BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J10

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783913.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    114   2e-25   Nicotiana sylvestris
ref|XP_009625898.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    111   2e-24   
gb|AFD22619.1|  dicer-like 2 protein                                    108   1e-23   Nicotiana attenuata
ref|XP_011084676.1|  PREDICTED: endoribonuclease Dicer homolog 2        108   1e-23   Sesamum indicum [beniseed]
ref|XP_008218472.1|  PREDICTED: endoribonuclease Dicer homolog 2        103   1e-21   Prunus mume [ume]
ref|XP_010312608.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  99.0    3e-20   
ref|XP_007208392.1|  hypothetical protein PRUPE_ppa000240mg           98.6    4e-20   
emb|CDP06207.1|  unnamed protein product                              97.8    5e-20   Coffea canephora [robusta coffee]
emb|CDO96786.1|  unnamed protein product                              95.5    1e-19   Coffea canephora [robusta coffee]
ref|XP_006480493.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  97.4    1e-19   Citrus sinensis [apfelsine]
ref|XP_006428679.1|  hypothetical protein CICLE_v10010912mg           97.4    1e-19   Citrus clementina [clementine]
ref|XP_008370841.1|  PREDICTED: endoribonuclease Dicer homolog 2      97.1    2e-19   
ref|XP_009361581.1|  PREDICTED: endoribonuclease Dicer homolog 2      96.3    2e-19   
ref|XP_002514810.1|  ATP binding protein, putative                    96.3    3e-19   
ref|XP_009340367.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  96.3    3e-19   Pyrus x bretschneideri [bai li]
emb|CDP04170.1|  unnamed protein product                              96.3    3e-19   Coffea canephora [robusta coffee]
emb|CDO96788.1|  unnamed protein product                              95.1    4e-19   Coffea canephora [robusta coffee]
ref|XP_011466081.1|  PREDICTED: endoribonuclease Dicer homolog 2      94.0    2e-18   Fragaria vesca subsp. vesca
gb|KCW84635.1|  hypothetical protein EUGRSUZ_B01461                   93.6    2e-18   Eucalyptus grandis [rose gum]
ref|XP_010038609.1|  PREDICTED: endoribonuclease Dicer homolog 2      93.6    2e-18   Eucalyptus grandis [rose gum]
ref|XP_008240740.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  92.4    4e-18   Prunus mume [ume]
ref|XP_010549772.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  92.4    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_010549776.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  92.4    5e-18   Tarenaya hassleriana [spider flower]
emb|CAN77284.1|  hypothetical protein VITISV_043738                   92.4    5e-18   Vitis vinifera
ref|XP_010649216.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  92.0    8e-18   Vitis vinifera
ref|XP_010649215.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  92.0    8e-18   Vitis vinifera
ref|XP_010649214.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  92.0    8e-18   Vitis vinifera
ref|XP_003535104.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  91.7    1e-17   Glycine max [soybeans]
ref|XP_010649218.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  91.7    1e-17   Vitis vinifera
emb|CBI17597.3|  unnamed protein product                              91.3    1e-17   Vitis vinifera
ref|XP_007217819.1|  hypothetical protein PRUPE_ppa027063mg           90.5    2e-17   
gb|KDO45679.1|  hypothetical protein CISIN_1g0030621mg                89.7    2e-17   Citrus sinensis [apfelsine]
ref|XP_011006570.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  90.5    2e-17   Populus euphratica
ref|XP_002312197.1|  hypothetical protein POPTR_0008s07580g           90.1    3e-17   
gb|KJB14793.1|  hypothetical protein B456_002G143000                  89.7    4e-17   Gossypium raimondii
ref|XP_006480488.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  89.7    5e-17   
ref|XP_006480490.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  89.7    5e-17   Citrus sinensis [apfelsine]
ref|XP_006428678.1|  hypothetical protein CICLE_v10010911mg           89.7    5e-17   Citrus clementina [clementine]
ref|XP_006300010.1|  hypothetical protein CARUB_v10016233mg           89.4    6e-17   
ref|XP_007216896.1|  hypothetical protein PRUPE_ppa019601mg           89.0    6e-17   
ref|XP_009348591.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  87.0    2e-16   
ref|XP_011015099.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  87.4    3e-16   Populus euphratica
ref|XP_011015091.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  87.4    3e-16   Populus euphratica
ref|XP_011015068.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  87.4    3e-16   Populus euphratica
ref|XP_008373031.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  86.7    3e-16   
gb|EYU39730.1|  hypothetical protein MIMGU_mgv1a0003142mg             87.0    3e-16   Erythranthe guttata [common monkey flower]
ref|XP_009348590.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  86.7    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_008373030.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  86.7    3e-16   
ref|XP_008392375.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  85.9    5e-16   
ref|XP_010508928.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  86.7    5e-16   
ref|XP_010508779.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  86.7    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010508629.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  86.7    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_007029210.1|  Dicer-like protein isoform 3                     86.3    6e-16   
ref|XP_007029211.1|  Dicer-like protein isoform 4                     86.3    6e-16   
ref|XP_007029209.1|  Dicer-like protein isoform 2                     86.3    6e-16   
ref|XP_007029212.1|  Dicer-like protein isoform 5                     86.3    6e-16   
ref|XP_008351646.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  85.9    7e-16   
ref|XP_007029208.1|  Dicer-like protein isoform 1                     86.3    7e-16   
gb|KHG30500.1|  hypothetical protein F383_12835                       86.3    7e-16   Gossypium arboreum [tree cotton]
gb|AAF26098.1|AC012328_1  unknown protein                             86.3    7e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KHG30499.1|  hypothetical protein F383_12835                       86.3    7e-16   Gossypium arboreum [tree cotton]
gb|ABF19798.1|  dicer-like 2 spliceform 2                             86.3    7e-16   Arabidopsis thaliana [mouse-ear cress]
gb|ABF19797.1|  dicer-like 2 spliceform 1                             86.3    7e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007029214.1|  Dicer-like protein isoform 7                     85.9    7e-16   
ref|NP_001078101.1|  endoribonuclease Dicer-like 2                    85.9    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007029213.1|  Dicer-like protein isoform 6                     85.9    8e-16   
ref|NP_566199.4|  endoribonuclease Dicer-like 2                       85.9    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315119.1|  hypothetical protein POPTR_0010s18870g           85.9    9e-16   
ref|XP_010312607.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  85.5    1e-15   
ref|XP_002884369.1|  hypothetical protein ARALYDRAFT_317213           85.5    1e-15   
ref|XP_010485670.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  84.3    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010485666.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  84.3    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010485668.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  84.3    3e-15   Camelina sativa [gold-of-pleasure]
emb|CDO96789.1|  unnamed protein product                              84.0    3e-15   Coffea canephora [robusta coffee]
ref|XP_007147466.1|  hypothetical protein PHAVU_006G127100g           84.0    4e-15   Phaseolus vulgaris [French bean]
ref|XP_007216887.1|  hypothetical protein PRUPE_ppa020875mg           82.0    1e-14   
ref|XP_007147469.1|  hypothetical protein PHAVU_006G127200g           81.6    2e-14   Phaseolus vulgaris [French bean]
ref|XP_008240779.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  80.9    3e-14   Prunus mume [ume]
ref|XP_004171378.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  79.7    4e-14   
emb|CDY50692.1|  BnaC05g47910D                                        80.5    6e-14   Brassica napus [oilseed rape]
ref|XP_006408318.1|  hypothetical protein EUTSA_v10019898mg           80.5    6e-14   Eutrema salsugineum [saltwater cress]
gb|KFK39865.1|  hypothetical protein AALP_AA3G298800                  79.7    9e-14   Arabis alpina [alpine rockcress]
gb|KEH20231.1|  endoribonuclease dicer-like protein                   79.7    1e-13   Medicago truncatula
gb|KEH42074.1|  endoribonuclease dicer-like protein                   79.3    1e-13   Medicago truncatula
gb|KJB61692.1|  hypothetical protein B456_009G374900                  79.0    2e-13   Gossypium raimondii
gb|KJB61693.1|  hypothetical protein B456_009G374900                  79.0    2e-13   Gossypium raimondii
ref|XP_006586847.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  78.6    2e-13   Glycine max [soybeans]
emb|CDY43132.1|  BnaA05g32540D                                        78.6    2e-13   Brassica napus [oilseed rape]
ref|XP_009130358.1|  PREDICTED: endoribonuclease Dicer homolog 2      78.6    2e-13   
ref|XP_006586846.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  78.6    2e-13   Glycine max [soybeans]
ref|XP_003534774.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  78.6    2e-13   Glycine max [soybeans]
gb|KHN23014.1|  Endoribonuclease Dicer like 2                         78.6    3e-13   Glycine soja [wild soybean]
gb|KJB61696.1|  hypothetical protein B456_009G374900                  78.2    3e-13   Gossypium raimondii
ref|XP_004139098.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  77.8    4e-13   Cucumis sativus [cucumbers]
ref|XP_008443676.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  77.8    4e-13   Cucumis melo [Oriental melon]
ref|XP_008443675.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  77.8    5e-13   
ref|XP_008443674.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  77.8    5e-13   Cucumis melo [Oriental melon]
ref|XP_008443670.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  77.8    5e-13   Cucumis melo [Oriental melon]
ref|XP_010673887.1|  PREDICTED: endoribonuclease Dicer homolog 2      77.8    5e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007140643.1|  hypothetical protein PHAVU_008G129500g           77.0    9e-13   Phaseolus vulgaris [French bean]
gb|ACE60552.1|  dicer-like protein 2                                  75.9    2e-12   Brassica rapa
ref|XP_003594551.1|  Endoribonuclease Dicer                           75.5    2e-12   
gb|AES64802.2|  endoribonuclease dicer-like protein                   75.5    2e-12   Medicago truncatula
ref|XP_004303843.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  74.3    6e-12   Fragaria vesca subsp. vesca
ref|XP_010101236.1|  Endoribonuclease Dicer-2-like protein            74.3    6e-12   
ref|XP_010249397.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  74.3    7e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010249398.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  73.9    7e-12   Nelumbo nucifera [Indian lotus]
ref|XP_004486471.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  73.6    1e-11   Cicer arietinum [garbanzo]
ref|XP_010312606.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  72.0    3e-11   Solanum lycopersicum
ref|XP_007147294.1|  hypothetical protein PHAVU_006G111800g           66.6    2e-09   Phaseolus vulgaris [French bean]
ref|XP_006604892.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  65.1    5e-09   Glycine max [soybeans]
ref|XP_003553782.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...  65.1    5e-09   Glycine max [soybeans]
gb|KHN43108.1|  Endoribonuclease Dicer like 2                         65.1    5e-09   Glycine soja [wild soybean]
gb|ACU23800.1|  unknown                                               61.2    3e-08   Glycine max [soybeans]
ref|XP_006844770.1|  hypothetical protein AMTR_s00016p00258500        62.0    6e-08   
ref|XP_010312604.1|  PREDICTED: endoribonuclease Dicer homolog 2-...  59.3    4e-07   Solanum lycopersicum
ref|XP_010088523.1|  Endoribonuclease Dicer-2-like protein            55.8    4e-06   
ref|XP_008681081.1|  PREDICTED: uncharacterized protein LOC100192...  51.2    1e-04   
ref|XP_008681082.1|  PREDICTED: uncharacterized protein LOC100192...  51.2    1e-04   Zea mays [maize]
ref|XP_008681083.1|  PREDICTED: uncharacterized protein LOC100192...  51.2    2e-04   
gb|EEC75643.1|  hypothetical protein OsI_12390                        50.8    2e-04   Oryza sativa Indica Group [Indian rice]
gb|AAS07188.1|  putative ribonuclease III, 5'-partial (with alter...  50.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AAS07190.1|  putative ribonuclease III, 5'-partial (with alter...  50.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AAS07189.1|  putative ribonuclease III, 5'-partial (with alter...  50.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEE59414.1|  hypothetical protein OsJ_11564                        50.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050564.1|  Os03g0583900                                     50.4    2e-04   
dbj|BAD34005.1|  CAF protein-like                                     50.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
sp|Q69LX2.2|DCL2B_ORYSJ  RecName: Full=Endoribonuclease Dicer hom...  50.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010233062.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  50.1    3e-04   
ref|XP_010233057.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  50.1    4e-04   
ref|XP_008644679.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  49.7    4e-04   Zea mays [maize]
ref|XP_008644676.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  49.7    5e-04   Zea mays [maize]
ref|XP_008644681.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  49.3    5e-04   Zea mays [maize]
ref|XP_010229604.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...  48.9    8e-04   
ref|XP_006651573.1|  PREDICTED: endoribonuclease Dicer homolog 2a...  48.9    0.001   Oryza brachyantha



