BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J07

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009764826.1|  PREDICTED: receptor-like protein kinase HSL1       176   2e-47   Nicotiana sylvestris
ref|XP_009631895.1|  PREDICTED: receptor-like protein kinase HSL1       175   6e-47   Nicotiana tomentosiformis
ref|XP_010268650.1|  PREDICTED: receptor-like protein kinase HSL1       169   7e-45   Nelumbo nucifera [Indian lotus]
emb|CDP00973.1|  unnamed protein product                                169   9e-45   Coffea canephora [robusta coffee]
ref|XP_004238044.1|  PREDICTED: receptor-like protein kinase HSL1       166   1e-43   Solanum lycopersicum
ref|XP_006356797.1|  PREDICTED: receptor-like protein kinase HSL1...    166   1e-43   Solanum tuberosum [potatoes]
ref|XP_009599063.1|  PREDICTED: receptor-like protein kinase HSL1       164   4e-43   Nicotiana tomentosiformis
ref|XP_010271555.1|  PREDICTED: receptor-like protein kinase HSL1       159   2e-41   Nelumbo nucifera [Indian lotus]
emb|CAN77413.1|  hypothetical protein VITISV_000471                     154   2e-39   Vitis vinifera
ref|XP_002283600.3|  PREDICTED: uncharacterized protein LOC100257433    154   5e-39   
ref|XP_011074306.1|  PREDICTED: receptor-like protein kinase HSL1       152   8e-39   Sesamum indicum [beniseed]
gb|AEP84281.1|  leucine rich repeat-containing protein                  146   1e-36   Corchorus capsularis [jute]
ref|XP_002510008.1|  receptor protein kinase, putative                  145   2e-36   Ricinus communis
gb|ACI42311.1|  putative leucine rich repeat transmembrane protei...    144   6e-36   Corchorus olitorius [Nalta jute]
ref|XP_008444976.1|  PREDICTED: receptor-like protein kinase HSL1       142   3e-35   Cucumis melo [Oriental melon]
ref|XP_008466101.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    140   8e-35   
ref|XP_004136411.1|  PREDICTED: receptor-like protein kinase HSL1...    140   9e-35   Cucumis sativus [cucumbers]
ref|XP_011017021.1|  PREDICTED: receptor-like protein kinase HSL1       140   1e-34   Populus euphratica
ref|XP_004148401.1|  PREDICTED: receptor-like protein kinase HSL1...    140   1e-34   Cucumis sativus [cucumbers]
ref|XP_009786287.1|  PREDICTED: receptor-like protein kinase HSL1       140   2e-34   Nicotiana sylvestris
ref|XP_004299842.1|  PREDICTED: receptor-like protein kinase HSL1       139   4e-34   Fragaria vesca subsp. vesca
ref|XP_010061584.1|  PREDICTED: receptor-like protein kinase HSL1       137   1e-33   Eucalyptus grandis [rose gum]
ref|XP_002301126.1|  hypothetical protein POPTR_0002s11230g             137   2e-33   
ref|XP_010556500.1|  PREDICTED: receptor-like protein kinase HSL1       137   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_009335485.1|  PREDICTED: receptor-like protein kinase HSL1       136   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_008378674.1|  PREDICTED: receptor-like protein kinase HSL1       136   4e-33   
gb|KJB59873.1|  hypothetical protein B456_009G278200                    135   7e-33   Gossypium raimondii
ref|XP_009357235.1|  PREDICTED: receptor-like protein kinase HSL1       134   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_009407104.1|  PREDICTED: uncharacterized protein LOC103989885    134   3e-32   
gb|KJB58763.1|  hypothetical protein B456_009G225100                    133   4e-32   Gossypium raimondii
ref|XP_007018366.1|  Leucine-rich repeat transmembrane protein ki...    133   4e-32   
ref|XP_008352752.1|  PREDICTED: receptor-like protein kinase HSL1       132   1e-31   
gb|KDP41546.1|  hypothetical protein JCGZ_15953                         128   5e-31   Jatropha curcas
ref|XP_010667798.1|  PREDICTED: receptor-like protein kinase HSL1       129   6e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008219158.1|  PREDICTED: receptor-like protein kinase HSL1       129   6e-31   Prunus mume [ume]
ref|XP_006487758.1|  PREDICTED: receptor-like protein kinase HSL1...    129   7e-31   Citrus sinensis [apfelsine]
gb|KJB29386.1|  hypothetical protein B456_005G097700                    127   4e-30   Gossypium raimondii
ref|XP_002510009.1|  receptor protein kinase, putative                  127   6e-30   Ricinus communis
ref|XP_006442751.1|  hypothetical protein CICLE_v10018723mg             127   6e-30   Citrus clementina [clementine]
gb|KJB64049.1|  hypothetical protein B456_010G030500                    126   1e-29   Gossypium raimondii
ref|XP_004963299.1|  PREDICTED: receptor-like protein kinase HAIK...    123   9e-29   Setaria italica
gb|EYU36418.1|  hypothetical protein MIMGU_mgv1a000952mg                123   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_010943258.1|  PREDICTED: receptor-like protein kinase HSL1...    122   2e-28   
gb|EPS67674.1|  hypothetical protein M569_07098                         122   2e-28   Genlisea aurea
ref|XP_008787759.1|  PREDICTED: receptor-like protein kinase HSL1       122   2e-28   
ref|XP_010943241.1|  PREDICTED: receptor-like protein kinase HSL1...    122   2e-28   
ref|NP_001067348.1|  Os12g0632900                                       121   4e-28   
gb|EEC69730.1|  hypothetical protein OsI_39240                          121   6e-28   Oryza sativa Indica Group [Indian rice]
gb|KEH36108.1|  LRR receptor-like kinase family protein                 121   6e-28   Medicago truncatula
ref|XP_006664774.1|  PREDICTED: receptor-like protein kinase HSL1...    120   7e-28   
ref|XP_010667796.1|  PREDICTED: receptor-like protein kinase HSL1       119   8e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ20064.1|  hypothetical protein OsJ_35662                          120   9e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007137285.1|  hypothetical protein PHAVU_009G114400g             119   4e-27   Phaseolus vulgaris [French bean]
ref|XP_003523762.1|  PREDICTED: receptor-like protein kinase HSL1...    116   3e-26   Glycine max [soybeans]
ref|XP_010442431.1|  PREDICTED: receptor-like protein kinase HSL1       115   5e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006402253.1|  hypothetical protein EUTSA_v10012576mg             114   1e-25   Eutrema salsugineum [saltwater cress]
ref|XP_006279956.1|  hypothetical protein CARUB_v10025822mg             114   1e-25   
ref|XP_006279955.1|  hypothetical protein CARUB_v10025822mg             114   1e-25   Capsella rubella
ref|XP_010482245.1|  PREDICTED: receptor-like protein kinase HSL1...    114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010482244.1|  PREDICTED: receptor-like protein kinase HSL1...    114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010440851.1|  PREDICTED: receptor-like protein kinase HSL1       112   5e-25   Camelina sativa [gold-of-pleasure]
ref|XP_008662594.1|  PREDICTED: receptor-like protein kinase HSL1       112   8e-25   Zea mays [maize]
gb|KFK40815.1|  hypothetical protein AALP_AA2G044900                    112   1e-24   Arabis alpina [alpine rockcress]
ref|XP_002865749.1|  hypothetical protein ARALYDRAFT_495025             111   2e-24   Arabidopsis lyrata subsp. lyrata
ref|NP_199777.1|  receptor like kinase                                  110   4e-24   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42540.1|  putative receptor protein kinase                       110   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123552.1|  PREDICTED: receptor-like protein kinase HSL1       110   4e-24   Brassica rapa
emb|CDX71602.1|  BnaC09g26430D                                          109   8e-24   
ref|XP_002442602.1|  hypothetical protein SORBIDRAFT_08g022790          109   8e-24   Sorghum bicolor [broomcorn]
emb|CDY37769.1|  BnaA10g05520D                                          109   9e-24   Brassica napus [oilseed rape]
ref|XP_006852742.1|  hypothetical protein AMTR_s00033p00105380          108   1e-23   
ref|XP_004501072.1|  PREDICTED: receptor-like protein kinase HSL1...    108   2e-23   Cicer arietinum [garbanzo]
ref|XP_008674126.1|  PREDICTED: receptor-like protein kinase HSL1       105   1e-22   Zea mays [maize]
gb|KDP41544.1|  hypothetical protein JCGZ_15951                       99.4    6e-22   Jatropha curcas
ref|XP_003526517.1|  PREDICTED: receptor-like protein kinase HSL1...    102   2e-21   Glycine max [soybeans]
ref|XP_007227013.1|  hypothetical protein PRUPE_ppa001184mg           97.1    1e-19   
ref|XP_003579098.1|  PREDICTED: receptor-like protein kinase HSL1     91.7    1e-17   Brachypodium distachyon [annual false brome]
emb|CBI19329.3|  unnamed protein product                              81.6    2e-14   Vitis vinifera
ref|XP_010943249.1|  PREDICTED: receptor-like protein kinase HSL1...  79.3    1e-13   Elaeis guineensis
gb|ABK26727.1|  unknown                                               76.3    2e-13   Picea sitchensis
gb|EMT01037.1|  Receptor-like protein kinase HSL1                     77.8    4e-13   
gb|KCW59611.1|  hypothetical protein EUGRSUZ_H02353                   76.3    1e-12   Eucalyptus grandis [rose gum]
ref|XP_010023354.1|  PREDICTED: LRR receptor-like serine/threonin...  76.3    1e-12   Eucalyptus grandis [rose gum]
ref|XP_010023353.1|  PREDICTED: LRR receptor-like serine/threonin...  76.3    1e-12   
ref|XP_010247922.1|  PREDICTED: receptor-like protein kinase HSL1     75.9    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009416779.1|  PREDICTED: receptor-like protein kinase HAIKU2   73.9    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010023352.1|  PREDICTED: LRR receptor-like serine/threonin...  73.9    9e-12   Eucalyptus grandis [rose gum]
gb|KCW59607.1|  hypothetical protein EUGRSUZ_H02351                   73.6    1e-11   Eucalyptus grandis [rose gum]
ref|XP_008674748.1|  PREDICTED: receptor-like protein kinase HSL1     73.6    1e-11   Zea mays [maize]
ref|XP_002456732.1|  hypothetical protein SORBIDRAFT_03g041570        73.2    1e-11   Sorghum bicolor [broomcorn]
ref|XP_006645116.1|  PREDICTED: receptor-like protein kinase HSL1...  73.2    2e-11   Oryza brachyantha
ref|XP_009626660.1|  PREDICTED: probably inactive leucine-rich re...  73.2    2e-11   Nicotiana tomentosiformis
emb|CDM82685.1|  unnamed protein product                              72.4    2e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009411887.1|  PREDICTED: receptor-like protein kinase HSL1     72.8    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006489991.1|  PREDICTED: probable LRR receptor-like serine...  72.8    2e-11   
ref|XP_006490007.1|  PREDICTED: LRR receptor-like serine/threonin...  72.4    2e-11   
gb|AGT16770.1|  hypothetical protein SHCRBa_022_K23_R_30              72.0    3e-11   Saccharum hybrid cultivar R570
emb|CDP16506.1|  unnamed protein product                              71.2    6e-11   Coffea canephora [robusta coffee]
ref|XP_004970775.1|  PREDICTED: receptor-like protein kinase HSL1...  71.2    6e-11   
ref|XP_004970774.1|  PREDICTED: receptor-like protein kinase HSL1...  71.2    6e-11   
ref|XP_009769280.1|  PREDICTED: probably inactive leucine-rich re...  71.2    7e-11   Nicotiana sylvestris
ref|XP_008645155.1|  PREDICTED: leucine-rich repeat receptor-like...  71.2    7e-11   
ref|XP_006300302.1|  hypothetical protein CARUB_v10019725mg           70.9    8e-11   Capsella rubella
ref|XP_010232642.1|  PREDICTED: receptor-like protein kinase HSL1     70.5    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_010943231.1|  PREDICTED: receptor-like protein kinase HAIKU2   70.5    1e-10   Elaeis guineensis
ref|XP_004245154.1|  PREDICTED: probably inactive leucine-rich re...  70.5    1e-10   Solanum lycopersicum
ref|XP_010911833.1|  PREDICTED: receptor-like protein kinase HSL1     70.5    1e-10   Elaeis guineensis
ref|XP_002281133.1|  PREDICTED: probably inactive leucine-rich re...  70.5    1e-10   Vitis vinifera
ref|XP_009406957.1|  PREDICTED: pollen-specific leucine-rich repe...  69.3    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008787835.1|  PREDICTED: uncharacterized protein LOC103705762  70.5    1e-10   
ref|XP_010064750.1|  PREDICTED: LRR receptor-like serine/threonin...  69.3    1e-10   Eucalyptus grandis [rose gum]
sp|P93194.2|RPK1_IPONI  RecName: Full=Receptor-like protein kinas...  70.1    2e-10   Ipomoea nil [qian niu]
gb|KCW68814.1|  hypothetical protein EUGRSUZ_F02414                   68.9    2e-10   Eucalyptus grandis [rose gum]
gb|KJB16079.1|  hypothetical protein B456_002G211900                  68.9    3e-10   Gossypium raimondii
gb|KJB16078.1|  hypothetical protein B456_002G211900                  68.9    3e-10   Gossypium raimondii
ref|XP_010667749.1|  PREDICTED: receptor-like protein kinase HAIKU2   68.9    3e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB64050.1|  hypothetical protein B456_010G030600                  68.6    4e-10   Gossypium raimondii
ref|XP_006489957.1|  PREDICTED: probable leucine-rich repeat rece...  68.2    4e-10   
ref|XP_010110900.1|  Receptor-like protein kinase                     68.6    5e-10   Morus notabilis
ref|XP_002313944.2|  hypothetical protein POPTR_0009s08540g           68.6    5e-10   
ref|XP_004516063.1|  PREDICTED: receptor-like protein 12-like         68.6    5e-10   Cicer arietinum [garbanzo]
ref|XP_006359740.1|  PREDICTED: probably inactive leucine-rich re...  68.2    6e-10   Solanum tuberosum [potatoes]
gb|KFK43299.1|  hypothetical protein AALP_AA1G106000                  67.8    7e-10   Arabis alpina [alpine rockcress]
ref|XP_009628481.1|  PREDICTED: receptor-like protein kinase HAIKU2   67.8    7e-10   Nicotiana tomentosiformis
emb|CAN61202.1|  hypothetical protein VITISV_009745                   67.8    7e-10   Vitis vinifera
ref|XP_006353616.1|  PREDICTED: receptor-like protein kinase HAIK...  67.8    8e-10   
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...  67.8    8e-10   Phoenix dactylifera
gb|KCW83048.1|  hypothetical protein EUGRSUZ_B00013                   67.8    9e-10   Eucalyptus grandis [rose gum]
ref|XP_007018364.1|  Leucine-rich receptor-like protein kinase fa...  67.4    9e-10   
gb|KDP35915.1|  hypothetical protein JCGZ_09887                       67.4    9e-10   Jatropha curcas
gb|KEH19869.1|  LRR receptor-like kinase                              64.7    1e-09   Medicago truncatula
ref|XP_006450029.1|  hypothetical protein CICLE_v10013944mg           67.0    1e-09   
ref|XP_006852741.1|  hypothetical protein AMTR_s00033p00104210        67.4    1e-09   
ref|XP_003589790.1|  Receptor-like protein kinase                     67.4    1e-09   
ref|XP_010428087.1|  PREDICTED: receptor-like protein kinase HSL1     67.0    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010064752.1|  PREDICTED: probable leucine-rich repeat rece...  65.1    1e-09   
ref|XP_006421396.1|  hypothetical protein CICLE_v10004247mg           67.0    1e-09   
ref|XP_010064748.1|  PREDICTED: probable LRR receptor-like serine...  67.0    1e-09   
gb|AFK43911.1|  unknown                                               64.3    1e-09   Medicago truncatula
ref|XP_008439806.1|  PREDICTED: receptor-like protein kinase HSL1     67.0    1e-09   Cucumis melo [Oriental melon]
dbj|BAO76349.1|  leucine-rich repeat family protein                   65.1    2e-09   Winogradskyella sp. PG-2
ref|XP_007020154.1|  Leucine-rich receptor-like protein kinase fa...  66.2    2e-09   
gb|EAY76695.1|  hypothetical protein OsI_04648                        66.6    2e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001044979.1|  Os01g0878300                                     66.6    2e-09   
ref|XP_003522732.1|  PREDICTED: receptor-like protein kinase HAIK...  66.6    2e-09   Glycine max [soybeans]
gb|KGN49260.1|  hypothetical protein Csa_6G518150                     66.6    2e-09   Cucumis sativus [cucumbers]
ref|XP_008802938.1|  PREDICTED: receptor-like protein kinase HAIKU2   67.0    2e-09   
ref|XP_009780300.1|  PREDICTED: receptor-like protein kinase HAIKU2   66.6    2e-09   Nicotiana sylvestris
ref|XP_004140933.1|  PREDICTED: LRR receptor-like serine/threonin...  66.6    2e-09   Cucumis sativus [cucumbers]
ref|XP_008456679.1|  PREDICTED: receptor-like protein kinase HAIKU2   66.6    2e-09   Cucumis melo [Oriental melon]
ref|XP_004159444.1|  PREDICTED: LRR receptor-like serine/threonin...  66.6    2e-09   
ref|XP_006489992.1|  PREDICTED: leucine-rich repeat receptor prot...  63.2    2e-09   Citrus sinensis [apfelsine]
gb|KDO37282.1|  hypothetical protein CISIN_1g036127mg                 63.2    2e-09   Citrus sinensis [apfelsine]
ref|XP_010322765.1|  PREDICTED: receptor-like protein kinase HAIKU2   66.2    2e-09   Solanum lycopersicum
gb|EMS54777.1|  Receptor-like protein kinase HSL1                     65.9    2e-09   Triticum urartu
ref|XP_010471238.1|  PREDICTED: receptor-like protein kinase HSL1     65.9    3e-09   Camelina sativa [gold-of-pleasure]
gb|KJB60054.1|  hypothetical protein B456_009G287800                  65.9    3e-09   Gossypium raimondii
ref|XP_006489958.1|  PREDICTED: LRR receptor-like serine/threonin...  65.9    3e-09   
ref|NP_001235554.1|  receptor protein kinase-like protein             65.9    3e-09   Glycine max [soybeans]
gb|KHG27129.1|  Receptor-like protein kinase HAIKU2                   65.9    3e-09   Gossypium arboreum [tree cotton]
ref|XP_004292067.1|  PREDICTED: receptor-like protein kinase HAIKU2   65.9    3e-09   Fragaria vesca subsp. vesca
ref|XP_011002775.1|  PREDICTED: receptor-like protein kinase HAIKU2   65.9    3e-09   Populus euphratica
gb|KHM99087.1|  Putative LRR receptor-like serine/threonine-prote...  65.9    3e-09   Glycine soja [wild soybean]
ref|XP_008382378.1|  PREDICTED: receptor-like protein kinase HAIKU2   65.9    3e-09   Malus domestica [apple tree]
ref|XP_010064692.1|  PREDICTED: probable leucine-rich repeat rece...  65.1    3e-09   
ref|XP_008372891.1|  PREDICTED: receptor-like protein kinase HAIKU2   65.5    4e-09   
gb|KDO51477.1|  hypothetical protein CISIN_1g045571mg                 63.5    4e-09   Citrus sinensis [apfelsine]
ref|XP_006591868.1|  PREDICTED: receptor-like protein kinase HSL1...  65.5    4e-09   Glycine max [soybeans]
ref|NP_001241340.1|  receptor-like protein kinase HSL1-like           65.5    4e-09   Glycine max [soybeans]
ref|XP_009596212.1|  PREDICTED: receptor-like protein kinase isof...  65.5    5e-09   
gb|KCW84032.1|  hypothetical protein EUGRSUZ_B00906                   65.5    5e-09   Eucalyptus grandis [rose gum]
gb|KCW68815.1|  hypothetical protein EUGRSUZ_F024152                  64.7    5e-09   Eucalyptus grandis [rose gum]
ref|XP_006427073.1|  hypothetical protein CICLE_v10027424mg           63.2    5e-09   
ref|XP_004955463.1|  PREDICTED: leucine-rich repeat receptor-like...  65.5    5e-09   Setaria italica
ref|XP_009596210.1|  PREDICTED: receptor-like protein kinase isof...  65.5    5e-09   Nicotiana tomentosiformis
ref|XP_004952135.1|  PREDICTED: leucine-rich repeat receptor-like...  65.5    5e-09   Setaria italica
gb|ADB85326.1|  putative receptor protein kinase                      63.2    5e-09   Phyllostachys edulis [kikko-chiku]
ref|XP_002461464.1|  hypothetical protein SORBIDRAFT_02g003080        65.5    5e-09   
gb|KCW83107.1|  hypothetical protein EUGRSUZ_B00060                   65.1    5e-09   Eucalyptus grandis [rose gum]
ref|XP_009346454.1|  PREDICTED: receptor-like protein kinase HAIKU2   65.1    5e-09   
ref|XP_006345275.1|  PREDICTED: probable LRR receptor-like serine...  63.9    5e-09   
ref|NP_177363.1|  leucine-rich receptor-like protein kinase           65.1    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006386429.1|  leucine-rich repeat transmembrane protein ki...  65.1    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009385796.1|  PREDICTED: probable inactive receptor kinase...  64.7    6e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010414844.1|  PREDICTED: receptor-like protein kinase HSL1...  65.1    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010414842.1|  PREDICTED: receptor-like protein kinase HSL1...  65.1    6e-09   
ref|XP_003636112.1|  LRR receptor-like serine/threonine-protein k...  62.8    6e-09   
dbj|BAF00973.1|  putative leucine-rich receptor-like protein kinase   65.1    6e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KEH38645.1|  verticillium wilt disease resistance protein          65.1    6e-09   Medicago truncatula
ref|XP_010268649.1|  PREDICTED: receptor-like protein kinase HAIKU2   65.1    6e-09   Nelumbo nucifera [Indian lotus]
gb|KCW83054.1|  hypothetical protein EUGRSUZ_B000191                  65.1    6e-09   Eucalyptus grandis [rose gum]
ref|XP_008236214.1|  PREDICTED: receptor-like protein kinase HAIKU2   64.7    7e-09   Prunus mume [ume]
gb|EYU20424.1|  hypothetical protein MIMGU_mgv1a021116mg              64.3    7e-09   Erythranthe guttata [common monkey flower]
ref|XP_009408032.1|  PREDICTED: probable LRR receptor-like serine...  64.7    7e-09   
ref|XP_007023086.1|  Leucine-rich repeat receptor protein kinase ...  64.7    7e-09   
gb|KDO48827.1|  hypothetical protein CISIN_1g044860mg                 63.2    8e-09   Citrus sinensis [apfelsine]
ref|XP_010443528.1|  PREDICTED: probably inactive leucine-rich re...  64.3    8e-09   Camelina sativa [gold-of-pleasure]
gb|KJB36070.1|  hypothetical protein B456_006G139200                  64.3    8e-09   Gossypium raimondii
ref|XP_006427075.1|  hypothetical protein CICLE_v100269282mg          63.9    8e-09   
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...  64.7    9e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299841.2|  PREDICTED: receptor-like protein kinase HAIKU2   64.7    9e-09   Fragaria vesca subsp. vesca
ref|XP_010045705.1|  PREDICTED: probable LRR receptor-like serine...  64.3    9e-09   Eucalyptus grandis [rose gum]
ref|XP_006494783.1|  PREDICTED: probable LRR receptor-like serine...  64.7    9e-09   
ref|XP_006842942.1|  hypothetical protein AMTR_s00075p00179970        63.5    9e-09   
gb|AFW73724.1|  putative leucine-rich repeat receptor-like protei...  64.3    9e-09   
gb|KEH19902.1|  Serine/Threonine kinase, plant-type protein, puta...  63.2    1e-08   Medicago truncatula
ref|XP_002263151.3|  PREDICTED: LRR receptor-like serine/threonin...  64.3    1e-08   Vitis vinifera
ref|NP_001048946.2|  Os03g0145000                                     64.3    1e-08   
ref|XP_002271143.2|  PREDICTED: receptor-like protein kinase HAIKU2   64.3    1e-08   Vitis vinifera
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor         63.9    1e-08   
ref|XP_002531997.1|  Receptor protein kinase CLAVATA1 precursor, ...  63.9    1e-08   Ricinus communis
ref|XP_006468120.1|  PREDICTED: probable LRR receptor-like serine...  63.9    1e-08   
dbj|BAJ88113.1|  predicted protein                                    63.9    1e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS70847.1|  hypothetical protein M569_03906                       63.9    1e-08   Genlisea aurea
gb|KDO36330.1|  hypothetical protein CISIN_1g035904mg                 62.8    1e-08   Citrus sinensis [apfelsine]
gb|EAY88517.1|  hypothetical protein OsI_09989                        63.9    1e-08   Oryza sativa Indica Group [Indian rice]
gb|KDO42499.1|  hypothetical protein CISIN_1g023193mg                 62.4    1e-08   Citrus sinensis [apfelsine]
gb|AFW76643.1|  putative leucine-rich repeat receptor-like protei...  63.9    1e-08   
gb|KDO48988.1|  hypothetical protein CISIN_1g036229mg                 63.9    1e-08   Citrus sinensis [apfelsine]
ref|XP_008339015.1|  PREDICTED: receptor-like protein kinase HAIKU2   63.9    1e-08   
ref|XP_006468119.1|  PREDICTED: probable LRR receptor-like serine...  63.9    1e-08   Citrus sinensis [apfelsine]
emb|CAN65551.1|  hypothetical protein VITISV_033329                   63.9    1e-08   Vitis vinifera
gb|KJB54982.1|  hypothetical protein B456_009G056800                  63.9    1e-08   Gossypium raimondii
ref|XP_010483372.1|  PREDICTED: probably inactive leucine-rich re...  63.9    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008455491.1|  PREDICTED: receptor-like protein kinase HSL1     63.9    2e-08   Cucumis melo [Oriental melon]
ref|XP_004235511.1|  PREDICTED: receptor-like protein kinase          63.9    2e-08   Solanum lycopersicum
gb|KHG14193.1|  hypothetical protein F383_07227                       63.5    2e-08   Gossypium arboreum [tree cotton]
ref|XP_001759642.1|  predicted protein                                63.5    2e-08   
ref|XP_007026631.1|  LRR receptor-like serine/threonine-protein k...  63.5    2e-08   
