BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J08

Length=234
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008660989.1|  PREDICTED: endoplasmin homolog                     145   2e-41   
tpg|DAA46734.1|  TPA: hypothetical protein ZEAMMB73_851694              145   8e-40   
ref|XP_008646956.1|  PREDICTED: endoplasmin homolog                     141   1e-39   
dbj|BAD94659.1|  HSP90-like protein                                     143   3e-39   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA46735.1|  TPA: hypothetical protein ZEAMMB73_851694              144   4e-39   
gb|KJB63271.1|  hypothetical protein B456_010G0030002                   139   2e-38   Gossypium raimondii
gb|KJB63270.1|  hypothetical protein B456_010G0030002                   139   2e-38   Gossypium raimondii
emb|CDP07384.1|  unnamed protein product                                145   2e-38   Coffea canephora [robusta coffee]
gb|AFW75766.1|  hypothetical protein ZEAMMB73_790349                    144   2e-38   
gb|KJB63272.1|  hypothetical protein B456_010G0030002                   140   2e-38   Gossypium raimondii
gb|AFK46854.1|  unknown                                                 134   3e-38   Medicago truncatula
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1               145   3e-38   
gb|AFW75767.1|  endoplasmin                                             145   3e-38   
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                     145   3e-38   Setaria italica
ref|NP_001151475.1|  endoplasmin precursor                              145   4e-38   Zea mays [maize]
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                    145   4e-38   
ref|XP_008666260.1|  PREDICTED: endoplasmin homolog                     133   4e-38   Zea mays [maize]
ref|XP_003589505.1|  Endoplasmin-like protein                           144   4e-38   Medicago truncatula
ref|XP_010109992.1|  Endoplasmin-like protein                           145   6e-38   
dbj|BAA90487.1|  heat shock protein 90                                  144   6e-38   Oryza sativa [red rice]
ref|NP_001058590.1|  Os06g0716700                                       144   6e-38   
gb|AAL79732.1|AC091774_23  heat shock protein 90                        144   6e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                     144   6e-38   Tarenaya hassleriana [spider flower]
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                     144   7e-38   Oryza brachyantha
gb|EAZ02369.1|  hypothetical protein OsI_24473                          144   8e-38   Oryza sativa Indica Group [Indian rice]
gb|EAZ38293.1|  hypothetical protein OsJ_22671                          144   8e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009596271.1|  PREDICTED: endoplasmin homolog                     142   8e-38   Nicotiana tomentosiformis
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...    144   8e-38   Catharanthus roseus [chatas]
ref|XP_002439030.1|  hypothetical protein SORBIDRAFT_10g030240          144   9e-38   
ref|NP_974606.1|  HSP90-like protein GRP94                              144   9e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194150.1|  HSP90-like protein GRP94                              144   9e-38   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB86368.1|  SHEPHERD                                               144   9e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441             144   9e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                     144   1e-37   Brassica rapa
emb|CDY34264.1|  BnaA01g13670D                                          143   1e-37   Brassica napus [oilseed rape]
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                     143   1e-37   Camelina sativa [gold-of-pleasure]
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                    143   1e-37   Arabis alpina [alpine rockcress]
emb|CDY24830.1|  BnaA08g14800D                                          143   1e-37   Brassica napus [oilseed rape]
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                     143   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg             143   1e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                     143   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_007017830.1|  Chaperone protein htpG family protein isoform 3    142   1e-37   
ref|XP_002273785.1|  PREDICTED: endoplasmin homolog                     143   1e-37   Vitis vinifera
emb|CDY08910.1|  BnaC08g11400D                                          143   1e-37   Brassica napus [oilseed rape]
gb|KDO84888.1|  hypothetical protein CISIN_1g003458mg                   140   1e-37   Citrus sinensis [apfelsine]
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg             143   1e-37   Capsella rubella
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...    143   2e-37   Hordeum vulgare [barley]
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                     143   2e-37   Brachypodium distachyon [annual false brome]
dbj|BAL42333.1|  Heat shock protein 90                                  142   2e-37   Nicotiana tabacum [American tobacco]
ref|XP_004499283.1|  PREDICTED: endoplasmin homolog isoform X3          142   2e-37   Cicer arietinum [garbanzo]
ref|XP_004499281.1|  PREDICTED: endoplasmin homolog isoform X1          142   2e-37   Cicer arietinum [garbanzo]
gb|KDO84887.1|  hypothetical protein CISIN_1g003458mg                   140   3e-37   Citrus sinensis [apfelsine]
ref|XP_007017829.1|  Chaperone protein htpG family protein isoform 2    142   3e-37   
emb|CAN79404.1|  hypothetical protein VITISV_028074                     143   3e-37   Vitis vinifera
gb|ABV82432.1|  Hsp90-like protein                                      142   3e-37   Dactylis glomerata [cocksfoot]
emb|CDY10992.1|  BnaA03g46510D                                          142   3e-37   Brassica napus [oilseed rape]
ref|XP_007017828.1|  Chaperone protein htpG family protein isoform 1    142   3e-37   
gb|EMS56078.1|  Endoplasmin-like protein                                142   3e-37   Triticum urartu
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg                142   3e-37   Erythranthe guttata [common monkey flower]
emb|CDX92620.1|  BnaC07g38780D                                          141   5e-37   
gb|EMT19498.1|  Endoplasmin-like protein                                142   5e-37   
emb|CDY03477.1|  BnaC01g16050D                                          141   5e-37   
gb|KJB14398.1|  hypothetical protein B456_002G122800                    141   6e-37   Gossypium raimondii
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                     141   7e-37   Nelumbo nucifera [Indian lotus]
gb|KDO84884.1|  hypothetical protein CISIN_1g003458mg                   141   8e-37   Citrus sinensis [apfelsine]
ref|XP_006473673.1|  PREDICTED: endoplasmin homolog                     141   8e-37   Citrus sinensis [apfelsine]
ref|XP_002307732.1|  hypothetical protein POPTR_0005s26260g             141   9e-37   Populus trichocarpa [western balsam poplar]
gb|KDO84886.1|  hypothetical protein CISIN_1g003458mg                   140   9e-37   Citrus sinensis [apfelsine]
gb|KJB14397.1|  hypothetical protein B456_002G122800                    141   9e-37   Gossypium raimondii
ref|XP_006435195.1|  hypothetical protein CICLE_v10000296mg             141   9e-37   Citrus clementina [clementine]
ref|XP_011045067.1|  PREDICTED: endoplasmin homolog                     141   9e-37   Populus euphratica
gb|KJB63502.1|  hypothetical protein B456_010G0030001                   140   9e-37   Gossypium raimondii
ref|XP_009791520.1|  PREDICTED: endoplasmin homolog                     140   1e-36   Nicotiana sylvestris
gb|EYU36792.1|  hypothetical protein MIMGU_mgv1a001447mg                140   1e-36   Erythranthe guttata [common monkey flower]
gb|KHG17445.1|  Endoplasmin                                             140   1e-36   Gossypium arboreum [tree cotton]
gb|KJB63501.1|  hypothetical protein B456_010G0030001                   140   1e-36   Gossypium raimondii
ref|XP_011074690.1|  PREDICTED: endoplasmin homolog                     140   1e-36   Sesamum indicum [beniseed]
ref|XP_006601356.1|  PREDICTED: endoplasmin homolog isoform X2          140   1e-36   Glycine max [soybeans]
ref|XP_003550428.1|  PREDICTED: endoplasmin homolog isoform X1          140   1e-36   
ref|XP_011083591.1|  PREDICTED: endoplasmin homolog                     140   2e-36   
ref|XP_004152644.1|  PREDICTED: endoplasmin homolog                     140   2e-36   Cucumis sativus [cucumbers]
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                     140   2e-36   Cucumis melo [Oriental melon]
gb|AAX19870.1|  unknown                                                 134   2e-36   Doryanthes excelsa
gb|EPS69355.1|  hypothetical protein M569_05408                         139   3e-36   Genlisea aurea
ref|XP_009791518.1|  PREDICTED: endoplasmin homolog                     139   3e-36   Nicotiana sylvestris
gb|KJB63273.1|  hypothetical protein B456_010G0030002                   131   3e-36   Gossypium raimondii
dbj|BAL42332.1|  Heat shock protein 90                                  139   3e-36   Nicotiana tabacum [American tobacco]
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                     139   3e-36   Nicotiana tomentosiformis
ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                     139   4e-36   Fragaria vesca subsp. vesca
gb|AFW81541.1|  hypothetical protein ZEAMMB73_624427                    135   5e-36   
ref|XP_003545030.1|  PREDICTED: endoplasmin homolog isoform X1          139   5e-36   Glycine max [soybeans]
ref|XP_004238368.1|  PREDICTED: endoplasmin homolog                     139   5e-36   Solanum lycopersicum
ref|XP_006596543.1|  PREDICTED: endoplasmin homolog isoform X2          139   5e-36   Glycine max [soybeans]
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                     139   6e-36   Pyrus x bretschneideri [bai li]
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...    138   6e-36   
gb|AAN34791.1|  Grp94                                                   138   8e-36   Xerophyta viscosa
gb|AIZ68158.1|  heat shock protein 90                                   138   8e-36   Ornithogalum longebracteatum [sea-onion]
gb|KDP36908.1|  hypothetical protein JCGZ_08199                         138   1e-35   Jatropha curcas
ref|NP_001146348.1|  shepherd-like1                                     137   1e-35   
ref|XP_010691883.1|  PREDICTED: endoplasmin homolog                     137   2e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006851911.1|  hypothetical protein AMTR_s00041p00161550          137   2e-35   Amborella trichopoda
ref|XP_007160650.1|  hypothetical protein PHAVU_001G005200g             137   3e-35   Phaseolus vulgaris [French bean]
ref|XP_006342064.1|  PREDICTED: endoplasmin homolog                     136   4e-35   Solanum tuberosum [potatoes]
ref|XP_010941296.1|  PREDICTED: endoplasmin homolog                     136   5e-35   Elaeis guineensis
ref|XP_008808636.1|  PREDICTED: endoplasmin homolog                     136   5e-35   Phoenix dactylifera
ref|XP_008656190.1|  PREDICTED: endoplasmin homolog                     125   7e-35   Zea mays [maize]
gb|KHN44921.1|  Endoplasmin like                                        130   7e-35   Glycine soja [wild soybean]
ref|XP_010266798.1|  PREDICTED: endoplasmin homolog                     135   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_009409971.1|  PREDICTED: endoplasmin homolog                     135   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002510550.1|  endoplasmin, putative                              135   1e-34   Ricinus communis
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343             135   2e-34   Selaginella moellendorffii
ref|XP_009393849.1|  PREDICTED: endoplasmin homolog                     134   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847             135   2e-34   Selaginella moellendorffii
ref|XP_010935079.1|  PREDICTED: endoplasmin homolog                     134   2e-34   Elaeis guineensis
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg             134   2e-34   Prunus persica
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                     134   2e-34   
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                     134   2e-34   Phoenix dactylifera
gb|KHG15193.1|  Endoplasmin                                             133   4e-34   Gossypium arboreum [tree cotton]
gb|ABV21762.1|  GRP94                                                   133   4e-34   Pinus taeda
ref|XP_006588134.1|  PREDICTED: endoplasmin homolog                     124   4e-34   Glycine max [soybeans]
ref|XP_010069812.1|  PREDICTED: endoplasmin homolog                     133   6e-34   Eucalyptus grandis [rose gum]
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                     133   6e-34   Prunus mume [ume]
ref|XP_001770511.1|  predicted protein                                  132   1e-33   
ref|XP_006657349.1|  PREDICTED: endoplasmin homolog                     130   1e-32   
ref|XP_001701885.1|  heat shock protein 90B                             128   4e-32   Chlamydomonas reinhardtii
ref|XP_007512535.1|  predicted protein                                  125   5e-31   Bathycoccus prasinos
ref|XP_003083767.1|  heat shock protein 90 (ISS)                        124   5e-31   
ref|XP_003063917.1|  predicted protein                                  124   7e-31   Micromonas pusilla CCMP1545
ref|XP_002508627.1|  predicted protein                                  123   1e-30   Micromonas commoda
ref|XP_001421809.1|  Heat Shock Protein 90, endoplasmic reticulum       122   3e-30   Ostreococcus lucimarinus CCE9901
ref|XP_002949693.1|  hypothetical protein VOLCADRAFT_80696              122   3e-30   Volvox carteri f. nagariensis
ref|XP_001753222.1|  predicted protein                                  117   2e-28   
emb|CEG00480.1|  Histidine kinase-like ATPase, ATP-binding domain       115   9e-28   Ostreococcus tauri
ref|XP_005823214.1|  hypothetical protein GUITHDRAFT_160160             115   2e-27   Guillardia theta CCMP2712
sp|Q9NKX1.2|ENPL_DICDI  RecName: Full=Endoplasmin homolog; AltNam...    112   1e-26   Dictyostelium discoideum
ref|XP_641313.1|  heat shock protein Hsp90 family protein               112   1e-26   Dictyostelium discoideum AX4
dbj|BAA94290.2|  glucose-regulated protein 94                           112   1e-26   Dictyostelium discoideum
gb|AHF81419.1|  heat shock protein 90-1                                 112   1e-26   Pyropia haitanensis
ref|XP_003288550.1|  hypothetical protein DICPUDRAFT_98061              112   2e-26   Dictyostelium purpureum
ref|XP_005651682.1|  heat shock protein Hsp90                           110   4e-26   Coccomyxa subellipsoidea C-169
ref|XP_005782556.1|  hypothetical protein EMIHUDRAFT_449776             110   5e-26   Emiliania huxleyi CCMP1516
ref|XP_008671461.1|  PREDICTED: endoplasmin homolog                     103   7e-26   Zea mays [maize]
ref|XP_005715704.1|  unnamed protein product                            109   2e-25   Chondrus crispus [carageen]
emb|CBN74418.1|  Heat shock protein 90                                  108   2e-25   Ectocarpus siliculosus
dbj|GAM27457.1|  hypothetical protein SAMD00019534_106330               108   3e-25   Acytostelium subglobosum LB1
gb|EFA78289.1|  heat shock protein Hsp90 family protein                 108   3e-25   Heterostelium album PN500
ref|XP_002117847.1|  hypothetical protein TRIADDRAFT_64388              107   4e-25   Trichoplax adhaerens
ref|XP_004358722.1|  heat shock protein Hsp90 family protein            108   5e-25   Cavenderia fasciculata
gb|ADR79285.1|  Hsp90 beta                                              107   5e-25   Brachionus ibericus
ref|XP_011402246.1|  Endoplasmin-like protein                           108   6e-25   Auxenochlorella protothecoides
gb|KDO21013.1|  hypothetical protein SPRG_13941                         106   1e-24   Saprolegnia parasitica CBS 223.65
ref|XP_008661247.1|  PREDICTED: uncharacterized protein LOC103640446    107   2e-24   
ref|XP_008620345.1|  heat shock protein 90kDa beta                      106   2e-24   Saprolegnia diclina VS20
pdb|3PEH|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    102   2e-24   Plasmodium falciparum 3D7