>ref|XP_009783913.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana sylvestris]
Length=1403

 Score =   114 bits (284),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 83/122 (68%), Gaps = 6/122 (5%)
 Frame = +1

Query  190  QELGCQ------PKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  351
            +ELGCQ       KYFPP LV    N  +T+Y CY+++L    Y   QL+ I+LA+RTRL
Sbjct  648  KELGCQISTDEESKYFPPELVSHCANDTETVYYCYVVDLQHDSYSSYQLRGIVLAVRTRL  707

Query  352  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  531
            + DDE L+F+L+++ G+ + Q  Y G V L++E+ILRC+RFQV++ R+L + +L+ L +A
Sbjct  708  KFDDERLTFDLDVDKGSLLVQVNYSGVVRLTSEEILRCQRFQVSLFRILLDRDLSKLQDA  767

Query  532  LG  537
            L 
Sbjct  768  LA  769



>ref|XP_009625898.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana tomentosiformis]
Length=1403

 Score =   111 bits (278),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 55/121 (45%), Positives = 81/121 (67%), Gaps = 6/121 (5%)
 Frame = +1

Query  190  QELGCQ------PKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  351
            +ELGCQ       KYFPP LV    N  + +Y CY+++L    Y   QL+ IILA+RTRL
Sbjct  648  KELGCQIYTDEESKYFPPELVSHCANDTEAVYYCYVVDLQHDSYSNYQLRGIILAVRTRL  707

Query  352  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  531
            + DDE L F+L+++ G+ + Q  Y G V L++E+ILRC+RFQV++ R+L + +L+ L +A
Sbjct  708  KLDDERLIFDLDVDNGSLLVQVNYSGVVRLTSEEILRCQRFQVSLFRILLDRDLSKLQDA  767

Query  532  L  534
            L
Sbjct  768  L  768



>gb|AFD22619.1| dicer-like 2 protein [Nicotiana attenuata]
Length=1403

 Score =   108 bits (271),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 81/122 (66%), Gaps = 6/122 (5%)
 Frame = +1

Query  190  QELGCQP------KYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  351
            +ELGCQ       KYFPP LV    N  + +Y CY ++L    Y   QL  IILA+RTRL
Sbjct  648  KELGCQIYTDEELKYFPPELVSHCANDTEAVYYCYEVDLQHDSYSSYQLCGIILAVRTRL  707

Query  352  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  531
            + DDE L+F+L+++ G+ + Q  Y G V L++E++LRC+RFQV++ R+L + +L+ L++A
Sbjct  708  KFDDERLTFDLDVDKGSLLVQVNYSGVVRLTSEEVLRCQRFQVSLFRILLDRDLSKLEDA  767

Query  532  LG  537
            L 
Sbjct  768  LA  769



>ref|XP_011084676.1| PREDICTED: endoribonuclease Dicer homolog 2 [Sesamum indicum]
Length=1398

 Score =   108 bits (271),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 54/121 (45%), Positives = 79/121 (65%), Gaps = 6/121 (5%)
 Frame = +1

Query  190  QELGCQP------KYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  351
            QE G +P      KY PP LVG+  N  +TLY+CY IEL   +   T+LQ+I+LA+ TRL
Sbjct  648  QECGYEPYSDECAKYLPPELVGSHGNVSETLYNCYAIELRPNFEYDTKLQDIVLAVHTRL  707

Query  352  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  531
            + D E  + +L+++ G  + +  ++G V L++EQ+  C+RFQ+TV RVL +HNLN L E 
Sbjct  708  DDDLERSNLDLDVDRGKLIVRIKHVGYVTLNSEQVALCQRFQLTVFRVLIDHNLNKLHEE  767

Query  532  L  534
            L
Sbjct  768  L  768



>ref|XP_008218472.1| PREDICTED: endoribonuclease Dicer homolog 2 [Prunus mume]
Length=1396

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 51/125 (41%), Positives = 75/125 (60%), Gaps = 7/125 (6%)
 Frame = +1

Query  190  QELGCQP------KYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            QELGC+P       Y P  LV     N    LY CYLIELN+ +     + +I+L +R+ 
Sbjct  648  QELGCEPYDDVQSSYVPVELVKPFCSNDASMLYHCYLIELNQNFGYDIPVHDIVLGMRSE  707

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  528
            L+ D+ N+ F+L +  G       Y+G++ LS+EQ+L CR+FQ+T+ R+L +HNLN L+E
Sbjct  708  LDCDNANMHFDLEVGRGTLTMNFKYVGEIHLSSEQVLLCRKFQITIFRILMDHNLNKLEE  767

Query  529  ALGRL  543
             L  L
Sbjct  768  VLDGL  772



>ref|XP_010312608.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Solanum lycopersicum]
Length=1406

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 54/123 (44%), Positives = 76/123 (62%), Gaps = 7/123 (6%)
 Frame = +1

Query  190  QELGCQ------PKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  351
            +EL CQ       KYFPP LV    N  + +Y CYL+E+    Y   +L  IILA+RTRL
Sbjct  649  KELECQIQTVEESKYFPPELVSHCSNDSEAVYYCYLVEMQHASYNDFELHGIILAVRTRL  708

Query  352  ESDDENLSFELNIE-GGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  528
            + DDE L+F+L+++  G    Q  Y   V L+ E+I RC+RFQV+V R+L + +L+ L +
Sbjct  709  KCDDEILAFDLDVDRRGLLQVQLNYSKVVTLTAEEIRRCQRFQVSVFRILLDRDLSILQD  768

Query  529  ALG  537
            ALG
Sbjct  769  ALG  771



>ref|XP_007208392.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
 gb|EMJ09591.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
Length=1415

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 50/125 (40%), Positives = 73/125 (58%), Gaps = 7/125 (6%)
 Frame = +1

Query  190  QELGCQP------KYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            QELGC+P       Y P  LV     N     Y CYLIELN+ +     + +I+L +R+ 
Sbjct  667  QELGCEPYDDVQSSYVPVELVKPFCSNDASISYHCYLIELNQNFGYDIPVHDIVLGMRSE  726

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  528
            L+ D  N+ F+L +  G       Y+G++ LS+EQ+L CR+FQ+T+ R+L +HNLN L+E
Sbjct  727  LDCDIANMHFDLEVGRGTLTMNFKYVGEIHLSSEQVLLCRKFQITIFRILMDHNLNKLEE  786

Query  529  ALGRL  543
             L  L
Sbjct  787  VLDGL  791



>emb|CDP06207.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            Q  Y P  LVG   N  + LY CYLI L   +   T   +I+LA R+RLE DDE L+FEL
Sbjct  21   QKHYVPWELVGRPGNDSEILYHCYLIALEPGFSCDTMPHDILLATRSRLEFDDETLTFEL  80

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            +++ GN   +  Y+  + L++E++L C++FQV +LR+L +HN N L EAL  L
Sbjct  81   DVDRGNLKIRMKYVRHIKLTSEEVLLCQKFQVALLRLLLDHNQNKLQEALSGL  133



>emb|CDO96786.1| unnamed protein product [Coffea canephora]
Length=478

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 70/110 (64%), Gaps = 0/110 (0%)
 Frame = +1

Query  214  YFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFELNIE  393
            Y P  LVG   N  +TLY CYLI L   +   T+  +I+LA R RLE DDE L+FEL+++
Sbjct  61   YVPSELVGCPGNDSETLYHCYLIALQPDFSCDTKPHDILLARRARLEFDDETLTFELDVD  120

Query  394  GGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
             G    +  YI  + L++E+++ C++FQVT+LR+L +HN   L EAL  L
Sbjct  121  RGKLKIRMNYIRQIKLTSEEVVLCQKFQVTLLRLLLDHNQKKLKEALSGL  170



>ref|XP_006480493.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X6 [Citrus 
sinensis]
Length=1396

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/110 (41%), Positives = 68/110 (62%), Gaps = 0/110 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
             P YFPP LV       +  Y CYLIEL +++      +NI+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQSPQDTKITYHCYLIELKQHFNYDISARNIVLAMRTELESEIKKVNFDL  718

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
             +E G       ++G + L   Q+L CRRFQ+T+ RV+ +HNL+ L+E L
Sbjct  719  EVERGRLTVNLKHLGRIQLIPNQVLLCRRFQITLFRVIMDHNLDKLNEIL  768



>ref|XP_006428679.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|ESR41919.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|KDO45680.1| hypothetical protein CISIN_1g000607mg [Citrus sinensis]
Length=1396

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/110 (41%), Positives = 68/110 (62%), Gaps = 0/110 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
             P YFPP LV       +  Y CYLIEL +++      +NI+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQSPQDTKITYHCYLIELKQHFNYDISARNIVLAMRTELESEIKKVNFDL  718

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
             +E G       ++G + L   Q+L CRRFQ+T+ RV+ +HNL+ L+E L
Sbjct  719  EVERGRLTVNLKHLGRIQLIPNQVLLCRRFQITLFRVIMDHNLDKLNEIL  768



>ref|XP_008370841.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
 ref|XP_008370842.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
Length=1397

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/125 (41%), Positives = 73/125 (58%), Gaps = 7/125 (6%)
 Frame = +1

Query  190  QELGCQP------KYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            QELG +P       Y P  LV     N P  LY CYLIELN+ +     + NI+L +R+ 
Sbjct  639  QELGSEPYDDVQCSYVPIELVKPFCSNDPSILYHCYLIELNQNFEYDIPVHNIVLGMRSE  698

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  528
            L+ D  N  F+L +  G+      Y+G++ L++EQ+L CRRFQ+T+ ++L +HNLN L E
Sbjct  699  LDCDIANPHFDLEVGRGSVTVNFKYVGEIHLNSEQVLLCRRFQITIFQILIDHNLNKLGE  758

Query  529  ALGRL  543
             L  L
Sbjct  759  VLDGL  763



>ref|XP_009361581.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
 ref|XP_009361582.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
Length=1410

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/125 (41%), Positives = 71/125 (57%), Gaps = 7/125 (6%)
 Frame = +1

Query  190  QELGCQP------KYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            QELG +P       Y P  LV     N P  LY CYLIELN+ +     + NI+L +R  
Sbjct  639  QELGSEPYDDAQCSYVPIELVKPFCSNDPSILYHCYLIELNQNFEYDIPVHNIVLGMRCE  698

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  528
            L+ D  N  F+L +  G+      Y+G + L++EQ+L CRRFQ+T+ R+L +HNLN L +
Sbjct  699  LDCDIANTHFDLEVGRGSLTVNFKYVGGIHLNSEQVLLCRRFQITIFRILIDHNLNKLGK  758

Query  529  ALGRL  543
             L  L
Sbjct  759  VLDGL  763



>ref|XP_002514810.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47364.1| ATP binding protein, putative [Ricinus communis]
Length=1388

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 48/132 (36%), Positives = 76/132 (58%), Gaps = 2/132 (2%)
 Frame = +1