ref|XP_004974753.1|  PREDICTED: leucine-rich repeat receptor-like...  63.2    2e-08   Setaria italica
ref|XP_006658283.1|  PREDICTED: leucine-rich repeat receptor-like...  63.5    2e-08   Oryza brachyantha
gb|KCW75741.1|  hypothetical protein EUGRSUZ_D00120                   63.5    2e-08   Eucalyptus grandis [rose gum]
ref|XP_008466102.1|  PREDICTED: receptor-like protein kinase HAIKU2   63.5    2e-08   Cucumis melo [Oriental melon]
ref|XP_003630689.1|  Leucine-rich repeat receptor protein kinase EXS  62.8    2e-08   Medicago truncatula
ref|XP_007142376.1|  hypothetical protein PHAVU_008G275000g           63.2    2e-08   Phaseolus vulgaris [French bean]
gb|KCW75740.1|  hypothetical protein EUGRSUZ_D00120                   63.5    2e-08   Eucalyptus grandis [rose gum]
ref|XP_002314669.2|  hypothetical protein POPTR_0010s09310g           62.8    2e-08   
ref|XP_003552234.1|  PREDICTED: probable LRR receptor-like serine...  63.5    2e-08   
ref|XP_006421394.1|  hypothetical protein CICLE_v10006797mg           63.2    2e-08   
ref|XP_004302375.1|  PREDICTED: probable inactive receptor kinase...  63.2    2e-08   Fragaria vesca subsp. vesca
gb|KDO40366.1|  hypothetical protein CISIN_1g037027mg                 60.8    2e-08   Citrus sinensis [apfelsine]
ref|XP_004963298.1|  PREDICTED: receptor-like protein kinase HAIK...  63.2    2e-08   
ref|WP_020569811.1|  hypothetical protein                             63.5    2e-08   
ref|XP_010064755.1|  PREDICTED: probable leucine-rich repeat rece...  63.2    2e-08   
ref|XP_003526519.1|  PREDICTED: receptor-like protein kinase HAIK...  63.2    2e-08   Glycine max [soybeans]
ref|XP_010054208.1|  PREDICTED: probable leucine-rich repeat rece...  63.2    2e-08   
gb|EYU34350.1|  hypothetical protein MIMGU_mgv1a020582mg              63.2    2e-08   Erythranthe guttata [common monkey flower]
ref|XP_010045748.1|  PREDICTED: probable LRR receptor-like serine...  63.2    2e-08   
gb|KHG27799.1|  Receptor-like protein kinase HSL1                     63.2    2e-08   Gossypium arboreum [tree cotton]
ref|XP_004976562.1|  PREDICTED: probable LRR receptor-like serine...  63.2    2e-08   Setaria italica
ref|XP_009394911.1|  PREDICTED: LRR receptor-like serine/threonin...  63.2    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011073656.1|  PREDICTED: LRR receptor-like serine/threonin...  63.2    2e-08   Sesamum indicum [beniseed]
ref|XP_009378558.1|  PREDICTED: receptor-like protein kinase HAIKU2   63.2    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_010064760.1|  PREDICTED: probable leucine-rich repeat rece...  61.6    2e-08   
ref|XP_006575703.1|  PREDICTED: probable inactive receptor kinase...  62.8    2e-08   Glycine max [soybeans]
ref|XP_006493639.1|  PREDICTED: LRR receptor-like serine/threonin...  63.2    2e-08   
ref|XP_007041450.1|  Leucine-rich receptor-like protein kinase fa...  63.2    3e-08   
ref|XP_010547240.1|  PREDICTED: receptor-like protein kinase 5        62.8    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_004964941.1|  PREDICTED: LRR receptor-like serine/threonin...  62.8    3e-08   Setaria italica
ref|XP_010267182.1|  PREDICTED: probably inactive leucine-rich re...  62.8    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_009132248.1|  PREDICTED: probably inactive leucine-rich re...  60.8    3e-08   Brassica rapa
ref|XP_006422685.1|  hypothetical protein CICLE_v10027748mg           62.8    3e-08   Citrus clementina [clementine]
ref|XP_006306692.1|  hypothetical protein CARUB_v10008210mg           62.8    3e-08   Capsella rubella
tpg|DAA46730.1|  TPA: putative leucine-rich repeat receptor-like ...  62.8    3e-08   
ref|XP_004309904.1|  PREDICTED: receptor-like protein kinase HSL1     62.8    3e-08   Fragaria vesca subsp. vesca
ref|XP_011033036.1|  PREDICTED: leucine-rich repeat receptor-like...  62.8    3e-08   Populus euphratica
ref|XP_008649763.1|  PREDICTED: probably inactive leucine-rich re...  62.8    3e-08   Zea mays [maize]
gb|EYU38079.1|  hypothetical protein MIMGU_mgv1a025172mg              62.4    3e-08   Erythranthe guttata [common monkey flower]
ref|XP_006441549.1|  hypothetical protein CICLE_v10018710mg           62.8    3e-08   Citrus clementina [clementine]
ref|XP_008786487.1|  PREDICTED: receptor-like protein kinase HSL1     62.8    3e-08   
ref|XP_004964942.1|  PREDICTED: LRR receptor-like serine/threonin...  62.8    3e-08   Setaria italica
ref|XP_008659490.1|  PREDICTED: leucine-rich repeat receptor-like...  62.8    3e-08   Zea mays [maize]
ref|XP_010497183.1|  PREDICTED: probable inactive leucine-rich re...  60.5    3e-08   
gb|AAG52992.2|  receptor-like protein kinase INRPK1a                  62.4    3e-08   Ipomoea nil [qian niu]
ref|XP_006427729.1|  hypothetical protein CICLE_v10024756mg           62.8    3e-08   Citrus clementina [clementine]
dbj|BAK02121.1|  predicted protein                                    62.4    3e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW68818.1|  hypothetical protein EUGRSUZ_F02419                   62.8    3e-08   Eucalyptus grandis [rose gum]
ref|XP_009357239.1|  PREDICTED: receptor-like protein kinase HAIKU2   62.8    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_002263186.3|  PREDICTED: LRR receptor-like serine/threonin...  62.4    4e-08   Vitis vinifera
ref|XP_002446972.1|  hypothetical protein SORBIDRAFT_06g026090        62.8    4e-08   
emb|CBI29425.3|  unnamed protein product                              62.4    4e-08   
ref|XP_009393471.1|  PREDICTED: receptor-like protein kinase HAIKU2   62.4    4e-08   
ref|XP_006465462.1|  PREDICTED: LRR receptor-like serine/threonin...  62.4    4e-08   
gb|KDO38769.1|  hypothetical protein CISIN_1g0355121mg                60.5    4e-08   
ref|XP_006486805.1|  PREDICTED: receptor-like protein kinase HAIK...  62.4    4e-08   
ref|XP_010086855.1|  putative LRR receptor-like serine/threonine-...  62.4    4e-08   
ref|XP_010684496.1|  PREDICTED: receptor-like protein kinase HSL1     62.4    4e-08   
gb|EYU36421.1|  hypothetical protein MIMGU_mgv1a000813mg              62.4    4e-08   
gb|AFK35762.1|  unknown                                               60.5    4e-08   
gb|KDO38679.1|  hypothetical protein CISIN_1g023644mg                 60.8    4e-08   
gb|EYU41358.1|  hypothetical protein MIMGU_mgv1a000915mg              62.4    4e-08   
gb|KDO67927.1|  hypothetical protein CISIN_1g002250mg                 62.4    4e-08   
ref|XP_010051688.1|  PREDICTED: receptor-like protein 2               59.3    4e-08   
ref|XP_010453248.1|  PREDICTED: probably inactive leucine-rich re...  62.4    4e-08   
ref|XP_004506661.1|  PREDICTED: leucine-rich repeat receptor prot...  62.4    4e-08   
ref|XP_010544042.1|  PREDICTED: receptor-like protein kinase HAIKU2   62.4    4e-08   
ref|XP_006465465.1|  PREDICTED: probable LRR receptor-like serine...  62.4    4e-08   
ref|XP_006465463.1|  PREDICTED: probable LRR receptor-like serine...  62.4    4e-08   
gb|ACM89591.1|  leucine-rich repeat family protein / protein kina...  62.4    4e-08   
ref|NP_001159226.1|  uncharacterized LOC100304312                     62.0    4e-08   
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...  62.4    5e-08   
ref|XP_009617928.1|  PREDICTED: probable inactive receptor kinase...  62.0    5e-08   
ref|XP_004982365.1|  PREDICTED: leucine-rich repeat extensin-like...  61.6    5e-08   
ref|XP_010064693.1|  PREDICTED: probable LRR receptor-like serine...  62.0    5e-08   
gb|KEH19876.1|  LRR receptor-like kinase family protein               60.1    5e-08   
ref|XP_011016947.1|  PREDICTED: receptor-like protein kinase HAIKU2   62.0    5e-08   
ref|XP_001764577.1|  predicted protein                                62.0    5e-08   
gb|KCW83108.1|  hypothetical protein EUGRSUZ_B00062                   62.0    5e-08   
ref|XP_006659458.1|  PREDICTED: receptor-like protein kinase-like     62.0    5e-08   
ref|XP_006465573.1|  PREDICTED: probable LRR receptor-like serine...  62.0    5e-08   
ref|XP_002889779.1|  hypothetical protein ARALYDRAFT_888250           62.0    5e-08   
ref|XP_006465577.1|  PREDICTED: probable LRR receptor-like serine...  62.0    5e-08   
ref|XP_010553167.1|  PREDICTED: leucine-rich repeat receptor-like...  62.0    5e-08   
ref|XP_006465578.1|  PREDICTED: probable LRR receptor-like serine...  62.0    5e-08   
ref|XP_010063638.1|  PREDICTED: receptor-like protein kinase          62.0    5e-08   
gb|EYU24843.1|  hypothetical protein MIMGU_mgv1a023040mg              62.0    5e-08   
ref|XP_007139651.1|  hypothetical protein PHAVU_008G047800g           62.0    5e-08   
ref|XP_006465575.1|  PREDICTED: probable LRR receptor-like serine...  62.0    5e-08   
ref|XP_006465579.1|  PREDICTED: probable LRR receptor-like serine...  62.0    5e-08   
ref|XP_006465576.1|  PREDICTED: probable LRR receptor-like serine...  62.0    5e-08   
ref|XP_010045481.1|  PREDICTED: probable LRR receptor-like serine...  62.0    6e-08   
gb|KDO40432.1|  hypothetical protein CISIN_1g045837mg                 61.6    6e-08   
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...  62.0    6e-08   
gb|KDO35965.1|  hypothetical protein CISIN_1g041953mg                 60.5    6e-08   
ref|XP_009389012.1|  PREDICTED: leucine-rich repeat extensin-like...  61.2    6e-08   
ref|XP_003541774.1|  PREDICTED: receptor-like protein kinase HAIK...  62.0    6e-08   
ref|XP_006602649.1|  PREDICTED: probable LRR receptor-like serine...  62.0    6e-08   
gb|EMT31747.1|  LRR receptor-like serine/threonine-protein kinase...  62.0    6e-08   
ref|XP_010912643.1|  PREDICTED: receptor-like protein kinase HSL1     61.6    6e-08   
gb|KEH36110.1|  LRR receptor-like kinase                              61.6    6e-08   
ref|XP_004303132.1|  PREDICTED: leucine-rich repeat extensin-like...  61.2    6e-08   
ref|XP_006363632.1|  PREDICTED: receptor-like protein 12-like         61.6    6e-08   
ref|XP_006421393.1|  hypothetical protein CICLE_v10007058mg           61.6    7e-08   
ref|XP_008244025.1|  PREDICTED: receptor-like protein 12              61.6    7e-08   
ref|XP_006602650.1|  PREDICTED: probable LRR receptor-like serine...  61.6    7e-08   
ref|XP_007213694.1|  hypothetical protein PRUPE_ppa000813mg           61.6    7e-08   
ref|XP_004230831.1|  PREDICTED: pollen-specific leucine-rich repe...  61.6    7e-08   
ref|XP_006465521.1|  PREDICTED: leucine-rich repeat receptor-like...  60.8    7e-08   
ref|XP_010454375.1|  PREDICTED: probable inactive leucine-rich re...  61.6    7e-08   
ref|XP_003567675.1|  PREDICTED: pollen-specific leucine-rich repe...  61.2    7e-08   
emb|CDX72876.1|  BnaC06g33240D                                        61.6    7e-08   
ref|XP_006421395.1|  hypothetical protein CICLE_v10004229mg           61.6    7e-08   
gb|EEE68782.1|  hypothetical protein OsJ_27504                        61.6    7e-08   
gb|AAD55979.1|AF159296_1  extensin-like protein                       61.2    8e-08   
ref|XP_002887421.1|  hypothetical protein ARALYDRAFT_476351           61.6    8e-08   
ref|XP_011081773.1|  PREDICTED: probably inactive leucine-rich re...  61.6    8e-08   
ref|XP_004501071.1|  PREDICTED: receptor-like protein kinase HAIK...  61.6    8e-08   
ref|XP_006427090.1|  hypothetical protein CICLE_v10026978mg           61.6    8e-08   
ref|XP_004233342.1|  PREDICTED: probable inactive receptor kinase...  61.2    8e-08   
ref|XP_004148679.1|  PREDICTED: probable inactive receptor kinase...  61.2    8e-08   
ref|XP_002992971.1|  hypothetical protein SELMODRAFT_136258           60.1    8e-08   
gb|KJB59645.1|  hypothetical protein B456_009G265300                  61.6    8e-08   
gb|AFW59133.1|  putative leucine-rich repeat receptor-like protei...  61.6    8e-08   
ref|XP_008458707.1|  PREDICTED: probable inactive receptor kinase...  61.2    8e-08   
ref|XP_002991811.1|  hypothetical protein SELMODRAFT_134330           60.1    8e-08   
gb|KHN27593.1|  Putative LRR receptor-like serine/threonine-prote...  58.5    8e-08   
gb|KDO45821.1|  hypothetical protein CISIN_1g002063mg                 61.2    8e-08   
ref|NP_001061927.1|  Os08g0446400                                     60.8    8e-08   
ref|XP_009335487.1|  PREDICTED: receptor-like protein kinase HAIKU2   61.2    9e-08   
ref|XP_010064761.1|  PREDICTED: probable LRR receptor-like serine...  61.2    9e-08   
dbj|BAD09494.1|  putative receptor-like protein kinase                61.2    9e-08   
ref|XP_006659459.1|  PREDICTED: receptor-like protein kinase-like     61.2    9e-08   
ref|XP_008795324.1|  PREDICTED: receptor-like protein kinase HSL1     61.6    9e-08   
ref|XP_011033024.1|  PREDICTED: receptor-like protein kinase isof...  61.2    9e-08   
ref|XP_011033023.1|  PREDICTED: receptor-like protein kinase isof...  61.2    9e-08   
ref|XP_007217616.1|  hypothetical protein PRUPE_ppa016276mg           61.2    9e-08   
ref|XP_009105677.1|  PREDICTED: probable LRR receptor-like serine...  61.2    9e-08   
ref|XP_011081775.1|  PREDICTED: probably inactive leucine-rich re...  61.2    9e-08   
emb|CDY38780.1|  BnaA07g28520D                                        61.2    9e-08   
gb|KEH36109.1|  LRR receptor-like kinase                              61.2    9e-08   
ref|XP_006493622.1|  PREDICTED: LRR receptor-like serine/threonin...  61.2    9e-08   
gb|KDO45819.1|  hypothetical protein CISIN_1g002063mg                 61.2    9e-08   
tpg|DAA58808.1|  TPA: leucine-rich repeat (LRR) family protein        60.8    1e-07   
gb|KDO46301.1|  hypothetical protein CISIN_1g001275mg                 61.2    1e-07   
gb|KJB83100.1|  hypothetical protein B456_013G229400                  60.5    1e-07   
ref|XP_006478192.1|  PREDICTED: receptor-like protein kinase HAIK...  61.2    1e-07   
gb|KJB58765.1|  hypothetical protein B456_009G225300                  61.2    1e-07   
ref|XP_010272145.1|  PREDICTED: probable inactive receptor kinase...  60.8    1e-07   
ref|NP_001045656.1|  Os02g0111800                                     61.2    1e-07   
dbj|BAJ91032.1|  predicted protein                                    60.5    1e-07   
gb|EAY84170.1|  hypothetical protein OsI_05549                        61.2    1e-07   
ref|XP_002521777.1|  Receptor protein kinase CLAVATA1 precursor, ...  61.2    1e-07   
ref|XP_006412962.1|  hypothetical protein EUTSA_v10027136mg           60.5    1e-07   
ref|XP_006492015.1|  PREDICTED: leucine-rich repeat receptor-like...  61.2    1e-07   
gb|EAZ21469.1|  hypothetical protein OsJ_05076                        61.2    1e-07   
ref|XP_006494784.1|  PREDICTED: probable LRR receptor-like serine...  61.2    1e-07   
ref|XP_010472587.1|  PREDICTED: probably inactive leucine-rich re...  60.8    1e-07   
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...  60.8    1e-07   
ref|XP_004503256.1|  PREDICTED: probable inactive receptor kinase...  60.8    1e-07   
gb|ABF99108.1|  Receptor protein kinase CLAVATA1 precursor, putat...  60.8    1e-07   
ref|XP_009104866.1|  PREDICTED: receptor-like protein kinase HSL1     60.8    1e-07   
ref|XP_006357131.1|  PREDICTED: probable inactive receptor kinase...  60.8    1e-07   
ref|XP_006651034.1|  PREDICTED: leucine-rich repeat receptor-like...  60.8    1e-07   
ref|XP_006375015.1|  hypothetical protein POPTR_0014s03600g           60.5    1e-07   
ref|XP_009333988.1|  PREDICTED: receptor-like protein kinase          60.8    1e-07   
ref|XP_010103492.1|  Receptor-like protein kinase HSL1                60.8    1e-07   
gb|EAY92008.1|  hypothetical protein OsI_13698                        60.8    1e-07   
ref|XP_010065822.1|  PREDICTED: receptor-like protein kinase HAIKU2   60.8    1e-07   
ref|XP_010107637.1|  Receptor-like protein kinase HAIKU2              60.8    1e-07   
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg           60.8    1e-07   
gb|KCW63493.1|  hypothetical protein EUGRSUZ_G01123                   60.8    1e-07   
ref|XP_008669002.1|  PREDICTED: probable LRR receptor-like serine...  60.8    1e-07   
dbj|BAK02212.1|  predicted protein                                    60.8    1e-07   
gb|AAP68887.1|  putative receptor-like protein kinase 1               60.8    1e-07   
ref|XP_009379270.1|  PREDICTED: receptor-like protein kinase HAIKU2   60.8    1e-07   
gb|KCW68461.1|  hypothetical protein EUGRSUZ_F02121                   60.8    1e-07   
gb|AAL12626.1|  leucine-rich repeat receptor-like kinase F21M12.36    60.8    1e-07   
ref|XP_008652733.1|  PREDICTED: putative leucine-rich repeat rece...  60.8    1e-07   
emb|CDP20234.1|  unnamed protein product                              60.8    1e-07   
ref|NP_172468.3|  leucine-rich receptor-like protein kinase           60.8    1e-07   
ref|XP_008225155.1|  PREDICTED: receptor-like protein kinase HSL1     60.8    1e-07   
ref|XP_002310940.2|  leucine-rich repeat transmembrane protein ki...  60.8    1e-07   
gb|KDO47840.1|  hypothetical protein CISIN_1g048688mg                 58.9    1e-07   
ref|XP_007227019.1|  hypothetical protein PRUPE_ppa001010mg           60.8    1e-07   
ref|XP_002325137.2|  leucine-rich repeat transmembrane protein ki...  60.8    1e-07   
gb|KCW73213.1|  hypothetical protein EUGRSUZ_E016741                  60.8    1e-07   
ref|XP_006848210.1|  hypothetical protein AMTR_s00029p00242610        59.3    1e-07   
gb|KCW68460.1|  hypothetical protein EUGRSUZ_F02120                   60.8    1e-07   
ref|NP_850942.1|  leucine-rich receptor-like protein kinase           60.8    1e-07   
emb|CBI25073.3|  unnamed protein product                              60.5    1e-07   
gb|KHN44768.1|  Putative LRR receptor-like serine/threonine-prote...  60.8    1e-07   
gb|KHN27325.1|  Putative leucine-rich repeat receptor-like protei...  60.8    1e-07   
ref|XP_011083980.1|  PREDICTED: probable LRR receptor-like serine...  60.5    1e-07   
ref|XP_002462351.1|  hypothetical protein SORBIDRAFT_02g024230        60.5    1e-07   
ref|XP_010509685.1|  PREDICTED: receptor-like protein 12              60.5    1e-07   
ref|XP_003545194.1|  PREDICTED: probable LRR receptor-like serine...  60.8    1e-07   
gb|KEH43816.1|  LRR/extensin 2                                        60.1    1e-07   
ref|XP_010930577.1|  PREDICTED: receptor-like protein kinase HSL1     60.5    1e-07   
gb|KJB14547.1|  hypothetical protein B456_002G130500                  60.5    1e-07   
gb|KCW83052.1|  hypothetical protein EUGRSUZ_B00018                   60.1    1e-07   
gb|KFK40345.1|  hypothetical protein AALP_AA3G362000                  57.8    1e-07   
ref|XP_006607007.1|  PREDICTED: probable leucine-rich repeat rece...  60.8    1e-07   
ref|XP_007012155.1|  Probably inactive leucine-rich repeat recept...  60.5    2e-07   
ref|XP_010058554.1|  PREDICTED: probable leucine-rich repeat rece...  60.5    2e-07   
gb|KHN11557.1|  Putative LRR receptor-like serine/threonine-prote...  60.5    2e-07   
gb|KEH25178.1|  LRR receptor-like kinase family protein               60.5    2e-07   
ref|XP_008455077.1|  PREDICTED: receptor-like protein kinase HAIKU2   60.5    2e-07   
ref|XP_010668734.1|  PREDICTED: receptor-like protein kinase HSL1     60.5    2e-07   
ref|XP_011022378.1|  PREDICTED: probable LRR receptor-like serine...  60.5    2e-07   
ref|XP_010467927.1|  PREDICTED: leucine-rich repeat extensin-like...  59.7    2e-07   
ref|XP_007137286.1|  hypothetical protein PHAVU_009G114500g           60.5    2e-07   
dbj|BAJ91649.1|  predicted protein                                    59.7    2e-07   
ref|XP_001754607.1|  CLL2 clavata1-like receptor S/T protein kina...  60.5    2e-07   
ref|XP_006477604.1|  PREDICTED: probable LRR receptor-like serine...  60.5    2e-07   
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...  60.5    2e-07   
ref|XP_002869498.1|  hypothetical protein ARALYDRAFT_491919           60.5    2e-07   
ref|XP_006857826.1|  hypothetical protein AMTR_s00069p00033900        60.1    2e-07   
emb|CDO97335.1|  unnamed protein product                              60.5    2e-07   
ref|XP_002968766.1|  hypothetical protein SELMODRAFT_90752            60.1    2e-07   
gb|KEH19878.1|  LRR receptor-like kinase                              58.2    2e-07   
ref|XP_010268651.1|  PREDICTED: LRR receptor-like serine/threonin...  60.5    2e-07   
gb|KHG09451.1|  hypothetical protein F383_09289                       60.5    2e-07   
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480        60.1    2e-07   
ref|XP_011018027.1|  PREDICTED: probable LRR receptor-like serine...  60.1    2e-07   
gb|KHN07496.1|  Putative leucine-rich repeat receptor-like protei...  60.5    2e-07   
ref|XP_002980529.1|  hypothetical protein SELMODRAFT_233539           60.1    2e-07   
ref|XP_002976801.1|  hypothetical protein SELMODRAFT_268021           60.1    2e-07   
ref|XP_006602866.1|  PREDICTED: probable LRR receptor-like serine...  60.1    2e-07   
gb|KDO54556.1|  hypothetical protein CISIN_1g001384mg                 60.1    2e-07   
emb|CDP13903.1|  unnamed protein product                              60.1    2e-07   
ref|XP_006298126.1|  hypothetical protein CARUB_v10014170mg           59.3    2e-07   
ref|XP_011030644.1|  PREDICTED: leucine-rich repeat extensin-like...  59.7    2e-07   
ref|XP_004250411.1|  PREDICTED: receptor-like protein kinase HAIKU2   60.1    2e-07   
ref|XP_006358999.1|  PREDICTED: receptor-like protein 12-like         60.1    2e-07   
gb|KJB61628.1|  hypothetical protein B456_009G3713001                 60.1    2e-07   
gb|KHN40541.1|  Putative LRR receptor-like serine/threonine-prote...  60.1    2e-07   
ref|XP_010249537.1|  PREDICTED: probably inactive leucine-rich re...  60.1    2e-07   
ref|XP_010249536.1|  PREDICTED: probably inactive leucine-rich re...  60.1    2e-07   
ref|XP_006650609.1|  PREDICTED: LRR receptor-like serine/threonin...  60.1    2e-07   
ref|XP_011030760.1|  PREDICTED: pollen-specific leucine-rich repe...  60.1    2e-07   
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...  60.1    2e-07   
ref|XP_007199705.1|  hypothetical protein PRUPE_ppa000895mg           60.1    2e-07   
ref|XP_008793696.1|  PREDICTED: leucine-rich repeat receptor-like...  59.7    2e-07   
ref|XP_003589782.1|  Receptor protein kinase-like protein             60.1    2e-07   
gb|KEH15982.1|  LRR receptor-like kinase family protein               60.1    2e-07   
gb|ABF73316.1|  clavata-like receptor                                 60.1    2e-07   
ref|XP_003589777.1|  Receptor protein kinase-like protein             60.1    2e-07   
gb|EMT18303.1|  Receptor-like protein kinase HSL1                     60.1    2e-07   
ref|XP_010547578.1|  PREDICTED: LRR receptor-like serine/threonin...  60.1    2e-07   
ref|XP_009381187.1|  PREDICTED: receptor-like protein kinase HSL1     60.1    2e-07   
gb|EMT26063.1|  Putative LRR receptor-like serine/threonine-prote...  57.4    2e-07   
ref|XP_006602872.1|  PREDICTED: probable LRR receptor-like serine...  60.1    2e-07   
gb|KCW68462.1|  hypothetical protein EUGRSUZ_F02122                   60.1    2e-07   
ref|XP_006465464.1|  PREDICTED: probable LRR receptor-like serine...  60.1    2e-07   
ref|XP_006664773.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  60.1    2e-07   
ref|XP_010064694.1|  PREDICTED: probable LRR receptor-like serine...  60.1    2e-07   
ref|XP_009144482.1|  PREDICTED: receptor-like protein kinase HAIKU2   60.1    2e-07   
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  59.7    2e-07   
ref|XP_006607008.1|  PREDICTED: LRR receptor-like serine/threonin...  60.1    2e-07   
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...  60.1    2e-07   
ref|XP_010097599.1|  LRR receptor-like serine/threonine-protein k...  60.1    2e-07   
gb|EMS64651.1|  Receptor-like protein kinase HSL1                     60.1    2e-07   
gb|AFW60504.1|  putative leucine-rich repeat receptor-like protei...  57.0    3e-07   
ref|XP_003577685.2|  PREDICTED: receptor-like protein kinase HSL1     60.1    3e-07   
ref|XP_009395807.1|  PREDICTED: probable inactive receptor kinase...  59.7    3e-07   
ref|XP_006421398.1|  hypothetical protein CICLE_v10004266mg           59.7    3e-07   
ref|XP_006470176.1|  PREDICTED: receptor-like protein kinase 5-like   59.7    3e-07   
ref|NP_197569.2|  probable inactive leucine-rich repeat receptor-...  59.7    3e-07   
ref|XP_009406402.1|  PREDICTED: probable inactive receptor kinase...  59.7    3e-07   
ref|XP_010416652.1|  PREDICTED: leucine-rich repeat extensin-like...  59.3    3e-07   