ref|XP_004994487.1|  heat shock protein gp96                            105   3e-24   Salpingoeca rosetta
gb|EPS65742.1|  heat shock protein 90                                   101   4e-24   Genlisea aurea
gb|EPS70213.1|  hypothetical protein M569_04546                         102   1e-23   Genlisea aurea
ref|XP_011048941.1|  PREDICTED: heat shock protein 83 isoform X3        103   3e-23   Populus euphratica
ref|XP_011048939.1|  PREDICTED: heat shock protein 83 isoform X2        103   3e-23   Populus euphratica
ref|XP_011048938.1|  PREDICTED: heat shock protein 83 isoform X1        103   3e-23   Populus euphratica
ref|XP_011085393.1|  PREDICTED: heat shock protein 83                   102   3e-23   Sesamum indicum [beniseed]
ref|XP_009776793.1|  PREDICTED: heat shock protein 90-1-like            102   3e-23   Nicotiana sylvestris
ref|XP_009627181.1|  PREDICTED: heat shock protein 90-1-like            102   4e-23   Nicotiana tomentosiformis
ref|XP_002262292.1|  endoplasmin homolog                                102   4e-23   Plasmodium knowlesi strain H
ref|XP_002290725.1|  heat shock protein Hsp90                           102   4e-23   Thalassiosira pseudonana CCMP1335
emb|CDO65499.1|  endoplasmin, putative                                  102   5e-23   Plasmodium reichenowi
gb|EWC75399.1|  hypothetical protein C923_03940                         102   5e-23   Plasmodium falciparum UGT5.1
ref|XP_001350620.1|  endoplasmin homolog precursor, putative            102   5e-23   Plasmodium falciparum 3D7
ref|XP_002157524.1|  PREDICTED: endoplasmin-like                        102   6e-23   Hydra vulgaris
ref|XP_010927990.1|  PREDICTED: heat shock protein 83-like isofor...    101   6e-23   
gb|EYU43186.1|  hypothetical protein MIMGU_mgv1a001565mg                102   6e-23   Erythranthe guttata [common monkey flower]
ref|XP_002535115.1|  heat shock protein, putative                     97.8    7e-23   Ricinus communis
ref|XP_003401925.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin-...    102   7e-23   Bombus terrestris [large earth bumblebee]
ref|XP_010927989.1|  PREDICTED: heat shock protein 83-like isofor...    101   8e-23   Elaeis guineensis
ref|XP_008814600.1|  heat shock protein 90kDa beta                      101   8e-23   Plasmodium inui San Antonio 1
ref|XP_004224999.1|  endoplasmin precursor                              101   8e-23   Plasmodium cynomolgi strain B
ref|XP_003578283.1|  PREDICTED: heat shock cognate 90 kDa protein...    101   8e-23   Brachypodium distachyon [annual false brome]
ref|XP_001617311.1|  endoplasmin precursor                              101   9e-23   Plasmodium vivax
ref|XP_003701264.1|  PREDICTED: endoplasmin-like                        101   9e-23   Megachile rotundata
gb|KEH17540.1|  heat shock protein 81-2                                 101   9e-23   Medicago truncatula
ref|XP_004293459.1|  PREDICTED: heat shock protein 90-1                 101   1e-22   Fragaria vesca subsp. vesca
emb|CAA82945.1|  heat-shock protein                                     101   1e-22   Secale cereale
ref|XP_006664594.1|  PREDICTED: heat shock protein 83-like              101   1e-22   
gb|AHG52035.1|  90 kDa heat shock protein                             95.5    1e-22   Cryptosporidium andersoni
gb|ACG47228.1|  heat shock protein 83                                   100   1e-22   Zea mays [maize]
ref|XP_009627613.1|  PREDICTED: heat shock protein 81-1-like            101   1e-22   Nicotiana tomentosiformis
ref|XP_008788962.1|  PREDICTED: heat shock protein 83-like              101   1e-22   Phoenix dactylifera
ref|XP_010045864.1|  PREDICTED: heat shock protein 83                   100   1e-22   Eucalyptus grandis [rose gum]
ref|XP_008464175.1|  PREDICTED: heat shock protein 81-1                 100   1e-22   Cucumis melo [Oriental melon]
gb|KCW88689.1|  hypothetical protein EUGRSUZ_A01044                     100   2e-22   Eucalyptus grandis [rose gum]
ref|XP_006619420.1|  PREDICTED: endoplasmin-like                        100   2e-22   Apis dorsata [rock honeybee]
ref|XP_003493872.1|  PREDICTED: endoplasmin-like                        100   2e-22   Bombus impatiens
ref|XP_010091648.1|  Endoplasmin-like protein                           100   2e-22   
ref|XP_003694125.1|  PREDICTED: endoplasmin-like                        100   2e-22   Apis florea [dwarf honeybee]
ref|XP_009519039.1|  hypothetical protein PHYSODRAFT_255139             100   2e-22   Phytophthora sojae
ref|XP_009355621.1|  PREDICTED: heat shock protein 83                   100   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_009019107.1|  hypothetical protein HELRODRAFT_157169             100   2e-22   Helobdella robusta
ref|XP_003575983.1|  PREDICTED: heat shock protein 83                   100   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_002443262.1|  hypothetical protein SORBIDRAFT_08g016560          100   2e-22   
gb|ACN33229.1|  unknown                                                 100   2e-22   Zea mays [maize]
emb|CDO69548.1|  hypothetical protein BN946_scf184785.g53               100   2e-22   Trametes cinnabarina
ref|XP_008674382.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    100   2e-22   
ref|XP_008807013.1|  PREDICTED: heat shock protein 83-like              100   3e-22   Phoenix dactylifera
dbj|BAK01596.1|  predicted protein                                      100   3e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB30529.1|  hypothetical protein B456_005G148100                    100   3e-22   Gossypium raimondii
ref|XP_010943343.1|  PREDICTED: heat shock protein 83-like              100   3e-22   Elaeis guineensis
ref|XP_004169550.1|  PREDICTED: endoplasmin homolog                     100   3e-22   
ref|XP_004140007.1|  PREDICTED: endoplasmin homolog                     100   3e-22   Cucumis sativus [cucumbers]
gb|EMT31740.1|  Heat shock protein 83                                   100   3e-22   
emb|CDR16821.1|  endoplasmin, putative                                  100   3e-22   
ref|XP_011101956.1|  PREDICTED: heat shock protein 90-1-like            100   3e-22   Sesamum indicum [beniseed]
ref|XP_003617952.1|  Heat-shock protein                                 100   3e-22   
ref|XP_003617951.1|  Heat-shock protein                                 100   3e-22   Medicago truncatula
gb|EUD74449.1|  heat shock protein 90kDa beta                           100   3e-22   Plasmodium vinckei petteri
gb|ADY39524.1|  putative heat shock protein gp-96                     94.7    3e-22   Hottentotta judaicus
gb|KJB30528.1|  hypothetical protein B456_005G148100                    100   3e-22   Gossypium raimondii
ref|XP_002321183.2|  hypothetical protein POPTR_0014s16280g           99.8    3e-22   
dbj|BAK00031.1|  predicted protein                                      100   3e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS50921.1|  Endoplasmin                                           99.8    3e-22   Triticum urartu
gb|AGZ62517.1|  90 kDa heat shock protein                             94.4    3e-22   Cryptosporidium muris
gb|KJB30531.1|  hypothetical protein B456_005G148100                    100   3e-22   Gossypium raimondii
gb|KHG10495.1|  Heat shock cognate 90 kDa                             99.8    3e-22   Gossypium arboreum [tree cotton]
gb|AAW25122.1|  SJCHGC06677 protein                                   99.8    3e-22   Schistosoma japonicum
ref|XP_008342195.1|  PREDICTED: heat shock protein 90-1-like          99.8    3e-22   Malus domestica [apple tree]
ref|XP_725468.1|  heat shock protein 90                               99.8    4e-22   Plasmodium yoelii
emb|CDS52035.1|  endoplasmin, putative                                99.8    4e-22   
ref|XP_001746031.1|  hypothetical protein                             99.8    4e-22   Monosiga brevicollis MX1
gb|KJB30530.1|  hypothetical protein B456_005G148100                  99.8    4e-22   Gossypium raimondii
ref|XP_676606.1|  endoplasmin precursor                               99.8    4e-22   
dbj|BAF63637.1|  glucose-regulated protein 94                         99.8    4e-22   Crassostrea gigas
ref|XP_002999135.1|  heat shock protein 90, putative                  99.8    4e-22   Phytophthora infestans T30-4
gb|ETI49777.1|  hypothetical protein, variant                         99.8    5e-22   Phytophthora parasitica P1569
gb|ETP47332.1|  hypothetical protein F442_06594                       99.8    5e-22   Phytophthora parasitica P10297
gb|ADQ86001.1|  90 kDa heat shock protein                             94.0    5e-22   Cryptosporidium muris
gb|ETK89541.1|  hypothetical protein, variant                         99.8    5e-22   Phytophthora parasitica
gb|ETP47333.1|  hypothetical protein, variant                         99.8    5e-22   Phytophthora parasitica P10297
ref|XP_008892102.1|  hypothetical protein PPTG_02652                  99.8    5e-22   Phytophthora parasitica INRA-310
gb|ETI49776.1|  hypothetical protein F443_06550                       99.8    5e-22   Phytophthora parasitica P1569
ref|XP_008892103.1|  hypothetical protein, variant                    99.4    5e-22   Phytophthora parasitica INRA-310
gb|ETK89540.1|  hypothetical protein L915_06419                       99.4    5e-22   Phytophthora parasitica
gb|KIO13608.1|  hypothetical protein M404DRAFT_12522                  99.4    5e-22   Pisolithus tinctorius Marx 270
ref|XP_008648551.1|  PREDICTED: heat shock protein 83-like isofor...  99.4    5e-22   
gb|ADQ85999.1|  90 kDa heat shock protein                             94.0    5e-22   Cryptosporidium muris
ref|XP_002531697.1|  heat shock protein, putative                     99.4    5e-22   Ricinus communis
ref|XP_009394558.1|  PREDICTED: heat shock protein 83-like            99.4    5e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|EKC38233.1|  Endoplasmin                                           99.8    5e-22   Crassostrea gigas
gb|ABA06415.1|  83 kDa heat shock protein                             95.1    5e-22   Leishmania chagasi
ref|XP_008648550.1|  PREDICTED: heat shock protein 83-like isofor...  99.4    6e-22   
ref|XP_002267463.2|  PREDICTED: heat shock protein 90-1               99.4    6e-22   Vitis vinifera
emb|CBI27411.3|  unnamed protein product                              99.0    6e-22   Vitis vinifera
gb|KFK33530.1|  hypothetical protein AALP_AA5G025000                  99.0    6e-22   Arabis alpina [alpine rockcress]
gb|EMS64316.1|  Heat shock protein 83                                 99.0    6e-22   Triticum urartu
ref|XP_004514756.1|  PREDICTED: endoplasmin homolog                   99.0    7e-22   Cicer arietinum [garbanzo]
ref|XP_004349108.2|  glucose-regulated protein 94                     99.0    7e-22   Capsaspora owczarzaki ATCC 30864
emb|CAN62743.1|  hypothetical protein VITISV_033107                   99.4    7e-22   Vitis vinifera
gb|KIK30952.1|  hypothetical protein PISMIDRAFT_25985                 98.6    8e-22   Pisolithus microcarpus 441
pdb|3H80|A  Chain A, Crystal Structure Of The Amino-Terminal Doma...  95.1    8e-22   Leishmania major strain Friedlin
gb|KIP09595.1|  hypothetical protein PHLGIDRAFT_126182                98.6    8e-22   Phlebiopsis gigantea 11061_1 CR5-6
gb|KDP29908.1|  hypothetical protein JCGZ_18477                       99.0    8e-22   Jatropha curcas
ref|XP_010257890.1|  PREDICTED: heat shock protein 81-1-like          99.0    8e-22   Nelumbo nucifera [Indian lotus]
gb|EEE68898.1|  hypothetical protein OsJ_27736                        98.6    8e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009605137.1|  PREDICTED: heat shock protein 83                 98.6    9e-22   Nicotiana tomentosiformis
ref|XP_008379983.1|  PREDICTED: heat shock protein 90-1-like          99.0    9e-22   
ref|NP_001062103.1|  Os08g0487800                                     98.6    9e-22   
ref|XP_002444835.1|  hypothetical protein SORBIDRAFT_07g028940        98.6    9e-22   Sorghum bicolor [broomcorn]
ref|XP_395614.3|  PREDICTED: endoplasmin-like isoform 1               98.6    9e-22   Apis mellifera [bee]
ref|XP_008622859.1|  heat shock protein 90kDa beta                    98.6    9e-22   Plasmodium vinckei vinckei
ref|XP_008243784.1|  PREDICTED: heat shock protein 90-1               98.6    9e-22   
ref|XP_002185158.1|  predicted protein                                98.6    9e-22   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_010502419.1|  PREDICTED: heat shock protein 83-like            98.6    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_005100278.1|  PREDICTED: mesocentin-like                       99.4    1e-21   
ref|NP_849932.1|  chloroplast heat shock protein 90                   98.6    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004297188.1|  PREDICTED: heat shock protein 83                 98.6    1e-21   Fragaria vesca subsp. vesca
ref|XP_006395659.1|  hypothetical protein EUTSA_v10003676mg           98.6    1e-21   Eutrema salsugineum [saltwater cress]
dbj|BAF01546.1|  heat shock like protein                              95.5    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009418533.1|  PREDICTED: heat shock protein 83-like            98.6    1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007225664.1|  hypothetical protein PRUPE_ppa001590mg           98.6    1e-21   Prunus persica
ref|XP_010464416.1|  PREDICTED: heat shock protein 90-1-like          98.6    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_008880478.1|  hypothetical protein H310_14401                  98.6    1e-21   Aphanomyces invadans
ref|XP_007142495.1|  hypothetical protein PHAVU_008G285400g           98.6    1e-21   
ref|XP_010514161.1|  PREDICTED: heat shock protein 83-like isofor...  98.6    1e-21   
ref|NP_178487.1|  chloroplast heat shock protein 90                   98.6    1e-21   
gb|KHN46925.1|  Heat shock protein 90                                 98.6    1e-21   
ref|XP_003545075.2|  PREDICTED: heat shock protein 83-like            98.6    1e-21   
emb|CAA72515.1|  heat shock protein                                   98.6    1e-21   
ref|XP_002875241.1|  hypothetical protein ARALYDRAFT_484305           98.6    1e-21   
gb|AAM19795.1|  At2g04030/F3C11.14                                    98.6    1e-21   
ref|XP_010514162.1|  PREDICTED: heat shock protein 83-like isofor...  98.6    1e-21   
ref|XP_008229890.1|  PREDICTED: heat shock protein 90-1               98.6    1e-21   
ref|XP_007214966.1|  hypothetical protein PRUPE_ppa001503mg           98.6    1e-21   
ref|XP_006437833.1|  hypothetical protein CICLE_v10030743mg           98.6    1e-21   
ref|XP_010425190.1|  PREDICTED: heat shock protein 83-like            98.6    1e-21   
ref|XP_006484274.1|  PREDICTED: heat shock protein 83-like            98.6    1e-21   
ref|XP_010457327.1|  PREDICTED: heat shock protein 90-1-like          98.6    1e-21   
ref|XP_004243554.1|  PREDICTED: heat shock protein 83                 98.6    1e-21   
tpg|DAA34121.1|  TPA: endoplasmic reticulum glucose-regulated pro...  94.4    1e-21   
gb|EEC69377.1|  hypothetical protein OsI_38512                        98.6    1e-21   
ref|NP_001066882.1|  Os12g0514500                                     98.6    1e-21   
ref|XP_008559868.1|  PREDICTED: endoplasmin                           98.2    1e-21   
ref|XP_002390612.1|  hypothetical protein MPER_10079                  94.7    1e-21   
ref|XP_009114127.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...  98.2    1e-21   
gb|KDO70251.1|  hypothetical protein CISIN_1g0038271mg                95.9    1e-21   
gb|KJB10746.1|  hypothetical protein B456_001G220600                  98.2    1e-21   
gb|KJB10745.1|  hypothetical protein B456_001G220600                  98.2    1e-21   
gb|KDP31417.1|  hypothetical protein JCGZ_11793                       98.2    1e-21   
gb|AGX25162.1|  heat shock protein                                    95.1    1e-21   
ref|XP_011330408.1|  PREDICTED: endoplasmin                           98.2    1e-21   
ref|XP_001599282.1|  PREDICTED: endoplasmin                           98.2    1e-21   
gb|KJB10747.1|  hypothetical protein B456_001G220600                  97.8    1e-21   
ref|XP_010486347.1|  PREDICTED: heat shock protein 90-1-like          98.2    1e-21   
emb|CDY33122.1|  BnaC09g22180D                                        98.2    1e-21   