Query  139  DMATTGSTGLQSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQL  318
            D+    +   QS   PY +    P YFPP LVG      +  Y CYLIELN+ +     +
Sbjct  627  DIVVEETVAQQSGNGPYDDE--HPMYFPPELVGQASQKSEAKYYCYLIELNQNFVYEIPV  684

Query  319  QNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVL  498
             N +LA+R+ LESD   L  +L  + G  + +  YIG++ L+ E ++ CR+F +TVL+VL
Sbjct  685  HNFVLAMRSELESDILGLDLDLEADRGLLMVKLKYIGEIHLTPETVIMCRKFLITVLKVL  744

Query  499  FEHNLNTLDEAL  534
             +H+++ L++ L
Sbjct  745  VDHSIDKLEDIL  756



>ref|XP_009340367.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
 ref|XP_009340372.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
Length=1397

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 51/125 (41%), Positives = 71/125 (57%), Gaps = 7/125 (6%)
 Frame = +1

Query  190  QELGCQP------KYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            QELG +P       Y P  LV     N P  LY CYLIELN+ +     + NI+L +R  
Sbjct  639  QELGSEPYDDAQCSYVPIELVKPFCSNDPSILYHCYLIELNQNFEYDIPVHNIVLGMRCE  698

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  528
            L+ D  N  F+L +  G+      Y+G + L++EQ+L CRRFQ+T+ R+L +HNLN L +
Sbjct  699  LDCDIANTHFDLEVGRGSLTVNFKYVGGIHLNSEQVLLCRRFQITIFRILIDHNLNKLGK  758

Query  529  ALGRL  543
             L  L
Sbjct  759  VLDGL  763



>emb|CDP04170.1| unnamed protein product [Coffea canephora]
Length=1351

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 52/124 (42%), Positives = 73/124 (59%), Gaps = 6/124 (5%)
 Frame = +1

Query  190  QELGCQP------KYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  351
            QEL  QP      +Y PP LV    N  +T Y CYLI+L   +       +I+LA+R  L
Sbjct  595  QELCRQPYVEEQVQYVPPELVDCLGNDSETSYYCYLIKLQPEFNYDDLPHDIVLAVRKTL  654

Query  352  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  531
            E   E L+F+L+ + G+   +  Y G + L++E++L CR+FQVT+ R L +HNLN L EA
Sbjct  655  ECHGETLNFDLDADRGSLKIEISYAGSITLASEEVLLCRKFQVTIFRALLDHNLNKLHEA  714

Query  532  LGRL  543
            LG L
Sbjct  715  LGGL  718



>emb|CDO96788.1| unnamed protein product [Coffea canephora]
Length=726

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 70/111 (63%), Gaps = 0/111 (0%)
 Frame = +1

Query  211  KYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFELNI  390
            +Y P  LVG   N  +TLY CY I L   +   T   +I+LA R RLE DDE L+FEL++
Sbjct  2    QYVPSELVGCPGNESETLYHCYQIALQPDFSCNTMPHDILLATRARLEFDDETLNFELDV  61

Query  391  EGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
              G+   +  Y+  + L++E+++ C++FQVT+LR+L +HN N L EAL  L
Sbjct  62   PRGSLKIRMKYVRRIKLASEEVVLCQKFQVTLLRLLLDHNQNKLKEALSGL  112



>ref|XP_011466081.1| PREDICTED: endoribonuclease Dicer homolog 2 [Fragaria vesca subsp. 
vesca]
Length=1397

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/125 (39%), Positives = 71/125 (57%), Gaps = 2/125 (2%)
 Frame = +1

Query  169  QSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            +S+  PY E   Q  Y P  LV         LY CYLIEL++ +     + + +L +R++
Sbjct  649  ESEHAPYDEE--QSSYVPIELVKPSSAGTSILYHCYLIELDQKFGYEIPVNDFVLGVRSQ  706

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  528
            L+ D  NL FEL    G+      Y G++ L +EQ+L CRRFQ+T+ R+L +HNL+ L E
Sbjct  707  LDRDISNLHFELEFGRGSLSVNFKYAGEMHLDSEQVLLCRRFQITIFRILMDHNLDKLKE  766

Query  529  ALGRL  543
            AL  L
Sbjct  767  ALDGL  771



>gb|KCW84635.1| hypothetical protein EUGRSUZ_B01461 [Eucalyptus grandis]
Length=1194

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 67/113 (59%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
             P YFPP LV    N  +TLY CY+IEL + Y     ++N++LA R+ LE+D  + SF+L
Sbjct  454  HPAYFPPELVNHHPNKSKTLYHCYVIELRQDYNYDATVENMVLATRSELEADICDKSFKL  513

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
             +  G       Y+G++ L   Q+  CR+FQ+T+L VL +H++  L E L  L
Sbjct  514  QVPRGLLSVNVTYVGEIHLDENQVHLCRKFQITLLSVLLDHSMVKLRETLSGL  566



>ref|XP_010038609.1| PREDICTED: endoribonuclease Dicer homolog 2 [Eucalyptus grandis]
Length=1403

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 67/113 (59%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
             P YFPP LV    N  +TLY CY+IEL + Y     ++N++LA R+ LE+D  + SF+L
Sbjct  663  HPAYFPPELVNHHPNKSKTLYHCYVIELRQDYNYDATVENMVLATRSELEADICDKSFKL  722

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
             +  G       Y+G++ L   Q+  CR+FQ+T+L VL +H++  L E L  L
Sbjct  723  QVPRGLLSVNVTYVGEIHLDENQVHLCRKFQITLLSVLLDHSMVKLRETLSGL  775



>ref|XP_008240740.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=804

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 47/121 (39%), Positives = 70/121 (58%), Gaps = 3/121 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD  360
            PY +   QP Y PP LV     N    LY CYLI++   +     + +I+L +R+ L+ D
Sbjct  54   PYDDQ--QPSYVPPELVKPWCSNDASILYHCYLIQMKPNFCSDIPVNDIVLGMRSELDCD  111

Query  361  DENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR  540
              N++F+L +  G          ++ LS+EQIL+CRRFQ+T+ R+L +HNL  L+E L R
Sbjct  112  VANMNFDLGVGKGTITVNFKKAAEIHLSSEQILQCRRFQITIFRILMDHNLQKLEEVLER  171

Query  541  L  543
            L
Sbjct  172  L  172



>ref|XP_010549772.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549773.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549775.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
Length=1395

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 51/120 (43%), Positives = 67/120 (56%), Gaps = 2/120 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP YFPP L+G      +T Y  YLI L  +Y     +Q+I+L  R  LE D 
Sbjct  651  PYSDE--QPCYFPPELIGHFLVESKTTYHFYLIGLKPWYPDDFHVQDILLGTRAELEDDI  708

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
               SF+L ++GG       YIG   L+ E++  CRRFQ+T+LR L +HN  TL EAL  L
Sbjct  709  GTTSFKLGVKGGAITVTLKYIGVFHLTQEEVFLCRRFQITLLRTLLDHNPETLTEALDGL  768



>ref|XP_010549776.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Tarenaya 
hassleriana]
Length=1350

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 51/120 (43%), Positives = 67/120 (56%), Gaps = 2/120 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP YFPP L+G      +T Y  YLI L  +Y     +Q+I+L  R  LE D 
Sbjct  606  PYSDE--QPCYFPPELIGHFLVESKTTYHFYLIGLKPWYPDDFHVQDILLGTRAELEDDI  663

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
               SF+L ++GG       YIG   L+ E++  CRRFQ+T+LR L +HN  TL EAL  L
Sbjct  664  GTTSFKLGVKGGAITVTLKYIGVFHLTQEEVFLCRRFQITLLRTLLDHNPETLTEALDGL  723



>emb|CAN77284.1| hypothetical protein VITISV_043738 [Vitis vinifera]
Length=1296

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 69/116 (59%), Gaps = 2/116 (2%)
 Frame = +1

Query  169  QSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            Q +  PY +   Q  Y+PP L+      P T Y CYLIEL++ Y      Q I+LA+R+ 
Sbjct  552  QDENMPYDDE--QATYYPPELINPSLKDPVTPYHCYLIELBQKYEYEVSPQGIVLAVRSE  609

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN  516
            LE D  N++F+L ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +  ++
Sbjct  610  LEYDVGNVNFDLQVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLIDRAID  665



>ref|XP_010649216.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Vitis 
vinifera]
Length=1460

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 69/116 (59%), Gaps = 2/116 (2%)
 Frame = +1

Query  169  QSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            Q +  PY +   Q  Y+PP L+      P T Y CYLIEL++ Y      Q I+LA+R+ 
Sbjct  651  QDENMPYDDE--QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSE  708

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN  516
            LE D  N++F+L ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +  ++
Sbjct  709  LEYDVGNVNFDLQVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLIDRAID  764



>ref|XP_010649215.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Vitis 
vinifera]
Length=1461

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 69/116 (59%), Gaps = 2/116 (2%)
 Frame = +1

Query  169  QSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            Q +  PY +   Q  Y+PP L+      P T Y CYLIEL++ Y      Q I+LA+R+ 
Sbjct  659  QDENMPYDDE--QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSE  716

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN  516
            LE D  N++F+L ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +  ++
Sbjct  717  LEYDVGNVNFDLQVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLIDRAID  772



>ref|XP_010649214.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Vitis 
vinifera]
Length=1468

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 69/116 (59%), Gaps = 2/116 (2%)
 Frame = +1

Query  169  QSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            Q +  PY +   Q  Y+PP L+      P T Y CYLIEL++ Y      Q I+LA+R+ 
Sbjct  659  QDENMPYDDE--QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSE  716

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN  516
            LE D  N++F+L ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +  ++
Sbjct  717  LEYDVGNVNFDLQVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLIDRAID  772



>ref|XP_003535104.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
 ref|XP_006586845.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
 gb|KHN23015.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1414

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/145 (32%), Positives = 79/145 (54%), Gaps = 9/145 (6%)
 Frame = +1

Query  106  DIVLDVWMQRFDMATTGSTGLQSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIE  285
            ++V D+ M+  ++   G+        PY E   QP + P GLV +  N  QT+Y CY +E
Sbjct  634  NLVPDIVMEEAEVEELGNE-------PYDE--NQPTFVPFGLVNSVSNNSQTVYHCYFME  684

Query  286  LNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRC  465
             N  +     +Q+I L +R  L+ +   + F++  + G+      Y G + LS +Q+L C
Sbjct  685  FNNKFSYDVSVQDIFLLMRIELDPEIGCMQFDMGFDRGSLSVNFRYKGTINLSPDQVLLC  744

Query  466  RRFQVTVLRVLFEHNLNTLDEALGR  540
            ++FQVT+LR+L +H++N L   L R
Sbjct  745  KKFQVTILRILIDHDMNKLTAGLDR  769



>ref|XP_010649218.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Vitis 
vinifera]
Length=1405

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 69/116 (59%), Gaps = 2/116 (2%)
 Frame = +1

Query  169  QSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            Q +  PY +   Q  Y+PP L+      P T Y CYLIEL++ Y      Q I+LA+R+ 
Sbjct  659  QDENMPYDDE--QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSE  716

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN  516
            LE D  N++F+L ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +  ++
Sbjct  717  LEYDVGNVNFDLQVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLIDRAID  772



>emb|CBI17597.3| unnamed protein product [Vitis vinifera]
Length=1340

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 69/116 (59%), Gaps = 2/116 (2%)
 Frame = +1

Query  169  QSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            Q +  PY +   Q  Y+PP L+      P T Y CYLIEL++ Y      Q I+LA+R+ 
Sbjct  596  QDENMPYDDE--QATYYPPELINPSLKDPVTPYHCYLIELDQKYEYEVSPQGIVLAVRSE  653