>ref|XP_009764826.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=958

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +2

Query  188  QARLDDQSEFFTAMKKSFTGSLMGRWDGEA-VCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            Q  ++DQS+FF  MKKS TG+ +  WD E  +C+Y+GV CD++  + KIDVSGWS+SG+F
Sbjct  20   QGTINDQSQFFVVMKKSLTGNSLSNWDSEKPLCQYKGVGCDNQGNITKIDVSGWSLSGQF  79

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
            P DVC+YLP+L+++ + HN F GGFP S+T+CSFLEELNM+AT+LTG +PDLSPLQ+L+ 
Sbjct  80   PNDVCTYLPRLQIVHLSHNNFQGGFPKSITNCSFLEELNMSATSLTGQIPDLSPLQSLKL  139

Query  545  LDLSYN  562
            LDLS N
Sbjct  140  LDLSNN  145



>ref|XP_009631895.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana tomentosiformis]
Length=958

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +2

Query  188  QARLDDQSEFFTAMKKSFTGSLMGRWDGEA-VCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            Q  ++DQS+FF  MKKS TG+ +  WD E  +C+Y+G+ CD++  + KIDVSGWS+SG+F
Sbjct  20   QGTINDQSQFFVLMKKSLTGNSLSNWDIEKPLCQYKGIGCDNQGNITKIDVSGWSLSGQF  79

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
            P DVC+YLP+L++L + HN F GGFP S+T+CSFLEELNM+AT+LTG +PDLSPLQ+L+ 
Sbjct  80   PNDVCTYLPRLQILHLSHNNFQGGFPKSITNCSFLEELNMSATSLTGQIPDLSPLQSLKL  139

Query  545  LDLSYN  562
            LDLS N
Sbjct  140  LDLSNN  145



>ref|XP_010268650.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=951

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 102/133 (77%), Gaps = 5/133 (4%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWD----GEA-VCEYRGVVCDDKDYVVKIDVSGW  346
            S+Q  +D+QS FFT MK S +G  + RWD    GE   C Y G+ C+D+ YV+K+DVSGW
Sbjct  20   SFQTTVDNQSHFFTLMKHSLSGKSLSRWDVFIPGEKPYCNYTGISCNDEGYVIKVDVSGW  79

Query  347  SISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSP  526
            S+SG+FP +VC+YLPKL +LR+ HN   G FP  +++CS LEELNMT++++TG+LPDLSP
Sbjct  80   SLSGQFPANVCNYLPKLHILRLSHNDLRGSFPVGISNCSLLEELNMTSSSITGTLPDLSP  139

Query  527  LQALRALDLSYNL  565
            +++LR LDLSYNL
Sbjct  140  MKSLRILDLSYNL  152



>emb|CDP00973.1| unnamed protein product [Coffea canephora]
Length=1006

 Score =   169 bits (428),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGD  373
            +QS+FFT M+ S +G+L+  WD    +  C Y+GV C+++ YV KID+SGWS+SG+FP D
Sbjct  75   NQSQFFTLMRTSLSGNLLSNWDVSKDQNFCNYQGVGCNNQGYVEKIDISGWSLSGQFPED  134

Query  374  VCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDL  553
            VCSYLP+LR+LR+GHN  HG FP S+T+CS LEEL M++  LTGSLPDLSPL ++R+LDL
Sbjct  135  VCSYLPELRILRLGHNNLHGSFPSSITNCSLLEELEMSSAYLTGSLPDLSPLNSMRSLDL  194

Query  554  SYN  562
            SYN
Sbjct  195  SYN  197



>ref|XP_004238044.1| PREDICTED: receptor-like protein kinase HSL1 [Solanum lycopersicum]
Length=957

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSLMGRWDGEA-VCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVC  379
            DQS+FF  MKK  TGS +  WD E  +C+YRGV CDD+  V+KI++S W +SG+FP DVC
Sbjct  23   DQSQFFLLMKKFVTGSSLSNWDIEKPICQYRGVGCDDRGNVIKINISAWYLSGQFPSDVC  82

Query  380  SYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSY  559
            SYLP+L+ L +GHN F GGFP  L +CS LEELNMT T+LTG +PDLSPL++LR LDLS 
Sbjct  83   SYLPRLKSLHIGHNNFQGGFPKYLINCSLLEELNMTKTSLTGQIPDLSPLKSLRVLDLSC  142

Query  560  N  562
            N
Sbjct  143  N  143



>ref|XP_006356797.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=955

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 95/121 (79%), Gaps = 1/121 (1%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSLMGRWD-GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVC  379
            DQS+FF  MKK  TGS +  WD G+ +C+Y+GV CD++  V+KI++S W +SG+FP DVC
Sbjct  24   DQSQFFVLMKKFVTGSSLSNWDIGKPICQYKGVGCDERGDVIKINISAWYLSGQFPSDVC  83

Query  380  SYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSY  559
            SY P+L+ L +GHN F GGFP  LT+CSFLEELNMT T+LTG +PDLSP+Q+L+ LDLS 
Sbjct  84   SYFPRLKSLHIGHNNFQGGFPKYLTNCSFLEELNMTKTSLTGQIPDLSPIQSLKLLDLSC  143

Query  560  N  562
            N
Sbjct  144  N  144



>ref|XP_009599063.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana tomentosiformis]
Length=950

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +2

Query  170  SVSGSYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWS  349
            ++S   Q  +++QS+FF  +KKS  G+ +  WDG+ +C + GV CDD+  V+KID+ GWS
Sbjct  15   AISSFCQGTINEQSQFFALLKKSVKGNSLSDWDGKPICNFSGVGCDDQGNVIKIDLFGWS  74

Query  350  ISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPL  529
            +SG FP DVCS+ P LR+LR+G+N F G FP  +T+CS LEELNM +T+ TG LPDLSPL
Sbjct  75   LSGLFPDDVCSFFPGLRILRLGNNNFQGAFPSYITNCSHLEELNMVSTSFTGPLPDLSPL  134

Query  530  QALRALDLSYN  562
            Q+LR L+LSYN
Sbjct  135  QSLRLLNLSYN  145


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +V +D+S   ++G+ P  +C  LPKL+VL++ +N   G FP SL + + L  L++    L
Sbjct  259  LVDLDMSVNRLTGKIPESICR-LPKLQVLQIYNNTISGDFPASLANSTTLTILSLYDNYL  317

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            TG +P +     AL ALDLS N
Sbjct  318  TGEIPHNFGVSSALLALDLSEN  339



>ref|XP_010271555.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=952

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 97/131 (74%), Gaps = 5/131 (4%)
 Frame = +2

Query  188  QARLDDQSEFFTAMKKSFTGSLMGRWD----GE-AVCEYRGVVCDDKDYVVKIDVSGWSI  352
             A +++QS FFT MK+S +G  +  WD    GE   C Y G+ C+D+ Y+V+IDVS WS+
Sbjct  22   HATIENQSHFFTLMKQSLSGKSLSSWDVAIAGERPYCNYTGIGCNDEGYIVEIDVSRWSL  81

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQ  532
            SG FP +VC YLP+LR+LR+GHN  HG FP  + +CS LE+LNMT ++LTG+LPD SP++
Sbjct  82   SGHFPANVCHYLPQLRILRLGHNNLHGNFPAGINNCSLLEDLNMTYSSLTGTLPDFSPMK  141

Query  533  ALRALDLSYNL  565
            +L+ LDLSYNL
Sbjct  142  SLKRLDLSYNL  152



>emb|CAN77413.1| hypothetical protein VITISV_000471 [Vitis vinifera]
Length=978

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 91/129 (71%), Gaps = 3/129 (2%)
 Frame = +2

Query  188  QARLDDQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSISG  358
            QA + +QS FFT MK S +G  +  WD     + C Y GV C+D+ YV  ID+SGWS+SG
Sbjct  21   QASITNQSHFFTLMKNSLSGBSLSDWDVTGKTSYCNYSGVSCNDEGYVEVIDISGWSLSG  80

Query  359  EFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
             FP DVCSYLP+LRVLR+ +N  H  FP  + +CS LEEL+M  + + G+LPDLSP+++L
Sbjct  81   RFPPDVCSYLPQLRVLRLSYNDLHDNFPEGIVNCSLLEELDMNGSQVIGTLPDLSPMKSL  140

Query  539  RALDLSYNL  565
            R LDLSYNL
Sbjct  141  RILDLSYNL  149



>ref|XP_002283600.3| PREDICTED: uncharacterized protein LOC100257433 [Vitis vinifera]
Length=2026

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%), Gaps = 3/129 (2%)
 Frame = +2

Query  188   QARLDDQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSISG  358
             QA + +QS FFT MK S +G+ +  WD     + C Y GV C+D+ YV  ID+SGWS+SG
Sbjct  1091  QASITNQSHFFTLMKNSLSGNSLSDWDVTGKTSYCNYSGVSCNDEGYVEVIDISGWSLSG  1150

Query  359   EFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
              FP DVCSYLP+LRVLR+ +N  H  FP  + +CS LEEL+M  + + G+LPDLSP+++L
Sbjct  1151  RFPPDVCSYLPQLRVLRLSYNDLHDNFPEGIVNCSLLEELDMNGSQVIGTLPDLSPMKSL  1210

Query  539   RALDLSYNL  565
             R LDLSYNL
Sbjct  1211  RILDLSYNL  1219


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 1/112 (1%)
 Frame = +2

Query  224  AMKKSFTGSLMGRWD-GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLR  400
            A  ++F   +   W+  ++ C +RG+ C+    V +I++S   +SG  P +    L  L 
Sbjct  39   AELQNFDTYVFDSWESNDSACNFRGITCNSDGRVREIELSNQRLSGVVPLESICQLESLE  98

Query  401  VLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
             L +G N   G   G L  C  L+ L++     TG LPD S L  L+ L L+
Sbjct  99   KLSLGFNFLQGTISGDLNKCVGLQYLDLGNNLFTGPLPDFSSLSGLKHLYLN  150



>ref|XP_011074306.1| PREDICTED: receptor-like protein kinase HSL1 [Sesamum indicum]
Length=961

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = +2

Query  125  MALHRIAIllllllYSVSGSYQARLDDQSEFFTAMKKSFTGSLMGRW---DGEAVCEYRG  295
            MA HR+ + LLL+  +   S +A +  QS+FF   KKS +G+ +  W    G + C Y G
Sbjct  4    MAFHRLFLFLLLVFSANYISCRANISSQSQFFDLFKKSVSGNSLSNWASGKGNSYCNYTG  63

Query  296  VVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEE  475
            + CDD++ VV+ID+SGWS+SG FP ++CSYLP LRVLR+ +N F G FP  + +CSFLEE
Sbjct  64   IACDDQENVVQIDISGWSLSGRFPEEICSYLPGLRVLRLRNNNFIGSFPLGIINCSFLEE  123

Query  476  LNMTATNLTGSLPDLSPLQALRALDLSYN  562
            L++++  LTG LPD SPL++LR LDLSYN
Sbjct  124  LSLSSIYLTGPLPDFSPLKSLRILDLSYN  152



>gb|AEP84281.1| leucine rich repeat-containing protein [Corchorus capsularis]
Length=958

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 86/122 (70%), Gaps = 0/122 (0%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVC  379
            DDQSEFF  MK S +G  +  W+G + C + G+ C+DK YV  I++SGWS+SG FP D+C
Sbjct  30   DDQSEFFNLMKGSVSGKPLSDWEGTSFCNFTGITCNDKGYVDSINLSGWSLSGNFPDDIC  89