ref|XP_003516650.1|  PREDICTED: heat shock protein 90-1-like          98.2    2e-21   
gb|EEE53305.1|  hypothetical protein OsJ_36277                        98.2    2e-21   
emb|CBK24402.2|  unnamed protein product                              98.2    2e-21   
ref|XP_010252714.1|  PREDICTED: heat shock protein 90-1-like          98.2    2e-21   
ref|XP_002413149.1|  tumor rejection antigen (gp96), putative         98.2    2e-21   
emb|CDX83528.1|  BnaC07g22680D                                        98.2    2e-21   
ref|XP_007045727.1|  Chaperone protein htpG family protein isoform 2  97.8    2e-21   
ref|XP_011009282.1|  PREDICTED: heat shock protein 90-1-like          98.2    2e-21   
ref|XP_009152136.1|  PREDICTED: heat shock protein 90-1-like          97.8    2e-21   
ref|XP_004239010.1|  PREDICTED: heat shock protein 81-1               97.8    2e-21   
emb|CBK20696.2|  unnamed protein product                              98.2    2e-21   
gb|KIJ44391.1|  hypothetical protein M422DRAFT_228502                 97.8    2e-21   
gb|KIM62086.1|  hypothetical protein SCLCIDRAFT_120509                97.8    2e-21   
ref|XP_002315997.1|  heat shock family protein                        97.8    2e-21   
ref|XP_008800616.1|  PREDICTED: heat shock protein 83                 97.8    2e-21   
gb|KHG08899.1|  Heat shock 83                                         97.8    2e-21   
ref|XP_007045726.1|  Chaperone protein htpG family protein isoform 1  97.8    2e-21   
ref|XP_006660235.1|  PREDICTED: endoplasmin homolog                   97.8    2e-21   
gb|KDO70248.1|  hypothetical protein CISIN_1g0038271mg                95.9    2e-21   
ref|XP_005643869.1|  heat shock protein Hsp90                         97.8    2e-21   
ref|XP_009124159.1|  PREDICTED: heat shock protein 90-1-like isof...  97.8    2e-21   
ref|XP_009124162.1|  PREDICTED: heat shock protein 90-1-like isof...  97.8    2e-21   
emb|CDY22132.1|  BnaC01g39690D                                        97.8    2e-21   
gb|ELU00023.1|  hypothetical protein CAPTEDRAFT_159587                97.8    2e-21   
gb|ACX42226.1|  heat shock protein 90                                 97.8    2e-21   
ref|XP_009798975.1|  PREDICTED: heat shock protein 83                 97.8    2e-21   
emb|CCM02389.1|  predicted protein                                    97.4    2e-21   
ref|XP_008651357.1|  PREDICTED: hypothetical protein isoform X1       97.8    2e-21   
ref|XP_003518802.1|  PREDICTED: heat shock protein 83-like            97.8    2e-21   
ref|XP_007385736.1|  HSP90-domain-containing protein                  97.4    2e-21   
ref|XP_008466112.1|  PREDICTED: heat shock protein 83                 97.8    2e-21   
ref|XP_006299404.1|  hypothetical protein CARUB_v10015564mg           97.8    2e-21   
ref|XP_009035651.1|  hypothetical protein AURANDRAFT_37153            97.4    2e-21   
ref|XP_004957103.1|  PREDICTED: endoplasmin homolog                   97.4    2e-21   
ref|XP_006844092.1|  hypothetical protein AMTR_s00006p00252810        97.4    2e-21   
gb|KHN29931.1|  Heat shock protein 83                                 97.4    2e-21   
ref|XP_010665948.1|  PREDICTED: heat shock protein 83                 97.4    2e-21   
ref|NP_001146412.1|  hypothetical protein                             95.9    2e-21   
gb|KDO58427.1|  hypothetical protein CISIN_1g003713mg                 97.4    2e-21   
ref|XP_010554255.1|  PREDICTED: heat shock protein 90-1               97.4    2e-21   
gb|EEE69897.1|  hypothetical protein OsJ_29732                        97.8    2e-21   
ref|XP_010684690.1|  PREDICTED: heat shock protein 83-like            97.4    2e-21   
gb|EYU28898.1|  hypothetical protein MIMGU_mgv1a001578mg              97.4    2e-21   
gb|KDR81842.1|  hypothetical protein GALMADRAFT_58852                 97.1    3e-21   
ref|XP_011260972.1|  PREDICTED: endoplasmin                           97.4    3e-21   
gb|EPY43731.1|  hypothetical protein AGDE_00190                       94.4    3e-21   
ref|XP_006292451.1|  hypothetical protein CARUB_v10018672mg           97.4    3e-21   
ref|XP_007863437.1|  HSP90-domain-containing protein                  97.1    3e-21   
ref|XP_006447753.1|  hypothetical protein CICLE_v10014316mg           97.4    3e-21   
gb|KIL68560.1|  hypothetical protein M378DRAFT_184990                 97.1    3e-21   
ref|XP_003519663.1|  PREDICTED: heat shock protein 83-like            97.1    3e-21   
gb|KHN43948.1|  Heat shock protein 90                                 97.1    3e-21   
ref|XP_009365237.1|  PREDICTED: heat shock protein 81-1               97.4    3e-21   
gb|KFB42185.1|  AGAP001424-PA-like protein                            97.1    3e-21   
gb|EJY77997.1|  Heat shock protein 92                                 97.1    3e-21   
ref|XP_006348634.1|  PREDICTED: endoplasmin homolog                   97.1    3e-21   
ref|XP_011444480.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  97.8    3e-21   
gb|KDO58428.1|  hypothetical protein CISIN_1g003713mg                 97.1    4e-21   
ref|XP_006849050.1|  hypothetical protein AMTR_s00028p00187760        97.1    4e-21   
ref|XP_011021135.1|  PREDICTED: heat shock protein 83-like            97.1    4e-21   
ref|XP_002311417.1|  heat shock family protein                        97.1    4e-21   
ref|XP_010112788.1|  Heat shock protein 90                            97.1    4e-21   
gb|EPY39497.1|  molecular chaperone HtpG                              94.4    4e-21   
ref|XP_006363008.1|  PREDICTED: endoplasmin homolog                   97.1    4e-21   
ref|XP_002155110.2|  PREDICTED: heat shock protein HSP 90-alpha       91.7    4e-21   
gb|KIK94310.1|  hypothetical protein PAXRUDRAFT_143168                96.7    4e-21   
gb|AFD53629.1|  90 kDa heat shock protein                             91.3    4e-21   
gb|KIK49294.1|  hypothetical protein CY34DRAFT_70017                  96.7    4e-21   
gb|KIM27867.1|  hypothetical protein M408DRAFT_70506                  96.7    5e-21   
ref|XP_005703696.1|  molecular chaperone HtpG                         96.3    5e-21   
gb|KIY68611.1|  heat-shock protein 90                                 96.3    5e-21   
emb|CEI86384.1|  Putative Heat shock protein 90-1                     92.4    5e-21   
ref|XP_005535057.1|  heat shock protein of Hsp90 family               96.7    5e-21   
ref|XP_010261402.1|  PREDICTED: heat shock protein 83-like            96.7    5e-21   
emb|CDY66279.1|  BnaAnng22000D                                        94.7    5e-21   
ref|XP_007764667.1|  heat-shock protein 90                            96.3    5e-21   
gb|ABB55890.1|  heat shock protein 90                                 95.9    5e-21   
ref|XP_010044352.1|  PREDICTED: heat shock protein 90-1               96.7    5e-21   
ref|XP_007157601.1|  hypothetical protein PHAVU_002G083000g           96.7    5e-21   
ref|XP_001662951.1|  AAEL012827-PA                                    96.7    5e-21   
gb|AFI80882.1|  SR00034                                               96.7    5e-21   
ref|XP_001833710.1|  heat shock protein 90                            96.3    5e-21   
ref|XP_011061023.1|  PREDICTED: endoplasmin                           96.3    6e-21   
emb|CEF70962.1|  Glycoprotein 93                                      96.3    6e-21   
ref|XP_010905224.1|  PREDICTED: heat shock protein 83-like            96.3    6e-21   
gb|KFK38234.1|  hypothetical protein AALP_AA3G086500                  96.3    6e-21   
ref|XP_009065664.1|  hypothetical protein LOTGIDRAFT_197084           96.3    6e-21   
gb|AIZ68156.1|  heat shock protein 83-like protein                    96.3    6e-21   
gb|KIJ16896.1|  hypothetical protein PAXINDRAFT_162512                96.3    6e-21   
ref|XP_009767250.1|  PREDICTED: heat shock protein 81-1-like          96.3    6e-21   
ref|XP_004962890.1|  PREDICTED: heat shock protein 83-like isofor...  96.3    6e-21   
ref|XP_010943850.1|  PREDICTED: heat shock protein 83-like            96.3    6e-21   
ref|XP_004962889.1|  PREDICTED: heat shock protein 83-like isofor...  96.3    6e-21   
emb|CDP00492.1|  unnamed protein product                              96.3    7e-21   
gb|KDN45298.1|  putative heat shock protein 80                        95.9    7e-21   
ref|XP_010681164.1|  PREDICTED: heat shock protein 90-1 isoform X1    96.3    7e-21   
gb|KDQ33187.1|  hypothetical protein PLEOSDRAFT_1052040               95.9    7e-21   
ref|XP_010657448.1|  PREDICTED: heat shock protein 83 isoform X3      96.3    7e-21   
ref|XP_001844128.1|  endoplasmin                                      96.3    7e-21   
ref|XP_010270190.1|  PREDICTED: heat shock protein 81-1-like isof...  95.9    8e-21   
ref|XP_010657447.1|  PREDICTED: heat shock protein 83 isoform X1      96.3    8e-21   
ref|XP_002270014.3|  PREDICTED: heat shock protein 83 isoform X2      96.3    8e-21   
ref|XP_010681165.1|  PREDICTED: heat shock protein 90-1 isoform X2    95.9    8e-21   
gb|KDR24512.1|  Endoplasmin                                           95.9    8e-21   
ref|XP_001731152.1|  hypothetical protein MGL_1335                    95.9    8e-21   
ref|XP_011152996.1|  PREDICTED: endoplasmin                           95.9    8e-21   
gb|KII88630.1|  hypothetical protein PLICRDRAFT_54457                 95.9    8e-21   
gb|ABD51951.1|  82 kDa heat shock protein                             94.7    8e-21   
ref|XP_010270191.1|  PREDICTED: heat shock protein 81-1-like isof...  95.9    8e-21   
ref|WP_021889422.1|  chaperone protein HtpG                           95.5    8e-21   
ref|XP_008045254.1|  heat shock protein 90                            95.9    9e-21   
ref|XP_004149483.1|  PREDICTED: heat shock protein 83-like            95.9    9e-21   
gb|KGN49798.1|  hypothetical protein Csa_5G135340                     95.9    9e-21   
ref|XP_011311739.1|  PREDICTED: endoplasmin                           95.9    9e-21   
gb|KGL81577.1|  Endoplasmin                                           92.0    9e-21   
gb|ACS75351.1|  endoplasmin                                           95.9    9e-21   
emb|CEI94693.1|  hypothetical protein RMCBS344292_08898               95.5    1e-20   
ref|XP_011155603.1|  PREDICTED: endoplasmin                           95.9    1e-20   
gb|KIM49477.1|  hypothetical protein M413DRAFT_109153                 95.5    1e-20   
emb|CEJ03082.1|  hypothetical protein RMCBS344292_17072               95.5    1e-20   
ref|XP_010547210.1|  PREDICTED: heat shock protein 83-like isofor...  95.5    1e-20   
ref|XP_010547208.1|  PREDICTED: heat shock protein 90-1-like isof...  95.5    1e-20   
emb|CCU97592.1|  unnamed protein product                              95.5    1e-20   
gb|EMD38391.1|  hypothetical protein CERSUDRAFT_153213                95.5    1e-20   
ref|XP_971540.1|  PREDICTED: endoplasmin                              95.5    1e-20   
gb|KIY65668.1|  HSP90-domain-containing protein                       95.1    1e-20   
ref|XP_009381110.1|  PREDICTED: heat shock protein 83                 95.5    1e-20   
gb|EPY42272.1|  molecular chaperone HtpG                              94.0    1e-20   
ref|NP_001063456.1|  Os09g0474300                                     95.1    1e-20   
gb|KJB30532.1|  hypothetical protein B456_005G148100                  95.1    1e-20   
ref|WP_022373071.1|  chaperone protein HtpG                           95.1    1e-20   
ref|XP_002948054.1|  hypothetical protein VOLCADRAFT_79927            95.5    1e-20   
ref|XP_001637407.1|  predicted protein                                95.5    1e-20   
ref|XP_009843856.1|  hypothetical protein H257_16935                  95.5    1e-20   
ref|XP_009844916.1|  hypothetical protein H257_17728                  94.0    1e-20   
ref|WP_021969709.1|  chaperone protein HtpG                           95.1    1e-20   
gb|EGT36283.1|  hypothetical protein CAEBREN_28043                    95.1    1e-20   
ref|XP_001712605.1|  hsp90                                            95.1    1e-20   
emb|CBK22622.2|  unnamed protein product                              95.5    1e-20   
emb|CAG08708.1|  unnamed protein product                              95.1    1e-20   
ref|XP_321706.5|  AGAP001424-PA                                       95.1    1e-20   
ref|XP_005704163.1|  molecular chaperone HtpG                         95.1    1e-20   
sp|Q25293.2|HSP83_LEIIN  RecName: Full=Heat shock protein 83-1; S...  95.1    2e-20   
pir||S57415  Hsp83 protein - Leishmania donovani infantum             95.1    2e-20
gb|AIT39757.1|  heat shock protein 90kDa beta                         95.1    2e-20   
ref|XP_007399693.1|  hypothetical protein PHACADRAFT_127903           94.7    2e-20   
ref|XP_003863861.1|  heat shock protein 83-1                          94.7    2e-20   
ref|XP_003392730.1|  heat shock protein 83-1                          94.7    2e-20   
ref|XP_010219153.1|  PREDICTED: endoplasmin-like                      92.0    2e-20   
ref|XP_001685762.1|  heat shock protein 83-1                          94.7    2e-20   
ref|XP_001685759.1|  heat shock protein 83-1                          94.7    2e-20   
ref|WP_031492840.1|  heat shock protein 90                            94.7    2e-20   
pdb|2ESA|A  Chain A, Grp94 N-Terminal Domain Bound To Geldanamyci...  91.3    2e-20   
ref|XP_004973760.1|  PREDICTED: endoplasmin homolog                   95.1    2e-20   
ref|XP_008677634.1|  PREDICTED: uncharacterized protein LOC100383...  94.7    2e-20   
gb|AFW65129.1|  hypothetical protein ZEAMMB73_326674                  94.7    2e-20   
gb|AER60491.1|  heat shock protein gp96                               94.7    2e-20   
pdb|1U2O|A  Chain A, Crystal Structure Of The N-Domain Of Grp94 L...  91.3    2e-20   
emb|CEP16055.1|  hypothetical protein                                 94.7    2e-20   
emb|CDY04167.1|  BnaA09g19450D                                        94.7    2e-20   
ref|XP_628530.1|  heat shock protein 90 (Hsp90), signal peptide p...  94.7    2e-20   
ref|XP_006407799.1|  hypothetical protein EUTSA_v10020096mg           94.7    2e-20   
ref|XP_008339741.1|  PREDICTED: heat shock protein 83                 94.7    2e-20   
emb|CCI39642.1|  unnamed protein product                              94.7    2e-20   
ref|XP_008389364.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...  93.2    2e-20   
ref|WP_031353378.1|  heat shock protein 90                            89.7    2e-20   
emb|CCA68353.1|  related to HSP80 heat shock protein 80               94.4    2e-20   
gb|EIE75417.1|  hsp83-like protein                                    94.4    2e-20   
ref|XP_668238.1|  heat shock protein 90                               94.7    2e-20   
ref|XP_003967565.1|  PREDICTED: endoplasmin-like                      94.7    2e-20   
ref|XP_001899398.1|  Endoplasmin precursor                            94.7    2e-20   
emb|CCI39641.1|  unnamed protein product                              94.7    2e-20   
gb|AEY75228.1|  Hsp1                                                  92.0    2e-20   
ref|XP_007361188.1|  HSP90-domain-containing protein                  94.4    2e-20   
gb|ABU45371.1|  Hsp90B                                                94.7    2e-20   
dbj|BAC40172.1|  unnamed protein product                              91.7    2e-20   
ref|XP_003035169.1|  heat-shock protein 90                            94.4    3e-20   
gb|EJW87335.1|  glucose-regulated protein 94                          94.7    3e-20   
tpg|DAA61912.1|  TPA: hypothetical protein ZEAMMB73_416250            94.4    3e-20   
ref|XP_006039346.1|  PREDICTED: endoplasmin-like                      92.0    3e-20   
gb|EPB86046.1|  heat shock protein 90-1                               94.4    3e-20   
ref|XP_009147028.1|  PREDICTED: heat shock protein 90-1-like          94.7    3e-20   
ref|XP_002141043.1|  Hsp90 protein                                    94.7    3e-20   
emb|CEF96474.1|  Histidine kinase-like ATPase, ATP-binding domain     94.4    3e-20   
emb|CCA22450.1|  heat shock protein 90 putative                       94.4    3e-20   
gb|ESA16930.1|  hypothetical protein GLOINDRAFT_77045                 94.4    3e-20   
emb|CDY35962.1|  BnaA05g29880D                                        94.4    3e-20   
gb|KIP08934.1|  hypothetical protein PHLGIDRAFT_103566                94.4    3e-20   
gb|EXX59912.1|  Hsp90 family chaperone HSC82                          94.4    3e-20   