Query  349  LESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN  516
            LE D  N++F+L ++ G       Y+G + L+ EQ+L CR+FQ+T+LRVL +  ++
Sbjct  654  LEYDVGNVNFDLQVDRGTMTVSMNYVGVIHLTAEQVLMCRKFQITLLRVLIDRAID  709



>ref|XP_007217819.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
 gb|EMJ19018.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
Length=758

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD  360
            PY +   QP Y PP LV     N    LY CYLI++   +     + +I+L +R+ L+ D
Sbjct  8    PYDDQ--QPSYVPPELVKPWCSNDASVLYHCYLIQMKPNFCSDIPVNDIVLGMRSELDCD  65

Query  361  DENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR  540
              N++F+L +             ++ LS+EQIL+CRRFQ+T+ R+L +HNL  L+E L R
Sbjct  66   VANMNFDLGVGKSTITVNFKKAAEIHLSSEQILQCRRFQITIFRILMDHNLQKLEEVLER  125

Query  541  L  543
            L
Sbjct  126  L  126



>gb|KDO45679.1| hypothetical protein CISIN_1g0030621mg, partial [Citrus sinensis]
Length=506

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 68/113 (60%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
             P YFPP LV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  115  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  174

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L  L
Sbjct  175  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEILKGL  227



>ref|XP_011006570.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Populus euphratica]
Length=1406

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 1/111 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD-DENLSFE  381
            QP Y+PP LV       +T Y CYLIELN+ +     + +++L +RT LESD   ++ F+
Sbjct  660  QPIYWPPELVSQGPRNLKTKYYCYLIELNQNFAYDIPVHDVVLVMRTELESDVIRSMGFD  719

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
            L  E G       YIGD+ L    +L CRRFQ+T+ +VL +H++N L E L
Sbjct  720  LEAERGLLTVNLRYIGDIDLERVLVLLCRRFQITLFKVLLDHSVNKLKEVL  770



>ref|XP_002312197.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
 gb|EEE89564.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
Length=1468

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 1/111 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD-DENLSFE  381
            QP Y PP LV       +T Y CYLIELN+ +     + +++L +RT LESD   ++ F+
Sbjct  709  QPIYLPPELVSRGPRNLKTKYYCYLIELNQNFAYDIPVHDVVLVVRTELESDVIRSMGFD  768

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
            L  E G       YIGD+ L    +L CRRFQ+T+ +VL +H++N L E L
Sbjct  769  LEAERGLLTVNLRYIGDIDLERVLVLLCRRFQITLFKVLLDHSVNKLKEVL  819



>gb|KJB14793.1| hypothetical protein B456_002G143000 [Gossypium raimondii]
Length=1393

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 47/141 (33%), Positives = 74/141 (52%), Gaps = 9/141 (6%)
 Frame = +1

Query  106  DIVLDVWMQRFDMATTGSTGLQSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIE  285
            ++V D+ ++  D    G      D         QP +FPP LV        T Y CYL+E
Sbjct  635  NLVPDIVVEENDAEEIGKESYNDD---------QPIFFPPELVNQDSQESMTKYYCYLME  685

Query  286  LNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRC  465
            L + +     +QNIIL +R++LE + +++  EL ++ G       YIG + LS++Q++ C
Sbjct  686  LKQNFGYEFPVQNIILLVRSQLEMEAKSVGIELEVDRGTLTVNLKYIGLIRLSSDQVILC  745

Query  466  RRFQVTVLRVLFEHNLNTLDE  528
            RRFQ+ + RVL +H    L E
Sbjct  746  RRFQIALFRVLMDHKAEKLTE  766



>ref|XP_006480488.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006480489.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Citrus 
sinensis]
Length=1401

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 67/110 (61%), Gaps = 0/110 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
             P YFPP LV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  718

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L
Sbjct  719  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEIL  768



>ref|XP_006480490.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006480491.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Citrus 
sinensis]
 ref|XP_006480492.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X5 [Citrus 
sinensis]
Length=1401

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 67/110 (61%), Gaps = 0/110 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
             P YFPP LV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  718

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L
Sbjct  719  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEIL  768



>ref|XP_006428678.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
 gb|ESR41918.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
Length=1401

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 67/110 (61%), Gaps = 0/110 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
             P YFPP LV       +  Y CYLIEL + +       +I+LA+RT LES+ + ++F+L
Sbjct  659  HPIYFPPELVNQCPQDTKITYHCYLIELKQNFNYDIPAHDIVLAVRTELESEIKKVNFDL  718

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
             ++ G       ++G + L+ +++L CRRFQ+ + RV+ +HNL+ L+E L
Sbjct  719  EVDRGRLTVNLKHLGKIQLTPDKVLLCRRFQIALFRVIMDHNLDKLNEIL  768



>ref|XP_006300010.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
 gb|EOA32908.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
Length=1392

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 61/113 (54%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F+L
Sbjct  658  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKIHLNDVLLGTRVELEDDIGNTGFQL  717

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L
Sbjct  718  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMEALDGL  770



>ref|XP_007216896.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
 gb|EMJ18095.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
Length=806

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 77/150 (51%), Gaps = 12/150 (8%)
 Frame = +1

Query  127  MQRFDMATTGSTGLQSDP----PPYQELGC------QPKYFPPGLVGTR-DNAPQTLYSC  273
            M+  DM   G T   +DP       QELG       QP Y P  LV     N    LY C
Sbjct  2    MEPIDMEIDG-TQQSADPLVVEEATQELGSEPYDDEQPSYVPAELVKPWCSNDASVLYHC  60

Query  274  YLIELNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQ  453
            YLIE+ + +     + N++L LR+ L  D  N++F+L ++ G          ++ LS EQ
Sbjct  61   YLIEMKQNFCSYIPVNNVVLGLRSELNCDIANMNFDLVVDKGTITVNFKKATEIHLSPEQ  120

Query  454  ILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            +L+CRRFQ+T+ R+L + NL  L E L RL
Sbjct  121  VLQCRRFQITIFRILVDCNLQNLKEVLERL  150



>ref|XP_009348591.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=581

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  378
            QP+Y P  LV     N    +Y CYLIEL   +     + +I+L  R  L+ D   N++F
Sbjct  32   QPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGTRNELDCDTVANMNF  91

Query  379  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            EL ++GG       + GDV LS+EQ+L CRRFQ+T+ ++L +  L  LDE L R 
Sbjct  92   ELQVQGGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDCKLKKLDEVLERF  146



>ref|XP_011015099.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Populus 
euphratica]
Length=1407

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 1/114 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  381
            QP Y PP L        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  660  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  719

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            L +E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L
Sbjct  720  LEVERGLLAVNLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGL  773



>ref|XP_011015091.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Populus 
euphratica]
Length=1408

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 1/114 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  381
            QP Y PP L        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  660  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  719

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            L +E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L
Sbjct  720  LEVERGLLAVNLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGL  773



>ref|XP_011015068.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011015076.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Populus 
euphratica]
 ref|XP_011015084.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
Length=1409

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 1/114 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  381
            QP Y PP L        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  660  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  719

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            L +E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L
Sbjct  720  LEVERGLLAVNLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGL  773



>ref|XP_008373031.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Malus 
domestica]
Length=665

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 8/126 (6%)
 Frame = +1

Query  190  QELGC------QPKYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            QELG       QP+Y P  LV     N    +Y CYLIEL   +     + +I+L +R  
Sbjct  21   QELGREPSDDEQPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGMRNE  80

Query  349  LESDD-ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLD  525
            L+ D   N++FEL ++ G       + GDV LS+EQ+L CRRFQ+T+ ++L +H L  L+
Sbjct  81   LDCDTIANMNFELQVQRGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDHKLKKLE  140

Query  526  EALGRL  543
            E L R 
Sbjct  141  EVLERF  146



>gb|EYU39730.1| hypothetical protein MIMGU_mgv1a0003142mg, partial [Erythranthe 
guttata]
Length=1143

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 65/107 (61%), Gaps = 6/107 (6%)
 Frame = +1

Query  190  QELGCQP------KYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  351
            +ELG +P      KYFPP L+G+     +T Y CYLIEL   +    QLQ ++LA+  RL
Sbjct  394  KELGSEPYIDEHAKYFPPELIGSCRKESKTHYHCYLIELKANFQYDVQLQEVVLAVHERL  453

Query  352  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLR  492
            + D E ++ +L+++ G  +    +IG + L +EQ+  CRRFQ+T+ R
Sbjct  454  DDDIEKVNLDLDVDRGKIIVGIKHIGYISLDSEQVALCRRFQITLFR  500



>ref|XP_009348590.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=775

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  378
            QP+Y P  LV     N    +Y CYLIEL   +     + +I+L  R  L+ D   N++F
Sbjct  32   QPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGTRNELDCDTVANMNF  91

Query  379  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            EL ++GG       + GDV LS+EQ+L CRRFQ+T+ ++L +  L  LDE L R 
Sbjct  92   ELQVQGGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDCKLKKLDEVLERF  146



>ref|XP_008373030.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Malus 
domestica]
Length=776

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 8/126 (6%)
 Frame = +1

Query  190  QELGC------QPKYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            QELG       QP+Y P  LV     N    +Y CYLIEL   +     + +I+L +R  
Sbjct  21   QELGREPSDDEQPRYVPIELVKPPCSNDASVMYHCYLIELKPNFDCDIPVSDIVLGMRNE  80

Query  349  LESDD-ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLD  525
            L+ D   N++FEL ++ G       + GDV LS+EQ+L CRRFQ+T+ ++L +H L  L+
Sbjct  81   LDCDTIANMNFELQVQRGPLTVNFKHAGDVSLSSEQVLACRRFQITIFKILVDHKLKKLE  140

Query  526  EALGRL  543
            E L R 
Sbjct  141  EVLERF  146



>ref|XP_008392375.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=731

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 71/126 (56%), Gaps = 8/126 (6%)
 Frame = +1

Query  190  QELG---C---QPKYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTR  348
            QELG   C   QP+Y P  LV     N    +Y CYLI+L +       + +I+LA R +
Sbjct  19   QELGREPCDDEQPRYVPTELVKPPCSNDASVMYHCYLIKLKQNIDCDIPVSDIVLATRNK  78

Query  349  LESDD-ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLD  525
            L+ D   N++FEL ++ G       Y GDV L +EQ+L CRRFQ+T+ R+L +H L  L+
Sbjct  79   LDCDTIANMNFELQVQRGPLAVNFKYAGDVNLCSEQVLVCRRFQITIFRILVDHELTKLE  138

Query  526  EALGRL  543
            + L R 
Sbjct  139  KVLERF  144



>ref|XP_010508928.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Camelina 
sativa]
Length=1355

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  662  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  721

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L +AL  L
Sbjct  722  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMKALDGL  774



>ref|XP_010508779.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
 ref|XP_010508854.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
Length=1394

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  659  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  718

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L +AL  L
Sbjct  719  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMKALDGL  771



>ref|XP_010508629.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
 ref|XP_010508709.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
Length=1397

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  662  QPCYFPPELVSQFSAQPQTTYHFYLIRMEPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  721

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L +AL  L
Sbjct  722  EDHKGTIAVTLSYVGAFHLTQEEVLMCRRFQITLFRVLLDHSVENLMKALDGL  774



>ref|XP_007029210.1| Dicer-like protein isoform 3 [Theobroma cacao]
 gb|EOY09712.1| Dicer-like protein isoform 3 [Theobroma cacao]
Length=1202

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 68/118 (58%), Gaps = 2/118 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP +FPP LV   ++     Y CYLIEL + +     + NI+L +R++LE D+
Sbjct  565  PYND--DQPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDN  622

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  537
            +++ FEL ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  623  KSMGFELEVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  680



>ref|XP_007029211.1| Dicer-like protein isoform 4, partial [Theobroma cacao]
 gb|EOY09713.1| Dicer-like protein isoform 4, partial [Theobroma cacao]
Length=970