Query  380  SYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSY  559
            SYLP+LRVL +  NKFHG F   + +CS LEE NM++  L  ++PD S + +LR LDLSY
Sbjct  90   SYLPELRVLDISRNKFHGNFLHGIFNCSRLEEFNMSSVYLRATVPDFSRMTSLRVLDLSY  149

Query  560  NL  565
            NL
Sbjct  150  NL  151



>ref|XP_002510008.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF52195.1| receptor protein kinase, putative [Ricinus communis]
Length=956

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 94/134 (70%), Gaps = 3/134 (2%)
 Frame = +2

Query  170  SVSGSYQARLDDQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVS  340
            S++   +A   +QS+FF  +K S +G+ +  WD   G++ C + GV C+ + YV K D++
Sbjct  15   SLAHPLEAISTNQSQFFNLLKTSLSGNALSDWDVSGGKSYCNFTGVSCNSQGYVEKFDIT  74

Query  341  GWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDL  520
            GWSISG FP  +CSYLP+LRV+R+GHN  HG F  S+ +CSFLEELN++   L G +PD 
Sbjct  75   GWSISGRFPDGMCSYLPQLRVIRLGHNHLHGNFLPSIINCSFLEELNVSLLYLDGKIPDF  134

Query  521  SPLQALRALDLSYN  562
            SPL++LR LD+SYN
Sbjct  135  SPLKSLRMLDMSYN  148



>gb|ACI42311.1| putative leucine rich repeat transmembrane protein kinase [Corchorus 
olitorius]
Length=957

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 86/122 (70%), Gaps = 0/122 (0%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVC  379
            DDQSEFF  MK S +G  +  W+G++ C + G+ C+DK YV  I++SGWS+SG FP  VC
Sbjct  29   DDQSEFFNLMKGSVSGKPLSDWEGKSFCNFTGITCNDKGYVDSINLSGWSLSGSFPDGVC  88

Query  380  SYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSY  559
            SYLP+LRVL +  NKFHG F   + +CS LEE NM++  L  ++PD S + +LR LDLSY
Sbjct  89   SYLPELRVLDISRNKFHGNFLHGIFNCSRLEEFNMSSVYLRTTVPDFSRMTSLRVLDLSY  148

Query  560  NL  565
            NL
Sbjct  149  NL  150



>ref|XP_008444976.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
Length=944

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 95/134 (71%), Gaps = 3/134 (2%)
 Frame = +2

Query  170  SVSGSYQARLDDQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVS  340
            S S +  + + +Q +FF  ++K+ +G  +  WD   G++ C + G+ C+D+ +VV+ID+S
Sbjct  19   SSSQALTSAITNQPQFFNLIQKTASGEFLSEWDLSGGKSFCNFTGIRCNDQGHVVEIDIS  78

Query  341  GWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDL  520
            G S+SG FP DVCSYLPKLRVLR+    F+G FP  +T+CS +EELN+++  L G++PDL
Sbjct  79   GQSLSGSFPEDVCSYLPKLRVLRLAGTGFYGRFPSGITNCSLIEELNLSSLYLNGTIPDL  138

Query  521  SPLQALRALDLSYN  562
            S ++ LR LDLSYN
Sbjct  139  SQMKQLRVLDLSYN  152



>ref|XP_008466101.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Cucumis melo]
Length=946

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTG-SLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVC  379
            DQS FF+ M+K   G SL   W G++ C + G+ C++K  VV ID+SG ++SG FP DVC
Sbjct  21   DQSLFFSLMQKGVVGNSLPSDWTGDSFCNFTGITCNEKGLVVGIDLSGRAVSGRFPADVC  80

Query  380  SYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSY  559
            SYLP+LRVLR+G +   G FP  +T+CS LEEL+M + +L G+LPD SPL+ LR LD+SY
Sbjct  81   SYLPELRVLRLGRSGLRGTFPRGVTNCSVLEELDMNSLSLMGTLPDFSPLKTLRILDMSY  140

Query  560  N  562
            N
Sbjct  141  N  141



>ref|XP_004136411.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
 ref|XP_004165067.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
 gb|KGN60297.1| hypothetical protein Csa_3G893960 [Cucumis sativus]
Length=947

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTG-SLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVC  379
            DQS FF+ M+K   G SL   W G + C + G+ C++K  VV +D+SG ++SG FP DVC
Sbjct  21   DQSLFFSLMQKGVVGNSLPSDWTGNSFCNFTGITCNEKGLVVGVDLSGRAVSGRFPADVC  80

Query  380  SYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSY  559
            SYLP+LRVLR+G +   G FPG +T+CS LEEL+M++ +L G+LPD S L+ LR LDLSY
Sbjct  81   SYLPELRVLRLGRSGLRGTFPGGVTNCSVLEELDMSSLSLMGTLPDFSSLKTLRILDLSY  140

Query  560  N  562
            N
Sbjct  141  N  141



>ref|XP_011017021.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
Length=958

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 84/120 (70%), Gaps = 3/120 (3%)
 Frame = +2

Query  212  EFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCS  382
            +FF  MK S +G+++  WD   G+  C + GV C+ + YV  IDV+GWSISG FP  +CS
Sbjct  29   QFFNLMKASLSGNVLSDWDVTGGKPYCNFTGVGCNGRGYVEMIDVTGWSISGRFPSGICS  88

Query  383  YLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            Y P LRVLR+GHN  HG F  S+ +CSFLEELN++    TG+ PD SPL++LR LD+SYN
Sbjct  89   YFPDLRVLRLGHNSIHGDFLHSIVNCSFLEELNLSFLFATGTYPDFSPLKSLRILDVSYN  148


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +V +D+S   ++G+ P  VC  LPKL VL++ +N   G  P ++ S + L  L++    L
Sbjct  263  LVDLDISVNKLTGKIPESVCR-LPKLEVLQLYNNSLSGEIPRAIASSTTLRILSVYDNFL  321

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            TG +P DL  L A+  +DLS N
Sbjct  322  TGEVPQDLGHLSAMIVVDLSEN  343



>ref|XP_004148401.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
 ref|XP_004166649.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
 gb|KGN62784.1| hypothetical protein Csa_2G372790 [Cucumis sativus]
Length=942

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 94/132 (71%), Gaps = 3/132 (2%)
 Frame = +2

Query  176  SGSYQARLDDQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGW  346
            S +    + +QS+FF  ++K+ +G  +  W+   G++ C + G+ C+D+ ++++ID+SG 
Sbjct  21   SQALTPAITNQSQFFNLIQKTASGEFLSDWNLSGGKSFCNFTGIRCNDQGHIIEIDISGQ  80

Query  347  SISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSP  526
            S+SG FP DVCSYLPKLRVLR+    F+G FP  +T+CS +EELNM++  L G++PDLS 
Sbjct  81   SLSGSFPEDVCSYLPKLRVLRLAGTGFYGRFPSGITNCSLIEELNMSSLYLNGTIPDLSQ  140

Query  527  LQALRALDLSYN  562
            ++ LR LDLSYN
Sbjct  141  MKQLRVLDLSYN  152



>ref|XP_009786287.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=953

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  188  QARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFP  367
            Q  ++DQS+FF  +KKS TG+ +  WDG+ +C + GV CDD+  V+KID+ GWS+SG FP
Sbjct  21   QGTINDQSQFFALLKKSVTGNSLSDWDGKPICNFSGVGCDDQGNVIKIDLFGWSLSGLFP  80

Query  368  GDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTG  505
             DVCS+ P+LR+LR+G+N F G FP ++T+CS LEELNM +T+ TG
Sbjct  81   DDVCSFFPELRILRLGNNNFQGAFPSNITNCSHLEELNMVSTSFTG  126


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +V +D+S   ++G+ P  +C  LPKL+VL++ +N   G FP SL + + L  L++    L
Sbjct  259  LVDLDMSVNRLTGKIPESICR-LPKLQVLQIYNNTISGDFPASLANSTTLTILSLYDNFL  317

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            TG +P +     AL ALDLS N
Sbjct  318  TGEIPHNFGVSSALLALDLSEN  339



>ref|XP_004299842.1| PREDICTED: receptor-like protein kinase HSL1 [Fragaria vesca 
subsp. vesca]
Length=965

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 90/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  203  DQSEFFTAMKKSFT---GSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            +QS+FF  + K  +   GS +  WD   G+  C + GV+C+D  YVV+ID+SG S+SG+F
Sbjct  30   NQSQFFVQVIKLLSPNSGSSLSDWDVKGGKPYCNFSGVICNDDGYVVQIDISGRSLSGQF  89

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
            P D+CSYLP+LR+L +G N  HG F  S+T+CSFLEEL+M    L+G+LPD SPL+ L+ 
Sbjct  90   PADICSYLPQLRILLLGRNNLHGDFVDSITNCSFLEELSMDHLYLSGTLPDFSPLKNLKI  149

Query  545  LDLSYN  562
            LD+SYN
Sbjct  150  LDMSYN  155



>ref|XP_010061584.1| PREDICTED: receptor-like protein kinase HSL1 [Eucalyptus grandis]
 gb|KCW68569.1| hypothetical protein EUGRSUZ_F02182 [Eucalyptus grandis]
Length=954

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 99/152 (65%), Gaps = 6/152 (4%)
 Frame = +2

Query  125  MALHRIAIllllllYSVSGSYQARLDDQSEFFTAMKKSFTGSLMGRW--DGEA---VCEY  289
            MALH  A+ L + L  +S   QA   +QS+FF  MK S  G+ M  W  DG A    C +
Sbjct  1    MALHS-AVFLCVSLVCLSCLSQAASTNQSQFFALMKDSLYGNAMLSWNLDGGAENSFCSF  59

Query  290  RGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFL  469
             GV C+ +  VV++D+ G S+SGEFP D+CSYLP+LR+LR+G NK  G F  S  +CS L
Sbjct  60   EGVTCNHQGEVVELDIDGKSLSGEFPADICSYLPQLRILRLGRNKLRGDFYNSFINCSLL  119

Query  470  EELNMTATNLTGSLPDLSPLQALRALDLSYNL  565
            EEL+M+   L G+LPD SP+Q+LR LDLS NL
Sbjct  120  EELDMSFLYLHGTLPDFSPMQSLRILDLSSNL  151



>ref|XP_002301126.1| hypothetical protein POPTR_0002s11230g [Populus trichocarpa]
 gb|EEE80399.1| hypothetical protein POPTR_0002s11230g [Populus trichocarpa]
Length=925

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 82/115 (71%), Gaps = 3/115 (3%)
 Frame = +2

Query  227  MKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKL  397
            MK S +G+++  WD   G++ C + GV C+ + YV  IDV+GWSISG FP  +CSY P L
Sbjct  1    MKASLSGNVLSDWDVTGGKSYCNFTGVSCNSRGYVEMIDVTGWSISGRFPSGICSYFPDL  60

Query  398  RVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            RVLR+GHN  HG F  S+ +CSFLEELN++    TG+ PD SPL++LR LD+SYN
Sbjct  61   RVLRLGHNSLHGDFLHSIVNCSFLEELNLSFLFATGTYPDFSPLKSLRILDVSYN  115


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +V +D+S   ++G+ P  VC  LPKL VL++ +N   G  P ++ S + L  L++    L
Sbjct  230  LVDLDISVNKLTGKIPESVCR-LPKLEVLQLYNNSLSGEIPSAIASSTTLRILSVYDNFL  288

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            TG +P DL  L A+  +DLS N
Sbjct  289  TGEVPQDLGHLSAMIVVDLSEN  310



>ref|XP_010556500.1| PREDICTED: receptor-like protein kinase HSL1 [Tarenaya hassleriana]
Length=956

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSLMGRWDGEAV---CEYRGVVCDDKDYVVKIDVSGWSISGEFPGD  373
            +Q+EFF  M  S +G  +  WD   +   C + GV CDD+  V  +D+SGWS+SG FP  
Sbjct  26   NQTEFFRLMTSSLSGDALSSWDPSDLNSHCNFTGVACDDQGSVTDLDLSGWSLSGNFPEG  85

Query  374  VCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDL  553
            +CSYLP LRVLR+ HN+FHG F  S+ +CS L+ELNM++  L  +LPD S +++LR LD+
Sbjct  86   ICSYLPDLRVLRLSHNRFHGSFLFSIANCSLLQELNMSSVFLRTNLPDFSDMKSLRVLDM  145

Query  554  SYNL  565
            SYNL
Sbjct  146  SYNL  149


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  ID+S   ++G  P  VCS LPKLRVL++ +N   G  P +L + + L  L++    L
Sbjct  263  LTDIDISVNKLTGSIPESVCS-LPKLRVLQLYNNSLTGEIPNALGNSTTLRILSLYDNFL  321

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            TG LP +L  L  + ALD+S N
Sbjct  322  TGELPKNLGSLSPMIALDVSEN  343



>ref|XP_009335485.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=964

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 90/127 (71%), Gaps = 6/127 (5%)
 Frame = +2

Query  203  DQSEFFTAMKKSFT---GSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            +QSEFF  + KS +   G+ +  WD   G+  C + GV C++  YVV++D+SG S+SG+F
Sbjct  33   NQSEFFVLIIKSVSANSGNSLSDWDVTGGKPYCNFSGVTCNNDGYVVELDISGRSLSGKF  92

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
            P  +CSYLP+LRVLR+G N   G F  S+T+CSFLEE+NM    L+ +LPD SPL++LR 
Sbjct  93   PAGICSYLPQLRVLRLGRNNLQGDFVDSITNCSFLEEVNMDHLFLSQTLPDFSPLKSLRV  152

Query  545  LDLSYNL  565
            LD+SYNL
Sbjct  153  LDMSYNL  159



>ref|XP_008378674.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=964

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 90/127 (71%), Gaps = 6/127 (5%)
 Frame = +2

Query  203  DQSEFFTAMKKSFT---GSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            +QSEFF  + KS +   G+ +  WD   G+  C + GV C++  YV+++D+SG S+SG+F
Sbjct  33   NQSEFFVLIIKSVSANSGNSLSDWDVTGGKPYCNFSGVTCNNDGYVLELDISGRSLSGKF  92

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
            P  +CSYLP+LRVLR+G N   G F  S+T+CSFLEE+NM    L+ +LPD SPL++LR 
Sbjct  93   PAGICSYLPQLRVLRLGRNNLQGDFVDSITNCSFLEEVNMDHLTLSQTLPDFSPLKSLRV  152

Query  545  LDLSYNL  565
            LD+SYNL
Sbjct  153  LDMSYNL  159



>gb|KJB59873.1| hypothetical protein B456_009G278200 [Gossypium raimondii]
Length=975

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD--GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGD  373
            D Q +FF AMK S +G  +  WD  G + C + GV C+DK YV +I++S WS+SG FP D
Sbjct  46   DHQFKFFNAMKASLSGKALSDWDMRGNSYCNFTGVTCNDKGYVERINLSDWSLSGYFPAD  105

Query  374  VCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDL  553
            VCSYLP LRVL +  N  HG F  S+ +CS LEE N+++ +L  +LPD   + +LR LDL
Sbjct  106  VCSYLPALRVLDISRNNLHGNFLNSVVNCSLLEEFNISSVSLRETLPDFFRMTSLRVLDL  165

Query  554  SYN  562
            SYN
Sbjct  166  SYN  168



>ref|XP_009357235.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1008

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  206  QSEFFTAMKKSFT---GSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFP  367
            QSEFF  + KS +   G+ +  WD   G+  C + GV+C+++ YVV++D+S  S+SG FP
Sbjct  79   QSEFFVLIIKSVSANAGNSLSDWDVKGGKPYCNFSGVICNNEGYVVELDISSRSLSGNFP  138

Query  368  GDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRAL  547
              +CSYLP+LRVLR+G N   G F  S+T+CSFLEELNM    L+ +LPD SP+++L+ L
Sbjct  139  AGICSYLPQLRVLRLGRNNLRGDFVDSITNCSFLEELNMEHLYLSQTLPDFSPMKSLKVL  198

Query  548  DLSYNL  565
            D+SYNL
Sbjct  199  DMSYNL  204



>ref|XP_009407104.1| PREDICTED: uncharacterized protein LOC103989885 [Musa acuminata 
subsp. malaccensis]
Length=1974

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +2

Query  200   DDQSEFFTAMKKSFTGSLMGRWD--GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGD  373
             + Q  F + +K+S  G  M RWD  G + C + G+ CDD +YVV+ID+S W ++G FP  
Sbjct  1056  ESQFSFLSLLKQSLQGPSMARWDFNGSSPCNFPGIACDDNEYVVEIDLSSWLLTGGFPPA  1115

Query  374   VCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDL  553
             VC  LP LRVLR+G N+   GFP  L  CSFLEELN +   + G++PDLSPLQ+LR++DL
Sbjct  1116  VCESLPGLRVLRLGFNEIRNGFPVDLFGCSFLEELNCSHAKIAGAVPDLSPLQSLRSIDL  1175

Query  554   SYN  562
             S N
Sbjct  1176  SNN  1178


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 1/118 (1%)
 Frame = +2

Query  212  EFFTAMKKSFTGSLMGRWDG-EAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYL  388
            +F  +++ +   +    WD     C + G+ CD    V +ID++   ISGE P D    L
Sbjct  34   QFKASLQTAANSTAFRSWDASNPTCSFDGIRCDSNGSVSEIDLTSAGISGEIPFDSLCRL  93

Query  389  PKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            P L  L +G+N  HG     L +C+ L  L++   +L G++PDL+PL  L+ L+LS N
Sbjct  94   PSLSALSLGYNGLHGAISDDLWNCTGLRRLDLAFNHLAGAVPDLAPLDKLQVLNLSDN  151



>gb|KJB58763.1| hypothetical protein B456_009G225100 [Gossypium raimondii]
Length=958

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 85/131 (65%), Gaps = 3/131 (2%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAV---CEYRGVVCDDKDYVVKIDVSGWSI  352
            S QA  DDQ  FF  MK S +G  +  WD   +   C++RGV C+++ YV  I++S WS+
Sbjct  22   SSQAIRDDQFRFFNLMKASLSGKALSAWDVSGMKSYCDFRGVSCNNRGYVESINISDWSL  81

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQ  532
            SG FP DVCS+LP+LRVL +  N   G F  S+ +CS LEE +M++  L  +LPD S + 
Sbjct  82   SGNFPADVCSHLPELRVLDISRNNLRGNFLNSIVNCSLLEEFSMSSVYLRTTLPDFSKMT  141

Query  533  ALRALDLSYNL  565
            +LR +DLSYNL
Sbjct  142  SLRVVDLSYNL  152



>ref|XP_007018366.1| Leucine-rich repeat transmembrane protein kinase family protein 
[Theobroma cacao]
 gb|EOY15591.1| Leucine-rich repeat transmembrane protein kinase family protein 
[Theobroma cacao]
Length=954

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 86/131 (66%), Gaps = 3/131 (2%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSI  352
            S +A   DQS+FFT MK S +G  +  WD   G+  C + GV C+D+ +V  ++++ WS+
Sbjct  19   SSEATRHDQSQFFTLMKASLSGKALSDWDVSGGKNYCNFTGVNCNDQGFVETLNLTDWSL  78

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQ  532
            SG FP DVCSYLP+LRVL +  N  HG F   + +CS LE+ NM++  L  +LPD S + 
Sbjct  79   SGNFPADVCSYLPELRVLDISRNNLHGNFLSGIVNCSLLEKFNMSSLFLRTTLPDFSRMA  138

Query  533  ALRALDLSYNL  565
            +LR LDLSYNL
Sbjct  139  SLRLLDLSYNL  149


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            ++ +D+S   +SG  P  +C  LPKLRVL++ +N   G  PG + + + L  L++ A  L
Sbjct  263  LIDLDMSVNQLSGSIPVSICR-LPKLRVLQLYNNSLTGEIPGVIANSTTLTMLSLYANFL  321

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G LP +L  L ++  LDLS N
Sbjct  322  SGQLPQNLGQLSSMIVLDLSEN  343



>ref|XP_008352752.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=963

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 88/126 (70%), Gaps = 6/126 (5%)
 Frame = +2

Query  206  QSEFFTAMKKSFT---GSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFP  367
            QSEFF  + KS +   G+ +  WD   G+  C + GV C+++ YVV++D+S  S+SG FP
Sbjct  34   QSEFFLLIIKSVSANAGNSLSDWDVKGGKPYCNFSGVTCNNEGYVVELDISSRSLSGNFP  93

Query  368  GDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRAL  547
              +CSYLP+LRVLR+G N   G F  S+T+CSFLEELNM    L+ +LPD SP+++L+ L
Sbjct  94   AGICSYLPQLRVLRLGRNNLRGDFVDSITNCSFLEELNMEHLYLSQTLPDFSPMKSLKVL  153

Query  548  DLSYNL  565
            D+SYNL
Sbjct  154  DMSYNL  159



>gb|KDP41546.1| hypothetical protein JCGZ_15953 [Jatropha curcas]
Length=601

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 93/130 (72%), Gaps = 3/130 (2%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSI  352
            S  A  ++QS FF  M+ S +G  +  WD   G+ VC + GV C++   V KID++GWSI
Sbjct  19   SLYATTNNQSYFFNLMRTSLSGKALSEWDVTGGKPVCNFTGVDCNNNGCVEKIDMTGWSI  78

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQ  532
            SG+FP  +CSYLP+L++LR+GHN+ HG F  S+ +CS LEELN+++  LTG+LPD S L+
Sbjct  79   SGKFPTGICSYLPELQILRLGHNQLHGEFLHSILNCSLLEELNLSSLYLTGTLPDFSSLR  138

Query  533  ALRALDLSYN  562
            AL+ LD+SYN
Sbjct  139  ALQILDVSYN  148



>ref|XP_010667798.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=958

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 86/131 (66%), Gaps = 3/131 (2%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWDGE---AVCEYRGVVCDDKDYVVKIDVSGWSI  352
            S QA  + QS++FT MKKS +G  +  W G    + C Y G+ C+ +  V K+++SGW +
Sbjct  20   SLQATSNKQSQYFTLMKKSLSGHALSYWSGNGGNSYCNYTGITCNIQGQVTKLNISGWLV  79