>ref|XP_008660989.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=209

 Score =   145 bits (366),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  51   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  110

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  111  KEKKILSIRDRGIGMTK  127



>tpg|DAA46734.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=377

 Score =   145 bits (366),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLY+NKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  200  VSRLMDIIINSLYNNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  259

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  260  KEKKILSIRDRGIGMTK  276



>ref|XP_008646956.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=215

 Score =   141 bits (355),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLY+ KDIFLRE ISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  114  VSRLMDIIINSLYNKKDIFLREPISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  173

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  174  KEKKILSIRDRGIGMTK  190



>dbj|BAD94659.1| HSP90-like protein [Arabidopsis thaliana]
Length=328

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>tpg|DAA46735.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=411

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLY+NKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  200  VSRLMDIIINSLYNNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  259

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  260  KEKKILSIRDRGIGMTK  276



>gb|KJB63271.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=264

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIKLD
Sbjct  83   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIKLD  142

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILS+RDRGIGMTK
Sbjct  143  KEKKILSLRDRGIGMTK  159



>gb|KJB63270.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=260

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIKLD
Sbjct  83   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIKLD  142

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILS+RDRGIGMTK
Sbjct  143  KEKKILSLRDRGIGMTK  159



>emb|CDP07384.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+ILGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEILGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>gb|AFW75766.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=710

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>gb|KJB63272.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=303

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIKLD
Sbjct  83   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIKLD  142

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILS+RDRGIGMTK
Sbjct  143  KEKKILSLRDRGIGMTK  159



>gb|AFK46854.1| unknown [Medicago truncatula]
Length=121

 Score =   134 bits (338),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/73 (96%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +3

Query  15   MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLDKDXK  194
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD AKLEIQIKLDK+ K
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDNAKLEIQIKLDKEKK  60

Query  195  ILSIRDRGIGMTK  233
            ILSIRDRGIGMTK
Sbjct  61   ILSIRDRGIGMTK  73



>ref|XP_008643502.1| PREDICTED: shepherd-like1 isoform X1 [Zea mays]
 gb|AFW69514.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=808

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>gb|AFW75767.1| endoplasmin [Zea mays]
Length=804

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_004966467.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=807

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|NP_001151475.1| endoplasmin precursor [Zea mays]
 gb|ACG42989.1| endoplasmin precursor [Zea mays]
Length=807

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>gb|AFW69515.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=1001

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  279  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  338

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  339  KEKKILSIRDRGIGMTK  355



>ref|XP_008666260.1| PREDICTED: endoplasmin homolog, partial [Zea mays]
Length=95

 Score =   133 bits (335),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/73 (93%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +3

Query  15   MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLDKDXK  194
            MDIIINSLY+NKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLDK+ K
Sbjct  1    MDIIINSLYNNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLDKEKK  60

Query  195  ILSIRDRGIGMTK  233
            ILSIRDRGIGMTK
Sbjct  61   ILSIRDRGIGMTK  73



>ref|XP_003589505.1| Endoplasmin-like protein [Medicago truncatula]
 gb|AES59756.1| heat shock protein 81-2 [Medicago truncatula]
Length=818

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD AKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDNAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_010109992.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXC25010.1| Endoplasmin-like protein [Morus notabilis]
Length=1004

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDA+DKIRFLSLTDK+ILGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDAIDKIRFLSLTDKEILGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]
Length=810

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  145  KEKKILSIRDRGIGMTK  161



>ref|NP_001058590.1| Os06g0716700 [Oryza sativa Japonica Group]
 dbj|BAF20504.1| Os06g0716700 [Oryza sativa Japonica Group]
Length=810

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  145  KEKKILSIRDRGIGMTK  161



>gb|AAL79732.1|AC091774_23 heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD53585.1| heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD61715.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|ADR66979.1| 90 kDa heat shock protein [Oryza sativa Japonica Group]
Length=812

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQIKLD
Sbjct  87   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQIKLD  146

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  147  KEKKILSIRDRGIGMTK  163



>ref|XP_010539097.1| PREDICTED: endoplasmin homolog [Tarenaya hassleriana]
Length=830

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKD+LGEGD AKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDVLGEGDNAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_006657350.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=810

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>gb|EAZ02369.1| hypothetical protein OsI_24473 [Oryza sativa Indica Group]
Length=837

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQIKLD
Sbjct  112  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQIKLD  171

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  172  KEKKILSIRDRGIGMTK  188



>gb|EAZ38293.1| hypothetical protein OsJ_22671 [Oryza sativa Japonica Group]
Length=838

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQIKLD
Sbjct  113  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQIKLD  172

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  173  KEKKILSIRDRGIGMTK  189



>ref|XP_009596271.1| PREDICTED: endoplasmin homolog, partial [Nicotiana tomentosiformis]
Length=644

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD AKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>sp|P35016.1|ENPL_CATRO RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Catharanthus roseus]
 gb|AAA16785.1| heat shock protein 90 [Catharanthus roseus]
Length=817

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK+ILGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEILGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_002439030.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
 gb|EER90397.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
Length=807

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDI+LRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIYLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|NP_974606.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 gb|AEE84862.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>ref|NP_194150.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 sp|Q9STX5.1|ENPL_ARATH RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; AltName: Full=HSP90-like 
protein 7; AltName: Full=Protein SHEPHERD; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45054.1| HSP90-like protein [Arabidopsis thaliana]
 emb|CAB79329.1| HSP90-like protein [Arabidopsis thaliana]
 gb|AAK63999.1| AT4g24190/T22A6_20 [Arabidopsis thaliana]
 dbj|BAB86369.1| SHEPHERD [Arabidopsis thaliana]
 gb|AAO42773.1| At4g24190/T22A6_20 [Arabidopsis thaliana]
 gb|AEE84861.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana]
Length=823

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>ref|XP_009137776.1| PREDICTED: endoplasmin homolog [Brassica rapa]
Length=822

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>emb|CDY34264.1| BnaA01g13670D [Brassica napus]
Length=822

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>ref|XP_010439073.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>gb|KFK29085.1| hypothetical protein AALP_AA7G086900 [Arabis alpina]
Length=823

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>emb|CDY24830.1| BnaA08g14800D [Brassica napus]
Length=819

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>ref|XP_010433803.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>ref|XP_006413464.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
 gb|ESQ54917.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
Length=822

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>ref|XP_010448597.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>ref|XP_007017830.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY15055.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
Length=712

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  75   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  134

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KIL++RDRGIGMTK
Sbjct  135  KEKKILTLRDRGIGMTK  151



>ref|XP_002273785.1| PREDICTED: endoplasmin homolog [Vitis vinifera]
 emb|CBI19885.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+ILGEGDTAKL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEILGEGDTAKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  146  KAKKILSIRDRGIGMTK  162



>gb|KDO84888.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=507

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_006283118.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
 gb|EOA16016.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
Length=823

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>sp|P36183.1|ENPL_HORVU RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA48143.1| GRP94 homologue [Hordeum vulgare]
 dbj|BAJ91793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK+++GEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVMGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRG+GMTK
Sbjct  146  KENKILSIRDRGVGMTK  162



>ref|XP_003563275.1| PREDICTED: endoplasmin homolog [Brachypodium distachyon]
Length=807

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL LTDK++LGEGDTAKLEIQIKLD
Sbjct  87   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLGLTDKEVLGEGDTAKLEIQIKLD  146

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRG+GMTK
Sbjct  147  KENKILSIRDRGVGMTK  163



>dbj|BAL42333.1| Heat shock protein 90 [Nicotiana tabacum]
Length=812

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD AKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_004499283.1| PREDICTED: endoplasmin homolog isoform X3 [Cicer arietinum]
Length=816

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD AKL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDNAKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_004499281.1| PREDICTED: endoplasmin homolog isoform X1 [Cicer arietinum]
 ref|XP_004499282.1| PREDICTED: endoplasmin homolog isoform X2 [Cicer arietinum]
Length=817

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD AKL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDNAKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>gb|KDO84887.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=584

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_007017829.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY15054.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=824

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  83   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  142

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KIL++RDRGIGMTK
Sbjct  143  KEKKILTLRDRGIGMTK  159



>emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
Length=1084

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+ILGEGDTAKL+IQIKLD
Sbjct  351  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEILGEGDTAKLDIQIKLD  410

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  411  KEKKILSIRDRGIGMTK  427



>gb|ABV82432.1| Hsp90-like protein [Dactylis glomerata]
Length=808

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LT+K++LGEGDTAKLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTEKEVLGEGDTAKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRG+GMTK
Sbjct  146  KENKILSIRDRGVGMTK  162



>emb|CDY10992.1| BnaA03g46510D [Brassica napus]
Length=871

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KI+SIRDRGIGMTK
Sbjct  145  KAKKIISIRDRGIGMTK  161



>ref|XP_007017828.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY15053.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=840

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLD
Sbjct  83   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLD  142

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KIL++RDRGIGMTK
Sbjct  143  KEKKILTLRDRGIGMTK  159



>gb|EMS56078.1| Endoplasmin-like protein [Triticum urartu]
Length=875

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK+++GEGDTAKLEIQIKLD
Sbjct  155  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVMGEGDTAKLEIQIKLD  214

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRG+GMTK
Sbjct  215  KENKILSIRDRGVGMTK  231



>gb|EYU38796.1| hypothetical protein MIMGU_mgv1a001101mg [Erythranthe guttata]
Length=889

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+ILGEGD AKLEIQIKLD
Sbjct  156  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEILGEGDDAKLEIQIKLD  215

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  216  KEKKILSIRDRGIGMTK  232



>emb|CDX92620.1| BnaC07g38780D [Brassica napus]
Length=792

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KIL IRDRGIGMTK
Sbjct  145  KAKKILCIRDRGIGMTK  161



>gb|EMT19498.1| Endoplasmin-like protein [Aegilops tauschii]
Length=1222

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK+ LGEGDTAKLEIQIKLD
Sbjct  96   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLTLTDKEALGEGDTAKLEIQIKLD  155

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRG+GMTK
Sbjct  156  KENKILSIRDRGVGMTK  172



>emb|CDY03477.1| BnaC01g16050D [Brassica napus]
Length=822

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGD AKLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDNAKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  145  KAKKILSIRDRGIGMTK  161



>gb|KJB14398.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=739

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KLEIQIKLD
Sbjct  83   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLEIQIKLD  142

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+LS+RDRGIGMTK
Sbjct  143  KEKKMLSLRDRGIGMTK  159



>ref|XP_010246858.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=821

 Score =   141 bits (356),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+ILGEGD  KLEIQIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEILGEGDNTKLEIQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  145  KEKKILSIRDRGIGMTK  161



>gb|KDO84884.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=818

 Score =   141 bits (355),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_006473673.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
Length=822

 Score =   141 bits (355),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_002307732.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
 gb|EEE94728.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
Length=823

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD AKL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNAKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>gb|KDO84886.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=762

 Score =   140 bits (354),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>gb|KJB14397.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=809

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KLEIQIKLD
Sbjct  83   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLEIQIKLD  142

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+LS+RDRGIGMTK
Sbjct  143  KEKKMLSLRDRGIGMTK  159



>ref|XP_006435195.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
 gb|ESR48435.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
Length=820

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_011045067.1| PREDICTED: endoplasmin homolog [Populus euphratica]
Length=823

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD AKL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNAKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>gb|KJB63502.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=781

 Score =   140 bits (354),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIKLD
Sbjct  60   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIKLD  119

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILS+RDRGIGMTK
Sbjct  120  KEKKILSLRDRGIGMTK  136



>ref|XP_009791520.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>gb|EYU36792.1| hypothetical protein MIMGU_mgv1a001447mg [Erythranthe guttata]
Length=818

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRG+GMTK
Sbjct  146  KENKILSIRDRGVGMTK  162



>gb|KHG17445.1| Endoplasmin [Gossypium arboreum]
Length=812

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KLEIQIKLD
Sbjct  83   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLEIQIKLD  142

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+LS+RDRGIGMTK
Sbjct  143  KEKKMLSLRDRGIGMTK  159



>gb|KJB63501.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=823

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIKLD
Sbjct  102  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIKLD  161

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILS+RDRGIGMTK
Sbjct  162  KEKKILSLRDRGIGMTK  178



>ref|XP_011074690.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=811

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD AKLE+QIKLD
Sbjct  85   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDDAKLEMQIKLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  145  KEKKILSIRDRGIGMTK  161



>ref|XP_006601356.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=813

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKD+LGEGD  KL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDVLGEGDNTKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_003550428.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN12637.1| Endoplasmin like [Glycine soja]
Length=814

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKD+LGEGD  KL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDVLGEGDNTKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_011083591.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=808

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_004152644.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 ref|XP_004162237.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN62687.1| hypothetical protein Csa_2G368880 [Cucumis sativus]
Length=817

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+ILGEGD +KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEILGEGDNSKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  146  KANKILSIRDRGIGMTK  162



>ref|XP_008444821.1| PREDICTED: endoplasmin homolog [Cucumis melo]
Length=817

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+ILGEGD +KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEILGEGDNSKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K  KILSIRDRGIGMTK
Sbjct  146  KANKILSIRDRGIGMTK  162



>gb|AAX19870.1| unknown, partial [Doryanthes excelsa]
Length=289

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK+ILGEGD  KLEI IKLD
Sbjct  87   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEILGEGDNTKLEILIKLD  146

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KIL+IRDRGIGMTK
Sbjct  147  KEKKILTIRDRGIGMTK  163



>gb|EPS69355.1| hypothetical protein M569_05408 [Genlisea aurea]
Length=815

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEG+ AKL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGENAKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            KD KILS+RDRGIGMTK
Sbjct  146  KDKKILSLRDRGIGMTK  162



>ref|XP_009791518.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEG+  KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGENTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>gb|KJB63273.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=178

 Score =   131 bits (329),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +3

Query  15   MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLDKDXK  194
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIKLDK+ K
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIKLDKEKK  60

Query  195  ILSIRDRGIGMTK  233
            ILS+RDRGIGMTK
Sbjct  61   ILSLRDRGIGMTK  73



>dbj|BAL42332.1| Heat shock protein 90 [Nicotiana tabacum]
Length=811

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEG+  KLEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGENTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_009606988.1| PREDICTED: endoplasmin homolog [Nicotiana tomentosiformis]
Length=812

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  +LEIQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTELEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_004291352.1| PREDICTED: endoplasmin homolog [Fragaria vesca subsp. vesca]
Length=815

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFLSLTDK+ILGEGD  KLEIQIKLD
Sbjct  84   VSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFLSLTDKEILGEGDNTKLEIQIKLD  143

Query  183  KDXKILSIRDRGIGMTK  233
            K+ +ILSIRDRGIGMTK
Sbjct  144  KEKRILSIRDRGIGMTK  160



>gb|AFW81541.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
 gb|AFW81542.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
Length=411

 Score =   135 bits (341),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLY+NKDIF RELISNASDALDKIRFLSLTDK++LGE DTAKLEIQIKLD
Sbjct  308  VSRLMDIIINSLYNNKDIFPRELISNASDALDKIRFLSLTDKEVLGERDTAKLEIQIKLD  367

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSI DRGIGMTK
Sbjct  368  KEKKILSIWDRGIGMTK  384



>ref|XP_003545030.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN39421.1| Endoplasmin like [Glycine soja]
Length=816

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_004238368.1| PREDICTED: endoplasmin homolog [Solanum lycopersicum]
Length=812

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDILINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRG+GMTK
Sbjct  146  KEKKILSIRDRGVGMTK  162



>ref|XP_006596543.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=815

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_009334927.1| PREDICTED: endoplasmin homolog [Pyrus x bretschneideri]
Length=818

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ +ILSIRDRGIGMTK
Sbjct  146  KEKRILSIRDRGIGMTK  162



>ref|XP_008387928.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin homolog [Malus domestica]
Length=818

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ +ILSIRDRGIGMTK
Sbjct  146  KEKRILSIRDRGIGMTK  162



>gb|AAN34791.1| Grp94 [Xerophyta viscosa]
Length=812

 Score =   138 bits (348),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KLEI IKLD
Sbjct  90   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLEIMIKLD  149

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  150  KEKKILSIRDRGIGMTK  166



>gb|AIZ68158.1| heat shock protein 90 [Ornithogalum saundersiae]
Length=814

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+ILGEGD  KLEI IKLD
Sbjct  87   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEILGEGDNTKLEIMIKLD  146

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+LSIRDRGIGMTK
Sbjct  147  KENKVLSIRDRGIGMTK  163



>gb|KDP36908.1| hypothetical protein JCGZ_08199 [Jatropha curcas]
Length=821

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGD  KL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDNTKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|NP_001146348.1| shepherd-like1 [Zea mays]
 gb|ACL53742.1| unknown [Zea mays]
Length=719

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/73 (95%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +3

Query  15   MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLDKDXK  194
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLDK+ K
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLDKEKK  60

Query  195  ILSIRDRGIGMTK  233
            ILSIRDRGIGMTK
Sbjct  61   ILSIRDRGIGMTK  73



>ref|XP_010691883.1| PREDICTED: endoplasmin homolog [Beta vulgaris subsp. vulgaris]
Length=810