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 68/118 (58%), Gaps = 2/118 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP +FPP LV   ++     Y CYLIEL + +     + NI+L +R++LE D+
Sbjct  637  PYND--DQPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDN  694

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  537
            +++ FEL ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  695  KSMGFELEVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  752



>ref|XP_007029209.1| Dicer-like protein isoform 2 [Theobroma cacao]
 gb|EOY09711.1| Dicer-like protein isoform 2 [Theobroma cacao]
Length=1307

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 68/118 (58%), Gaps = 2/118 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP +FPP LV   ++     Y CYLIEL + +     + NI+L +R++LE D+
Sbjct  563  PYND--DQPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDN  620

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  537
            +++ FEL ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  621  KSMGFELEVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  678



>ref|XP_007029212.1| Dicer-like protein isoform 5 [Theobroma cacao]
 gb|EOY09714.1| Dicer-like protein isoform 5 [Theobroma cacao]
Length=1077

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 68/118 (58%), Gaps = 2/118 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP +FPP LV   ++     Y CYLIEL + +     + NI+L +R++LE D+
Sbjct  440  PYND--DQPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDN  497

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  537
            +++ FEL ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  498  KSMGFELEVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  555



>ref|XP_008351646.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=730

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSF  378
            QP+Y P  LV     N    +Y CYLI+L +       + +I+LA R +L+ D   N++F
Sbjct  29   QPRYVPTELVKPPCSNDASVMYHCYLIKLKQNIDCDIPVSDIVLATRNKLDCDTIANMNF  88

Query  379  ELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            EL ++ G       Y GDV L +EQ+L CRRFQ+T+ R+L +H L  L++ L R 
Sbjct  89   ELQVQRGPLAVNFKYAGDVNLCSEQVLVCRRFQITIFRILVDHELTKLEKVLERF  143



>ref|XP_007029208.1| Dicer-like protein isoform 1 [Theobroma cacao]
 gb|EOY09710.1| Dicer-like protein isoform 1 [Theobroma cacao]
Length=1418

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 68/118 (58%), Gaps = 2/118 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP +FPP LV   ++     Y CYLIEL + +     + NI+L +R++LE D+
Sbjct  674  PYND--DQPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDN  731

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  537
            +++ FEL ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  732  KSMGFELEVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  789



>gb|KHG30500.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1290

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 11/146 (8%)
 Frame = +1

Query  106  DIVLDVWMQRFDMATTGSTGLQSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIE  285
            ++V D+ ++  D    G      D         QP +FPP LV        T Y CYL+E
Sbjct  686  NLVPDIVVEENDAEEIGKESYNDD---------QPIFFPPELVNQDSQESMTKYYCYLME  736

Query  286  LNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRC  465
            L + +     + NIIL +R++LE   E  S EL ++ G       YIG + LS++Q++ C
Sbjct  737  LKQNFGYEIPVHNIILLVRSQLEM--EAKSIELEVDRGTLTVNLKYIGLIRLSSDQVILC  794

Query  466  RRFQVTVLRVLFEHNLNTLDEALGRL  543
            RRFQ+ + RVL +H    L E L  L
Sbjct  795  RRFQIALFRVLMDHKAEKLTELLSDL  820



>gb|AAF26098.1|AC012328_1 unknown protein [Arabidopsis thaliana]
Length=2042

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = +1

Query  205   QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
             QP YFPP LV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  1312  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNFHLNDVLLGTRVVLEDDIGNTSFRL  1371

Query  385   NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                 G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L
Sbjct  1372  EDHRGTIAVTLSYVGAFHLTQEEVLFCRRFQITLFRVLLDHSVENLMEALNGL  1424



>gb|KHG30499.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1358

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 11/146 (8%)
 Frame = +1

Query  106  DIVLDVWMQRFDMATTGSTGLQSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIE  285
            ++V D+ ++  D    G      D         QP +FPP LV        T Y CYL+E
Sbjct  686  NLVPDIVVEENDAEEIGKESYNDD---------QPIFFPPELVNQDSQESMTKYYCYLME  736

Query  286  LNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRC  465
            L + +     + NIIL +R++LE   E  S EL ++ G       YIG + LS++Q++ C
Sbjct  737  LKQNFGYEIPVHNIILLVRSQLEM--EAKSIELEVDRGTLTVNLKYIGLIRLSSDQVILC  794

Query  466  RRFQVTVLRVLFEHNLNTLDEALGRL  543
            RRFQ+ + RVL +H    L E L  L
Sbjct  795  RRFQIALFRVLMDHKAEKLTELLSDL  820



>gb|ABF19798.1| dicer-like 2 spliceform 2 [Arabidopsis thaliana]
Length=1374

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  644  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNLHLNDVLLGTRVVLEDDIGNTSFRL  703

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L
Sbjct  704  EDHRGTIAVTLSYVGAFHLTREEVLFCRRFQITLFRVLLDHSVENLMEALNGL  756



>gb|ABF19797.1| dicer-like 2 spliceform 1 [Arabidopsis thaliana]
Length=1386

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  656  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNLHLNDVLLGTRVVLEDDIGNTSFRL  715

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L
Sbjct  716  EDHRGTIAVTLSYVGAFHLTREEVLFCRRFQITLFRVLLDHSVENLMEALNGL  768



>ref|XP_007029214.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
 gb|EOY09716.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
Length=947

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 68/118 (58%), Gaps = 2/118 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP +FPP LV   ++     Y CYLIEL + +     + NI+L +R++LE D+
Sbjct  370  PYND--DQPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDN  427

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  537
            +++ FEL ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  428  KSMGFELEVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  485



>ref|NP_001078101.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73925.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1374

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  644  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNFHLNDVLLGTRVVLEDDIGNTSFRL  703

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L
Sbjct  704  EDHRGTIAVTLSYVGAFHLTQEEVLFCRRFQITLFRVLLDHSVENLMEALNGL  756



>ref|XP_007029213.1| Dicer-like protein isoform 6 [Theobroma cacao]
 gb|EOY09715.1| Dicer-like protein isoform 6 [Theobroma cacao]
Length=1114

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 68/118 (58%), Gaps = 2/118 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP +FPP LV   ++     Y CYLIEL + +     + NI+L +R++LE D+
Sbjct  370  PYND--DQPIFFPPELVNQCEHEDMKKYYCYLIELKQNFDYEFPVHNIMLLVRSQLEIDN  427

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  537
            +++ FEL ++ G       Y+G + L   Q++  +RFQ+ V RVL +H +  L E LG
Sbjct  428  KSMGFELEVDRGFLTVNLKYVGLIRLDPSQVILSKRFQIAVFRVLMDHKVEKLTEVLG  485



>ref|NP_566199.4| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 ref|NP_001189798.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 sp|Q3EBC8.2|DCL2_ARATH RecName: Full=Endoribonuclease Dicer homolog 2; AltName: Full=Dicer-like 
protein 2; Short=AtDCL2 [Arabidopsis thaliana]
 gb|AEE73924.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73926.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1388

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 45/113 (40%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV      P+T Y  YLI +     +   L +++L  R  LE D  N SF L
Sbjct  658  QPCYFPPELVSQFSAQPETTYHFYLIRMKPNSPRNFHLNDVLLGTRVVLEDDIGNTSFRL  717

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L
Sbjct  718  EDHRGTIAVTLSYVGAFHLTQEEVLFCRRFQITLFRVLLDHSVENLMEALNGL  770



>ref|XP_002315119.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
 gb|EEF01290.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
Length=1408

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD-ENLSFE  381
            QP Y PP L        +T Y CYLIELN+ +     + +I+L +RT LESD   ++ FE
Sbjct  659  QPIYLPPELASQGPRNLKTKYYCYLIELNQKFDYGVPVHDIVLVMRTELESDVLSSMGFE  718

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            L  E G       YIGD+ L    +L CRRFQ+T+  VL    +N L+E L  L
Sbjct  719  LEAERGLLAVSLRYIGDIYLDQVPVLLCRRFQITLFEVLIHREVNKLEEVLKGL  772



>ref|XP_010312607.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Solanum 
lycopersicum]
Length=1370

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 49/123 (40%), Positives = 73/123 (59%), Gaps = 7/123 (6%)
 Frame = +1

Query  190  QELGCQPK------YFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  351
            +EL C+ K      Y+P   V    N  + +Y CYL+EL    Y  +QL  IILA+RT+L
Sbjct  631  KELECKIKIVEQSLYYPSEFVSHCGNESEAVYYCYLVELPHDSYNDSQLHGIILAVRTKL  690

Query  352  ESDDENLSFELNIE-GGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDE  528
            + DDE L+F+L+++  G    Q  Y   V  ++E+I RC+RFQV+V R+L + +L+ L E
Sbjct  691  KFDDEILAFDLDVDRRGRLKVQLNYRKVVIFTSEEIRRCQRFQVSVFRILRDPDLSKLQE  750

Query  529  ALG  537
             L 
Sbjct  751  VLA  753



>ref|XP_002884369.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60628.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
Length=2033

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 59/113 (52%), Gaps = 0/113 (0%)
 Frame = +1

Query  205   QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
             QP YFPP LV      P+T Y  YLI +     +   L +++L  R  LE D  N  F L
Sbjct  1303  QPCYFPPELVSQFSVQPETTYHFYLIRMKPSSQRNFHLNDVLLGTRVVLEDDIGNTGFRL  1362

Query  385   NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                 G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L
Sbjct  1363  EDHKGTIAVTLSYVGAFHLTQEEVLLCRRFQITLFRVLLDHSVKNLMEALNGL  1415



>ref|XP_010485670.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Camelina 
sativa]
Length=1354

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 59/113 (52%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  663  QPCYFPPELVSQFSAQPQTTYHFYLIRMAPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  722

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL + ++  L EAL  L
Sbjct  723  EDHKGTIAVTLSYVGAFHLTQEEVLVCRRFQITLFRVLLDQSVENLMEALDGL  775



>ref|XP_010485666.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010485667.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
Length=1398

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 59/113 (52%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  663  QPCYFPPELVSQFSAQPQTTYHFYLIRMAPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  722

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL + ++  L EAL  L
Sbjct  723  EDHKGTIAVTLSYVGAFHLTQEEVLVCRRFQITLFRVLLDQSVENLMEALDGL  775



>ref|XP_010485668.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
 ref|XP_010485669.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
Length=1395

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 59/113 (52%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV      PQT Y  YLI +     ++  L +++L  R  LE D  N  F L
Sbjct  660  QPCYFPPELVSQFSAQPQTTYHFYLIRMAPNSPRKFHLNDVLLGTRVELEDDIGNTGFRL  719

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL + ++  L EAL  L
Sbjct  720  EDHKGTIAVTLSYVGAFHLTQEEVLVCRRFQITLFRVLLDQSVENLMEALDGL  772



>emb|CDO96789.1| unnamed protein product [Coffea canephora]
Length=801

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 46/110 (42%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            Q +Y P  LVG   N  + LY CYLI L   +   T   +I+LA  TRLE D E L FEL
Sbjct  26   QMQYVPRELVGRPGNDSEILYHCYLIALQPDFSCNTMPHDILLA--TRLEFDAETLDFEL  83

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
            ++  G+   +  Y+  + L++E++L C++FQVT+ R+L + N N L EAL
Sbjct  84   DVPRGSLKIRMKYVRHIKLTSEEVLLCQKFQVTLFRLLIDQNQNKLQEAL  133



>ref|XP_007147466.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147467.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147468.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19460.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19461.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19462.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
Length=1392

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/112 (35%), Positives = 68/112 (61%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP Y P GLV    N+  T Y CYL+E +  +   T +Q++ LA+R +L+ +   + F+L
Sbjct  656  QPIYAPFGLVNCVSNSSHTTYHCYLMEFSPNFCYHTSVQDVFLAIRIKLDPEIGCMQFDL  715