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQ  532
             G  P  VCSYLP+LRVL   +N F G  P  + +CS LE LNM+++ L+G LP+ S ++
Sbjct  80   KGSLPPYVCSYLPELRVLDTSNNTFPGPVPDGIINCSLLEVLNMSSSYLSGKLPNFSSMK  139

Query  533  ALRALDLSYNL  565
            +LRALDLSYNL
Sbjct  140  SLRALDLSYNL  150



>ref|XP_008219158.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=967

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 88/127 (69%), Gaps = 6/127 (5%)
 Frame = +2

Query  203  DQSEFFTAMKKSFT---GSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            +QS+FF  M KS +   G+ +  WD   G+  C + GV C+++ YVV++D+SG S+SG F
Sbjct  34   NQSQFFVLMIKSLSDNSGNSLSDWDITGGKPYCNFSGVTCNNEGYVVEMDISGRSLSGHF  93

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
            P D+CSYLP+LRV+R+G N   G F  S+T+CS LEEL+M    L+ +LPD S L+ LR 
Sbjct  94   PADICSYLPELRVIRLGRNNLQGDFLDSITNCSVLEELSMDHLFLSQTLPDFSRLKFLRI  153

Query  545  LDLSYNL  565
            LDLSYNL
Sbjct  154  LDLSYNL  160



>ref|XP_006487758.1| PREDICTED: receptor-like protein kinase HSL1-like [Citrus sinensis]
Length=963

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 87/132 (66%), Gaps = 4/132 (3%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSI  352
            S    ++ +S+FF  MK S +G  +  WD   G+  C + G+ C+D+ +V  ID+SGW +
Sbjct  20   SQAISVNHESQFFKLMKTSLSGDKLSDWDIDGGKPYCNFSGISCNDQGHVSMIDISGWLL  79

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHG-GFPGSLTSCSFLEELNMTATNLTGSLPDLSPL  529
            +G+FP  VCSYLP+L+VLR+  N  HG     S+ +CS LEELNM+   LTG+LPD SP+
Sbjct  80   AGQFPSGVCSYLPELQVLRLARNHVHGSNLLDSIVNCSLLEELNMSFMYLTGTLPDFSPM  139

Query  530  QALRALDLSYNL  565
            Q L+ LDLS NL
Sbjct  140  QNLQRLDLSNNL  151



>gb|KJB29386.1| hypothetical protein B456_005G097700 [Gossypium raimondii]
Length=956

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 82/130 (63%), Gaps = 3/130 (2%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSI  352
            S +A   DQS+FF  MK S +G  +  WD   G+  C + GV C+D+ YV  ++ +GWS+
Sbjct  20   SCRAMKHDQSKFFNLMKASLSGKALSDWDVIGGKPYCNFTGVNCNDRGYVEVLNFTGWSL  79

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQ  532
            SG FP DVC +LP+LRVL +  N FHG F   + +CS LE  NM++  L   LPD S L 
Sbjct  80   SGIFPDDVCFHLPELRVLDISRNNFHGNFLNGIVNCSSLEVFNMSSIYLRTKLPDFSKLV  139

Query  533  ALRALDLSYN  562
            +LR LDLSYN
Sbjct  140  SLRVLDLSYN  149



>ref|XP_002510009.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF52196.1| receptor protein kinase, putative [Ricinus communis]
Length=933

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 94/152 (62%), Gaps = 6/152 (4%)
 Frame = +2

Query  125  MALHRIAIllllllYSVSG--SYQARLDDQSEFFTAMKKSFTGSLMGRWD----GEAVCE  286
            MALH I  + +L+++S     +  A    Q+ FF  MK +  G+ +  WD      + C 
Sbjct  1    MALHSIFYIFVLIVFSACPLLAISANQSHQAHFFNIMKTTLAGNALSDWDVNGGRSSPCN  60

Query  287  YRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSF  466
            + GV C+D+ YV +ID++GWSISG+FP  +C YLP+LRVLR+G N  HG F  S+ +CS 
Sbjct  61   FTGVGCNDRGYVERIDITGWSISGQFPAGICLYLPQLRVLRLGFNYLHGDFVHSINNCSL  120

Query  467  LEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            LEEL+++   L G+LPD S L  LR L++  N
Sbjct  121  LEELDLSYLYLGGTLPDFSTLNYLRILNIPCN  152



>ref|XP_006442751.1| hypothetical protein CICLE_v10018723mg [Citrus clementina]
 gb|ESR55991.1| hypothetical protein CICLE_v10018723mg [Citrus clementina]
Length=963

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSI  352
            S    ++ +S+FF  MK S +G  +  WD   G+  C + G+ C+D+ +V  ID+SGW +
Sbjct  20   SQAISVNHESQFFKLMKTSLSGDKLSDWDIDGGKPYCNFSGISCNDQGHVSMIDISGWLL  79

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHG-GFPGSLTSCSFLEELNMTATNLTGSLPDLSPL  529
            +G+FP  VC+YLP+L+VLR+  N   G     S+ +CS LEELNM+   LTG+LPD SP+
Sbjct  80   AGQFPSGVCAYLPELQVLRLARNHVDGSNLLDSIVNCSLLEELNMSFMYLTGTLPDFSPM  139

Query  530  QALRALDLSYNL  565
            Q LR LDLS NL
Sbjct  140  QNLRRLDLSNNL  151



>gb|KJB64049.1| hypothetical protein B456_010G030500 [Gossypium raimondii]
Length=951

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 83/130 (64%), Gaps = 3/130 (2%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWSI  352
            S +A   +Q +FF+ MK S +G+ +  W+   GE  C + GV C+++ YV  ++ SGWS+
Sbjct  19   SSKAIRHNQWQFFSIMKASLSGNPLSDWEVNEGEGYCNFTGVSCNNEGYVESMNFSGWSL  78

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQ  532
            +G FP DVCSYLP+LRVL +  N F G F   + +CS LE  NM++  L  + PDLS   
Sbjct  79   TGNFPADVCSYLPELRVLDISRNNFRGNFLNGVVNCSVLEVFNMSSVYLNATFPDLSKTT  138

Query  533  ALRALDLSYN  562
            +LR LDLSYN
Sbjct  139  SLRILDLSYN  148



>ref|XP_004963299.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Setaria 
italica]
Length=987

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 79/127 (62%), Gaps = 4/127 (3%)
 Frame = +2

Query  197  LDDQSEFFTAMKKSFTGSLMGRWD----GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            LD Q+ +   MK+ F G  M RWD        C ++GV CD+   V  IDV+ W + G  
Sbjct  32   LDTQAAYLARMKEQFPGPGMSRWDFSSPAPDYCRFQGVACDEGGNVTGIDVTSWRLVGRL  91

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
            P  VC+ LP LR LR+  N   GGFP  L +C++LE LN++ + ++G++PDLSPL+ALR 
Sbjct  92   PPGVCASLPALRELRMACNDVRGGFPAGLLNCTYLEVLNVSYSGMSGTVPDLSPLRALRV  151

Query  545  LDLSYNL  565
            LD+S NL
Sbjct  152  LDMSNNL  158



>gb|EYU36418.1| hypothetical protein MIMGU_mgv1a000952mg [Erythranthe guttata]
Length=935

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  242  TGSLMGRWDGEA----VCEYRGVVCD--DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRV  403
            +G+ + RW  +      C Y G+ CD  D+  VV++D+SGWS++G+FP ++CSY P LRV
Sbjct  6    SGNSLSRWGSDTGNNNYCNYSGIACDGGDRRNVVELDISGWSLTGKFPDEICSYFPGLRV  65

Query  404  LRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQ-ALRALDLSYN  562
            LR+GHN F G  P  +T+CS L+ELNM++   +G LPD SPL+ +LR LDLSYN
Sbjct  66   LRLGHNSFSGDLPRGITNCSSLQELNMSSVYFSGELPDFSPLKSSLRVLDLSYN  119



>ref|XP_010943258.1| PREDICTED: receptor-like protein kinase HSL1 isoform X3 [Elaeis 
guineensis]
Length=857

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 82/134 (61%), Gaps = 7/134 (5%)
 Frame = +2

Query  182  SYQAR-LDDQSEFFTAMKKSFTGSLMGRWD-GEAV-----CEYRGVVCDDKDYVVKIDVS  340
            S QA  L  Q  F + MK S  G  M  WD  +AV     C + G+ CDD  YVV+ID+S
Sbjct  34   SLQATTLQTQFNFLSLMKDSLLGPSMAHWDFTDAVGDRPYCNFSGISCDDHGYVVEIDLS  93

Query  341  GWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDL  520
             W ++G+FP  VCS LP LR LR+  N    GFP  L +CSFL ELN + + LTG++PDL
Sbjct  94   SWKLAGDFPSGVCSSLPMLRALRLADNDISNGFPEDLFNCSFLGELNFSHSGLTGAVPDL  153

Query  521  SPLQALRALDLSYN  562
            S LQ+L  +DLS N
Sbjct  154  SQLQSLHMIDLSNN  167



>gb|EPS67674.1| hypothetical protein M569_07098, partial [Genlisea aurea]
Length=878

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +2

Query  281  CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
            C + G+ CD++  +V +D+SGW + G+F  D+CSYLP+L  L+   N F+GGFP  + +C
Sbjct  1    CNFTGISCDERRNIVAVDISGWGLQGKFIEDICSYLPELISLQAAENTFNGGFPFGILNC  60

Query  461  SFLEELNMTATNLTGSLPDLSPLQALRALDLSYNL  565
            S LE LNM+AT LTG+LPD SPLQ+L+ LDLSYNL
Sbjct  61   SRLESLNMSATQLTGALPDFSPLQSLKVLDLSYNL  95


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            ++ +D+S  + +G+ P  +C  LPKLRVL++ ++   G  P  L+  + L  L++    L
Sbjct  208  LINLDMSVNNFTGQIPASICR-LPKLRVLQIYNSSLTGSLPVELSYSTTLNTLSLYGNFL  266

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            TG +P DL    AL A+D+S N
Sbjct  267  TGEIPQDLGKSSALVAIDISEN  288



>ref|XP_008787759.1| PREDICTED: receptor-like protein kinase HSL1 [Phoenix dactylifera]
Length=952

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 78/130 (60%), Gaps = 6/130 (5%)
 Frame = +2

Query  191  ARLDDQSEFFTAMKKSFTGSLMGRWD------GEAVCEYRGVVCDDKDYVVKIDVSGWSI  352
            A L  QS F + MK S +G  M  WD      G   C + G+ C+D  YVV+ID+S W +
Sbjct  22   ATLRTQSNFLSLMKDSLSGPSMASWDFAGAVGGSPYCNFSGISCNDHGYVVEIDLSSWKL  81

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQ  532
             G+FP  VCS LP LR L +  N    GFP  L +CS L ELN + + LTG++PD+S LQ
Sbjct  82   VGDFPSGVCSSLPMLRALLLADNDIRNGFPKDLLNCSSLAELNFSHSGLTGTVPDISQLQ  141

Query  533  ALRALDLSYN  562
            +LR +DLS N
Sbjct  142  SLRLIDLSNN  151



>ref|XP_010943241.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Elaeis 
guineensis]
Length=968

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 82/134 (61%), Gaps = 7/134 (5%)
 Frame = +2

Query  182  SYQAR-LDDQSEFFTAMKKSFTGSLMGRWD-GEAV-----CEYRGVVCDDKDYVVKIDVS  340
            S QA  L  Q  F + MK S  G  M  WD  +AV     C + G+ CDD  YVV+ID+S
Sbjct  34   SLQATTLQTQFNFLSLMKDSLLGPSMAHWDFTDAVGDRPYCNFSGISCDDHGYVVEIDLS  93

Query  341  GWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDL  520
             W ++G+FP  VCS LP LR LR+  N    GFP  L +CSFL ELN + + LTG++PDL
Sbjct  94   SWKLAGDFPSGVCSSLPMLRALRLADNDISNGFPEDLFNCSFLGELNFSHSGLTGAVPDL  153

Query  521  SPLQALRALDLSYN  562
            S LQ+L  +DLS N
Sbjct  154  SQLQSLHMIDLSNN  167



>ref|NP_001067348.1| Os12g0632900 [Oryza sativa Japonica Group]
 gb|ABA99942.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30367.1| Os12g0632900 [Oryza sativa Japonica Group]
 gb|EAZ21324.1| hypothetical protein OsJ_36978 [Oryza sativa Japonica Group]
Length=977

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = +2

Query  215  FFTAMKKSFTGSLMGRWDGEA----VCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCS  382
            + + MK+ F G  M RWD  A     C+++GV CD    V  IDV+ W +SG  PG VC 
Sbjct  43   YLSQMKQEFAGPAMARWDFSAPAVDYCKFQGVGCDASGNVTAIDVTSWRLSGRLPGGVCE  102

Query  383  YLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             LP LR +R+G+N   GGFPG L +C+ LE LN++ + ++G++PDLS + ALR LD+S N
Sbjct  103  ALPALREVRLGYNDIRGGFPGGLVNCTSLEVLNLSCSGVSGAVPDLSRMPALRVLDVSNN  162



>gb|EEC69730.1| hypothetical protein OsI_39240 [Oryza sativa Indica Group]
Length=965

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = +2

Query  215  FFTAMKKSFTGSLMGRWDGEA----VCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCS  382
            + + MK+ F G  M RWD  A     C+++GV CD    V  IDV+ W +SG  PG VC 
Sbjct  43   YLSQMKQEFAGPAMARWDFSAPAVDYCKFQGVGCDASGNVTAIDVTSWRLSGRLPGGVCE  102

Query  383  YLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             LP LR +R+G+N   GGFPG L +C+ LE LN++ + ++G++PDLS + ALR LD+S N
Sbjct  103  ALPALREVRLGYNDIRGGFPGGLVNCTSLEVLNLSCSGVSGAVPDLSRMPALRVLDVSNN  162



>gb|KEH36108.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=965

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 8/126 (6%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSLMGRWD----GEAVCEYRGVVCDDKDYVVKIDVSGWS-ISGEFP  367
            +QSEFF+ MK+S +G+    W      + +C++ G+ CD+K  ++ +D SGWS +SG FP
Sbjct  28   NQSEFFSLMKESLSGNYPFDWGVSKVDKPICDFTGITCDNKGDIISLDFSGWSSLSGNFP  87

Query  368  GDVCSYLPKLRVLRVGHNKFHGGFP-GSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
             ++CSYLP LRVL +G+ KF   FP  S+ +CS LE LNM   +L+G+LPD S L+ LR 
Sbjct  88   SNICSYLPNLRVLNLGNTKFK--FPTNSIINCSHLELLNMNKMHLSGTLPDFSSLKYLRV  145

Query  545  LDLSYN  562
            LDLSYN
Sbjct  146  LDLSYN  151



>ref|XP_006664774.1| PREDICTED: receptor-like protein kinase HSL1-like [Oryza brachyantha]
Length=933

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 78/123 (63%), Gaps = 4/123 (3%)
 Frame = +2

Query  206  QSEFFTAMKKSFTGSLMGRWDGEA----VCEYRGVVCDDKDYVVKIDVSGWSISGEFPGD  373
            Q+ + + MK+ F G  M RWD  A     C ++G+ CD    V  IDV+ W +SG  P  
Sbjct  38   QATYLSQMKQEFAGPAMARWDFSAPAVDYCRFQGIGCDGSGNVTAIDVTSWRLSGRLPAG  97

Query  374  VCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDL  553
            VC+ LP LR +R+G+N   GGFP  L +C+ LE LN++   ++G++PDLSP++AL+ LD+
Sbjct  98   VCAALPALREVRLGYNDIRGGFPAGLLNCTSLEVLNLSYAGVSGAVPDLSPMRALKVLDM  157

Query  554  SYN  562
            S N
Sbjct  158  SDN  160



>ref|XP_010667796.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 82/127 (65%), Gaps = 3/127 (2%)
 Frame = +2

Query  191  ARLDDQSEFFTAMKKSFTGSLMGRWDGEA---VCEYRGVVCDDKDYVVKIDVSGWSISGE  361
            A +D QS++FT MK S +G+ + +W  +A    C Y G+ C+ + +V+K++++G S+ G 
Sbjct  24   ATVDKQSQYFTLMKSSLSGNALSQWSAQAESSYCNYTGITCNIQGHVIKMNLTGQSLKGS  83

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALR  541
            FP DVCSYLP+LR L +  N   G FP  + +CS +E L M    L+G LP+ S +++LR
Sbjct  84   FPADVCSYLPELRFLDISRNDITGSFPQGIINCSTMEVLIMNNLFLSGRLPNFSGMKSLR  143

Query  542  ALDLSYN  562
             LDLS N
Sbjct  144  ILDLSLN  150



>gb|EAZ20064.1| hypothetical protein OsJ_35662 [Oryza sativa Japonica Group]
Length=828

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = +2

Query  215  FFTAMKKSFTGSLMGRWD----GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCS  382
            + + MK+ F G  M RWD    G   C+++GV CD    V  IDV+ W +SG  PG VC 
Sbjct  41   YLSQMKQEFAGPAMARWDFSSPGVDYCKFQGVGCDASGNVTAIDVTSWRLSGRLPGGVCE  100

Query  383  YLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             LP LR +R+G+N    GFPG L +C+ LE LN++ + ++GS+PDLS + ALR LD+S N
Sbjct  101  ALPALREVRLGYNDIRSGFPGGLVNCTSLEVLNLSCSGVSGSVPDLSRMPALRVLDVSNN  160



>ref|XP_007137285.1| hypothetical protein PHAVU_009G114400g [Phaseolus vulgaris]
 gb|ESW09279.1| hypothetical protein PHAVU_009G114400g [Phaseolus vulgaris]
Length=959

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 81/123 (66%), Gaps = 3/123 (2%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSLMGRWDGEA-VCEYRGVVCDDKDYVVKIDVSGWS-ISGEFPGDV  376
            +QS+FF  +K S  G     WD E  VC +  V C+ +  V+K+D+SGWS ++G+FP D 
Sbjct  28   NQSQFFILIKDSLPGKYPMNWDAEKPVCSFTRVTCNTRGDVIKLDLSGWSSLTGKFPSDT  87

Query  377  CSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
            CSYLP+LR L +GH +F      ++ +CS LEELNM     TG+LPD S L++LR LDLS
Sbjct  88   CSYLPQLRSLHLGHTRFQFNV-DTILNCSHLEELNMNHMFQTGTLPDFSSLKSLRILDLS  146

Query  557  YNL  565
            YNL
Sbjct  147  YNL  149



>ref|XP_003523762.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=966

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 91/139 (65%), Gaps = 10/139 (7%)
 Frame = +2

Query  170  SVSGSYQARLDDQSEFFTAMKK-SFTGSLMGRWDGEA----VCEYRGVVCDDKDYVVKID  334
            S+S +   + ++QS+FF+ MK  S +G     WD       VC + GV C+ K  V+ +D
Sbjct  18   SLSQAITTKNNNQSQFFSLMKDLSLSGKYPTNWDAAGKLVPVCGFTGVTCNTKGDVISLD  77

Query  335  VSGWS-ISGEFPGDVCSYLPKLRVLRVGHNKFHGGFP-GSLTSCSFLEELNMTATNLTGS  508
            +S  S +SG FP D+CSYLP+LRVLR+GH +F   FP  ++ +CS LEELNM   +LTG+
Sbjct  78   LSDRSSLSGNFPPDICSYLPQLRVLRLGHTRFK--FPIDTILNCSHLEELNMNHMSLTGT  135

Query  509  LPDLSPL-QALRALDLSYN  562
            LPD S L ++LR LDLSYN
Sbjct  136  LPDFSSLKKSLRVLDLSYN  154



>ref|XP_010442431.1| PREDICTED: receptor-like protein kinase HSL1 [Camelina sativa]
Length=970

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 78/128 (61%), Gaps = 7/128 (5%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD-----GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            + Q +FF  MK S  G  +  W+     G   C++ GV CD +  V  ID+SGWS+SG F
Sbjct  31   NQQPQFFKLMKNSLFGDALSSWNVSDDVGTNYCDFIGVRCDGQGLVTDIDLSGWSLSGVF  90

Query  365  PGDVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
            P  +CSY P LRVLR+  N  +    F  ++ SCS L ELNM++  L G+LPD S ++AL
Sbjct  91   PDGICSYFPNLRVLRLSRNHLNSSSSFLSTIPSCSLLRELNMSSLYLKGTLPDFSSMKAL  150

Query  539  RALDLSYN  562
            R +D+S+N
Sbjct  151  RVIDMSWN  158


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  ID+S   ++G  P  +CS LPKLRVL++ +N   G  P SL +   L+ L++    L
Sbjct  273  LTDIDISVSRLTGSIPDSICS-LPKLRVLQLYNNSLTGEIPKSLGNSRTLKILSLYDNYL  331

Query  500  TGSL-PDLSPLQALRALDLSYN  562
            TG L P+L     + ALD+S N
Sbjct  332  TGELPPNLGSSSPMIALDVSEN  353



>ref|XP_006402253.1| hypothetical protein EUTSA_v10012576mg [Eutrema salsugineum]
 gb|ESQ43706.1| hypothetical protein EUTSA_v10012576mg [Eutrema salsugineum]
Length=976

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 8/129 (6%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD------GEAVCEYRGVVCDDKDYVVKIDVSGWSISGE  361
            + Q +F   MK S +G  +  W+          C + G+ CD +  V  +D+SGWS+SG+
Sbjct  28   NQQPQFLKLMKNSLSGDALSSWNLSDTAKTTHYCNFSGIRCDGQGLVTDLDLSGWSLSGK  87

Query  362  FPGDVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQA  535
            FP  +CSYLP LRVLR+ HN  +    F  S+  CS L+ELNM++  LT +LP+ S +++
Sbjct  88   FPDGICSYLPNLRVLRLSHNHLNRSSSFLNSIPECSLLQELNMSSLYLTATLPNFSLMKS  147

