918 isoform X2 [Eucalyptus 
grandis]
Length=122

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+V+KLD  D++ + KAM+ VS  +G+ S+S+D KD KLTV+G  D V +V KLRK  
Sbjct  1    MKKLVVKLDLHDDRDRSKAMRVVSGFEGIGSLSMDPKDSKLTVSGDFDPVKVVNKLRKSW  60

Query  276  NTDIVSVGP  302
            +TDIVSVGP
Sbjct  61   HTDIVSVGP  69



>ref|XP_007143476.1| hypothetical protein PHAVU_007G075100g [Phaseolus vulgaris]
 gb|ESW15470.1| hypothetical protein PHAVU_007G075100g [Phaseolus vulgaris]
Length=126

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK++  D+K K+KAMK VS + GVES+S++ K++KLT+ G +DAV +V KLRK+C
Sbjct  1    MNKVVLKVELPDDKIKKKAMKAVSKISGVESVSLEMKEQKLTLIGDMDAVVVVEKLRKVC  60

Query  276  NTDIVSVGP  302
             T+I+S G 
Sbjct  61   YTEIISYGA  69



>ref|XP_010055771.1| PREDICTED: uncharacterized protein LOC104443917 [Eucalyptus grandis]
 ref|XP_010041258.1| PREDICTED: uncharacterized protein LOC104430202 isoform X1 [Eucalyptus 
grandis]
Length=122

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+V+KLD  D++ + KAM+ VS  +G+ S+S+D KD KLTV+G  D V +V KLRK  
Sbjct  1    MKKLVVKLDLHDDRDRSKAMRVVSGFEGIGSLSMDPKDSKLTVSGDFDPVKVVNKLRKSW  60

Query  276  NTDIVSVGP  302
            +TDIVSVGP
Sbjct  61   HTDIVSVGP  69



>gb|KFK26877.1| hypothetical protein AALP_AA8G305000 [Arabis alpina]
Length=115

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M K VLKLD   E+ KQKAM  V  L GV+++ + K+ KLTVTG IDA  IV KL+KIC+
Sbjct  1    MQKAVLKLDVHCERIKQKAMSTVCCLSGVDTVGL-KEGKLTVTGEIDAYMIVKKLKKICH  59

Query  279  TDIVSVG  299
            T+I++VG
Sbjct  60   TEIITVG  66



>ref|XP_010053219.1| PREDICTED: FK506-binding protein 4-like isoform X2 [Eucalyptus 
grandis]
Length=136

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +3

Query  102  MKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICN  278
            MKVVLK++  D+K KQKAMK VS L G++SI++D K+KK+TV G++D V +V KL+K   
Sbjct  1    MKVVLKVEVHDDKAKQKAMKAVSGLSGIDSIAMDLKEKKMTVIGTVDPVEVVSKLKKKWY  60

Query  279  TDIVSVGP  302
            T+I+ VGP
Sbjct  61   TEILMVGP  68



>gb|KJB24781.1| hypothetical protein B456_004G160000 [Gossypium raimondii]
Length=179

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLKLD  D+K K KA+K VS+L G+++I++D K ++LTV G++D V++V KLRK  
Sbjct  1    MKKIVLKLDLHDDKAKHKALKTVSTLSGIDTIAMDMKAQQLTVIGTVDPVNVVSKLRKNW  60

Query  276  NTDIVSVGP  302
            +T IVSVGP
Sbjct  61   STTIVSVGP  69



>ref|XP_010058287.1| PREDICTED: uncharacterized protein LOC104446079 [Eucalyptus grandis]
Length=152

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  90   QSNMMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLR  266
            Q N +K+V+K+D  D++ + KAM+ VS  +G+ S+++D KDKKLTV+G  D V +V KLR
Sbjct  16   QDNRLKLVVKVDLHDDRDRSKAMRIVSGFEGIGSLAMDLKDKKLTVSGDFDPVKVVNKLR  75

Query  267  KICNTDIVSVGP  302
            K  +T+IVSVGP
Sbjct  76   KSRHTEIVSVGP  87



>ref|XP_006599547.1| PREDICTED: uncharacterized protein LOC100801079 isoform X2 [Glycine 
max]
Length=134

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KVVLK+D  D++ K+KAMK  S + GVE +S+  KDKK+ + G ID VS+V KLRK C+T
Sbjct  4    KVVLKVDLHDDRMKKKAMKIASGVTGVELVSVKVKDKKMILLGDIDPVSVVSKLRKWCHT  63