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGD AKLEI IKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDNAKLEILIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_006851911.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
 gb|ERN13378.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
Length=818

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+ILGEGD  KLEI IKLD
Sbjct  88   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEILGEGDNTKLEILIKLD  147

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+LSIRDRGIGMTK
Sbjct  148  KEKKVLSIRDRGIGMTK  164



>ref|XP_007160650.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
 gb|ESW32644.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
Length=817

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KL+I+IKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLDIRIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  146  KEKKILSIRDRGIGMTK  162



>ref|XP_006342064.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=806

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGD  KLEIQIKLD
Sbjct  86   VSRLMDILINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDNTKLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KIL IRDRG+GMTK
Sbjct  146  KEKKILFIRDRGVGMTK  162



>ref|XP_010941296.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=838

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLT+K+ILGEGD  KLEI IKLD
Sbjct  109  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTNKEILGEGDNTKLEILIKLD  168

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  169  KEKKILSIRDRGIGMTK  185



>ref|XP_008808636.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=817

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLT+K+ILGEGD  KLEI IKLD
Sbjct  88   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTNKEILGEGDNTKLEILIKLD  147

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  148  KEKKILSIRDRGIGMTK  164



>ref|XP_008656190.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=100

 Score =   125 bits (314),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  15   MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLDKDXK  194
            MDIIINSLY+NKDIF RELISNASDALDKIRFLSLTDK++LGE DTAKLEIQIKLDK+ K
Sbjct  1    MDIIINSLYNNKDIFPRELISNASDALDKIRFLSLTDKEVLGERDTAKLEIQIKLDKEKK  60

Query  195  ILSIRDRGIGMTK  233
            ILSI DRGIGMTK
Sbjct  61   ILSIWDRGIGMTK  73



>gb|KHN44921.1| Endoplasmin like [Glycine soja]
Length=283

 Score =   130 bits (327),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VS LMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+++GEGD  KL+IQIKLD
Sbjct  143  VSWLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVVGEGDNTKLDIQIKLD  202

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K LSIR+RGIGMTK
Sbjct  203  KEKKSLSIRERGIGMTK  219



>ref|XP_010266798.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=822

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI++NSLYSNKDIFLRELISNASDALDKIRFLSLT+K+ILGEGD  KLEIQI LD
Sbjct  85   VSRLMDILVNSLYSNKDIFLRELISNASDALDKIRFLSLTNKEILGEGDNTKLEIQINLD  144

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+LSIRDRGIGMT+
Sbjct  145  KEKKVLSIRDRGIGMTR  161



>ref|XP_009409971.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=814

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGD  KL+I IKLD
Sbjct  88   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDNTKLDILIKLD  147

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  148  KEKKILSIRDRGIGMTK  164



>ref|XP_002510550.1| endoplasmin, putative [Ricinus communis]
 gb|EEF52737.1| endoplasmin, putative [Ricinus communis]
Length=816

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEG+  KL+IQIKLD
Sbjct  86   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGENTKLDIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRD+GIGMTK
Sbjct  146  KEKKILSIRDKGIGMTK  162



>ref|XP_002969701.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
 gb|EFJ28825.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
Length=867

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDII+NSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEGD +KLEI+IKLD
Sbjct  90   VSRLMDIIVNSLYSNKDIFLRELISNASDALDKIRFLSLTDKSQLGEGDESKLEIRIKLD  149

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+LSIRDRGIGMTK
Sbjct  150  KEKKLLSIRDRGIGMTK  166



>ref|XP_009393849.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=815

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGD  KL+I IKLD
Sbjct  88   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDDTKLDILIKLD  147

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  148  KEKKILSIRDRGIGMTK  164



>ref|XP_002981308.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
 gb|EFJ17496.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
Length=867

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDII+NSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEGD +KLEI+IKLD
Sbjct  90   VSRLMDIIVNSLYSNKDIFLRELISNASDALDKIRFLSLTDKSQLGEGDESKLEIRIKLD  149

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+LSIRDRGIGMTK
Sbjct  150  KEKKLLSIRDRGIGMTK  166



>ref|XP_010935079.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=822

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+DIIINSLYSNKDIFLRELISNASDALDKIRFLSLT+KDILGEGD  KLEI +KLD
Sbjct  88   VSRLLDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTNKDILGEGDNTKLEILMKLD  147

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  148  KEKKILSIRDRGIGMTK  164



>ref|XP_007225662.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
 gb|EMJ26861.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
Length=815

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGD   LEIQIKLD
Sbjct  86   VSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDDTNLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ +ILSIRDRGIGMTK
Sbjct  146  KEKRILSIRDRGIGMTK  162



>ref|XP_008377135.1| PREDICTED: endoplasmin homolog [Malus domestica]
Length=818

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGD   LEIQIKLD
Sbjct  86   VSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDDTNLEIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ +I+SIRDRGIGMTK
Sbjct  146  KEKRIISIRDRGIGMTK  162



>ref|XP_008788614.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=822

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+DIIINSLYSNKDIFLRELISNASDALDKIRFLSLT+K+ILGEGD  KLEI IKLD
Sbjct  88   VSRLLDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTNKEILGEGDNTKLEILIKLD  147

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  148  KEKKILSIRDRGIGMTK  164



>gb|KHG15193.1| Endoplasmin [Gossypium arboreum]
Length=718

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +3

Query  15   MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLDKDXK  194
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIKLDK+ K
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIKLDKEKK  60

Query  195  ILSIRDRGIGMTK  233
            ILS+RDRGIGMTK
Sbjct  61   ILSLRDRGIGMTK  73



>gb|ABV21762.1| GRP94 [Pinus taeda]
Length=834

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLYSNKDIFLRELISNASDALDKIRF++LTDK++LGEGD  +L+I+IKLD
Sbjct  88   VSRLMDILINSLYSNKDIFLRELISNASDALDKIRFMALTDKNVLGEGDNTRLDIKIKLD  147

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  148  KENKILSIRDRGIGMTK  164



>ref|XP_006588134.1| PREDICTED: endoplasmin homolog [Glycine max]
Length=137

 Score =   124 bits (311),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  15   MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLDKDXK  194
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+++GEGD  KL+IQIKLDK+ K
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVVGEGDNTKLDIQIKLDKEKK  60

Query  195  ILSIRDRGIGMTK  233
             LSIR+RGIGMTK
Sbjct  61   SLSIRERGIGMTK  73



>ref|XP_010069812.1| PREDICTED: endoplasmin homolog [Eucalyptus grandis]
 gb|KCW58281.1| hypothetical protein EUGRSUZ_H00972 [Eucalyptus grandis]
Length=822

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI++NSLYSNKDIFLRELISNASDALDKIRFL+LTDKDILGEGD  KLEIQ+K+D
Sbjct  86   VSRLMDILVNSLYSNKDIFLRELISNASDALDKIRFLALTDKDILGEGDDTKLEIQMKVD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ +I+++RDRGIGMTK
Sbjct  146  KEKRIVTLRDRGIGMTK  162



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGD   L+IQIKLD
Sbjct  86   VSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDDTNLQIQIKLD  145

Query  183  KDXKILSIRDRGIGMTK  233
            K+ +ILSIRDRGIGMTK
Sbjct  146  KEKRILSIRDRGIGMTK  162



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFLSLTD  +LGEGD AKL+I IKLD
Sbjct  96   VSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFLSLTDSSVLGEGDDAKLDIHIKLD  155

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+L+IRDRGIGMTK
Sbjct  156  KEKKVLTIRDRGIGMTK  172



>ref|XP_006657349.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=951

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            ++ L+DIIINS Y N DIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQIKLD
Sbjct  418  LTNLIDIIINSPYRNSDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQIKLD  477

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSIRDRGIGMTK
Sbjct  478  KEKKILSIRDRGIGMTK  494



>ref|XP_001701885.1| heat shock protein 90B [Chlamydomonas reinhardtii]
 gb|EDP06860.1| heat shock protein 90B, partial [Chlamydomonas reinhardtii]
Length=768

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMDIII+SLYSNKDIFLRELISNASDALDKIRFLSLTDK ILG+GDT+ LEI+I LD
Sbjct  54   VTRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFLSLTDKSILGDGDTSNLEIKIWLD  113

Query  183  KDXKILSIRDRGIGMTK  233
             + K+L IRDRGIGMTK
Sbjct  114  PESKVLYIRDRGIGMTK  130



>ref|XP_007512535.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17135.1| predicted protein [Bathycoccus prasinos]
Length=1223

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISN SDALDKIRFLSLTD   LG+GD A+L+I+IK+D
Sbjct  475  VSRLMDIIINSLYSNKDIFLRELISNGSDALDKIRFLSLTDASQLGDGDAAQLDIRIKID  534

Query  183  KDXKILSIRDRGIGMTK  233
            KD K++SIRD+G+GMTK
Sbjct  535  KDQKLISIRDKGVGMTK  551



>ref|XP_003083767.1| heat shock protein 90 (ISS) [Ostreococcus tauri]
Length=788

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISN SDALDKIRF+SLTDK+ LG G+ A L+I+IK D
Sbjct  61   VSRLMDIIINSLYSNKDIFLRELISNGSDALDKIRFMSLTDKEQLGSGENANLDIRIKAD  120

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+L+IRDRG+GMTK
Sbjct  121  KERKVLTIRDRGVGMTK  137



>ref|XP_003063917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=820

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRFL+LTD+ +LG GD A LEI+IK+D
Sbjct  56   VSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFLALTDESLLGVGDDANLEIRIKVD  115

Query  183  KDXKILSIRDRGIGMTK  233
             D KIL+IRDRG+GMTK
Sbjct  116  HDKKILTIRDRGVGMTK  132



>ref|XP_002508627.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69885.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRFLSLTD+ +LG GD A L+I+IK+D
Sbjct  48   VSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFLSLTDESVLGAGDDANLDIRIKVD  107

Query  183  KDXKILSIRDRGIGMTK  233
            K+  +LSIRDRG+GMTK
Sbjct  108  KENGVLSIRDRGVGMTK  124



>ref|XP_001421809.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00103.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
Length=794

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRF+SLTDK+ LG G+ A L+I+IK D
Sbjct  63   VSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFMSLTDKEQLGGGENADLDIRIKAD  122

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+L+IRDRGIGMTK
Sbjct  123  KERKVLTIRDRGIGMTK  139



>ref|XP_002949693.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
 gb|EFJ49245.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
Length=808

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEG+ A L+I+I LD
Sbjct  80   VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKAQLGEGEAANLDIKIWLD  139

Query  183  KDXKILSIRDRGIGMTK  233
               + L+IRDRGIGMTK
Sbjct  140  AASRTLNIRDRGIGMTK  156



>ref|XP_001753222.1| predicted protein [Physcomitrella patens]
 gb|EDQ81851.1| predicted protein [Physcomitrella patens]
Length=759

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYSNKDIFLREL+SNASDALDKIRFLSL DK +L +G  A+L+I IK+D
Sbjct  26   VSRLMDIIINSLYSNKDIFLRELVSNASDALDKIRFLSLMDKTLLSDGKDAELDIHIKVD  85

Query  183  KDXKILSIRDRGIGMTK  233
            K   +LSIRD G+GMTK
Sbjct  86   KKENVLSIRDNGVGMTK  102



>emb|CEG00480.1| Histidine kinase-like ATPase, ATP-binding domain [Ostreococcus 
tauri]
Length=789

 Score =   115 bits (289),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL  IIINSLYSNKDIFLRELISN SDALDKIRF+SLTDK+ LG G+ A L+I+IK D
Sbjct  64   VSRL--IIINSLYSNKDIFLRELISNGSDALDKIRFMSLTDKEQLGSGENANLDIRIKAD  121

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+L+IRDRG+GMTK
Sbjct  122  KERKVLTIRDRGVGMTK  138



>ref|XP_005823214.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
 gb|EKX36234.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
Length=839

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V RLMDIIINSLYS K+IFLRELISNASDALDKIRFLSLTD  +LGEGD +KLEI+I+ D
Sbjct  79   VGRLMDIIINSLYSKKEIFLRELISNASDALDKIRFLSLTDPKVLGEGDQSKLEIRIEAD  138

Query  183  KDXKILSIRDRGIGMTK  233
            K+   +SI D GIGMT+
Sbjct  139  KEAGTISISDTGIGMTR  155



>sp|Q9NKX1.2|ENPL_DICDI RecName: Full=Endoplasmin homolog; AltName: Full=92 kDa phosphoprotein; 
AltName: Full=Glucose-regulated protein 94 homolog; 
Short=GRP-94 homolog; Flags: Precursor [Dictyostelium discoideum]
Length=768

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V++LM+IIINSLYS K+IFLRELISNASDALDKIRFL+LT+ D+LGEG+ + L+I IK+D
Sbjct  58   VNKLMNIIINSLYSKKEIFLRELISNASDALDKIRFLALTNADLLGEGEQSNLDIHIKID  117

Query  183  KDXKILSIRDRGIGMTK  233
            K   +L I DRG+GMTK
Sbjct  118  KANNVLHITDRGVGMTK  134



>ref|XP_641313.1| heat shock protein Hsp90 family protein [Dictyostelium discoideum 
AX4]
 gb|EAL67255.1| heat shock protein Hsp90 family protein [Dictyostelium discoideum 
AX4]
Length=767

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V++LM+IIINSLYS K+IFLRELISNASDALDKIRFL+LT+ D+LGEG+ + L+I IK+D
Sbjct  58   VNKLMNIIINSLYSKKEIFLRELISNASDALDKIRFLALTNADLLGEGEQSNLDIHIKID  117

Query  183  KDXKILSIRDRGIGMTK  233
            K   +L I DRG+GMTK
Sbjct  118  KANNVLHITDRGVGMTK  134



>dbj|BAA94290.2| glucose-regulated protein 94 [Dictyostelium discoideum]
Length=768

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V++LM+IIINSLYS K+IFLRELISNASDALDKIRFL+LT+ D+LGEG+ + L+I IK+D
Sbjct  58   VNKLMNIIINSLYSKKEIFLRELISNASDALDKIRFLALTNADLLGEGEQSNLDIHIKID  117

Query  183  KDXKILSIRDRGIGMTK  233
            K   +L I DRG+GMTK
Sbjct  118  KANNVLHITDRGVGMTK  134



>gb|AHF81419.1| heat shock protein 90-1 [Pyropia haitanensis]
Length=809

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +3

Query  15   MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLDKDXK  194
            MDIIINSLYSN+DIFLRELISNASDALDKIRFL+L+D   LG GD A LEI++++DK  +
Sbjct  1    MDIIINSLYSNRDIFLRELISNASDALDKIRFLALSDSSALGTGDAAALEIRVRVDKAAR  60

Query  195  ILSIRDRGIGMTK  233
             LS+RDRG+GMT+
Sbjct  61   TLSLRDRGVGMTR  73



>ref|XP_003288550.1| hypothetical protein DICPUDRAFT_98061 [Dictyostelium purpureum]
 gb|EGC34917.1| hypothetical protein DICPUDRAFT_98061 [Dictyostelium purpureum]
Length=779

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V++LM+IIINSLYS K+IFLRELISNASDALDKIRFL LT+  +LGEG+ +KL++ IK+D
Sbjct  61   VNKLMNIIINSLYSKKEIFLRELISNASDALDKIRFLGLTNPSLLGEGEQSKLDVHIKID  120

Query  183  KDXKILSIRDRGIGMTK  233
            K+  +L I D+G+GMTK
Sbjct  121  KENNVLHITDKGVGMTK  137



>ref|XP_005651682.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE27138.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=768

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 69/77 (90%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMDI+I+SLYSNK+IFLRELISNA+DALDKIRFLSLTDK  LGE  T+ LEI++K+D
Sbjct  61   VNRLMDILIHSLYSNKEIFLRELISNAADALDKIRFLSLTDKGQLGE--TSDLEIRVKVD  118

Query  183  KDXKILSIRDRGIGMTK  233
             D KIL+I+D G+GMT+
Sbjct  119  HDNKILTIQDTGVGMTR  135



>ref|XP_005782556.1| hypothetical protein EMIHUDRAFT_449776 [Emiliania huxleyi CCMP1516]
 gb|EOD30127.1| hypothetical protein EMIHUDRAFT_449776 [Emiliania huxleyi CCMP1516]
Length=785

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V++LMDIIINSLYS K+IFLRELISN SDALDK+RF+SLTD  +LGEGDT+KLE+++  D
Sbjct  56   VNKLMDIIINSLYSKKEIFLRELISNGSDALDKVRFMSLTDSAVLGEGDTSKLEMKLIAD  115

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K L++ DRG GM+K
Sbjct  116  KEAKTLTLIDRGCGMSK  132