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR  540
            + + G+   +  Y G + LS++Q+L C++FQVT+LR+L ++ +N     L +
Sbjct  716  DFDRGSVSVKLRYKGTINLSSDQVLLCKKFQVTLLRILIDNCMNKFTTGLDK  767



>ref|XP_007216887.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
 gb|EMJ18086.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
Length=752

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD  360
            PY +   QP Y P  LV     N    LY CYLI++   +     + +I+L +R+ L+ D
Sbjct  3    PYDDE--QPSYVPAELVKPWCSNDASALYHCYLIQMKPNFCYDIPVNDIVLGMRSELDCD  60

Query  361  DENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR  540
              N++F+L +  G          ++ LS+EQ+L+CRRFQ+T+ R+L +H L  L + L R
Sbjct  61   IANMTFDLEVGRGTITVNFKKAAEIHLSSEQVLQCRRFQITIFRILLDHELPNLGKVLER  120

Query  541  L  543
            L
Sbjct  121  L  121



>ref|XP_007147469.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 ref|XP_007147470.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19463.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19464.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
Length=1388

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 46/145 (32%), Positives = 79/145 (54%), Gaps = 9/145 (6%)
 Frame = +1

Query  106  DIVLDVWMQRFDMATTGSTGLQSDPPPYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIE  285
            ++V D++++  +M   G+        PY E   QP Y P GLV    N   T Y CYL+E
Sbjct  631  NLVPDIFIEEAEMEGFGNE-------PYDE--NQPAYVPFGLVNCVSNNSHTTYHCYLME  681

Query  286  LNRYYYKRTQLQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRC  465
            L + +     +Q+I LA R  L+ +     F++  + G+   + +Y G + LS + +L C
Sbjct  682  LIQNFSYDICVQDIFLATRIELDPEIGCTQFDMGFDRGSLSVKLIYKGTIDLSPDLVLLC  741

Query  466  RRFQVTVLRVLFEHNLNTLDEALGR  540
            ++FQVT+LR+L ++++N L   L +
Sbjct  742  KKFQVTLLRILIDNSMNKLAMGLDK  766



>ref|XP_008240779.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=781

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 63/114 (55%), Gaps = 1/114 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTR-DNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP Y P  LV     N    LY CYLIE+   +     + +I+L +R+ L+ D  N++F+
Sbjct  37   QPSYVPAELVKPWCSNDASALYHCYLIEMKPNFCYDIPVNDIVLGMRSELDCDIANMTFD  96

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            L +  G          ++ LS+EQ+L+CRRFQ+T+  +L +H L  L + L RL
Sbjct  97   LEVGRGTITVNFKKAAEIHLSSEQVLQCRRFQITIFGILLDHELPNLGKVLERL  150



>ref|XP_004171378.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cucumis sativus]
Length=453

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 60/101 (59%), Gaps = 0/101 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP Y PP  V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  163  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  222

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEH  507
            +++ G++     Y+G + LS EQ+L  R+FQ T+ RVL  H
Sbjct  223  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRVLLNH  263



>emb|CDY50692.1| BnaC05g47910D [Brassica napus]
Length=1389

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 57/113 (50%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV       QT Y  Y I +   +      ++I+L  R +LE D  N  F L
Sbjct  654  QPSYFPPELVSQFSALSQTTYHLYSIRMKSEFPGNLHFKDILLGTRVKLEDDIGNTCFRL  713

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ ++IL CRRFQ+T+ RVL +H++  L  AL  L
Sbjct  714  EDHLGTIAVTLSYVGAFDLAQDEILLCRRFQITLFRVLLDHSVENLVAALDGL  766



>ref|XP_006408318.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
 gb|ESQ49771.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
Length=1390

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 57/113 (50%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP Y PP LV       QT Y  YLI +     +  Q  +I L  RT LE D  +  F+L
Sbjct  656  QPCYLPPELVSQFSGQSQTTYHLYLIRMKPDSRRNFQFNDIFLGTRTELEDDIGSTCFQL  715

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G    + E++L CR+FQ+T+ RVL +H++  L EAL  L
Sbjct  716  EDHHGTIAVTLSYVGAFDFTQEEVLLCRKFQITLFRVLLDHSVENLMEALDGL  768



>gb|KFK39865.1| hypothetical protein AALP_AA3G298800 [Arabis alpina]
Length=986

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 56/113 (50%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP Y PP LV      PQT Y  Y I +     +  + + I L  R  LE D  N  F L
Sbjct  436  QPCYLPPELVSQFSAEPQTTYHMYSIRMKPSSSRDIKFKEIFLGTRVELEDDLGNTGFRL  495

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ E++L CRRFQ+T+ RVL +H++  L EAL  L
Sbjct  496  EDHKGTVAVTLSYVGAFHLTQEEVLLCRRFQITLFRVLLDHSVENLVEALDGL  548



>gb|KEH20231.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1219

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 2/108 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY E   QP Y P  LV    N   T+Y CYLIEL + +     +Q+I LA R +L+ + 
Sbjct  653  PYDEE--QPSYVPLELVNRMSNNSCTIYYCYLIELKQKFSYDLTVQDIFLATRVKLDLES  710

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEH  507
            E + F++  + G+      Y G + LS +Q+L C+RFQV VL +L  H
Sbjct  711  ECMEFDMCFDRGSLSVNLRYKGSINLSPDQVLLCKRFQVNVLGILMNH  758



>gb|KEH42074.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1385

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 2/108 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY E   QP Y P  LV    N   T+Y CYL+EL + +     +Q+I LA R +L+ + 
Sbjct  651  PYDE--DQPSYVPLELVNRMPNNSNTIYYCYLLELKQNFSYDITVQDIFLATRVKLDLET  708

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEH  507
            E + F +  + G+      Y G + LS +Q+L C+RFQV VL +L  H
Sbjct  709  ECMQFNMGFDRGSLSVNLKYKGSINLSPDQVLLCKRFQVNVLGILMNH  756



>gb|KJB61692.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61694.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61695.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1395

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP +FPP LV        T Y CYL+EL + +     + NI+L +R + + D+
Sbjct  654  PYND--DQPIFFPPELVNKGSLDSMTKYYCYLMELKQNFDYEVPVHNIMLLVRNQFDMDE  711

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
            ++++ EL ++ G       YIG + L+++Q++ CRRFQ+ V +VL +       E L
Sbjct  712  KSVNIELEVDRGTLTVNMKYIGLIRLNSDQVILCRRFQLAVFQVLMDRKAEKFAEVL  768



>gb|KJB61693.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1306

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP +FPP LV        T Y CYL+EL + +     + NI+L +R + + D+
Sbjct  565  PYND--DQPIFFPPELVNKGSLDSMTKYYCYLMELKQNFDYEVPVHNIMLLVRNQFDMDE  622

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
            ++++ EL ++ G       YIG + L+++Q++ CRRFQ+ V +VL +       E L
Sbjct  623  KSVNIELEVDRGTLTVNMKYIGLIRLNSDQVILCRRFQLAVFQVLMDRKAEKFAEVL  679



>ref|XP_006586847.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Glycine 
max]
Length=1387

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/119 (34%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY E   QP + P GLV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ + 
Sbjct  652  PYDE--NQPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEI  709

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR  540
                F++  + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L +
Sbjct  710  GCTQFDMGFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDK  768



>emb|CDY43132.1| BnaA05g32540D [Brassica napus]
Length=1388

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 57/113 (50%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV       QT Y  Y I +   +      ++++L  R +LE D  N  F L
Sbjct  654  QPSYFPPELVSQFSALSQTTYHFYSIRMKSEFPGNLHFKDVLLGTRVKLEDDIGNTCFRL  713

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ +++L CRRFQ+T+ RVL +H++  L  AL  L
Sbjct  714  EDHLGTIAVTLSYVGGFDLTQDEVLLCRRFQITLFRVLLDHSVENLLAALDGL  766



>ref|XP_009130358.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
 ref|XP_009130359.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
Length=1388

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 57/113 (50%), Gaps = 0/113 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP YFPP LV       QT Y  Y I +   +      ++++L  R +LE D  N  F L
Sbjct  654  QPSYFPPELVSQFSALSQTTYHFYSIRMKSEFPGNLHFKDVLLGTRVKLEDDIGNTCFRL  713

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G       Y+G   L+ +++L CRRFQ+T+ RVL +H++  L  AL  L
Sbjct  714  EDHLGTIAVTLSYVGGFDLTQDEVLLCRRFQITLFRVLLDHSVENLLAALDGL  766



>ref|XP_006586846.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
Length=1420

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/119 (34%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY E   QP + P GLV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ + 
Sbjct  686  PYDE--NQPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEI  743

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR  540
                F++  + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L +
Sbjct  744  GCTQFDMGFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDK  802



>ref|XP_003534774.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
Length=1421

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/119 (34%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY E   QP + P GLV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ + 
Sbjct  686  PYDE--NQPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEI  743

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR  540
                F++  + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L +
Sbjct  744  GCTQFDMGFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDK  802



>gb|KHN23014.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1324

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/119 (34%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY E   QP + P GLV +  N   T+Y CYL+EL++ +     +Q+I LA+R  L+ + 
Sbjct  589  PYDE--NQPTFVPFGLVNSVSNNSHTIYHCYLMELSQNFSYDISVQDIFLAIRIELDPEI  646

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR  540
                F++  + G+   +  Y G + LS   +L C++FQVT+L  + +H++N L  +L +
Sbjct  647  GCTQFDMGFDRGSVSLKLRYKGTINLSPNLVLLCKKFQVTLLGSIIDHSMNKLATSLDK  705



>gb|KJB61696.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1076

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/110 (34%), Positives = 62/110 (56%), Gaps = 0/110 (0%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP +FPP LV        T Y CYL+EL + +     + NI+L +R + + D+++++ EL
Sbjct  340  QPIFFPPELVNKGSLDSMTKYYCYLMELKQNFDYEVPVHNIMLLVRNQFDMDEKSVNIEL  399

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
             ++ G       YIG + L+++Q++ CRRFQ+ V +VL +       E L
Sbjct  400  EVDRGTLTVNMKYIGLIRLNSDQVILCRRFQLAVFQVLMDRKAEKFAEVL  449



>ref|XP_004139098.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cucumis sativus]
 gb|KGN66658.1| hypothetical protein Csa_1G654870 [Cucumis sativus]
Length=1393

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 40/109 (37%), Positives = 63/109 (58%), Gaps = 1/109 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP Y PP  V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  653  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  712

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDE  528
            +++ G++     Y+G + LS EQ+L  R+FQ T+ +VL  H   N L E
Sbjct  713  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFKVLLNHTWTNKLSE  761



>ref|XP_008443676.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
 ref|XP_008443677.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
Length=1306

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 40/109 (37%), Positives = 62/109 (57%), Gaps = 1/109 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP Y PP  V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  566  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  625

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDE  528
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H   N L E
Sbjct  626  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSE  674



>ref|XP_008443675.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Cucumis 
melo]
Length=1346

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 40/109 (37%), Positives = 62/109 (57%), Gaps = 1/109 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP Y PP  V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  606  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  665

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDE  528
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H   N L E
Sbjct  666  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSE  714



>ref|XP_008443674.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Cucumis 
melo]
Length=1365

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 40/109 (37%), Positives = 62/109 (57%), Gaps = 1/109 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP Y PP  V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  653  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  712

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDE  528
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H   N L E
Sbjct  713  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSE  761



>ref|XP_008443670.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443671.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443672.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
Length=1393

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 40/109 (37%), Positives = 62/109 (57%), Gaps = 1/109 (1%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            QP Y PP  V    +    +Y CYLIEL + ++      NI+LA+RT LE + +++  +L
Sbjct  653  QPIYVPPEFVHCCPHNSSVVYHCYLIELKQNFHYDISAHNIVLAMRTELEFEVQSMCHDL  712