Query  536  LRALDLSYN  562
            LRA+D+S+N
Sbjct  148  LRAIDMSWN  156



>ref|XP_006279956.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
 gb|EOA12854.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
Length=945

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 78/128 (61%), Gaps = 7/128 (5%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD-----GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            + Q +FF  MK S  G  +  W+     G   C++ GV CD +  V  +D+SGWS+SG F
Sbjct  4    NQQPQFFKLMKSSLFGDALSSWNVSDDVGAYYCDFTGVRCDGQGLVTDLDLSGWSLSGVF  63

Query  365  PGDVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
            P  +CSY P LRVLR+  N  +    F  S+ +CS L ELNM++  L G+LPD S ++AL
Sbjct  64   PDGICSYFPNLRVLRLSRNHLNRSSSFLSSIPNCSLLRELNMSSLYLQGTLPDFSSMKAL  123

Query  539  RALDLSYN  562
            R +D+S+N
Sbjct  124  RVIDMSWN  131


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  ID+S   ++G  P  +C+ LPKLRVL++ +N   G  P SL +   L+ L++    L
Sbjct  246  LTDIDISVSRLTGSIPDSICT-LPKLRVLQLYNNSLTGQIPKSLGNSRTLQILSLYDNYL  304

Query  500  TGSL-PDLSPLQALRALDLSYN  562
            TG L P+L     + ALD+S N
Sbjct  305  TGELPPNLGSSSPMIALDVSEN  326



>ref|XP_006279955.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
 gb|EOA12853.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
Length=968

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 78/128 (61%), Gaps = 7/128 (5%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD-----GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            + Q +FF  MK S  G  +  W+     G   C++ GV CD +  V  +D+SGWS+SG F
Sbjct  27   NQQPQFFKLMKSSLFGDALSSWNVSDDVGAYYCDFTGVRCDGQGLVTDLDLSGWSLSGVF  86

Query  365  PGDVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
            P  +CSY P LRVLR+  N  +    F  S+ +CS L ELNM++  L G+LPD S ++AL
Sbjct  87   PDGICSYFPNLRVLRLSRNHLNRSSSFLSSIPNCSLLRELNMSSLYLQGTLPDFSSMKAL  146

Query  539  RALDLSYN  562
            R +D+S+N
Sbjct  147  RVIDMSWN  154


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  ID+S   ++G  P  +C+ LPKLRVL++ +N   G  P SL +   L+ L++    L
Sbjct  269  LTDIDISVSRLTGSIPDSICT-LPKLRVLQLYNNSLTGQIPKSLGNSRTLQILSLYDNYL  327

Query  500  TGSL-PDLSPLQALRALDLSYN  562
            TG L P+L     + ALD+S N
Sbjct  328  TGELPPNLGSSSPMIALDVSEN  349



>ref|XP_010482245.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Camelina 
sativa]
Length=970

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 78/128 (61%), Gaps = 7/128 (5%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD-----GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            + Q +FF  MK S  G  +  W+     G   C++ GV CD +  V  +D+SGWS+SG F
Sbjct  31   NQQPKFFKLMKNSLFGDALSSWNVSDDVGTNYCDFIGVRCDGQGLVTDLDLSGWSLSGVF  90

Query  365  PGDVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
            P  +CSY P LRVLR+  N  +    F  ++ SCS L ELNM++  L G+LPD S ++AL
Sbjct  91   PDGICSYFPNLRVLRLSRNHLNSSSSFLSTIPSCSLLRELNMSSLYLKGTLPDFSSMKAL  150

Query  539  RALDLSYN  562
            R +D+S+N
Sbjct  151  RVIDMSWN  158


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  ID+S   ++G  P  +CS LPKLRVL++ +N   G  P SL +   L+ L++    L
Sbjct  273  LTDIDISVSRLTGSIPDSICS-LPKLRVLQLYNNSLTGEIPKSLGNSRTLKILSLYDNYL  331

Query  500  TGSL-PDLSPLQALRALDLSYN  562
            TG L P+L     + ALD+S N
Sbjct  332  TGELPPNLGSSSPMIALDVSEN  353



>ref|XP_010482244.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Camelina 
sativa]
Length=970

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 78/128 (61%), Gaps = 7/128 (5%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD-----GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            + Q +FF  MK S  G  +  W+     G   C++ GV CD +  V  +D+SGWS+SG F
Sbjct  31   NQQPKFFKLMKNSLFGDALSSWNVSDDVGTNYCDFIGVRCDGQGLVTDLDLSGWSLSGVF  90

Query  365  PGDVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
            P  +CSY P LRVLR+  N  +    F  ++ SCS L ELNM++  L G+LPD S ++AL
Sbjct  91   PDGICSYFPNLRVLRLSRNHLNSSSSFLSTIPSCSLLRELNMSSLYLKGTLPDFSSMKAL  150

Query  539  RALDLSYN  562
            R +D+S+N
Sbjct  151  RVIDMSWN  158


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  ID+S   ++G  P  +CS LPKLRVL++ +N   G  P SL +   L+ L++    L
Sbjct  273  LTDIDISVSRLTGSIPDSICS-LPKLRVLQLYNNSLTGEIPKSLGNSRTLKILSLYDNYL  331

Query  500  TGSL-PDLSPLQALRALDLSYN  562
            TG L P+L     + ALD+S N
Sbjct  332  TGELPPNLGSSSPMIALDVSEN  353



>ref|XP_010440851.1| PREDICTED: receptor-like protein kinase HSL1 [Camelina sativa]
Length=970

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 77/128 (60%), Gaps = 7/128 (5%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD-----GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            + Q +FF  MK S  G  +  W+     G   C++ GV CD +  V  +D+S WS+SG F
Sbjct  31   NQQPQFFKLMKNSLFGDALSSWNVSDDVGTNYCDFTGVRCDGQGLVTDLDLSSWSLSGVF  90

Query  365  PGDVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
            P  +CSY P LRVLR+  N  +    F  ++ SCS L ELNM++  L G+LPD S ++AL
Sbjct  91   PDGICSYFPNLRVLRLSRNHLNRSSSFLSTIPSCSLLRELNMSSLYLKGTLPDFSSMKAL  150

Query  539  RALDLSYN  562
            R +D+S+N
Sbjct  151  RVIDMSWN  158


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  ID+S   ++G  P  +CS LPKLRVL++ +N   G  P SL +   L+ L++    L
Sbjct  273  LTDIDISVSRLTGSIPDSICS-LPKLRVLQLYNNSLTGEIPKSLGNSRTLKILSLYDNYL  331

Query  500  TGSL-PDLSPLQALRALDLSYN  562
            TG L P+L     + ALD+S N
Sbjct  332  TGELPPNLGYSSPMVALDVSEN  353



>ref|XP_008662594.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
 tpg|DAA47694.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1003

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 76/130 (58%), Gaps = 6/130 (5%)
 Frame = +2

Query  194  RLDDQSEFFTAMKKSFTGSLMGRW-----DGEAVCEYRGVVCDDKDYVVKIDVSGWSISG  358
             LD Q+ +   MK+ F G  M RW          C +RGV CD    V  IDV+ W + G
Sbjct  36   ELDTQAAYLAKMKEEFPGPGMSRWWDFTSPAPDYCSFRGVACDPSGNVTGIDVTSWRLVG  95

Query  359  EFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQA  535
              P  VC+ LP LR LR+  N   GGFP  + +C+ LE LN++ + ++G++P DLSPL+A
Sbjct  96   RLPPGVCAALPALRELRMACNDVRGGFPLGVLNCTSLEVLNLSFSGVSGAVPRDLSPLRA  155

Query  536  LRALDLSYNL  565
            LR LDLS NL
Sbjct  156  LRVLDLSNNL  165



>gb|KFK40815.1| hypothetical protein AALP_AA2G044900 [Arabis alpina]
Length=959

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 81/124 (65%), Gaps = 6/124 (5%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD-GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDV  376
            + Q++FF  M+ S +G+    W+  +  C + GV+CD +  V  +D+SGWS+SG FP  +
Sbjct  28   NQQAQFFKLMRSSLSGN---AWNLSDDYCNFPGVICDGQGLVTDLDLSGWSLSGIFPDGI  84

Query  377  CSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALD  550
            CSY P LRVLR+ HN  +    F  ++ +CS L ELN+++  L  +LPD SP+++LR +D
Sbjct  85   CSYFPNLRVLRLSHNHLNRSSSFLHTIPNCSMLRELNLSSLYLKATLPDFSPMKSLRVID  144

Query  551  LSYN  562
            +S+N
Sbjct  145  MSWN  148


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 47/83 (57%), Gaps = 2/83 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  ID+S   ++G  P  +CS LPKLRVL++ +N   G  P SL     L+ L++    L
Sbjct  263  LTDIDISVSRLTGSIPESICS-LPKLRVLQLYNNSLTGEIPKSLGYSKTLKILSLYDNYL  321

Query  500  TGSL-PDLSPLQALRALDLSYNL  565
            TG L P+L     + ALD+S NL
Sbjct  322  TGELPPNLGSSSPMIALDVSENL  344



>ref|XP_002865749.1| hypothetical protein ARALYDRAFT_495025 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42008.1| hypothetical protein ARALYDRAFT_495025 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 79/125 (63%), Gaps = 8/125 (6%)
 Frame = +2

Query  206  QSEFFTAMKKSFTGSLMGRWD----GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGD  373
            Q +FF  MK S +G  +  W+    G   C + GV CD +  V  +D+SG  +SG FP  
Sbjct  31   QPQFFKLMKNSLSG--LSSWNVSDVGTYYCNFNGVRCDGQGLVTDLDLSGLYLSGIFPEG  88

Query  374  VCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRAL  547
            +CSYLP LRVLR+ HN  +    F  ++ +CS L+ELNM++  L G+LPD SP+++LR +
Sbjct  89   ICSYLPNLRVLRLSHNHLNRSSSFLNTIPNCSLLQELNMSSVYLKGTLPDFSPMKSLRVI  148

Query  548  DLSYN  562
            D+S+N
Sbjct  149  DMSWN  153


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  ID+S   ++G  P  +CS LPKLRVL++ +N   G  P SL     L+ L++    L
Sbjct  268  LTDIDISVSRLTGSIPDSICS-LPKLRVLQLYNNSLTGEIPKSLGKSKTLKILSLYDNYL  326

Query  500  TGSL-PDLSPLQALRALDLSYN  562
            TG L P+L     + ALD+S N
Sbjct  327  TGELPPNLGSSSPMIALDVSEN  348



>ref|NP_199777.1| receptor like kinase [Arabidopsis thaliana]
 dbj|BAB10911.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59387.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95842.1| receptor like kinase [Arabidopsis thaliana]
Length=966

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 77/127 (61%), Gaps = 6/127 (5%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD----GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFP  367
            + Q +FF  MK S  G  +  W+    G   C + GV CD +  V  +D+SG S+SG FP
Sbjct  29   NQQPQFFKLMKNSLFGDALSTWNVYDVGTNYCNFTGVRCDGQGLVTDLDLSGLSLSGIFP  88

Query  368  GDVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALR  541
              VCSY P LRVLR+ HN  +    F  ++ +CS L +LNM++  L G+LPD S +++LR
Sbjct  89   DGVCSYFPNLRVLRLSHNHLNKSSSFLNTIPNCSLLRDLNMSSVYLKGTLPDFSQMKSLR  148

Query  542  ALDLSYN  562
             +D+S+N
Sbjct  149  VIDMSWN  155



>dbj|BAC42540.1| putative receptor protein kinase [Arabidopsis thaliana]
Length=966

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 77/127 (61%), Gaps = 6/127 (5%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD----GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFP  367
            + Q +FF  MK S  G  +  W+    G   C + GV CD +  V  +D+SG S+SG FP
Sbjct  29   NQQPQFFKLMKNSLFGDALSTWNVYDVGTNYCNFTGVRCDGQGLVTDLDLSGLSLSGIFP  88

Query  368  GDVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALR  541
              VCSY P LRVLR+ HN  +    F  ++ +CS L +LNM++  L G+LPD S +++LR
Sbjct  89   DGVCSYFPNLRVLRLSHNHLNKSSSFLNTIPNCSLLRDLNMSSVYLKGTLPDFSQMKSLR  148

Query  542  ALDLSYN  562
             +D+S+N
Sbjct  149  VIDMSWN  155



>ref|XP_009123552.1| PREDICTED: receptor-like protein kinase HSL1 [Brassica rapa]
Length=966

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 80/128 (63%), Gaps = 7/128 (5%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD-GEAV----CEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            + QS+FF  MK S +   +  W+  +AV    C + GV CD +  V  +D+SG S+SG F
Sbjct  28   NQQSQFFKLMKNSLSSDALSSWNLSDAVTSYYCNFTGVRCDGQGLVTDLDLSGLSLSGIF  87

Query  365  PGDVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
            P  +CS+LP LRVLR+  N  +    F   +  CS L+ELNM++  LT +LPD SP+++L
Sbjct  88   PDGICSFLPNLRVLRLSRNHLNRSSSFLNDIPDCSLLQELNMSSLYLTATLPDFSPMKSL  147

Query  539  RALDLSYN  562
            R +D+S+N
Sbjct  148  RVIDMSWN  155


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  +D+S   ++G  P  +CS LPKLRVL++ +N   G  P SL +   L+ L++    L
Sbjct  270  LTDLDISVSKLTGRIPESICS-LPKLRVLQLYNNSLTGEIPKSLGNSRTLKILSLYDNYL  328

Query  500  TGSL-PDLSPLQALRALDLSYN  562
            TG L P+L     + ALD+S N
Sbjct  329  TGELPPNLGSSSPMIALDVSEN  350



>emb|CDX71602.1| BnaC09g26430D [Brassica napus]
Length=953

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 79/126 (63%), Gaps = 7/126 (6%)
 Frame = +2

Query  206  QSEFFTAMKKSFTGSLMGRWD-GEAV----CEYRGVVCDDKDYVVKIDVSGWSISGEFPG  370
            QS+FF  MK S +   +  W+  +AV    C + GV CD +  V  +D+SG S+SG FP 
Sbjct  30   QSQFFKLMKNSLSSDALSSWNLSDAVTSYYCNFTGVRCDGQGLVTDLDLSGLSLSGIFPD  89

Query  371  DVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
             +CS+LP LRVLR+  N  +    F   +  CS L+ELNM++  LT +LPD SP+++LR 
Sbjct  90   GICSFLPNLRVLRLSRNHLNRSSSFLNDIPDCSLLQELNMSSLYLTATLPDFSPMKSLRV  149

Query  545  LDLSYN  562
            +D+S+N
Sbjct  150  IDMSWN  155



>ref|XP_002442602.1| hypothetical protein SORBIDRAFT_08g022790 [Sorghum bicolor]
 gb|EES16440.1| hypothetical protein SORBIDRAFT_08g022790 [Sorghum bicolor]
Length=1005

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 76/132 (58%), Gaps = 8/132 (6%)
 Frame = +2

Query  194  RLDDQSEFFTAMKKSFTGSLMGRW-------DGEAVCEYRGVVCDDKDYVVKIDVSGWSI  352
             LD Q+ +   MK+ F G  M RW            C + GV CD    V  IDV+ W +
Sbjct  38   ELDTQAAYLAKMKEQFPGPGMSRWWDFTSSPAAPDYCSFHGVTCDRSGNVTGIDVTSWRL  97

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSL-PDLSPL  529
             G  P  VC+ LP LR LR+ +N   GGFP  + +C+ LE LN++ + ++G++ PDLSPL
Sbjct  98   VGRLPPGVCAALPALRELRMAYNDVRGGFPLGVLNCTSLEVLNLSFSGVSGAVPPDLSPL  157

Query  530  QALRALDLSYNL  565
            ++LR LDLS NL
Sbjct  158  RSLRVLDLSNNL  169



>emb|CDY37769.1| BnaA10g05520D [Brassica napus]
Length=1111

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 80/128 (63%), Gaps = 7/128 (5%)
 Frame = +2

Query  200  DDQSEFFTAMKKSFTGSLMGRWD-GEAV----CEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            + QS+FF  MK S +   +  W+  +AV    C + GV CD +  V  +D+SG S+SG F
Sbjct  173  NQQSQFFKLMKNSLSSDALSYWNLSDAVTSYYCNFTGVRCDGQGLVTDLDLSGLSLSGIF  232

Query  365  PGDVCSYLPKLRVLRVGHNKFH--GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
            P  +CS+LP LRVLR+  N  +    F   +  CS L+ELNM++  LT +LPD SP+++L
Sbjct  233  PDGICSFLPNLRVLRLSRNHLNRSSSFLNDIPDCSLLQELNMSSLYLTATLPDFSPMKSL  292

Query  539  RALDLSYN  562
            R +D+S+N
Sbjct  293  RVIDMSWN  300


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  +D+S   ++G  P  +CS LPKLRVL++ +N   G  P SL +   L+ L++    L
Sbjct  415  LTDLDISVSKLTGRIPESICS-LPKLRVLQLYNNSLTGEIPKSLGNSRTLKILSLYDNYL  473

Query  500  TGSL-PDLSPLQALRALDLSYN  562
            TG L P+L     + ALD+S N
Sbjct  474  TGELPPNLGSSSPMIALDVSEN  495



>ref|XP_006852742.1| hypothetical protein AMTR_s00033p00105380 [Amborella trichopoda]
 gb|ERN14209.1| hypothetical protein AMTR_s00033p00105380 [Amborella trichopoda]
Length=960

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +2

Query  275  AVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLT  454
            A C + GV+CD    +++++ SG  + G FP + C +LP+LR L++G N FHG FP  + 
Sbjct  62   AYCNFEGVLCDTFGSIMELNFSGRVLGGLFPANACHFLPELRTLKLGGNWFHGDFPVGIV  121

Query  455  SCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            +CS LEELN+T  + +G LPDLSPL +L+ LDLSYN
Sbjct  122  NCSLLEELNLTMNHFSGQLPDLSPLTSLKVLDLSYN  157



>ref|XP_004501072.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=966

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 83/125 (66%), Gaps = 7/125 (6%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSLMGRWD---GEAVCEYRGVVCDDKDYVVKIDVSGWS-ISGEFPG  370
            +QSEFF+ MK S TG+    W     + +C + G+ C+DK  V+ +D +G+S +SG FP 
Sbjct  29   NQSEFFSLMKLSLTGNHPLDWSFKLDKPICAFTGITCNDKGDVMSLDFTGYSSLSGNFPL  88

Query  371  DVCSYLPKLRVLRVGHNKFHGGFP-GSLTSCSFLEELNMTATNLTGSLPDLSPLQALRAL  547
            ++C Y P LR+LR+ + KF   FP  S+T+CS LEEL M   + +G+LP+ S L++LR L
Sbjct  89   NICIYFPNLRILRLSNTKFK--FPTNSITNCSHLEELYMNQMHQSGTLPNFSSLKSLRIL  146

Query  548  DLSYN  562
            DLSYN
Sbjct  147  DLSYN  151



>ref|XP_008674126.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
 tpg|DAA54766.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1021

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 75/130 (58%), Gaps = 6/130 (5%)
 Frame = +2

Query  194  RLDDQSEFFTAMKKSFTGSLMGRW-----DGEAVCEYRGVVCDDKDYVVKIDVSGWSISG  358
             LD Q+ +   MK+ F G  M RW          C + G+ CD    V  IDV+ W + G
Sbjct  37   ELDTQAAYLANMKEQFAGPGMSRWWDFMSPAPDYCSFHGIACDRSGNVTGIDVTSWRLVG  96

Query  359  EFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSL-PDLSPLQA  535
              P  VC+ LP LR LR+ +N   GGFP  + +C+ LE LN++ + ++G++ P+LS L+A
Sbjct  97   RLPPGVCAALPALRELRMAYNDVRGGFPLGVLNCTSLEVLNLSYSGVSGAVPPNLSRLRA  156

Query  536  LRALDLSYNL  565
            LR LDLS NL
Sbjct  157  LRVLDLSNNL  166



>gb|KDP41544.1| hypothetical protein JCGZ_15951 [Jatropha curcas]
Length=232

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 72/121 (60%), Gaps = 6/121 (5%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCS  382
            +QSEFF  MK   +G  +  W   ++ E    +       VK    GWSISG FP  +CS
Sbjct  30   NQSEFFNLMKTFLSGKPLSDW--MSMEENHSAISPASIVTVK----GWSISGRFPVGICS  83

Query  383  YLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            YL KLR+LRVG+N  +G    S+ +CS LE+LNMT+  L G   D S L++L+ LD+SYN
Sbjct  84   YLAKLRILRVGYNNLYGDILHSIVNCSQLEQLNMTSLYLEGMFADFSKLKSLKVLDMSYN  143

Query  563  L  565
            L
Sbjct  144  L  144



>ref|XP_003526517.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=963

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 85/127 (67%), Gaps = 9/127 (7%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSLMGRWD--GEAV--CEYRGVVCDDKDYVVKIDVSGWSISG-EFP  367
            +QS+FF+ MK S +G     WD  GE V  C + GV C+ K  V+ +D+SG S    +FP
Sbjct  27   NQSQFFSLMKDSLSGKYPTNWDAAGEVVPICGFTGVTCNTKGEVINLDLSGLSSLSGKFP  86

Query  368  GDVCSYLPKLRVLRVGHNKFHGGFP-GSLTSCSFLEELNMTATNLTGSLPDLSPL-QALR  541
             D+CSYLP+LRVLR+GH +    FP  ++ +CS LEELNM   +LTG+LPD S L +++R
Sbjct  87   PDICSYLPQLRVLRLGHTRLK--FPIDTILNCSHLEELNMNHMSLTGTLPDFSSLKKSIR  144

Query  542  ALDLSYN  562
             LDLSYN
Sbjct  145  ILDLSYN  151



>ref|XP_007227013.1| hypothetical protein PRUPE_ppa001184mg [Prunus persica]
 gb|EMJ28212.1| hypothetical protein PRUPE_ppa001184mg [Prunus persica]
Length=886