>ref|XP_008671461.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=150

 Score =   103 bits (257),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VS+ MDIIINSLYSNKDI++RELI+NAS+AL KIRFLSL DK++LGE DT KLEI IKLD
Sbjct  22   VSKPMDIIINSLYSNKDIYVRELIANASNALGKIRFLSLADKEVLGEEDTEKLEIHIKLD  81

Query  183  KDXKILSIRD  212
               ++LSIRD
Sbjct  82   NKKQMLSIRD  91



>ref|XP_005715704.1| unnamed protein product [Chondrus crispus]
 emb|CDF35885.1| unnamed protein product [Chondrus crispus]
Length=781

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +3

Query  15   MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLDKDXK  194
            MDIIINSLYSNKD+FLRELISNASDALDKIRFL+L++  +LGEGD AKLEI+++ +K+  
Sbjct  1    MDIIINSLYSNKDVFLRELISNASDALDKIRFLALSNSKLLGEGDQAKLEIRVRANKEAG  60

Query  195  ILSIRDRGIGMTK  233
             L IRD G+GMT+
Sbjct  61   TLEIRDTGLGMTR  73



>emb|CBN74418.1| Heat shock protein 90 [Ectocarpus siliculosus]
Length=767

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 66/78 (85%), Gaps = 4/78 (5%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAK-LEIQIKL  179
            V+RLMDIIINSLY NKDIFLRELISNASDALDKIRFLS++D D LG   TAK LEI+I  
Sbjct  63   VNRLMDIIINSLYKNKDIFLRELISNASDALDKIRFLSVSDPDKLG---TAKDLEIRISA  119

Query  180  DKDXKILSIRDRGIGMTK  233
            DKD + L+IRD G+GMTK
Sbjct  120  DKDARTLTIRDAGVGMTK  137



>dbj|GAM27457.1| hypothetical protein SAMD00019534_106330 [Acytostelium subglobosum 
LB1]
Length=821

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V++LM+IIINSLYS K+IFLRELISNASDALDKIRFL+LT+  +LG+GD +KL+I+I +D
Sbjct  89   VNKLMNIIINSLYSKKEIFLRELISNASDALDKIRFLALTNPALLGDGDQSKLDIRIMID  148

Query  183  KDXKILSIRDRGIGMTK  233
               K+L I DRGIGMTK
Sbjct  149  NANKVLHIIDRGIGMTK  165



>gb|EFA78289.1| heat shock protein Hsp90 family protein [Polysphondylium pallidum 
PN500]
Length=822

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V++LM+IIINSLYS K+IFLRELISNASDALDKIRFL+LT+  +LGEGD A L+I+I +D
Sbjct  89   VNKLMNIIINSLYSKKEIFLRELISNASDALDKIRFLALTNPSLLGEGDQANLDIRIMID  148

Query  183  KDXKILSIRDRGIGMTK  233
            K  K + I DRG+GMTK
Sbjct  149  KVNKYIHIIDRGVGMTK  165



>ref|XP_002117847.1| hypothetical protein TRIADDRAFT_64388 [Trichoplax adhaerens]
 gb|EDV19690.1| hypothetical protein TRIADDRAFT_64388 [Trichoplax adhaerens]
Length=669

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSR+M +IINSLY NK+IFLRELISN+SDALDKIRF+SLTDK++L  G+  +LEI+IK+D
Sbjct  66   VSRMMKLIINSLYRNKEIFLRELISNSSDALDKIRFMSLTDKEVL--GNNPELEIKIKVD  123

Query  183  KDXKILSIRDRGIGMTK  233
            K+ ++L I D GIGMTK
Sbjct  124  KENRVLHITDTGIGMTK  140



>ref|XP_004358722.1| heat shock protein Hsp90 family protein [Dictyostelium fasciculatum]
 gb|EGG20872.1| heat shock protein Hsp90 family protein [Dictyostelium fasciculatum]
Length=777

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V++LM+IIINSLYS K+IFLRELISN++DALDKIRFL+LT+  +LGEG+ A L+I+I++D
Sbjct  53   VNKLMNIIINSLYSKKEIFLRELISNSADALDKIRFLALTNPALLGEGEQANLDIKIQVD  112

Query  183  KDXKILSIRDRGIGMTK  233
            K+   L I D+GIGMTK
Sbjct  113  KENHFLHITDKGIGMTK  129



>gb|ADR79285.1| Hsp90 beta [Brachionus ibericus]
Length=802

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+R+M +IINSLY NK+IFLRELISNASDALDKIRF+SLTDKD+LGE  T +L I+IK D
Sbjct  91   VNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFMSLTDKDVLGE--TEELSIRIKSD  148

Query  183  KDXKILSIRDRGIGMTK  233
            K+ ++L I D GIGMTK
Sbjct  149  KENRMLHITDTGIGMTK  165



>ref|XP_011402246.1| Endoplasmin-like protein [Auxenochlorella protothecoides]
 gb|KFM29193.1| Endoplasmin-like protein [Auxenochlorella protothecoides]
Length=1046

 Score =   108 bits (269),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 69/78 (88%), Gaps = 1/78 (1%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAK-LEIQIKL  179
            V+RLMDI+INSLYSNKDIFLRELISNA+DALDKIRFL+LTDK  LG+ + ++ L I+I +
Sbjct  43   VNRLMDILINSLYSNKDIFLRELISNAADALDKIRFLALTDKSQLGDTEESQALGIRIWV  102

Query  180  DKDXKILSIRDRGIGMTK  233
            D++ ++LSIRD G+GMT+
Sbjct  103  DEERRVLSIRDSGVGMTR  120



>gb|KDO21013.1| hypothetical protein SPRG_13941 [Saprolegnia parasitica CBS 223.65]
Length=817

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLY +K+IFLRELISNASDALDK+RFL+L+D  +LGE    +LEI+I  D
Sbjct  61   VSRLMDIIINSLYKSKEIFLRELISNASDALDKLRFLALSDNGLLGE--KKELEIRISYD  118

Query  183  KDXKILSIRDRGIGMTK  233
            KD K L+IRD GIGMTK
Sbjct  119  KDAKTLTIRDTGIGMTK  135



>ref|XP_008661247.1| PREDICTED: uncharacterized protein LOC103640446 [Zea mays]
Length=1193

 Score =   107 bits (266),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSR MDIIINSLY+NKDIF+ E ISN SDAL++IR LSLTDK++L EGDT KLEIQ  LD
Sbjct  355  VSRPMDIIINSLYNNKDIFVWESISNVSDALERIRILSLTDKEVLVEGDTEKLEIQ--LD  412

Query  183  KDXKILSIRDRGIGMT  230
            K+ K+LS++D+ IGMT
Sbjct  413  KEKKMLSMQDKSIGMT  428



>ref|XP_008620345.1| heat shock protein 90kDa beta [Saprolegnia diclina VS20]
 gb|EQC26200.1| heat shock protein 90kDa beta [Saprolegnia diclina VS20]
Length=829

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLY +K+IFLRELISNASDALDK+RFL+L+D  +LGE    +LEI+I  D
Sbjct  61   VSRLMDIIINSLYKSKEIFLRELISNASDALDKLRFLALSDNSLLGE--KKELEIRISYD  118

Query  183  KDXKILSIRDRGIGMTK  233
            KD K L+IRD GIGMTK
Sbjct  119  KDGKTLTIRDTGIGMTK  135



>pdb|3PEH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 
From Plasmodium Falciparum, Pfl1070c In The Presence Of A 
Thienopyrimidine Derivative
 pdb|3PEH|B Chain B, Crystal Structure Of The N-Terminal Domain Of An Hsp90 
From Plasmodium Falciparum, Pfl1070c In The Presence Of A 
Thienopyrimidine Derivative
 pdb|3PEJ|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 
From Plasmodium Falciparum, Pfl1070c In The Presence Of Macbecin
 pdb|3PEJ|B Chain B, Crystal Structure Of The N-Terminal Domain Of An Hsp90 
From Plasmodium Falciparum, Pfl1070c In The Presence Of Macbecin
Length=281

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMDII+NSLY+ K++FLRELISNA+DAL+KIRFLSL+D+ +LGE    KLEI+I  +
Sbjct  32   VTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGE--EKKLEIRISAN  89

Query  183  KDXKILSIRDRGIGMTK  233
            K+  ILSI D GIGMTK
Sbjct  90   KEKNILSITDTGIGMTK  106



>ref|XP_004994487.1| heat shock protein gp96 [Salpingoeca rosetta]
 gb|EGD72664.1| heat shock protein gp96 [Salpingoeca rosetta]
Length=850

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+R+M +IINSLY NKDIFLRELISNASDALDKIRFLSLTDKD+L  GD   L I+I  D
Sbjct  95   VNRMMKLIINSLYKNKDIFLRELISNASDALDKIRFLSLTDKDVL--GDVPDLHIKIHAD  152

Query  183  KDXKILSIRDRGIGMTK  233
            KD  +L I D GIGMT+
Sbjct  153  KDNGVLHITDTGIGMTR  169



>gb|EPS65742.1| heat shock protein 90, partial [Genlisea aurea]
Length=222

 Score =   101 bits (251),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD  +LEI+IK D
Sbjct  49   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL--GDAGELEIRIKPD  106

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  107  PDNGTITITDTGIGMTK  123



>gb|EPS70213.1| hypothetical protein M569_04546, partial [Genlisea aurea]
Length=459

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNKD+FLRELISNASDALDK+RFLS+T+  +L   D+  L+I+I++D
Sbjct  90   VSRLMDLIVNSLYSNKDVFLRELISNASDALDKLRFLSVTEPQLL--KDSVDLDIRIQVD  147

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMT+
Sbjct  148  KDNGIITITDTGIGMTR  164



>ref|XP_011048941.1| PREDICTED: heat shock protein 83 isoform X3 [Populus euphratica]
Length=793

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD ++L   D A L+I+I+ D
Sbjct  99   VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELL--KDAADLDIRIQTD  156

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMT+
Sbjct  157  KDNGIITITDSGIGMTR  173



>ref|XP_011048939.1| PREDICTED: heat shock protein 83 isoform X2 [Populus euphratica]
Length=794

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD ++L   D A L+I+I+ D
Sbjct  99   VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELL--KDAADLDIRIQTD  156

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMT+
Sbjct  157  KDNGIITITDSGIGMTR  173



>ref|XP_011048938.1| PREDICTED: heat shock protein 83 isoform X1 [Populus euphratica]
Length=795

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD ++L   D A L+I+I+ D
Sbjct  99   VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELL--KDAADLDIRIQTD  156

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMT+
Sbjct  157  KDNGIITITDSGIGMTR  173



>ref|XP_011085393.1| PREDICTED: heat shock protein 83 [Sesamum indicum]
Length=796

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNKD+FLRELISNASDALDK+RFLS+TD  +L +G    L+I+I+ D
Sbjct  96   VSRLMDLIVNSLYSNKDVFLRELISNASDALDKLRFLSVTDPQLLTDG--VDLDIRIQAD  153

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMT+
Sbjct  154  KDNGIITITDTGIGMTR  170



>ref|XP_009776793.1| PREDICTED: heat shock protein 90-1-like [Nicotiana sylvestris]
Length=786

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLSLT+  +L  GD  +LEI+IK D
Sbjct  90   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSLTEPSLL--GDAGELEIRIKCD  147

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  148  PDNGTITITDTGIGMTK  164



>ref|XP_009627181.1| PREDICTED: heat shock protein 90-1-like [Nicotiana tomentosiformis]
Length=791

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLSLT+  +L  GD  +LEI+IK D
Sbjct  94   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSLTEPSLL--GDAGELEIRIKCD  151

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  152  PDNGTITITDTGIGMTK  168



>ref|XP_002262292.1| endoplasmin homolog [Plasmodium knowlesi strain H]
 emb|CAQ42170.1| endoplasmin homolog, putative [Plasmodium knowlesi strain H]
Length=814

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+R+MDII+NSLY+ K++FLRELISNA+DAL+KIRFLSL+D+++LGE    KLEI+I  +
Sbjct  74   VTRMMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDENVLGE--EKKLEIRISAN  131

Query  183  KDXKILSIRDRGIGMTK  233
            K+  ILSI D GIGMTK
Sbjct  132  KEKNILSITDTGIGMTK  148



>ref|XP_002290725.1| heat shock protein Hsp90 [Thalassiosira pseudonana CCMP1335]
 gb|EED92477.1| heat shock protein Hsp90 [Thalassiosira pseudonana CCMP1335]
Length=710

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 63/74 (85%), Gaps = 2/74 (3%)
 Frame = +3

Query  12   LMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLDKDX  191
            ++DI++NSLY+NKD+FLRELISNASDALDKIRFLS+T  ++L  GDT  LE++I+ D D 
Sbjct  1    MLDIVVNSLYTNKDVFLRELISNASDALDKIRFLSVTKPEML--GDTPDLEMKIEYDPDQ  58

Query  192  KILSIRDRGIGMTK  233
            + L+IRD G+GMTK
Sbjct  59   RTLTIRDTGVGMTK  72



>emb|CDO65499.1| endoplasmin, putative [Plasmodium reichenowi]
Length=821

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMDII+NSLY+ K++FLRELISNA+DAL+KIRFLSL+D+ +LGE    KLEI+I  +
Sbjct  81   VTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGE--EKKLEIRISAN  138

Query  183  KDXKILSIRDRGIGMTK  233
            K+  ILSI D GIGMTK
Sbjct  139  KEKNILSITDTGIGMTK  155



>gb|EWC75399.1| hypothetical protein C923_03940 [Plasmodium falciparum UGT5.1]
Length=821

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMDII+NSLY+ K++FLRELISNA+DAL+KIRFLSL+D+ +LGE    KLEI+I  +
Sbjct  81   VTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGE--EKKLEIRISAN  138

Query  183  KDXKILSIRDRGIGMTK  233
            K+  ILSI D GIGMTK
Sbjct  139  KEKNILSITDTGIGMTK  155



>ref|XP_001350620.1| endoplasmin homolog precursor, putative [Plasmodium falciparum 
3D7]
 gb|AAN36300.1|AE014847_27 endoplasmin homolog precursor, putative [Plasmodium falciparum 
3D7]
 gb|ETW17599.1| hypothetical protein PFFVO_03482 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
 gb|ETW30020.1| hypothetical protein PFFCH_02514 [Plasmodium falciparum FCH/4]
 gb|ETW33075.1| hypothetical protein PFTANZ_06206 [Plasmodium falciparum Tanzania 
(2000708)]
 gb|ETW41618.1| hypothetical protein PFNF135_04028 [Plasmodium falciparum NF135/5.C10]
 gb|ETW48200.1| hypothetical protein PFMALIP_03768 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW55901.1| hypothetical protein PFUGPA_01946 [Plasmodium falciparum Palo 
Alto/Uganda]
 gb|ETW60253.1| hypothetical protein PFMC_03797 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR68694.1| hypothetical protein PFBG_03925 [Plasmodium falciparum 7G8]
 gb|EUT82491.1| hypothetical protein PFAG_03867 [Plasmodium falciparum Santa 
Lucia]
 gb|EWC87645.1| hypothetical protein PFNF54_03770 [Plasmodium falciparum NF54]
Length=821

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMDII+NSLY+ K++FLRELISNA+DAL+KIRFLSL+D+ +LGE    KLEI+I  +
Sbjct  81   VTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFLSLSDESVLGE--EKKLEIRISAN  138

Query  183  KDXKILSIRDRGIGMTK  233
            K+  ILSI D GIGMTK
Sbjct  139  KEKNILSITDTGIGMTK  155



>ref|XP_002157524.1| PREDICTED: endoplasmin-like [Hydra vulgaris]
Length=825

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSR+M +IINSLY NK+IFLRELISNASDALDKIRFLSLTDK +L   D  +  ++IK D
Sbjct  88   VSRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLTDKSVLSATD--EFSVKIKAD  145

Query  183  KDXKILSIRDRGIGMTK  233
            KD  IL I D GIGMTK
Sbjct  146  KDNNILHITDTGIGMTK  162



>ref|XP_010927990.1| PREDICTED: heat shock protein 83-like isoform X2 [Elaeis guineensis]
Length=672

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+TD  +LG+G   +LEI+IK D
Sbjct  92   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTDPSLLGDG--GELEIRIKPD  149

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  150  PDNGTITIFDTGIGMTK  166



>gb|EYU43186.1| hypothetical protein MIMGU_mgv1a001565mg [Erythranthe guttata]
Length=794

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNKD+FLRELISNASDALDK+RFLS+TD  +L   DT  L+I+I+ D
Sbjct  95   VSRLMDLIVNSLYSNKDVFLRELISNASDALDKLRFLSVTDPQLL--KDTYDLDIRIQTD  152