Query  385  NIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHN-LNTLDE  528
            +++ G++     Y+G + LS EQ+L  R+FQ T+ R L  H   N L E
Sbjct  713  DVDRGSFDVNFKYVGIIKLSPEQVLLSRQFQRTIFRALLNHTWTNKLSE  761



>ref|XP_010673887.1| PREDICTED: endoribonuclease Dicer homolog 2 [Beta vulgaris subsp. 
vulgaris]
Length=1432

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 67/120 (56%), Gaps = 2/120 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   Q +Y P   VG    +   +Y  YL+EL + +Y    + +I+L  +T L SD 
Sbjct  678  PYNDH--QARYVPSEFVGDGPTSSSDVYHGYLMELKQDFYSDIPVHDIVLVFKTELASDV  735

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
             N+ F+++++ GN      YIG + L+ +Q+  C ++QV VLRVL + + + L E++  L
Sbjct  736  GNMHFDMDVDWGNMSVDVKYIGKINLTRKQVALCTQYQVAVLRVLRDLDFDKLVESVKEL  795



>ref|XP_007140643.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
 gb|ESW12637.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
Length=1420

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 63/111 (57%), Gaps = 2/111 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY +   QP Y P GLV    N   T Y CYL+EL++ +     +++I LA+R  L+++ 
Sbjct  685  PYDD--NQPTYVPFGLVNCVSNNSHTTYHCYLMELSQNFSYDIFVEDIFLAMRVELDTEV  742

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN  516
                F++  + G+   +  Y G + LS +Q+L C+ FQ T+LR+L   ++N
Sbjct  743  VCSQFDMGFDRGDVSVKLSYKGTINLSQDQVLLCKNFQATLLRILIRRDIN  793



>gb|ACE60552.1| dicer-like protein 2 [Brassica rapa]
Length=1392

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/114 (37%), Positives = 59/114 (52%), Gaps = 2/114 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFEL  384
            Q  YFPP LV       QT Y  Y I +   + +     +I+L  R  LE+D  N  F L
Sbjct  657  QSSYFPPELVSQFSAHSQTTYHFYSIRMKSEFPRNLHFNDILLGTRVELEADIGNTCFRL  716

Query  385  NIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
                G  +G T+ Y+G   L+  ++L CRRFQ+T+ RVL +H++  L  AL  L
Sbjct  717  EDHLGT-IGVTLSYVGAFDLTQNEVLLCRRFQITLFRVLLDHSVENLAAALDGL  769



>ref|XP_003594551.1| Endoribonuclease Dicer [Medicago truncatula]
Length=1418

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 61/111 (55%), Gaps = 2/111 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY E   QP Y P  LV    N   T+Y CYLIEL + +     +Q+I LA R  L+ + 
Sbjct  688  PYSEE--QPSYVPFELVNHMSNNSSTIYYCYLIELKQNFSYDITVQDIFLATRVELDPEI  745

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN  516
              + F++  + G+      Y G++ LS +Q+L C+RFQV++L +L    ++
Sbjct  746  GCMQFDMCFDRGSLAVNLRYRGNINLSPDQVLLCKRFQVSILGILMNSKMD  796



>gb|AES64802.2| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1377

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 61/111 (55%), Gaps = 2/111 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY E   QP Y P  LV    N   T+Y CYLIEL + +     +Q+I LA R  L+ + 
Sbjct  649  PYSEE--QPSYVPFELVNHMSNNSSTIYYCYLIELKQNFSYDITVQDIFLATRVELDPEI  706

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN  516
              + F++  + G+      Y G++ LS +Q+L C+RFQV++L +L    ++
Sbjct  707  GCMQFDMCFDRGSLAVNLRYRGNINLSPDQVLLCKRFQVSILGILMNSKMD  757



>ref|XP_004303843.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Fragaria vesca 
subsp. vesca]
Length=1393

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 42/124 (34%), Positives = 64/124 (52%), Gaps = 6/124 (5%)
 Frame = +1

Query  190  QELGCQPK------YFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  351
            QE  C+P       Y P  LV T  N    LY  Y+I L++ +     +++ +L +RT+L
Sbjct  640  QEFECEPYDEEQSCYVPSELVKTCSNDDTMLYHQYIIVLDQTFDYEIPVKDFVLCMRTKL  699

Query  352  ESDDENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  531
            + +  N   EL    G       Y G++ L+ EQ+L CRRFQVT+  +L +HNL+  +E 
Sbjct  700  DFEIANWHSELEFGSGCLTVNFKYGGEIHLNAEQVLNCRRFQVTIFGILIDHNLDKWNEV  759

Query  532  LGRL  543
               L
Sbjct  760  FDGL  763



>ref|XP_010101236.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB88160.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1429

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 41/121 (34%), Positives = 68/121 (56%), Gaps = 3/121 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTL-YSCYLIELNRYYYKRTQLQNIILALRTRLESD  360
            PY++   QP Y P  +VG+   A   + Y CYLIEL + +     + +++L +R+ LESD
Sbjct  650  PYKDE--QPSYVPSEMVGSFGPADAGVSYHCYLIELKQDFGYDVPIHDLVLCMRSALESD  707

Query  361  DENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGR  540
              N+ F+L +  G+       +G + L+ +Q+   R FQVT+LR+L +H  + L E   +
Sbjct  708  LANIHFDLQVGRGSVTVNLKNVGTLSLNRDQVTWSRMFQVTLLRLLVDHKFDNLREVHSQ  767

Query  541  L  543
            L
Sbjct  768  L  768



>ref|XP_010249397.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Nelumbo 
nucifera]
Length=1394

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 64/114 (56%), Gaps = 7/114 (6%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQT----LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  372
            Q  YFP  LV   ++ P      +Y CY+I L + +      ++I L +R  L +D EN 
Sbjct  651  QVNYFPAELV---NHCPSCSVIEMYHCYVIRLKKNFKYDVPFRDIALLVRHNLGADFENF  707

Query  373  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
             F+L ++ G      VY G + LS +Q+L  RRFQ+TVLRVL +H+++ + + +
Sbjct  708  YFDLEVDWGFVTVNLVYNGTIHLSPDQVLMARRFQITVLRVLIDHSMDKVKDVM  761



>ref|XP_010249398.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Nelumbo 
nucifera]
Length=1188

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 64/114 (56%), Gaps = 7/114 (6%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQT----LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  372
            Q  YFP  LV   ++ P      +Y CY+I L + +      ++I L +R  L +D EN 
Sbjct  445  QVNYFPAELV---NHCPSCSVIEMYHCYVIRLKKNFKYDVPFRDIALLVRHNLGADFENF  501

Query  373  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
             F+L ++ G      VY G + LS +Q+L  RRFQ+TVLRVL +H+++ + + +
Sbjct  502  YFDLEVDWGFVTVNLVYNGTIHLSPDQVLMARRFQITVLRVLIDHSMDKVKDVM  555



>ref|XP_004486471.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cicer arietinum]
Length=1400

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 2/108 (2%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDD  363
            PY E   QP Y P  LV    N   T Y CYLIEL + +     +Q+I LA R  L+ + 
Sbjct  667  PYDEE--QPSYVPFELVNRVLNNSNTTYYCYLIELKQNFSYDFTVQDIFLATRVELDPEI  724

Query  364  ENLSFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEH  507
              + F++  + G+      Y G + LS +Q+L C+RFQV VL +L +H
Sbjct  725  ACMQFDMCFDRGSLDVNLKYKGSINLSPDQVLLCKRFQVNVLGILMDH  772



>ref|XP_010312606.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Solanum 
lycopersicum]
Length=1406

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 49/159 (31%), Positives = 74/159 (47%), Gaps = 43/159 (27%)
 Frame = +1

Query  190  QELGCQPK------YFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  351
            +EL C+ K      Y+P   V    N  + +Y CYL+EL    Y  +QL  IILA+RT+L
Sbjct  631  KELECKIKIVEQSLYYPSEFVSHCGNESEAVYYCYLVELPHDSYNDSQLHGIILAVRTKL  690

Query  352  ESDDENLSFELNI--------------------EGGNWVGQTVYIGDVGL----------  441
            + DDE L+F+L++                    E   W   + Y   V +          
Sbjct  691  KFDDEILAFDLDVDRRGRLKVQLNYRKVVIFTSEEVRWFLSSFYSLPVKMVWGRLKVQLN  750

Query  442  -------SNEQILRCRRFQVTVLRVLFEHNLNTLDEALG  537
                   ++E+I RC+RFQV+V R+L + +L+ L E L 
Sbjct  751  YRKVVIFTSEEIRRCQRFQVSVFRILRDPDLSKLQEVLA  789



>ref|XP_007147294.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
 gb|ESW19288.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
Length=754

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 58/113 (51%), Gaps = 4/113 (4%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQTLYS--CYLIELNRYYYKRTQLQNIILALRTRLESD-DENLS  375
             P Y PP LV     +    Y   CYL+EL   Y    ++ +I+LA+RT LES+  E LS
Sbjct  8    HPCYVPPELVNCSSKSCSVTYEYYCYLMELKEDYKYEVKVGDIVLAMRTELESEIIETLS  67

Query  376  -FELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEA  531
               L +E G           + LS+EQ+ +CRRFQ T+ ++L   + N L  A
Sbjct  68   GTSLVVERGKLSLNLTPAKPIQLSSEQVEKCRRFQTTLFKILLNGDFNQLPSA  120



>ref|XP_006604892.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Glycine 
max]
Length=788

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/107 (30%), Positives = 56/107 (52%), Gaps = 2/107 (2%)
 Frame = +1

Query  208  PKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  381
            P Y P  LV          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  9    PSYVPSELVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  68

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTL  522
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L
Sbjct  69   FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKL  115



>ref|XP_003553782.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Glycine 
max]
Length=756

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/107 (30%), Positives = 56/107 (52%), Gaps = 2/107 (2%)
 Frame = +1

Query  208  PKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  381
            P Y P  LV          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  9    PSYVPSELVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  68

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTL  522
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L
Sbjct  69   FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKL  115



>gb|KHN43108.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=836

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/107 (30%), Positives = 56/107 (52%), Gaps = 2/107 (2%)
 Frame = +1

Query  208  PKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  381
            P Y P  LV          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  57   PSYVPSELVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  116

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTL  522
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L
Sbjct  117  FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKL  163



>gb|ACU23800.1| unknown [Glycine max]
Length=273

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 55/107 (51%), Gaps = 2/107 (2%)
 Frame = +1

Query  208  PKYFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESD--DENLSFE  381
            P Y P   V          Y CYL+EL ++Y  +  + +I+LA+R+ L+S+  D      
Sbjct  9    PSYVPSERVSCSSKGRNVTYHCYLMELEQHYEYQVSVNDIVLAIRSELDSEIVDTLSGTS  68

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTL  522
             +++ G  +    ++  + LS E++  CRRFQ T+ R+L   ++  L
Sbjct  69   FDVKRGKLLVNLRHLEPIQLSPEKVQSCRRFQTTLFRILLNRDVTKL  115



>ref|XP_006844770.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
 gb|ERN06445.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
Length=1424

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 46/139 (33%), Positives = 69/139 (50%), Gaps = 14/139 (10%)
 Frame = +1

Query  139  DMATTGSTGLQSDPPPYQELGCQPKYFPPGLVG-TRDNAPQTLYSCYLIELNRYYYKRTQ  315
            D A+ GS G      P +E      YFP  L+G  +    + LY CY I L+       +
Sbjct  657  DDASMGSGG-----EPCEEF--HAMYFPQELIGHLKKGCGKELYDCYSITLHSNVDHGWE  709

Query  316  LQNIILALRTRLESDDENLSFELNIEGGNWVGQTVYIGDVG---LSNEQILRCRRFQVTV  486
             ++++L ++  L  D E LSF   + G N V   V +G  G   L  EQ+L  RRFQ T+
Sbjct  710  FRSLLLMVKCNLGYDFEQLSF---VMGPNQVSVAVNMGYAGTRELDVEQVLMARRFQTTI  766