Query  282  DIVSVGP  302
            +IVSVGP
Sbjct  64   EIVSVGP  70



>ref|XP_006589521.1| PREDICTED: uncharacterized protein LOC100793876, partial [Glycine 
max]
Length=128

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRK-I  272
            M KVVLK++  D+K K+KAMK VS + GVE +S D KDKKLT+ G ID V +V KLRK +
Sbjct  1    MKKVVLKVEIHDDKIKKKAMKAVSGILGVELVSADTKDKKLTIIGDIDPVKVVAKLRKQL  60

Query  273  CNTDIVSVGP  302
            C+ DIV VGP
Sbjct  61   CHADIVFVGP  70



>gb|AAF81309.1|AC061957_5 Contains a weak similarity to a farnesylated protein GMFP5 mRNA 
from Glycine max gb|U64916. ESTs gb|AI993148, gb|T44360 come 
from this gene [Arabidopsis thaliana]
Length=203

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 2/68 (3%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICN-  278
            K+VLKLD  D++ KQKA+K VS+L G++SI++D K+KKLTV G++D V++V KLRK    
Sbjct  29   KIVLKLDLHDDRAKQKALKTVSTLPGIDSIAMDMKEKKLTVIGTVDPVNVVSKLRKYWPM  88

Query  279  TDIVSVGP  302
            TDIV VGP
Sbjct  89   TDIVLVGP  96



>ref|XP_004511203.1| PREDICTED: uncharacterized protein LOC101508098 [Cicer arietinum]
Length=640

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +3

Query  108  VVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNTD  284
            ++L +D  D+KTK+KAMK +S++ GVES+S+D K++KLT+TG ID V +VGKL K+CN +
Sbjct  513  LLLMMDVHDDKTKKKAMKAISNISGVESVSMDLKEQKLTLTGDIDLVHVVGKLSKLCNPN  572

Query  285  IVSVG  299
            I+SVG
Sbjct  573  ILSVG  577



>ref|XP_009127221.1| PREDICTED: uncharacterized protein LOC103852083 [Brassica rapa]
Length=113

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M K VLKLD   E+TKQKAM  V  L GV+S+ + K+ KLTV G IDA  IV KL+KIC 
Sbjct  1    MQKAVLKLDVCCERTKQKAMSTVCCLSGVQSVDV-KEGKLTVVGEIDAFIIVKKLKKICY  59

Query  279  TDIVSVG  299
            T+I++VG
Sbjct  60   TEIITVG  66



>ref|XP_004240715.1| PREDICTED: uncharacterized protein LOC101259546 [Solanum lycopersicum]
Length=136

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            MMKVVLKL+Y DEK KQK MKKVS ++GVES+S+D KDKKLTV G++D V IV KL+K+C
Sbjct  1    MMKVVLKLEYVDEKVKQKVMKKVSVVEGVESMSMDTKDKKLTVVGNVDPVVIVSKLKKLC  60

Query  276  NTDIVSVGP  302
            +T+IV VGP
Sbjct  61   HTEIVLVGP  69



>ref|XP_010261350.1| PREDICTED: FK506-binding protein 4-like [Nelumbo nucifera]
Length=141

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKLD  D+K KQKAMK VSSL G++SI++D K+KKLTV G +D V +V KLRK+ 
Sbjct  1    MKKVVLKLDLHDDKAKQKAMKAVSSLAGIDSIAMDMKEKKLTVVGDVDPVDVVSKLRKLW  60

Query  276  NTDIVSVGP  302
            +TDIVSVGP
Sbjct  61   HTDIVSVGP  69



>ref|XP_010442814.1| PREDICTED: uncharacterized protein LOC104725786 [Camelina sativa]
Length=115

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISIDKDKKLTVTGSIDAVSIVGKLRKICN  278
            M   VLKLD   EK KQKAM  V  L GV+S+ + KD KLTVTG ID   IV KL+K+C 
Sbjct  1    MQVAVLKLDVHCEKLKQKAMATVCRLSGVKSVGV-KDDKLTVTGEIDTYIIVKKLKKVCY  59

Query  279  TDIVSVGP  302
            T+I+SVGP
Sbjct  60   TEIISVGP  67



>ref|XP_002276701.1| PREDICTED: FK506-binding protein 4 [Vitis vinifera]
 emb|CBI40403.3| unnamed protein product [Vitis vinifera]
Length=164