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I+++ D GIGMT 
Sbjct  153  KDNGIITLTDTGIGMTH  169



>ref|XP_002535115.1| heat shock protein, putative [Ricinus communis]
 gb|EEF27267.1| heat shock protein, putative, partial [Ricinus communis]
Length=220

 Score = 97.8 bits (242),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD   LEI+I+ D
Sbjct  95   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL--GDAGDLEIRIRPD  152

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  153  PDNGTITISDSGIGMTK  169



>ref|XP_003401925.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin-like [Bombus terrestris]
Length=798

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 4/78 (5%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT-AKLEIQIKL  179
            V+R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L   DT  +L I+IK 
Sbjct  82   VNRMMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL---DTNPELAIRIKT  138

Query  180  DKDXKILSIRDRGIGMTK  233
            DK+ KILSI D GIGMTK
Sbjct  139  DKENKILSITDSGIGMTK  156



>ref|XP_010927989.1| PREDICTED: heat shock protein 83-like isoform X1 [Elaeis guineensis]
Length=794

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+TD  +LG+G   +LEI+IK D
Sbjct  92   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTDPSLLGDG--GELEIRIKPD  149

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  150  PDNGTITIFDTGIGMTK  166



>ref|XP_008814600.1| heat shock protein 90kDa beta [Plasmodium inui San Antonio 1]
 gb|EUD69074.1| heat shock protein 90kDa beta [Plasmodium inui San Antonio 1]
Length=814

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMDII+NSLY+ K++FLRELISNA+DAL+KIRF+SL+D+ +LGE    KLEI+I  +
Sbjct  74   VTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFMSLSDEKVLGE--EKKLEIRISAN  131

Query  183  KDXKILSIRDRGIGMTK  233
            K+  ILSI D GIGMTK
Sbjct  132  KEKNILSITDTGIGMTK  148



>ref|XP_004224999.1| endoplasmin precursor [Plasmodium cynomolgi strain B]
 dbj|GAB69052.1| endoplasmin precursor [Plasmodium cynomolgi strain B]
Length=812

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMDII+NSLY+ K++FLRELISNA+DAL+KIRF+SL+D+ +LGE    KLEI+I  +
Sbjct  74   VTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFMSLSDEKVLGE--EKKLEIKISAN  131

Query  183  KDXKILSIRDRGIGMTK  233
            K+  ILSI D GIGMTK
Sbjct  132  KEKNILSITDTGIGMTK  148



>ref|XP_003578283.1| PREDICTED: heat shock cognate 90 kDa protein-like [Brachypodium 
distachyon]
Length=794

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+TD  +L +G  A++EI+IK D
Sbjct  91   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTDPSMLSDG--AEMEIRIKPD  148

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  149  PDAGTITITDSGIGMTK  165



>ref|XP_001617311.1| endoplasmin precursor [Plasmodium vivax Sal-1]
 gb|EDL47584.1| endoplasmin precursor, putative [Plasmodium vivax]
Length=814

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMDII+NSLY+ K++FLRELISNA+DAL+KIRF+SL+D+ +LGE    KLEI+I  +
Sbjct  74   VTRLMDIIVNSLYTQKEVFLRELISNAADALEKIRFMSLSDEKVLGE--EKKLEIRISAN  131

Query  183  KDXKILSIRDRGIGMTK  233
            K+  ILSI D GIGMTK
Sbjct  132  KEKNILSITDTGIGMTK  148



>ref|XP_003701264.1| PREDICTED: endoplasmin-like [Megachile rotundata]
Length=806

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L      +L I+IK D
Sbjct  82   VNRMMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVLDAN--PELAIRIKTD  139

Query  183  KDXKILSIRDRGIGMTK  233
            K+ KILSI D GIGMTK
Sbjct  140  KENKILSISDSGIGMTK  156



>gb|KEH17540.1| heat shock protein 81-2 [Medicago truncatula]
Length=791

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +LGE  + +LEI+IK D
Sbjct  90   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLLGE--SGELEIRIKPD  147

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  148  PDNGTITITDSGIGMTK  164



>ref|XP_004293459.1| PREDICTED: heat shock protein 90-1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 4/78 (5%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL-GEGDTAKLEIQIKL  179
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD D+L G GD   L+I+I+ 
Sbjct  103  VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDPDLLKGGGD---LDIRIQT  159

Query  180  DKDXKILSIRDRGIGMTK  233
            D D  I++I D GIGMT+
Sbjct  160  DTDNGIINITDSGIGMTR  177



>emb|CAA82945.1| heat-shock protein [Secale cereale]
Length=781

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+TD  +L +G   +LEI+IK D
Sbjct  83   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTDSSVLADG--GELEIRIKPD  140

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  141  PDAGTITITDSGIGMTK  157



>ref|XP_006664594.1| PREDICTED: heat shock protein 83-like [Oryza brachyantha]
Length=780

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD D+L +G   +L+I+I+ D
Sbjct  84   VNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLLKDG--PELDIRIQTD  141

Query  183  KDXKILSIRDRGIGMTK  233
            KD  +++I D GIGMTK
Sbjct  142  KDNGVITITDSGIGMTK  158



>gb|AHG52035.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
Length=152

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L  GD  +LEI+I  D
Sbjct  76   VSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL--GDKTELEIRISYD  133

Query  183  KDXKILSIRDRGIGMTK  233
             + + +SI D G+GMT+
Sbjct  134  VNKRTISITDTGVGMTR  150



>gb|ACG47228.1| heat shock protein 83 [Zea mays]
Length=524

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD ++L +G   +L+I+I+ D
Sbjct  107  VNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPELLKDG--PQLDIRIQTD  164

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMTK
Sbjct  165  KDNGIITITDSGIGMTK  181



>ref|XP_009627613.1| PREDICTED: heat shock protein 81-1-like [Nicotiana tomentosiformis]
Length=798

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLSLT+  +L  GD+ +LEI+IK D
Sbjct  94   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSLTEPSLL--GDSGELEIRIKPD  151

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  152  PDNGTITITDTGIGMTK  168



>ref|XP_008788962.1| PREDICTED: heat shock protein 83-like [Phoenix dactylifera]
Length=796

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+TD  +LG+G   +LEI+IK D
Sbjct  91   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTDPSLLGDG--GELEIRIKPD  148

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  149  PDNGTITISDTGIGMTK  165



>ref|XP_010045864.1| PREDICTED: heat shock protein 83 [Eucalyptus grandis]
 gb|KCW88688.1| hypothetical protein EUGRSUZ_A01044 [Eucalyptus grandis]
Length=794

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T+  +L +   A L+I+I+ D
Sbjct  98   VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPQLLKDA-AADLDIRIQTD  156

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I+SI D GIGMT+
Sbjct  157  KDNGIISITDTGIGMTR  173



>ref|XP_008464175.1| PREDICTED: heat shock protein 81-1 [Cucumis melo]
Length=790

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD  +L E      +I+I+ D
Sbjct  103  VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDPGLLKEA--IDFDIRIQTD  160

Query  183  KDXKILSIRDRGIGMTK  233
            KD  ILSI D GIGMT+
Sbjct  161  KDNGILSITDTGIGMTR  177



>gb|KCW88689.1| hypothetical protein EUGRSUZ_A01044 [Eucalyptus grandis]
Length=752

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T+  +L +   A L+I+I+ D
Sbjct  98   VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPQLLKDA-AADLDIRIQTD  156

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I+SI D GIGMT+
Sbjct  157  KDNGIISITDTGIGMTR  173



>ref|XP_006619420.1| PREDICTED: endoplasmin-like [Apis dorsata]
Length=798

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 66/78 (85%), Gaps = 4/78 (5%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT-AKLEIQIKL  179
            V+R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L   DT ++L I+IK 
Sbjct  82   VNRIMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL---DTNSELAIRIKS  138

Query  180  DKDXKILSIRDRGIGMTK  233
            DK+ KILSI D GIGMTK
Sbjct  139  DKENKILSITDSGIGMTK  156



>ref|XP_003493872.1| PREDICTED: endoplasmin-like [Bombus impatiens]
Length=798

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 4/78 (5%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT-AKLEIQIKL  179
            V+R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L   DT  +L I+IK 
Sbjct  82   VNRMMRLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL---DTNPELAIRIKS  138

Query  180  DKDXKILSIRDRGIGMTK  233
            DK+ KILSI D GIGMTK
Sbjct  139  DKENKILSITDSGIGMTK  156



>ref|XP_010091648.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXB44914.1| Endoplasmin-like protein [Morus notabilis]
Length=809

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD  +LEI+IK D
Sbjct  92   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL--GDAGQLEIRIKSD  149

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  150  PDNGTITITDTGIGMTK  166



>ref|XP_003694125.1| PREDICTED: endoplasmin-like [Apis florea]
Length=831

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 4/78 (5%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT-AKLEIQIKL  179
            V+R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L   DT  +L I+IK 
Sbjct  115  VNRIMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL---DTNPELAIRIKS  171

Query  180  DKDXKILSIRDRGIGMTK  233
            DK+ KILSI D GIGMTK
Sbjct  172  DKENKILSITDSGIGMTK  189



>ref|XP_009519039.1| hypothetical protein PHYSODRAFT_255139 [Phytophthora sojae]
 gb|EGZ23751.1| hypothetical protein PHYSODRAFT_255139 [Phytophthora sojae]
Length=761

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLY  K+IFLRELISNASDALDKIRFL+L++ ++LG+     LEI+I  D
Sbjct  13   VSRLMDILINSLYRTKEIFLRELISNASDALDKIRFLALSNSELLGK--LRDLEIRISFD  70

Query  183  KDXKILSIRDRGIGMTK  233
            KD   L+IRD G+GMTK
Sbjct  71   KDAHTLTIRDTGVGMTK  87



>ref|XP_009355621.1| PREDICTED: heat shock protein 83 [Pyrus x bretschneideri]
Length=794

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD+ +L+I+IK D
Sbjct  92   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPHLL--GDSGELQIRIKPD  149

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  150  PDNGTITISDTGIGMTK  166



>ref|XP_009019107.1| hypothetical protein HELRODRAFT_157169 [Helobdella robusta]
 gb|ESO02893.1| hypothetical protein HELRODRAFT_157169 [Helobdella robusta]
Length=736

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 60/77 (78%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V R+M +IINSLY NK+IFLRELISNASDALDKIRFLSLTD   +G    A+L I+IK D
Sbjct  65   VDRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLTDNTAMGSN--AELSIKIKTD  122

Query  183  KDXKILSIRDRGIGMTK  233
            KD  +L + D G+GMTK
Sbjct  123  KDNHVLHVTDTGVGMTK  139



>ref|XP_003575983.1| PREDICTED: heat shock protein 83 [Brachypodium distachyon]
Length=813

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD D+L +G   +L+I+I+ D
Sbjct  115  VNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLLKDG--PELDIRIQTD  172

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMT+
Sbjct  173  KDNGIITITDSGIGMTR  189



>ref|XP_002443262.1| hypothetical protein SORBIDRAFT_08g016560 [Sorghum bicolor]
 gb|EES17100.1| hypothetical protein SORBIDRAFT_08g016560 [Sorghum bicolor]
Length=814

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD ++L +G   +L+I+I+ D
Sbjct  110  VNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPELLKDG--PQLDIRIQTD  167

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMTK
Sbjct  168  KDNGIITITDSGIGMTK  184



>gb|ACN33229.1| unknown [Zea mays]
Length=813

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD ++L +G   +L+I+I+ D
Sbjct  107  VNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPELLKDG--PQLDIRIQTD  164

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMTK
Sbjct  165  KDNGIITITDSGIGMTK  181



>emb|CDO69548.1| hypothetical protein BN946_scf184785.g53 [Trametes cinnabarina]
Length=698

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 64/78 (82%), Gaps = 4/78 (5%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAK-LEIQIKL  179
            +S+L+D+IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD  +L   DT K L I+I  
Sbjct  12   ISQLLDLIINTFYSNKEIFLRELISNASDALDKIRYASLTDPSVL---DTGKDLYIRITP  68

Query  180  DKDXKILSIRDRGIGMTK  233
            DK+ KILSIRD GIGMTK
Sbjct  69   DKENKILSIRDTGIGMTK  86



>ref|XP_008674382.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 83 [Zea mays]
Length=815

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD ++L +G   +L+I+I+ D
Sbjct  107  VNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPELLKDG--PQLDIRIQTD  164

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMTK
Sbjct  165  KDNGIITITDSGIGMTK  181



>ref|XP_008807013.1| PREDICTED: heat shock protein 83-like [Phoenix dactylifera]
Length=796

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RF S+TD  +LG+G   +LEI+IK D
Sbjct  92   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFFSVTDPSLLGDG--GELEIRIKPD  149

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  150  PDNGTITIIDTGIGMTK  166



>dbj|BAK01596.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=814

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD D+L +G   +L+I+I+ D
Sbjct  117  VNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLLKDG--PELDIRIQTD  174

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMT+
Sbjct  175  KDNGIITITDSGIGMTR  191



>gb|KJB30529.1| hypothetical protein B456_005G148100 [Gossypium raimondii]
Length=743

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD+ +LEI+IK D
Sbjct  86   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL--GDSGELEIRIKPD  143

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  144  PDNGTITITDTGIGMTK  160



>ref|XP_010943343.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=797

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +LG+G   +LEI IK D
Sbjct  92   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLLGDG--GELEIHIKPD  149

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  150  PDNGTITISDTGIGMTK  166



>ref|XP_004169550.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
Length=791

 Score =   100 bits (248),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD  +L E      +I+I+ D
Sbjct  103  VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSGLLKEA--VDFDIRIQTD  160

Query  183  KDXKILSIRDRGIGMTK  233
            KD  ILSI D GIGMT+
Sbjct  161  KDNGILSITDTGIGMTR  177



>ref|XP_004140007.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN46596.1| hypothetical protein Csa_6G111370 [Cucumis sativus]
Length=791

 Score =   100 bits (248),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD  +L E      +I+I+ D
Sbjct  103  VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSGLLKEA--VDFDIRIQTD  160

Query  183  KDXKILSIRDRGIGMTK  233
            KD  ILSI D GIGMT+
Sbjct  161  KDNGILSITDTGIGMTR  177



>gb|EMT31740.1| Heat shock protein 83 [Aegilops tauschii]
Length=792

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD D+L +G   +L+I+I+ D
Sbjct  116  VNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLLKDG--PELDIRIQTD  173

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMT+
Sbjct  174  KDNGIITITDSGIGMTR  190



>emb|CDR16821.1| endoplasmin, putative [Plasmodium chabaudi chabaudi]
Length=806

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RL+DIIINSLY+ KD+F+RELISNA+DAL+KIRFLSL+D+ +L   D  KLEI+I  +
Sbjct  79   VTRLLDIIINSLYTQKDVFMRELISNAADALEKIRFLSLSDESVL--NDEKKLEIRISAN  136

Query  183  KDXKILSIRDRGIGMTK  233
            KD  ILSI D G+GMTK
Sbjct  137  KDKNILSITDTGVGMTK  153



>ref|XP_011101956.1| PREDICTED: heat shock protein 90-1-like [Sesamum indicum]
 ref|XP_011101957.1| PREDICTED: heat shock protein 90-1-like [Sesamum indicum]
Length=798

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD  +LEI+IK D
Sbjct  94   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPALL--GDAGELEIRIKPD  151

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  152  PDNGTITIMDTGIGMTK  168



>ref|XP_003617952.1| Heat-shock protein [Medicago truncatula]
Length=797

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T+ D++   D    +I+I+ D
Sbjct  103  VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPDLM--KDAIDFDIRIQTD  160

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMTK
Sbjct  161  KDNGIITITDTGIGMTK  177



>ref|XP_003617951.1| Heat-shock protein [Medicago truncatula]
 gb|AET00910.1| heat shock protein 81-2 [Medicago truncatula]
Length=792

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T+ D++   D    +I+I+ D
Sbjct  98   VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPDLM--KDAIDFDIRIQTD  155

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMTK
Sbjct  156  KDNGIITITDTGIGMTK  172



>gb|EUD74449.1| heat shock protein 90kDa beta [Plasmodium vinckei petteri]
Length=802

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RL+DIIINSLY+ KD+F+RELISNA+DAL+KIRFLSL+D+ +L   D  KLEI+I  +
Sbjct  75   VTRLLDIIINSLYTQKDVFMRELISNAADALEKIRFLSLSDESVL--NDEKKLEIRISAN  132

Query  183  KDXKILSIRDRGIGMTK  233
            KD  ILSI D G+GMTK
Sbjct  133  KDKNILSITDTGVGMTK  149



>gb|ADY39524.1| putative heat shock protein gp-96 [Hottentotta judaicus]
Length=171