Query  487  LRVLFEHNLNTLDEALGRL  543
             ++L   N++ + E+L RL
Sbjct  767  FKILITGNVSEMRESLERL  785



>ref|XP_010312604.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010312605.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
Length=1433

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 6/74 (8%)
 Frame = +1

Query  190  QELGCQPK------YFPPGLVGTRDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRL  351
            +EL C+ K      Y+P   V    N  + +Y CYL+EL    Y  +QL  IILA+RT+L
Sbjct  631  KELECKIKIVEQSLYYPSEFVSHCGNESEAVYYCYLVELPHDSYNDSQLHGIILAVRTKL  690

Query  352  ESDDENLSFELNIE  393
            + DDE L+F+L+++
Sbjct  691  KFDDEILAFDLDVD  704



>ref|XP_010088523.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB36440.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1077

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 29/84 (35%), Positives = 44/84 (52%), Gaps = 4/84 (5%)
 Frame = +1

Query  184  PYQELGCQPKYFPPGLVGT--RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLES  357
            PY++    P+Y P  +VG+   D    TLY CYL+EL + +     + NI+L  R  LE 
Sbjct  340  PYED--AHPRYIPSEMVGSFCPDGDAHTLYYCYLLELKQEFEYDIPVHNILLGTRNELEV  397

Query  358  DDENLSFELNIEGGNWVGQTVYIG  429
            D  N  F+L +  G+ +    Y+G
Sbjct  398  DGGNTHFDLKVGSGSLIVNLKYVG  421



>ref|XP_008681081.1| PREDICTED: uncharacterized protein LOC100192986 isoform X1 [Zea 
mays]
Length=1408

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 15/120 (13%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDN-APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP  LV    + + +  Y CY++ L      +T    I+LA++  + SD  + SF+
Sbjct  677  QPDYFPEQLVDNWSSFSRRGFYYCYMVSLEGC--SKTTPAEIVLAVKCDMGSDFISNSFK  734

Query  382  LNIEGGNWVGQTV------YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            L      W  Q        Y+G + L+ EQ++  RRFQ T+L +L  ++L+ +   +  L
Sbjct  735  L------WGVQDYLSFTMRYVGIIHLNQEQVIAARRFQTTILSLLISNDLSEVSNYIKNL  788



>ref|XP_008681082.1| PREDICTED: uncharacterized protein LOC100192986 isoform X2 [Zea 
mays]
Length=1401

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 15/120 (13%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDN-APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP  LV    + + +  Y CY++ L      +T    I+LA++  + SD  + SF+
Sbjct  670  QPDYFPEQLVDNWSSFSRRGFYYCYMVSLEGC--SKTTPAEIVLAVKCDMGSDFISNSFK  727

Query  382  LNIEGGNWVGQTV------YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            L      W  Q        Y+G + L+ EQ++  RRFQ T+L +L  ++L+ +   +  L
Sbjct  728  L------WGVQDYLSFTMRYVGIIHLNQEQVIAARRFQTTILSLLISNDLSEVSNYIKNL  781



>ref|XP_008681083.1| PREDICTED: uncharacterized protein LOC100192986 isoform X3 [Zea 
mays]
Length=1192

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 15/120 (13%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDN-APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP  LV    + + +  Y CY++ L      +T    I+LA++  + SD  + SF+
Sbjct  677  QPDYFPEQLVDNWSSFSRRGFYYCYMVSLEGC--SKTTPAEIVLAVKCDMGSDFISNSFK  734

Query  382  LNIEGGNWVGQTV------YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEALGRL  543
            L      W  Q        Y+G + L+ EQ++  RRFQ T+L +L  ++L+ +   +  L
Sbjct  735  L------WGVQDYLSFTMRYVGIIHLNQEQVIAARRFQTTILSLLISNDLSEVSNYIKNL  788



>gb|EEC75643.1| hypothetical protein OsI_12390 [Oryza sativa Indica Group]
Length=1318

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP   V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  575  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  633

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVL  498
            L     N      Y+G + L+ EQ++  RRFQ T+L  L
Sbjct  634  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFL  672



>gb|AAS07188.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=416

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 49/100 (49%), Gaps = 2/100 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP   V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  274  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  332

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLF  501
            L     N      Y+G + L+ EQ++  RRFQ T+L  L 
Sbjct  333  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLI  372



>gb|AAS07190.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=538

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 49/100 (49%), Gaps = 2/100 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP   V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  274  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  332

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLF  501
            L     N      Y+G + L+ EQ++  RRFQ T+L  L 
Sbjct  333  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFLI  372



>gb|AAS07189.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=1017

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP   V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  274  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  332

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVL  498
            L     N      Y+G + L+ EQ++  RRFQ T+L  L
Sbjct  333  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFL  371



>gb|EEE59414.1| hypothetical protein OsJ_11564 [Oryza sativa Japonica Group]
Length=1371

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP   V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  632  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  690

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVL  498
            L     N      Y+G + L+ EQ++  RRFQ T+L  L
Sbjct  691  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFL  729



>ref|NP_001050564.1| Os03g0583900 [Oryza sativa Japonica Group]
 sp|Q10HL3.1|DCL2A_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2a; AltName: Full=Dicer-like 
protein 2a; Short=OsDCL2a [Oryza sativa Japonica 
Group]
 gb|AAT76309.1| putative RNA helicase/RNAseIII protein, C-terminus truncated 
[Oryza sativa Japonica Group]
 gb|ABF97330.1| Type III restriction enzyme, res subunit family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12478.1| Os03g0583900 [Oryza sativa Japonica Group]
 dbj|BAG92928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1410

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP   V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  667  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  725

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVL  498
            L     N      Y+G + L+ EQ++  RRFQ T+L  L
Sbjct  726  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFL  764



>dbj|BAD34005.1| CAF protein-like [Oryza sativa Japonica Group]
 dbj|BAD36404.1| CAF protein-like [Oryza sativa Japonica Group]
Length=1375

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP   V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  636  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  694

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVL  498
            L     N      Y+G + L+ EQ++  RRFQ T+L  L
Sbjct  695  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFL  733



>sp|Q69LX2.2|DCL2B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2b; AltName: Full=Dicer-like 
protein 2b; Short=OsDCL2b [Oryza sativa Japonica 
Group]
Length=1377

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = +1

Query  205  QPKYFPPGLVGT-RDNAPQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP   V   R  +   +Y CY I L     K     +I+LAL+  L SD  + SF+
Sbjct  638  QPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCP-KTASPTDILLALKCDLGSDFTSSSFK  696

Query  382  LNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVL  498
            L     N      Y+G + L+ EQ++  RRFQ T+L  L
Sbjct  697  LPGGQDNASVTMKYVGIIHLNQEQVIIARRFQTTILSFL  735



>ref|XP_010233062.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
 ref|XP_010233066.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
Length=1144

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 56/108 (52%), Gaps = 8/108 (7%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  372
            QP YFP  LV   DN    +   +Y CY+I L  +  + T   +IILA++  + SD  + 
Sbjct  402  QPAYFPEELV---DNWLSFSCLGIYICYMISLEGFL-QTTAPTDIILAMKCDMGSDFVSR  457

Query  373  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN  516
            SF+L            Y+G + L+ EQ++  RRFQ ++L +L  + + 
Sbjct  458  SFKLYGTQDYVTVAIKYMGIIHLNQEQVIIARRFQTSILSLLINNAIK  505



>ref|XP_010233057.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Brachypodium distachyon]
Length=1248

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 56/108 (52%), Gaps = 8/108 (7%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  372
            QP YFP  LV   DN    +   +Y CY+I L  +  + T   +IILA++  + SD  + 
Sbjct  506  QPAYFPEELV---DNWLSFSCLGIYICYMISLEGFL-QTTAPTDIILAMKCDMGSDFVSR  561

Query  373  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLN  516
            SF+L            Y+G + L+ EQ++  RRFQ ++L +L  + + 
Sbjct  562  SFKLYGTQDYVTVAIKYMGIIHLNQEQVIIARRFQTSILSLLINNAIK  609



>ref|XP_008644679.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X4 
[Zea mays]
Length=682

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 56/114 (49%), Gaps = 11/114 (10%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  372
            QP YFP  L+   DN    + + LY CY I L           +IILA++  +  D    
Sbjct  37   QPVYFPEELM---DNWVSFSLRGLYYCYNISLQGSCNTTADPTDIILAVKCDMGPDFFRY  93

Query  373  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
            SF L   GG  +    Y+  + L+ EQ+L  RRFQ+TVL +L   N + +  A+
Sbjct  94   SFNL---GGTDI-TIKYLYKIHLNQEQVLFARRFQITVLSLLINSNSSEVSNAI  143



>ref|XP_008644676.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Zea mays]
Length=751

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 56/114 (49%), Gaps = 11/114 (10%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  372
            QP YFP  L+   DN    + + LY CY I L           +IILA++  +  D    
Sbjct  37   QPVYFPEELM---DNWVSFSLRGLYYCYNISLQGSCNTTADPTDIILAVKCDMGPDFFRY  93

Query  373  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
            SF L   GG  +    Y+  + L+ EQ+L  RRFQ+TVL +L   N + +  A+
Sbjct  94   SFNL---GGTDI-TIKYLYKIHLNQEQVLFARRFQITVLSLLINSNSSEVSNAI  143



>ref|XP_008644681.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X6 
[Zea mays]
Length=639

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 56/114 (49%), Gaps = 11/114 (10%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  372
            QP YFP  L+   DN    + + LY CY I L           +IILA++  +  D    
Sbjct  37   QPVYFPEELM---DNWVSFSLRGLYYCYNISLQGSCNTTADPTDIILAVKCDMGPDFFRY  93

Query  373  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
            SF L   GG  +    Y+  + L+ EQ+L  RRFQ+TVL +L   N + +  A+
Sbjct  94   SFNL---GGTDI-TIKYLYKIHLNQEQVLFARRFQITVLSLLINSNSSEVSNAI  143



>ref|XP_010229604.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2a-like [Brachypodium distachyon]
Length=1398

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 57/112 (51%), Gaps = 3/112 (3%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDNAPQT-LYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENLSFE  381
            QP YFP   +G   +     +Y CY I L           +IILA++  L SD    SF+
Sbjct  660  QPDYFPEEFLGNWFSFSHLGIYHCYKISLGGCLKTIASPTDIILAVKCDLGSDFIANSFK  719

Query  382  LNIEGGNWVGQTV-YIGDVGLSNEQILRCRRFQVTVLRVLFEHNLNTLDEAL  534
            L+    +++  ++ Y+G++ L+ EQ+   RRFQ T+L +L   + +    A+
Sbjct  720  LS-GAQDFISVSIKYVGNIHLNQEQVNSARRFQTTILSLLINKDHSEASNAI  770



>ref|XP_006651573.1| PREDICTED: endoribonuclease Dicer homolog 2a-like [Oryza brachyantha]
Length=1348

 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 8/102 (8%)
 Frame = +1

Query  205  QPKYFPPGLVGTRDN----APQTLYSCYLIELNRYYYKRTQLQNIILALRTRLESDDENL  372
            QP YFP   V   DN    + Q +Y CY I L       +   +I+LA++  + SD  ++
Sbjct  604  QPAYFPEEFV---DNWCSFSHQGIYYCYKISLEGCLETDSP-TDILLAVKCDMGSDFTSI  659

Query  373  SFELNIEGGNWVGQTVYIGDVGLSNEQILRCRRFQVTVLRVL  498
            SF++     N      Y G + L+ EQ++  RRFQ T+L +L
Sbjct  660  SFQMPGGQDNACVTMNYAGIIHLNQEQVIIARRFQTTILSLL  701



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490