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +2

Query  329  IDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGS  508
            +D+SG S+SG FP D+CSYLP+LRV+R+G N   G F  S+T+CS LEEL+M    L+ +
Sbjct  1    MDISGRSLSGHFPADICSYLPELRVIRLGRNNLQGDFLNSITNCSVLEELSMDHLFLSQT  60

Query  509  LPDLSPLQALRALDLSYNL  565
            LPD S L+ LR LDLSYNL
Sbjct  61   LPDFSRLKFLRILDLSYNL  79



>ref|XP_003579098.1| PREDICTED: receptor-like protein kinase HSL1 [Brachypodium distachyon]
Length=981

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 71/124 (57%), Gaps = 11/124 (9%)
 Frame = +2

Query  227  MKKSFTGSLMGRWD------GEAVCEYRGVVCDDKDY-VVKIDVSGWSISGEFPGDVCSY  385
            MK+ F G  M RWD          C + G+ CDD D+ +  IDV+ W ++G+ P  +CS 
Sbjct  34   MKREFAGPAMARWDLSSSPAPAEYCRFPGISCDDADFNITGIDVTSWRLTGKLPLGLCSS  93

Query  386  LPKLRVLRVGHNKFHGGFPGS-LTSCSF-LEELNMTATNLTGSLPD--LSPLQALRALDL  553
            LP LR +R+  N   GGFP + L +CS  LE LN++   ++G +P   LS + ALR LD 
Sbjct  94   LPSLREVRMAFNDVRGGFPAALLNNCSSQLEVLNISYAGVSGPIPADLLSAMAALRVLDA  153

Query  554  SYNL  565
            S NL
Sbjct  154  SNNL  157



>emb|CBI19329.3| unnamed protein product [Vitis vinifera]
Length=644

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 3/78 (4%)
 Frame = +2

Query  329  IDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGS  508
            ID+SGWS+SG FP DVCSYLP+LRVLR+ +N  H  FP  + +CS LEEL+M   N+   
Sbjct  31   IDISGWSLSGRFPPDVCSYLPQLRVLRLSYNDLHDNFPEGIVNCSLLEELDM---NVPFI  87

Query  509  LPDLSPLQALRALDLSYN  562
             P +  + +L  L LS N
Sbjct  88   PPSIGNMTSLVDLQLSGN  105



>ref|XP_010943249.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Elaeis 
guineensis]
Length=894

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQ  532
            SG+FP  VCS LP LR LR+  N    GFP  L +CSFL ELN + + LTG++PDLS LQ
Sbjct  24   SGDFPSGVCSSLPMLRALRLADNDISNGFPEDLFNCSFLGELNFSHSGLTGAVPDLSQLQ  83

Query  533  ALRALDLSYN  562
            +L  +DLS N
Sbjct  84   SLHMIDLSNN  93



>gb|ABK26727.1| unknown [Picea sitchensis]
Length=291

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (54%), Gaps = 7/126 (6%)
 Frame = +2

Query  203  DQSEFFTAMKKSF---TGSLMGRWDGEAV--CEYRGVVCDDKDYVVKIDVSGWSISGEFP  367
            D+ +   ++K      T +  G W+  A   C++ G+ C+    V +I++    +SG  P
Sbjct  55   DEIQILLSIKSGLRDSTNAFQG-WESSAASPCKWNGITCNTAGSVTEINLENNGLSGPIP  113

Query  368  GDVCSYLPKLRVLRVGHNKFHGGFP-GSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
                  L  L  +++G+N  HG  P G   +CS LE LN+T+  LTG+LPD S L++L++
Sbjct  114  SSAICSLKALTSIQLGNNSLHGNIPDGQWINCSQLETLNLTSNLLTGTLPDFSALRSLKS  173

Query  545  LDLSYN  562
            L LS N
Sbjct  174  LGLSEN  179



>gb|EMT01037.1| Receptor-like protein kinase HSL1 [Aegilops tauschii]
Length=820

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  356  GEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQA  535
            G  P  +C+ LP LR L + +N+  GGFP  L +CS LE LN++  +++G+LPDLSP++A
Sbjct  23   GRLPPGICAALPALRDLLLAYNEIRGGFPPGLLNCSSLETLNLSFASVSGALPDLSPMRA  82

Query  536  LRALDLSYNL  565
            LR LDLS NL
Sbjct  83   LRVLDLSDNL  92



>gb|KCW59611.1| hypothetical protein EUGRSUZ_H02353 [Eucalyptus grandis]
Length=906

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = +2

Query  281  CEYRGVVCDDKDY-VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPG-SLT  454
            C + GV C+ ++  VV ID+SG +++G FP D C  +  LR L +G N F+G   G SL+
Sbjct  74   CNWTGVTCETRNRSVVAIDLSGLNVAGRFPYDFCR-IRTLRKLLLGDNSFNGTVAGPSLS  132

Query  455  SCSFLEELNMTATNLTGSLPDLSP-LQALRALDLSYN  562
             CS L+ LN+++    G LPDLSP    LR LDLSYN
Sbjct  133  LCSHLQWLNISSNYFVGQLPDLSPGFADLRFLDLSYN  169


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +V+ DVS  S +GE P ++CS   KL+ + V +N+F G  P SL SC  LE + ++   L
Sbjct  377  LVEFDVSSNSFTGELPENLCSR-GKLQQVIVLNNRFTGSLPSSLASCDSLEYVRISNNGL  435

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G +P     LQA+  LD+SYN
Sbjct  436  SGEVPAGFWGLQAVSYLDMSYN  457


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +2

Query  335  VSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP  514
            ++G   SG+ P ++C  L  L V+ V +N+F GG P  +T+   L++L M    LTG +P
Sbjct  478  IAGNKFSGDIPAEICQ-LSNLTVVDVSNNQFGGGLPTCITNLGSLQKLKMQGNLLTGPIP  536

Query  515  -DLSPLQALRALDLSYN  562
              + P   L  L+LS N
Sbjct  537  SSVGPWADLTELNLSNN  553



>ref|XP_010023354.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 isoform X3 [Eucalyptus grandis]
 gb|KCW59610.1| hypothetical protein EUGRSUZ_H02353 [Eucalyptus grandis]
Length=999

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = +2

Query  281  CEYRGVVCDDKDY-VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPG-SLT  454
            C + GV C+ ++  VV ID+SG +++G FP D C  +  LR L +G N F+G   G SL+
Sbjct  74   CNWTGVTCETRNRSVVAIDLSGLNVAGRFPYDFCR-IRTLRKLLLGDNSFNGTVAGPSLS  132

Query  455  SCSFLEELNMTATNLTGSLPDLSP-LQALRALDLSYN  562
             CS L+ LN+++    G LPDLSP    LR LDLSYN
Sbjct  133  LCSHLQWLNISSNYFVGQLPDLSPGFADLRFLDLSYN  169


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +V+ DVS  S +GE P ++CS   KL+ + V +N+F G  P SL SC  LE + ++   L
Sbjct  377  LVEFDVSSNSFTGELPENLCSR-GKLQQVIVLNNRFTGSLPSSLASCDSLEYVRISNNGL  435

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G +P     LQA+  LD+SYN
Sbjct  436  SGEVPAGFWGLQAVSYLDMSYN  457


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +2

Query  335  VSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP  514
            ++G   SG+ P ++C  L  L V+ V +N+F GG P  +T+   L++L M    LTG +P
Sbjct  478  IAGNKFSGDIPAEICQ-LSNLTVVDVSNNQFGGGLPTCITNLGSLQKLKMQGNLLTGPIP  536

Query  515  -DLSPLQALRALDLSYN  562
              + P   L  L+LS N
Sbjct  537  SSVGPWADLTELNLSNN  553



>ref|XP_010023353.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 isoform X2 [Eucalyptus grandis]
Length=1000

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = +2

Query  281  CEYRGVVCDDKDY-VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPG-SLT  454
            C + GV C+ ++  VV ID+SG +++G FP D C  +  LR L +G N F+G   G SL+
Sbjct  74   CNWTGVTCETRNRSVVAIDLSGLNVAGRFPYDFCR-IRTLRKLLLGDNSFNGTVAGPSLS  132

Query  455  SCSFLEELNMTATNLTGSLPDLSP-LQALRALDLSYN  562
             CS L+ LN+++    G LPDLSP    LR LDLSYN
Sbjct  133  LCSHLQWLNISSNYFVGQLPDLSPGFADLRFLDLSYN  169


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +V+ DVS  S +GE P ++CS   KL+ + V +N+F G  P SL SC  LE + ++   L
Sbjct  377  LVEFDVSSNSFTGELPENLCSR-GKLQQVIVLNNRFTGSLPSSLASCDSLEYVRISNNGL  435

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G +P     LQA+  LD+SYN
Sbjct  436  SGEVPAGFWGLQAVSYLDMSYN  457


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +2

Query  335  VSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP  514
            ++G   SG+ P ++C  L  L V+ V +N+F GG P  +T+   L++L M    LTG +P
Sbjct  478  IAGNKFSGDIPAEICQ-LSNLTVVDVSNNQFGGGLPTCITNLGSLQKLKMQGNLLTGPIP  536

Query  515  -DLSPLQALRALDLSYN  562
              + P   L  L+LS N
Sbjct  537  SSVGPWADLTELNLSNN  553



>ref|XP_010247922.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=975

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = +2

Query  206  QSEFFTAMKKSFTGSL--MGRW-DGEAVCEYRGVVCD-DKDYVVKIDVSGWSISGEFPGD  373
            ++E     KK     L  +  W D E+ C++ G+ CD D   V+ + +   S+SGE    
Sbjct  40   ETEALLQFKKQLKDPLGYLESWRDSESPCDFTGIFCDPDSGQVINVTLENKSLSGEISPS  99

Query  374  VCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDL  553
            + S L  L  L +  N   G  P  +TSC  L  LN++   LTG+LPDLS LQ+L ALD+
Sbjct  100  I-SKLESLSTLNLASNSISGKLPSEITSCRNLRLLNLSGNELTGTLPDLSELQSLEALDV  158

Query  554  SYN  562
              N
Sbjct  159  EDN  161



>ref|XP_009416779.1| PREDICTED: receptor-like protein kinase HAIKU2 [Musa acuminata 
subsp. malaccensis]
Length=1026

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 62/118 (53%), Gaps = 1/118 (1%)
 Frame = +2

Query  212  EFFTAMKKSFTGSLMGRWD-GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYL  388
            +F  ++K S   ++   WD G + C + G+ CD    V +ID++   ISGE   D    L
Sbjct  43   QFKASLKASTNATVFQSWDAGSSACSFAGIKCDSNGSVSEIDLTETGISGEIAFDSLCRL  102

Query  389  PKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            P L  L +G N   G     +++C+ L  L++    L G++PDL+ L  L+ L+LS N
Sbjct  103  PSLSALSLGSNSLTGSVSADVSNCTGLRHLDLAFNYLGGAVPDLARLNKLQVLNLSDN  160



>ref|XP_010023352.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 isoform X1 [Eucalyptus grandis]
 gb|KCW59608.1| hypothetical protein EUGRSUZ_H02351 [Eucalyptus grandis]
Length=1001

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = +2

Query  281  CEYRGVVCDDKDY-VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPG-SLT  454
            C + GV C+ ++  VV ID+S  +++G FP D C  +  LR L +G N F+G   G SL+
Sbjct  74   CNWTGVTCETRNRSVVAIDLSELNVAGRFPYDFCR-IRTLRKLSLGDNSFNGTVAGPSLS  132

Query  455  SCSFLEELNMTATNLTGSLPDLSP-LQALRALDLSYN  562
             CS L+ LN+++    G LPDLSP    LR LDLSYN
Sbjct  133  LCSHLQWLNISSNYFVGQLPDLSPGFADLRFLDLSYN  169


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            V  + ++G S SG+ P ++C  L  L V+ V +N+F GG P  +T+   L++L M    L
Sbjct  473  VTSLLIAGNSFSGDIPAEICQ-LSNLTVVDVSNNRFGGGLPTCITNLGSLQKLKMQGNLL  531

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            TG +P  + P   L  L+LS N
Sbjct  532  TGPIPSSVGPWAHLAELNLSNN  553


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +V+ DVS  S +GE P ++CS     RV+   +N+F G  P SL SC  L  + ++   L
Sbjct  377  LVEFDVSTNSFTGELPENLCSRGKLQRVIAF-NNRFTGSLPSSLASCDSLGYVRISNNGL  435

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G +P     LQ L  LD+SYN
Sbjct  436  SGEVPAGFWGLQGLSHLDMSYN  457



>gb|KCW59607.1| hypothetical protein EUGRSUZ_H02351 [Eucalyptus grandis]
Length=997

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (62%), Gaps = 4/97 (4%)
 Frame = +2

Query  281  CEYRGVVCDDKDY-VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPG-SLT  454
            C + GV C+ ++  VV ID+S  +++G FP D C  +  LR L +G N F+G   G SL+
Sbjct  74   CNWTGVTCETRNRSVVAIDLSELNVAGRFPYDFCR-IRTLRKLSLGDNSFNGTVAGPSLS  132

Query  455  SCSFLEELNMTATNLTGSLPDLSP-LQALRALDLSYN  562
             CS L+ LN+++    G LPDLSP    LR LDLSYN
Sbjct  133  LCSHLQWLNISSNYFVGQLPDLSPGFADLRFLDLSYN  169


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            V  + ++G S SG+ P ++C  L  L V+ V +N+F GG P  +T+   L++L M    L
Sbjct  473  VTSLLIAGNSFSGDIPAEICQ-LSNLTVVDVSNNRFGGGLPTCITNLGSLQKLKMQGNLL  531

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            TG +P  + P   L  L+LS N
Sbjct  532  TGPIPSSVGPWAHLAELNLSNN  553


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +V+ DVS  S +GE P ++CS     RV+   +N+F G  P SL SC  L  + ++   L
Sbjct  377  LVEFDVSTNSFTGELPENLCSRGKLQRVIAF-NNRFTGSLPSSLASCDSLGYVRISNNGL  435

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G +P     LQ L  LD+SYN
Sbjct  436  SGEVPAGFWGLQGLSHLDMSYN  457



>ref|XP_008674748.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
 ref|XP_008674749.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
 ref|XP_008674750.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
 tpg|DAA56552.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=958

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 58/102 (57%), Gaps = 3/102 (3%)
 Frame = +2

Query  263  WD-GEAVCEYRGVVCD-DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGG  436
            WD   + C++ GV CD +   V+ I +S  S+SG       S L +LR L +G N   G 
Sbjct  47   WDESHSPCQFYGVTCDHNSGDVIGISLSNISLSGTISSSF-SLLGQLRTLELGANSISGT  105

Query  437  FPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             P +L  C+ L+ LN++  +LTG LPDLS L  LR LDLS N
Sbjct  106  VPAALADCTNLQVLNLSMNSLTGELPDLSALVNLRVLDLSTN  147



>ref|XP_002456732.1| hypothetical protein SORBIDRAFT_03g041570 [Sorghum bicolor]
 gb|EES01852.1| hypothetical protein SORBIDRAFT_03g041570 [Sorghum bicolor]
Length=962

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 59/103 (57%), Gaps = 3/103 (3%)
 Frame = +2

Query  260  RWD-GEAVCEYRGVVCD-DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHG  433
             WD   + C++ GV CD +   V+ I +S  S+SG       S L +LR L +G N   G
Sbjct  48   NWDESHSPCQFYGVTCDRNSGDVIGISLSNISLSGTISSSF-SLLEQLRNLELGANSISG  106

Query  434  GFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
              P +L +CS L+ LN++  +LTG LPDLS L  L+ LDLS N
Sbjct  107  SIPAALANCSNLQVLNLSMNSLTGQLPDLSALVNLQVLDLSTN  149


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = +2

Query  326  KIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTG  505
            K+  S   +SG+ P  + S L +L  L + HN   G  P  +  CS + +LN+   +LTG
Sbjct  456  KLVASNNRLSGQIPKQIGS-LKQLTYLHLEHNALEGSIPPDIGMCSSMVDLNLAENSLTG  514

Query  506  SLPD-LSPLQALRALDLSYNL  565
             +PD L+ L  L +L++S+N+
Sbjct  515  DIPDTLASLVTLNSLNISHNM  535



>ref|XP_006645116.1| PREDICTED: receptor-like protein kinase HSL1-like [Oryza brachyantha]
Length=964

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 60/105 (57%), Gaps = 3/105 (3%)
 Frame = +2

Query  254  MGRWD-GEAVCEYRGVVCD-DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKF  427
            +  WD   + C++ GV CD +   V+ I +S  S+SG       S L +LR L +G N  
Sbjct  46   LKNWDDSHSPCQFYGVTCDQNSGGVIGISLSNASLSGTISSSF-SLLRQLRTLELGANSI  104

Query  428  HGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             G  P +L +C+ L+ LN++  +LTG LPDLS L  L+ LDLS N
Sbjct  105  SGTVPAALANCTNLQVLNLSTNSLTGQLPDLSTLIKLQVLDLSTN  149



>ref|XP_009626660.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Nicotiana tomentosiformis]
Length=951

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 66/121 (55%), Gaps = 4/121 (3%)
 Frame = +2

Query  212  EFFTAMKKSFT---GSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCS  382
            E   +MK S     GSL      ++ C + GV+CD+  +V KI++SG ++SG+    V +
Sbjct  33   ELLLSMKASMKDPLGSLHDWIPSQSFCHWNGVICDELSHVAKIELSGKNLSGKISESVFN  92

Query  383  YLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             LP +  + + +N+  G  P + +SC  L  LN++  N TG LP  S +  L  LDLS N
Sbjct  93   -LPHVESIDLSNNQLSGEIPSNFSSCLALRFLNLSNNNFTGPLPQGSRIPLLETLDLSNN  151

Query  563  L  565
            +
Sbjct  152  M  152



>emb|CDM82685.1| unnamed protein product [Triticum aestivum]
 emb|CDJ26457.1| unnamed protein product [Triticum aestivum]
Length=683

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 60/105 (57%), Gaps = 3/105 (3%)
 Frame = +2

Query  254  MGRWD-GEAVCEYRGVVCDDKDYVVK-IDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKF  427
            +  WD   + C++ GV CD+   VV  + +S  S+SG       S L +LR L +  N  
Sbjct  46   LSNWDESHSPCQFHGVTCDEISGVVTGVSLSNASLSGTISPSF-SVLHQLRTLDLSANSI  104

Query  428  HGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             G  P +LT+C+ L+ LN++  +LTG LPDLS L  L+ LDLS N
Sbjct  105  SGTIPAALTNCTNLQVLNLSVNSLTGQLPDLSSLLKLQVLDLSTN  149



>ref|XP_009411887.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411888.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411889.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=997

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 2/95 (2%)
 Frame = +2

Query  281  CEYRGVVCD-DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTS  457
            CE+ G+ CD D  +V+ I +   S+SG     + S LP L  L +  N   G  P ++  
Sbjct  94   CEFTGIHCDIDSGHVIGISLPNISLSGVISPSI-SLLPNLTTLELWENAISGVVPSAIAK  152

Query  458  CSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            C+ L+ LN++A  LTG LPDLS LQ L+ LDLS N
Sbjct  153  CTNLQVLNLSANFLTGQLPDLSSLQKLQVLDLSKN  187



>ref|XP_006489991.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Citrus sinensis]
Length=1027

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            ++ I ++   +SGE P ++C+YLP L+ L +  N FHG  P +L+ C  L++LN+ + NL
Sbjct  153  ILDIRLTNNRLSGELPKNICNYLPHLKALFLDKNMFHGKIPSALSKCKQLQQLNLHSNNL  212

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G++P ++  L  L+ +DL YN
Sbjct  213  SGAIPKEIGNLTMLKGIDLGYN  234



>ref|XP_006490007.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR-like [Citrus sinensis]
Length=736

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            ++ I ++   +SGE P ++C+YLP L+ L +  N FHG  P +L+ C  L++LN+ + NL
Sbjct  153  ILDIRLTNNRLSGELPKNICNYLPHLKALFLDKNMFHGKIPSALSKCKQLQQLNLHSNNL  212

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G++P ++  L  L+ +DL YN
Sbjct  213  SGAIPKEIGNLTMLKGIDLGYN  234



>gb|AGT16770.1| hypothetical protein SHCRBa_022_K23_R_30 [Saccharum hybrid cultivar 
R570]
Length=962

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 3/103 (3%)
 Frame = +2

Query  260  RWD-GEAVCEYRGVVCD-DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHG  433
             WD   + C++ GV CD +   V+ I +S  S+SG       S L +LR L +G N   G
Sbjct  48   NWDESHSPCQFYGVTCDHNSGDVIGISLSNISLSGTISSSF-SLLEQLRTLELGANSISG  106

Query  434  GFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
              P +L +C+ L+ LN++  +LTG LPDLS L  L+ LDLS N
Sbjct  107  IIPAALANCTNLQVLNLSMNSLTGQLPDLSALVNLQVLDLSTN  149



>emb|CDP16506.1| unnamed protein product [Coffea canephora]
Length=952

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 2/100 (2%)
 Frame = +2

Query  266  DGEAVCEYRGVVCD-DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFP  442
            D  + C++ GV CD +   V +I + G S+SG     + S L  L  LR+  N   G  P
Sbjct  33   DSNSPCQFYGVSCDQNTGLVTEISLDGKSLSGVISPSI-SQLQSLTSLRLPSNMLSGSLP  91

Query  443  GSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
              LT+C+ L+ LN+T  N+ GSLPDLS L  +  LDLS N
Sbjct  92   SELTNCTNLKVLNVTGNNMNGSLPDLSRLTKMEVLDLSIN  131



>ref|XP_004970775.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Setaria italica]
Length=961

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 3/103 (3%)
 Frame = +2

Query  260  RWDG-EAVCEYRGVVCD-DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHG  433
             WD   + C++ GV CD +   V+ I +S  S+SG       S L +LR L VG N   G
Sbjct  46   NWDKFHSPCQFYGVTCDHNSGDVIGISLSNISLSGTISSSF-SLLQQLRTLEVGANSISG  104