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 55/69 (80%), Gaps = 2/69 (3%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+VLKLD  D+K KQKA+K VS+L G++SIS+D K+KKLT+ G++D V++V KLRK  
Sbjct  1    MKKLVLKLDLHDDKAKQKALKTVSTLPGIDSISMDMKEKKLTIIGTVDPVNVVSKLRKYW  60

Query  276  NT-DIVSVG  299
             T D+V+VG
Sbjct  61   PTADLVAVG  69



>ref|NP_001183498.1| hypothetical protein [Zea mays]
 gb|ACR36967.1| unknown [Zea mays]
 gb|AFW59798.1| hypothetical protein ZEAMMB73_957967 [Zea mays]
Length=151

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            KVVLKLD  D + KQK +K VS+L G++SI++D K+ KLTV G  D V +VG+LRK+ + 
Sbjct  5    KVVLKLDLHDNRDKQKVLKAVSTLHGIDSIAVDMKESKLTVVGLADPVDVVGRLRKVGSA  64

Query  282  DIVSVGP  302
             IVSVGP
Sbjct  65   AIVSVGP  71



>ref|XP_010055693.1| PREDICTED: uncharacterized protein LOC104443849 [Eucalyptus grandis]
 gb|KCW72212.1| hypothetical protein EUGRSUZ_E00657 [Eucalyptus grandis]
Length=122

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+V+KLD  D++ + KAM+ VS  +G+ S+S+D KD KLTV+G  D V +V KLRK  
Sbjct  1    MKKLVVKLDLHDDRDRSKAMRVVSGFEGIGSLSMDPKDSKLTVSGDFDPVKVVNKLRKSW  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>gb|KJB24305.1| hypothetical protein B456_004G138000 [Gossypium raimondii]
Length=131

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLKL  +D+  KQK MK VS L GV+SI+ID KDKKLTV G +D V +V KLRK  
Sbjct  1    MKKVVLKLSLQDDIEKQKTMKAVSGLSGVDSIAIDMKDKKLTVIGEVDPVVVVSKLRKQW  60

Query  276  NTDIVSVGP  302
             T I++VGP
Sbjct  61   YTQILTVGP  69



>ref|XP_009119699.1| PREDICTED: uncharacterized protein LOC103844652 isoform X1 [Brassica 
rapa]
Length=207

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 3/71 (4%)
 Frame = +3

Query  99   MMKVVLKLD-YKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKI  272
            +MK+VLKLD + D K KQKA+K VS+L G++SI++D K+KKLTV G++D V++V KLRK 
Sbjct  30   LMKIVLKLDLHDDNKAKQKALKTVSTLPGIDSIAMDMKEKKLTVIGTVDPVNVVSKLRKY  89

Query  273  C-NTDIVSVGP  302
               TDI+ VGP
Sbjct  90   WPTTDIILVGP  100



>ref|XP_010055691.1| PREDICTED: uncharacterized protein LOC104443848 [Eucalyptus grandis]
Length=122

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+V+KLD  D++ + KAM+ VS  +G+ S+S+D KD KLTV+G  D V +V KLRK  
Sbjct  1    MKKLVVKLDLHDDRDRSKAMRVVSGFEGIGSLSMDPKDSKLTVSGDFDPVKVVNKLRKSW  60

Query  276  NTDIVSVGP  302
            +T+IVSVGP
Sbjct  61   HTEIVSVGP  69



>ref|XP_010053218.1| PREDICTED: FK506-binding protein 4-like isoform X1 [Eucalyptus 
grandis]
Length=137

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 53/69 (77%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M KVVLK++  D+K KQKAMK VS L G++SI++D K+KK+TV G++D V +V KL+K  
Sbjct  1    MKKVVLKVEVHDDKAKQKAMKAVSGLSGIDSIAMDLKEKKMTVIGTVDPVEVVSKLKKKW  60

Query  276  NTDIVSVGP  302
             T+I+ VGP
Sbjct  61   YTEILMVGP  69



>ref|XP_011015798.1| PREDICTED: FK506-binding protein 4 isoform X1 [Populus euphratica]
Length=181

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLK+D  D+K KQKAMK VS+L G++S+++D K KKLTV G++D V+ V KLRK  
Sbjct  1    MKKFVLKVDLHDDKAKQKAMKTVSTLTGIDSMAMDMKAKKLTVIGTVDPVNAVSKLRKYW  60

Query  276  NTDIVSVG  299
             TDI++VG
Sbjct  61   PTDIITVG  68



>ref|XP_011037035.1| PREDICTED: FK506-binding protein 4-like [Populus euphratica]
Length=181