 Score = 94.7 bits (234),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 60/77 (78%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTDK  L    T +L I+IK D
Sbjct  83   VNRMMKLIINSLYRNKEIFLRELISNASDALDKIRVLSLTDKAALAA--TEELTIRIKSD  140

Query  183  KDXKILSIRDRGIGMTK  233
            K+  +L I D GIGMTK
Sbjct  141  KENHLLHITDTGIGMTK  157



>gb|KJB30528.1| hypothetical protein B456_005G148100 [Gossypium raimondii]
Length=790

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD+ +LEI+IK D
Sbjct  86   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL--GDSGELEIRIKPD  143

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  144  PDNGTITITDTGIGMTK  160



>ref|XP_002321183.2| hypothetical protein POPTR_0014s16280g [Populus trichocarpa]
 gb|EEE99498.2| hypothetical protein POPTR_0014s16280g [Populus trichocarpa]
Length=723

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD ++L   D   L+I+I+ D
Sbjct  99   VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELL--KDATDLDIRIQTD  156

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMT+
Sbjct  157  KDNGIITIIDSGIGMTR  173



>dbj|BAK00031.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=779

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+TD  +L +G    +EI+IK D
Sbjct  82   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTDPSVLADG--GDMEIRIKPD  139

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  140  PDAGTITITDSGIGMTK  156



>gb|EMS50921.1| Endoplasmin [Triticum urartu]
Length=725

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+TD  +L +G    +EI+IK D
Sbjct  21   VSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTDPSVLADG--GDMEIRIKPD  78

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  79   PDAGTITITDSGIGMTK  95



>gb|AGZ62517.1| 90 kDa heat shock protein, partial [Cryptosporidium muris]
Length=149

 Score = 94.4 bits (233),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L  G+  +LEI+I  D
Sbjct  74   VSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL--GNKTELEIRISYD  131

Query  183  KDXKILSIRDRGIGMTK  233
             + + +SI D G+GMT+
Sbjct  132  VNKRTISITDTGVGMTR  148



>gb|KJB30531.1| hypothetical protein B456_005G148100 [Gossypium raimondii]
Length=832

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD+ +LEI+IK D
Sbjct  86   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL--GDSGELEIRIKPD  143

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  144  PDNGTITITDTGIGMTK  160



>gb|KHG10495.1| Heat shock cognate 90 kDa [Gossypium arboreum]
Length=790

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD+ +LEI+IK D
Sbjct  86   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL--GDSGELEIRIKPD  143

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  144  PDNGTITITDTGIGMTK  160



>gb|AAW25122.1| SJCHGC06677 protein [Schistosoma japonicum]
Length=797

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V R+M II+NSLY NK+IFLRELISNASDALDK+RFLSLT+ ++L E D  ++ I+IK D
Sbjct  82   VDRMMKIIVNSLYKNKEIFLRELISNASDALDKVRFLSLTNNEMLNESD--EMSIRIKAD  139

Query  183  KDXKILSIRDRGIGMTK  233
            KD + L I D GIGMT+
Sbjct  140  KDSRTLHITDTGIGMTE  156



>ref|XP_008342195.1| PREDICTED: heat shock protein 90-1-like [Malus domestica]
Length=806

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 4/78 (5%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL-GEGDTAKLEIQIKL  179
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T  D+L G GD   L+I+I+ 
Sbjct  99   VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTQPDLLKGGGD---LDIRIQT  155

Query  180  DKDXKILSIRDRGIGMTK  233
            DKD  I++I D GIGMT+
Sbjct  156  DKDNGIINIIDSGIGMTR  173



>ref|XP_725468.1| heat shock protein 90 [Plasmodium yoelii yoelii 17XNL]
 gb|EAA17033.1| heat shock protein 90 [Plasmodium yoelii yoelii]
 gb|ETB61702.1| hypothetical protein YYC_01540 [Plasmodium yoelii 17X]
 emb|CDU20743.1| endoplasmin, putative [Plasmodium yoelii]
 emb|CDZ14371.1| endoplasmin, putative [Plasmodium yoelii]
Length=808

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RL+DIIINSLY+ KD+F+RELISNA+DAL+KIRFLSL+D+ IL   D  KLEI+I  +
Sbjct  77   VTRLLDIIINSLYTQKDVFMRELISNAADALEKIRFLSLSDESIL--KDEKKLEIRISAN  134

Query  183  KDXKILSIRDRGIGMTK  233
            KD  ILSI D G+GMTK
Sbjct  135  KDKNILSITDTGVGMTK  151



>emb|CDS52035.1| endoplasmin, putative [Plasmodium berghei ANKA]
Length=808

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RL+DIIINSLY+ KD+F+RELISNA+DAL+KIRFLSL+D+ IL   D  KLEI+I  +
Sbjct  77   VTRLLDIIINSLYTQKDVFMRELISNAADALEKIRFLSLSDESIL--KDEKKLEIRISAN  134

Query  183  KDXKILSIRDRGIGMTK  233
            KD  ILSI D G+GMTK
Sbjct  135  KDKNILSITDTGVGMTK  151



>ref|XP_001746031.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ88926.1| predicted protein [Monosiga brevicollis MX1]
Length=744

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSR+M +II+SLY NKDIFLRE+ISNASDALDKIR LSLTDK +L  GD   L I+I +D
Sbjct  22   VSRMMKLIIHSLYKNKDIFLREIISNASDALDKIRLLSLTDKSVL--GDLEDLHIKIHVD  79

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K+L I D GIGMT+
Sbjct  80   KENKVLHITDTGIGMTR  96



>gb|KJB30530.1| hypothetical protein B456_005G148100 [Gossypium raimondii]
Length=746

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD+ +LEI+IK D
Sbjct  86   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL--GDSGELEIRIKPD  143

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  144  PDNGTITITDTGIGMTK  160



>ref|XP_676606.1| endoplasmin precursor [Plasmodium berghei strain ANKA]
 emb|CAH93601.1| endoplasmin homolog precursor, putative [Plasmodium berghei]
Length=807

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RL+DIIINSLY+ KD+F+RELISNA+DAL+KIRFLSL+D+ IL   D  KLEI+I  +
Sbjct  77   VTRLLDIIINSLYTQKDVFMRELISNAADALEKIRFLSLSDESIL--KDEKKLEIRISAN  134

Query  183  KDXKILSIRDRGIGMTK  233
            KD  ILSI D G+GMTK
Sbjct  135  KDKNILSITDTGVGMTK  151



>dbj|BAF63637.1| glucose-regulated protein 94 [Crassostrea gigas]
Length=797

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+R+M +IINSLY NK+IFLRELISNASDALDKIRFLSLTDK  L    T +L I+IK D
Sbjct  82   VNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLTDKSALSA--TEELSIKIKAD  139

Query  183  KDXKILSIRDRGIGMT  230
            KD  +L + D GIGMT
Sbjct  140  KDNHVLHVTDTGIGMT  155



>ref|XP_002999135.1| heat shock protein 90, putative [Phytophthora infestans T30-4]
 gb|EEY69281.1| heat shock protein 90, putative [Phytophthora infestans T30-4]
Length=823

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLY  K+IFLRELISNASDALDKIRFL+L++ ++LG+     LEI+I  D
Sbjct  68   VSRLMDILINSLYRTKEIFLRELISNASDALDKIRFLALSNNELLGK--LRDLEIRISFD  125

Query  183  KDXKILSIRDRGIGMTK  233
            KD   L+IRD G+GMTK
Sbjct  126  KDAGTLTIRDTGVGMTK  142



>gb|ETI49777.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETL96118.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM49272.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETO78400.1| hypothetical protein, variant [Phytophthora parasitica P1976]
Length=834

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLY  K+IFLRELISNASDALDKIRFL+L++ ++LG+     LEI+I  D
Sbjct  67   VSRLMDILINSLYRTKEIFLRELISNASDALDKIRFLALSNNELLGK--LRDLEIRISFD  124

Query  183  KDXKILSIRDRGIGMTK  233
            KD   L+IRD G+GMTK
Sbjct  125  KDAGTLTIRDTGVGMTK  141



>gb|ETP47332.1| hypothetical protein F442_06594 [Phytophthora parasitica P10297]
Length=836

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLY  K+IFLRELISNASDALDKIRFL+L++ ++LG+     LEI+I  D
Sbjct  69   VSRLMDILINSLYRTKEIFLRELISNASDALDKIRFLALSNNELLGK--LRDLEIRISFD  126

Query  183  KDXKILSIRDRGIGMTK  233
            KD   L+IRD G+GMTK
Sbjct  127  KDAGTLTIRDTGVGMTK  143



>gb|ADQ86001.1| 90 kDa heat shock protein [Cryptosporidium muris]
Length=153

 Score = 94.0 bits (232),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L  G+  +LEI+I  D
Sbjct  78   VSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL--GNKTELEIRISYD  135

Query  183  KDXKILSIRDRGIGMTK  233
             + + +SI D G+GMT+
Sbjct  136  VNKRTISITDTGVGMTR  152



>gb|ETK89541.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL42942.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETP19414.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
Length=834

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLY  K+IFLRELISNASDALDKIRFL+L++ ++LG+     LEI+I  D
Sbjct  67   VSRLMDILINSLYRTKEIFLRELISNASDALDKIRFLALSNNELLGK--LRDLEIRISFD  124

Query  183  KDXKILSIRDRGIGMTK  233
            KD   L+IRD G+GMTK
Sbjct  125  KDAGTLTIRDTGVGMTK  141



>gb|ETP47333.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=835

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLY  K+IFLRELISNASDALDKIRFL+L++ ++LG+     LEI+I  D
Sbjct  68   VSRLMDILINSLYRTKEIFLRELISNASDALDKIRFLALSNNELLGK--LRDLEIRISFD  125

Query  183  KDXKILSIRDRGIGMTK  233
            KD   L+IRD G+GMTK
Sbjct  126  KDAGTLTIRDTGVGMTK  142



>ref|XP_008892102.1| hypothetical protein PPTG_02652 [Phytophthora parasitica INRA-310]
 gb|ETN22882.1| hypothetical protein PPTG_02652 [Phytophthora parasitica INRA-310]
Length=835

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLY  K+IFLRELISNASDALDKIRFL+L++ ++LG+     LEI+I  D
Sbjct  68   VSRLMDILINSLYRTKEIFLRELISNASDALDKIRFLALSNNELLGK--LRDLEIRISFD  125

Query  183  KDXKILSIRDRGIGMTK  233
            KD   L+IRD G+GMTK
Sbjct  126  KDAGTLTIRDTGVGMTK  142



>gb|ETI49776.1| hypothetical protein F443_06550 [Phytophthora parasitica P1569]
 gb|ETL96117.1| hypothetical protein L917_06233 [Phytophthora parasitica]
 gb|ETM49271.1| hypothetical protein L914_06346 [Phytophthora parasitica]
 gb|ETO78399.1| hypothetical protein F444_06616 [Phytophthora parasitica P1976]
Length=835

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLY  K+IFLRELISNASDALDKIRFL+L++ ++LG+     LEI+I  D
Sbjct  68   VSRLMDILINSLYRTKEIFLRELISNASDALDKIRFLALSNNELLGK--LRDLEIRISFD  125

Query  183  KDXKILSIRDRGIGMTK  233
            KD   L+IRD G+GMTK
Sbjct  126  KDAGTLTIRDTGVGMTK  142



>ref|XP_008892103.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETN22883.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
Length=834

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLY  K+IFLRELISNASDALDKIRFL+L++ ++LG+     LEI+I  D
Sbjct  67   VSRLMDILINSLYRTKEIFLRELISNASDALDKIRFLALSNNELLGK--LRDLEIRISFD  124

Query  183  KDXKILSIRDRGIGMTK  233
            KD   L+IRD G+GMTK
Sbjct  125  KDAGTLTIRDTGVGMTK  141



>gb|ETK89540.1| hypothetical protein L915_06419 [Phytophthora parasitica]
 gb|ETL42941.1| hypothetical protein L916_06365 [Phytophthora parasitica]
 gb|ETP19413.1| hypothetical protein F441_06555 [Phytophthora parasitica CJ01A1]
Length=835

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDI+INSLY  K+IFLRELISNASDALDKIRFL+L++ ++LG+     LEI+I  D
Sbjct  68   VSRLMDILINSLYRTKEIFLRELISNASDALDKIRFLALSNNELLGK--LRDLEIRISFD  125

Query  183  KDXKILSIRDRGIGMTK  233
            KD   L+IRD G+GMTK
Sbjct  126  KDAGTLTIRDTGVGMTK  142



>gb|KIO13608.1| hypothetical protein M404DRAFT_12522 [Pisolithus tinctorius Marx 
270]
Length=699

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            +S+L+D+IIN+ YSNK+IFLRELISNASDALDKIR+ SLTD  +L  G   +L I+I  D
Sbjct  12   ISQLLDLIINTFYSNKEIFLRELISNASDALDKIRYASLTDPSVLDSG--KELYIRITPD  69

Query  183  KDXKILSIRDRGIGMTK  233
            K+ +ILSIRD GIGMTK
Sbjct  70   KENRILSIRDTGIGMTK  86



>ref|XP_008648551.1| PREDICTED: heat shock protein 83-like isoform X2 [Zea mays]
Length=730

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD ++L +G   +L+I+I+ D
Sbjct  42   VNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPELLKDG--PQLDIRIQSD  99

Query  183  KDXKILSIRDRGIGMTK  233
            KD  +++I D GIGMTK
Sbjct  100  KDNGVITITDSGIGMTK  116



>gb|ADQ85999.1| 90 kDa heat shock protein [Cryptosporidium muris]
Length=156

 Score = 94.0 bits (232),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L  G+  +LEI+I  D
Sbjct  81   VSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL--GNKTELEIRISYD  138

Query  183  KDXKILSIRDRGIGMTK  233
             + + +SI D G+GMT+
Sbjct  139  VNKRTISITDTGVGMTR  155



>ref|XP_002531697.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30688.1| heat shock protein, putative [Ricinus communis]
Length=799

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFL +T+ ++L   D A L+I+I+ D
Sbjct  102  VSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLGVTEPELL--KDAADLDIRIQTD  159

Query  183  KDXKILSIRDRGIGMTK  233
            KD  I++I D GIGMT+
Sbjct  160  KDNGIVTIIDSGIGMTR  176



>ref|XP_009394558.1| PREDICTED: heat shock protein 83-like [Musa acuminata subsp. 
malaccensis]
Length=798

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+TD  +L  GD   LEI+IK D
Sbjct  92   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTDSSLL--GDAGDLEIRIKPD  149

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  150  PDNGTITITDTGIGMTK  166



>gb|EKC38233.1| Endoplasmin [Crassostrea gigas]
Length=1082

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+R+M +IINSLY NK+IFLRELISNASDALDKIRFLSLTDK  L    T +L I+IK D
Sbjct  367  VNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLTDKSALSA--TEELSIKIKAD  424

Query  183  KDXKILSIRDRGIGMT  230
            KD  +L + D GIGMT
Sbjct  425  KDNHVLHVTDTGIGMT  440



>gb|ABA06415.1| 83 kDa heat shock protein [Leishmania chagasi]
Length=204

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            +++LM +IIN+ YSNK+IFLRELISNASDA DKIR+ SLTD  +LGE  + +L I++  D
Sbjct  9    INQLMSLIINTFYSNKEIFLRELISNASDACDKIRYQSLTDPSVLGE--SPRLCIRVVPD  66

Query  183  KDXKILSIRDRGIGMTK  233
            K+ K L++ D GIGMTK
Sbjct  67   KENKTLTVEDNGIGMTK  83



>ref|XP_008648550.1| PREDICTED: heat shock protein 83-like isoform X1 [Zea mays]
Length=741

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 67/77 (87%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            V+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD ++L +G   +L+I+I+ D
Sbjct  42   VNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPELLKDG--PQLDIRIQSD  99

Query  183  KDXKILSIRDRGIGMTK  233
            KD  +++I D GIGMTK
Sbjct  100  KDNGVITITDSGIGMTK  116



>ref|XP_002267463.2| PREDICTED: heat shock protein 90-1 [Vitis vinifera]
Length=792

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD  +LEI+IK D
Sbjct  88   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL--GDAGELEIRIKPD  145

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  146  PDNGTITITDTGIGMTK  162



>emb|CBI27411.3| unnamed protein product [Vitis vinifera]
Length=750

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  3    VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAKLEIQIKLD  182
            VSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L  GD  +LEI+IK D
Sbjct  68   VSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL--GDAGELEIRIKPD  125

Query  183  KDXKILSIRDRGIGMTK  233
             D   ++I D GIGMTK
Sbjct  126  PDNGTITITDTGIGMTK  142



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565019478555