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K VLK+D  D+K KQKAMK VS+L G++S+++D K KKLTV G++D V+ V KLRK  
Sbjct  1    MKKFVLKVDLHDDKAKQKAMKTVSTLTGIDSMAMDMKAKKLTVIGTVDPVNAVSKLRKYW  60

Query  276  NTDIVSVG  299
             TDI++VG
Sbjct  61   PTDIITVG  68



>gb|KHN42457.1| hypothetical protein glysoja_033925 [Glycine soja]
Length=136

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 9/76 (12%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIV-------  254
            M KVVLK++  D+K K+KAMK VS + GVES+S+D KD+K+T+ G +D V++V       
Sbjct  1    MKKVVLKVELHDDKIKKKAMKAVSGISGVESVSVDMKDQKMTIIGDVDPVTVVGKFTKFS  60

Query  255  -GKLRKICNTDIVSVG  299
             GKLRK C+ +I+SVG
Sbjct  61   LGKLRKFCHVEILSVG  76



>ref|NP_001235140.1| uncharacterized protein LOC100306444 [Glycine max]
 gb|ACU14624.1| unknown [Glycine max]
Length=136

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 9/76 (12%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIV-------  254
            M KVVLK++  D+K K+KAMK VS + GVES+S+D KD+K+T+ G +D V++V       
Sbjct  1    MKKVVLKVELHDDKIKKKAMKAVSGISGVESVSVDMKDQKMTIIGDVDPVTVVGKFTKFS  60

Query  255  -GKLRKICNTDIVSVG  299
             GKLRK C+ +I+SVG
Sbjct  61   LGKLRKFCHVEILSVG  76



>gb|KJB49431.1| hypothetical protein B456_008G119800 [Gossypium raimondii]
Length=171

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +3

Query  108  VVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNTD  284
            VVLKLD  D+K KQKA+K VS+L G++SI++D K K+LTV G++D V++V KLRK   TD
Sbjct  2    VVLKLDLHDDKAKQKALKTVSTLSGIDSIAMDMKAKQLTVVGTVDPVTVVSKLRKHWPTD  61

Query  285  IVSVG  299
            IV VG
Sbjct  62   IVLVG  66



>ref|XP_011035352.1| PREDICTED: FK506-binding protein 4-like isoform X2 [Populus euphratica]
Length=110

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +3

Query  156  MKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNTDIVSVGP  302
            MKKVSSL GV+SIS+D KDKKLTV G +D V IV KLRK+CNT+I++VGP
Sbjct  1    MKKVSSLSGVDSISMDMKDKKLTVIGDVDPVHIVSKLRKLCNTEIITVGP  50



>ref|XP_008668086.1| PREDICTED: metal ion binding protein isoform X1 [Zea mays]
Length=148

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +3

Query  105  KVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKICNT  281
            K+VLKLD  D+K KQK +K VS+L G++SIS+D K   LTV G  D V +V +LRK+   
Sbjct  16   KLVLKLDLHDDKDKQKVLKAVSTLHGIDSISVDMKGSNLTVVGLADPVDVVARLRKVAAA  75

Query  282  DIVSVGP  302
            +IVSVGP
Sbjct  76   EIVSVGP  82



>gb|AEW09330.1| hypothetical protein UMN_4898_01, partial [Pinus radiata]
 gb|AFG52518.1| hypothetical protein UMN_4898_01, partial [Pinus taeda]
Length=85

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +3

Query  93   SNMMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRK  269
            SNM K+VL++   DEK+K+KAM  V++++GVES+++D K++K+TV G+ D V +  KLRK
Sbjct  2    SNMKKMVLRVAIDDEKSKRKAMTAVAAVEGVESVAVDLKERKITVIGNADPVCLTVKLRK  61

Query  270  ICNTDIVSVGP  302
               T+++SVGP
Sbjct  62   FGCTELLSVGP  72



>gb|ABK26790.1| unknown [Picea sitchensis]
Length=117

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = +3

Query  99   MMKVVLKLDYKDEKTKQKAMKKVSSLDGVESISID-KDKKLTVTGSIDAVSIVGKLRKIC  275
            M K+ LKL  +DEK+K++AMK ++ ++GVES+S+D K++K+TV G  D VS+  KLRKI 
Sbjct  1    MKKMELKLVIEDEKSKRRAMKAIAGIEGVESVSVDMKERKMTVIGEADPVSLTVKLRKIG  60

Query  276  NTDIVSVGP  302
             T+++SVGP
Sbjct  61   FTELLSVGP  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550