Query  434  GFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
              P +L +C+ L+ LN++  +LTG LPDLS L  L+ LD+S N
Sbjct  105  IVPAALANCTNLQVLNLSMNSLTGQLPDLSALLNLQVLDVSTN  147



>ref|XP_004970774.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Setaria italica]
Length=956

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 3/103 (3%)
 Frame = +2

Query  260  RWDG-EAVCEYRGVVCD-DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHG  433
             WD   + C++ GV CD +   V+ I +S  S+SG       S L +LR L VG N   G
Sbjct  41   NWDKFHSPCQFYGVTCDHNSGDVIGISLSNISLSGTISSSF-SLLQQLRTLEVGANSISG  99

Query  434  GFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
              P +L +C+ L+ LN++  +LTG LPDLS L  L+ LD+S N
Sbjct  100  IVPAALANCTNLQVLNLSMNSLTGQLPDLSALLNLQVLDVSTN  142



>ref|XP_009769280.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Nicotiana sylvestris]
Length=949

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 66/121 (55%), Gaps = 4/121 (3%)
 Frame = +2

Query  212  EFFTAMK---KSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCS  382
            E   +MK   K   GSL      ++ C + GV+CD+  +V KI++SG ++SG+    + +
Sbjct  33   ELLLSMKVWMKDPLGSLHNWIPSQSFCHWNGVICDELSHVTKIELSGKNLSGKISESIFN  92

Query  383  YLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             LP +  + + +N+  G  P + +SC  L  LN++  N TG LP  S +  L  LDLS N
Sbjct  93   -LPHVESIDLSNNQLSGEIPRNFSSCLALRFLNLSNNNFTGPLPQGSRIPLLETLDLSNN  151

Query  563  L  565
            +
Sbjct  152  M  152



>ref|XP_008645155.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Zea mays]
 ref|XP_008645156.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Zea mays]
 ref|XP_008645157.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Zea mays]
 ref|XP_008645158.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Zea mays]
 gb|AFW69772.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1033

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 75/159 (47%), Gaps = 30/159 (19%)
 Frame = +2

Query  167  YSVSGSYQARLDDQSEFFTAMKKSFTGSL--MGRW-DGEAV---CEYRGVVCDDKDYVVK  328
            +S+S +      D+     A+K  F  SL  +  W DG      C + GV C+    V +
Sbjct  16   WSISCTRAGAAGDERAALLALKAGFVDSLGALADWTDGAKAAPHCRWTGVRCNAAGLVDE  75

Query  329  IDVSGWSISGEFPGDV----------------CSYLPK-------LRVLRVGHNKFHGGF  439
            +D+SG ++SG+  GDV                 + LPK       LRVL V  N F G F
Sbjct  76   LDLSGKNLSGKVTGDVLRLPSLAVLNLSSNAFATALPKSLAPLSSLRVLDVSQNSFEGAF  135

Query  440  PGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDL  553
            P  L +C+ L+ +N +  N  G+LP DL+   +L+ +DL
Sbjct  136  PAGLGACAGLDTVNASGNNFVGALPADLANATSLQTVDL  174



>ref|XP_006300302.1| hypothetical protein CARUB_v10019725mg [Capsella rubella]
 gb|EOA33200.1| hypothetical protein CARUB_v10019725mg [Capsella rubella]
Length=976

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 78/164 (48%), Gaps = 33/164 (20%)
 Frame = +2

Query  74   FFPPFSSSRDQKKTNKKMALHRIAIllllllYSVSGSYQARLDDQSEFFTAMKKSFTGSL  253
            FFPP     + + T +K AL R               ++ RLDD      + K S     
Sbjct  23   FFPP-----NVESTVEKQALFR---------------FKNRLDDPHNVLESWKPS-----  57

Query  254  MGRWDGEAVCEYRGVVCD-DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFH  430
                  ++ C YRGV CD   + V  I +   ++SG     + S L KL  L +  N   
Sbjct  58   ------DSPCVYRGVTCDLISEEVTGISLGNANLSGTISPSI-SALTKLSTLSLPFNSIS  110

Query  431  GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            G  P  +T+C+ L+ LN+T+  L+G++P+LSPL+ L  LD+S N
Sbjct  111  GVIPPEITNCTNLKVLNLTSNRLSGTIPNLSPLKTLEILDISGN  154



>ref|XP_010232642.1| PREDICTED: receptor-like protein kinase HSL1 [Brachypodium distachyon]
Length=948

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 57/103 (55%), Gaps = 3/103 (3%)
 Frame = +2

Query  260  RWDG-EAVCEYRGVVCDD-KDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHG  433
             WD   + C Y GV CD     V+ + +S  S+SG       S L +L  L +G N   G
Sbjct  48   NWDEFHSPCYYYGVTCDKLSGEVIGVSLSNVSLSGTISPSF-SLLRRLHTLELGANSISG  106

Query  434  GFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
              P +L +C+ L+ LN++  +LTG LPDLSPL  L+ LDLS N
Sbjct  107  IIPAALANCTNLQVLNLSMNSLTGQLPDLSPLLKLQVLDLSTN  149



>ref|XP_010943231.1| PREDICTED: receptor-like protein kinase HAIKU2 [Elaeis guineensis]
Length=1002

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 0/94 (0%)
 Frame = +2

Query  281  CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
            C + G+VC+  + V +I++     SGE P      LP L  L +G+N   G F   + +C
Sbjct  55   CNFTGIVCNSANSVAEINLRNRGFSGELPLSSLCQLPSLSELSLGYNHLFGEFTADIRNC  114

Query  461  SFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            + L  L++    LTG +PDLSPL  L  L++S N
Sbjct  115  TGLRRLDLAFNKLTGVVPDLSPLNKLEVLNISDN  148



>ref|XP_004245154.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Solanum lycopersicum]
Length=944

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = +2

Query  272  EAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSL  451
            ++ C + GVVCDD  +V KI++SG ++SG+    + ++ P + ++ + +N+ +G  P ++
Sbjct  54   QSFCHWNGVVCDDLLHVAKIELSGKNLSGKLSETIFNF-PYVELIDLSNNQLYGEIPSNI  112

Query  452  TSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYNL  565
            ++C  L  LN++  N TG LP  S +  L  LDLS N+
Sbjct  113  STCLALRFLNLSNNNFTGLLPQGSRIPLLETLDLSNNM  150



>ref|XP_010911833.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis]
Length=974

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = +2

Query  266  DGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPG  445
            + ++ C++ GV CDD   V++I ++  S+SG+      S L  L  L +G N   G  P 
Sbjct  65   ESQSPCQFVGVNCDDSGQVIRISLANLSLSGKI-SPSVSVLHSLSSLVLGANAISGIVPA  123

Query  446  SLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            +L +C+ L+ LN++  +LTG LPDLS LQ LR LDLS N
Sbjct  124  ALVNCTNLQVLNLSTNSLTGQLPDLSSLQNLRVLDLSTN  162



>ref|XP_002281133.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Vitis vinifera]
 ref|XP_010648487.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Vitis vinifera]
 emb|CBI20837.3| unnamed protein product [Vitis vinifera]
Length=967

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 66/124 (53%), Gaps = 5/124 (4%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSL--MGRWDGEA-VCEYRGVVCDDKDYVVKIDVSGWSISGEFPGD  373
            ++ E   + K S    L  +  W+     C + G++C +  +V  ID+SG +ISGE    
Sbjct  29   EEIELLLSFKASINDPLGFLSNWNSSVDFCNWYGILCTNSSHVSSIDLSGKNISGEI-SP  87

Query  374  VCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDL  553
            V   LP +  + + +N   GG PG+++ C  L  LN++  NLTGS+P  S    L ALDL
Sbjct  88   VFFGLPYIETVNLSNNALSGGIPGNISLCYSLRYLNLSNNNLTGSMPRGSA-SGLEALDL  146

Query  554  SYNL  565
            S N+
Sbjct  147  SNNV  150



>ref|XP_009406957.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Musa acuminata subsp. malaccensis]
Length=401

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 61/112 (54%), Gaps = 8/112 (7%)
 Frame = +2

Query  248  SLMGRWDGEAVCEYRGVVC------DDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLR  409
            +  G W G  VC Y G+VC        +D V  +D +G  ++G FP ++ + L ++ ++ 
Sbjct  39   NFTGNWVGHDVCSYNGIVCAPSLGDPSQDAVAGLDFNGADLAGHFPVEL-ALLHEISLIH  97

Query  410  VGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
            V  N+F G  PG+L++   LEEL+++     G  P ++  L  LR LDL +N
Sbjct  98   VNSNRFQGQIPGNLSNLQLLEELDLSNNGFVGPFPMEVLQLPKLRYLDLRFN  149



>ref|XP_008787835.1| PREDICTED: uncharacterized protein LOC103705762 [Phoenix dactylifera]
Length=2109

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +2

Query  281   CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
             C + G+VC+  + V KI+++   ISG+ P      LP L  L +G N   G F   + +C
Sbjct  944   CNFTGIVCNSANSVAKINLNSKGISGKPPFSSLCRLPALSELSLGSNHLSGTFAADIRTC  1003

Query  461   SFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             + L+ L++     TG +PDLSPL  L  L+LS N
Sbjct  1004  TGLQRLDLAFNKFTGVVPDLSPLNKLEVLNLSDN  1037


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 0/94 (0%)
 Frame = +2

Query  281  CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
            C + G+VC+  + V KI+++   ISG+ P      LP L  L +G N   G     + +C
Sbjct  56   CNFTGIVCNSANSVAKINLNSKGISGKPPFSSLCRLPALSELSLGSNHLSGTLAADIRNC  115

Query  461  SFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            + L+ L++     TG +PDLSPL  L+ L+LS N
Sbjct  116  TGLQRLDLAYNKFTGVVPDLSPLNKLKVLNLSDN  149



>ref|XP_010064750.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Eucalyptus grandis]
Length=513

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 68/128 (53%), Gaps = 12/128 (9%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGE  361
            +++++LD  S +            +  W+G + C +RG+ CD    +V  ++S  +I G 
Sbjct  55   TWKSKLDSGSRYN-----------LSSWNGSSPCSWRGIDCDPLGSIVSFNLSSSAIRGT  103

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQAL  538
                  S+LP L  LR+ +NK  G  P S+   S L  L +T  NL+G++P +L  L++L
Sbjct  104  LHALNFSHLPNLVTLRLPYNKLFGNIPLSIGHLSKLIRLELTGNNLSGNIPIELGSLRSL  163

Query  539  RALDLSYN  562
            + LDL+ N
Sbjct  164  QYLDLASN  171



>sp|P93194.2|RPK1_IPONI RecName: Full=Receptor-like protein kinase; Flags: Precursor 
[Ipomoea nil]
 gb|AAB36558.2| receptor-like protein kinase INRPK1 [Ipomoea nil]
Length=1109

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 58/95 (61%), Gaps = 2/95 (2%)
 Frame = +2

Query  281  CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
            C + GV CD + +V  +++S + ISGEF G   S+L  L+ + +  N F G  P  L +C
Sbjct  57   CSWLGVECDRRQFVDTLNLSSYGISGEF-GPEISHLKHLKKVVLSGNGFFGSIPSQLGNC  115

Query  461  SFLEELNMTATNLTGSLPD-LSPLQALRALDLSYN  562
            S LE +++++ + TG++PD L  LQ LR L L +N
Sbjct  116  SLLEHIDLSSNSFTGNIPDTLGALQNLRNLSLFFN  150


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +2

Query  287  YRGVVCDD---KDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTS  457
            + GV+  D      +  +D++    +G  P ++CS   KL+ L +G+N   G  P  L  
Sbjct  416  FTGVIPQDLGANSSLEVLDLTRNMFTGHIPPNLCSQ-KKLKRLLLGYNYLEGSVPSDLGG  474

Query  458  CSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            CS LE L +   NL G LPD    Q L   DLS N
Sbjct  475  CSTLERLILEENNLRGGLPDFVEKQNLLFFDLSGN  509



>gb|KCW68814.1| hypothetical protein EUGRSUZ_F02414 [Eucalyptus grandis]
Length=676

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 68/128 (53%), Gaps = 12/128 (9%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGE  361
            +++++LD  S +            +  W+G + C +RG+ CD    +V  ++S  +I G 
Sbjct  32   TWKSKLDSGSRYN-----------LSSWNGSSPCSWRGIDCDPLGSIVSFNLSSSAIRGT  80

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQAL  538
                  S+LP L  LR+ +NK  G  P S+   S L  L +T  NL+G++P +L  L++L
Sbjct  81   LHALNFSHLPNLVTLRLPYNKLFGNIPLSIGHLSKLIRLELTGNNLSGNIPIELGSLRSL  140

Query  539  RALDLSYN  562
            + LDL+ N
Sbjct  141  QYLDLASN  148



>gb|KJB16079.1| hypothetical protein B456_002G211900 [Gossypium raimondii]
Length=968

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +2

Query  212  EFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLP  391
            +F +++++S +        G++ C + GVVC+   +V +I++    I G  P D    L 
Sbjct  59   KFKSSVERSDSNVFSSWTQGKSACNFSGVVCNSNGFVTEINLPQQQIVGYLPFDSICELQ  118

Query  392  KLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
             L  + VG+N FHG     L  CS L  L++     +G +PDLS L  L+ L+L+
Sbjct  119  ALEKIDVGNNSFHGKISEDLKKCSGLHYLDLGCNAFSGEVPDLSSLNGLKFLNLN  173



>gb|KJB16078.1| hypothetical protein B456_002G211900 [Gossypium raimondii]
Length=996

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +2

Query  212  EFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLP  391
            +F +++++S +        G++ C + GVVC+   +V +I++    I G  P D    L 
Sbjct  59   KFKSSVERSDSNVFSSWTQGKSACNFSGVVCNSNGFVTEINLPQQQIVGYLPFDSICELQ  118

Query  392  KLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
             L  + VG+N FHG     L  CS L  L++     +G +PDLS L  L+ L+L+
Sbjct  119  ALEKIDVGNNSFHGKISEDLKKCSGLHYLDLGCNAFSGEVPDLSSLNGLKFLNLN  173



>ref|XP_010667749.1| PREDICTED: receptor-like protein kinase HAIKU2 [Beta vulgaris 
subsp. vulgaris]
Length=979

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +2

Query  248  SLMGRW-DGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNK  424
            +L   W     +C++ G+ C++   V++ID+S   +SG  P D    LP L+ L  G N 
Sbjct  40   TLFSTWISSNPICDFHGISCNNAGNVIEIDLSKQRLSGTLPFDTICSLPSLQKLAFGFNS  99

Query  425  FHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
              G     L +C+ L+ L++     +GS PD+SPL  L+ L L+
Sbjct  100  LSGAISSHLRNCTNLQYLDLGNNQFSGSFPDISPLSELKYLYLN  143



>gb|KJB64050.1| hypothetical protein B456_010G030600 [Gossypium raimondii]
Length=985

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = +2

Query  221  TAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLR  400
            +A+ KS T +        ++C + G+ C+ + ++ ++D+S  +++G  P D    LP L+
Sbjct  43   SALNKSTTTAFNSWQTPNSICTFNGITCNHEGFITELDLSTQNLTGILPFDSLCKLPSLQ  102

Query  401  VLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
             L  G+N  HG   G L +C  L+ L++     TG  PD+S L  L+ L L+
Sbjct  103  KLSFGYNSLHGPITGELNNCVKLQYLDLGNNFFTGIFPDISSLIQLKFLHLN  154


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +VKI+V+    SG+ P  +   L +L VL+  +N   G  P SL SC  L ++NM   +L
Sbjct  461  LVKIEVNDNKFSGKIPHGI-GELKRLNVLKFHNNMLSGSIPESLCSCVSLSDINMAVNSL  519

Query  500  TGSLPD-LSPLQALRALDLSYN  562
            +G +P  L  L  L +L+LS N
Sbjct  520  SGKIPSCLGSLATLNSLNLSLN  541



>ref|XP_006489957.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170-like [Citrus sinensis]
Length=697

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            ++ I ++   +SGE P ++C+YLP L+ L +  N  HG  P +L+ C  L++LN+   NL
Sbjct  153  ILDIRLTNNRLSGELPKNICNYLPYLKALFLDKNMLHGKIPSALSKCKQLQQLNLQFNNL  212

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G++P ++  L  L+ +DL YN
Sbjct  213  SGAIPKEIGNLTMLKGIDLGYN  234



>ref|XP_010110900.1| Receptor-like protein kinase [Morus notabilis]
 gb|EXC28853.1| Receptor-like protein kinase [Morus notabilis]
Length=1112

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 56/96 (58%), Gaps = 3/96 (3%)
 Frame = +2

Query  281  CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
            C + G+ CD+   VV +++S   ISG+  G    +L  L+VL +  N FHG  P  L +C
Sbjct  61   CSWVGIECDNTHNVVSLNLSSSGISGQI-GPEVGHLKHLQVLDLSINSFHGSIPQDLGNC  119

Query  461  SFLEELNMTATNLTGSLPDL--SPLQALRALDLSYN  562
            + LE L++ + +LTG +P    S LQ LR ++L YN
Sbjct  120  TLLESLSLISNSLTGEIPTTLKSNLQNLRLIELYYN  155



>ref|XP_002313944.2| hypothetical protein POPTR_0009s08540g [Populus trichocarpa]
 gb|EEE87899.2| hypothetical protein POPTR_0009s08540g [Populus trichocarpa]
Length=989

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 4/126 (3%)
 Frame = +2

Query  191  ARLDDQSEFFTAMKKSFTGS---LMGRWDGE-AVCEYRGVVCDDKDYVVKIDVSGWSISG  358
            ++ DDQ +     K +   S   +   W  E +VC + G+VC+   +V +I++    + G
Sbjct  26   SKSDDQFQMLLKFKSAVQHSKTNVFTTWTQENSVCSFTGIVCNKNRFVTEINLPQQQLEG  85

Query  359  EFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
              P D    L  L  + +G N  HGG    L  C+ L+ L++   + TG +PDL  LQ L
Sbjct  86   VLPFDAICGLRSLEKISMGSNSLHGGITEDLKHCTSLQVLDLGNNSFTGKVPDLFTLQKL  145

Query  539  RALDLS  556
            + L L+
Sbjct  146  KILSLN  151



>ref|XP_004516063.1| PREDICTED: receptor-like protein 12-like [Cicer arietinum]
Length=1050

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 8/128 (6%)
 Frame = +2

Query  197  LDDQSEFFTAMKKSFT-----GSLMGRWDGE-AVCEYRGVVCDDKDYVVKIDVSGWSISG  358
            L+DQ      +K + T      +++  W+   A C++ GV CD K +V+ +D+SG SISG
Sbjct  31   LEDQQSLLLQLKNNLTFELESSTILKLWNESIACCDWIGVTCDGKGFVIGLDLSGESISG  90

Query  359  EFPGDVCSY-LPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQ  532
             F      + L  L+ L +  N F+   P        L  LNM+  N  G +P D+S L 
Sbjct  91   GFDNTSSLFSLQHLQKLNLADNNFNSVIPSGFNKLEMLTYLNMSYANFVGQVPSDISQLT  150

Query  533  ALRALDLS  556
             L  LD+S
Sbjct  151  RLITLDIS  158



>ref|XP_006359740.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790-like [Solanum tuberosum]
Length=946

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +2

Query  272  EAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSL  451
            ++ C + GVVCDD  +V KI++SG ++SG+    + ++ P +  + + +N+ +G  P ++
Sbjct  54   QSFCHWNGVVCDDLSHVAKIELSGKNLSGKLSETIFNF-PYVESIDLSNNQLYGEIPSNI  112

Query  452  TSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYNL  565
            ++C  L  LN++  N T  LP  S +  L  LDLS N+
Sbjct  113  STCLALRFLNLSNNNFTSLLPQGSRIPLLETLDLSNNM  150



>gb|KFK43299.1| hypothetical protein AALP_AA1G106000 [Arabis alpina]
Length=974

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 61/122 (50%), Gaps = 4/122 (3%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSLMGRWDGEAV----CEYRGVVCDDKDYVVKIDVSGWSISGEFPG  370
            D  +    +K S + S  G  +   V    C + GV CD +  V +ID+SG  ++G FP 
Sbjct  25   DDLQILLKLKSSLSNSNPGVLNSWKVNSDHCRFTGVTCDSRGSVTEIDLSGQGLTGNFPI  84

Query  371  DVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALD  550
            D    L  L+ L +G N F G  P  L +C+ L+ L++     +G+ PD S L  L+ L 
Sbjct  85   DSVCELKSLQKLSLGFNSFSGSIPIDLKNCTNLKYLDLGNNLFSGTFPDFSDLNQLQYLY  144

Query  551  LS  556
            L+
Sbjct  145  LN  146


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            + KI+++     GE P  +   L  L  L++  N F G  P S+ SCS L +LNM   +L
Sbjct  453  LTKIELNNNRFLGEIPSSI-GKLKGLSSLKMQSNGFSGNIPDSIGSCSMLSDLNMAQNSL  511

Query  500  TGSLPD-LSPLQALRALDLSYN  562
            +G +P  L  L  L AL+LS N
Sbjct  512  SGEIPHMLGSLPTLNALNLSDN  533



>ref|XP_009628481.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana tomentosiformis]
Length=987

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 54/100 (54%), Gaps = 2/100 (2%)
 Frame = +2

Query  266  DGEAVCEYRGVVCDDKD-YVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFP  442
            D E+ C++ G+ CD K   V  I +   SISG     + S L  L  L +  N   G  P
Sbjct  66   DSESPCKFNGITCDQKTGLVTAISLDNKSISGVISPSIFS-LQSLTSLVLPSNSLSGVLP  124

Query  443  GSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
              +T+C+ L+ LN+T  N+ G++PDLS L  L  LDLS N
Sbjct  125  SEITNCTNLKILNVTGNNMNGTIPDLSKLTNLEVLDLSIN  164



>emb|CAN61202.1| hypothetical protein VITISV_009745 [Vitis vinifera]
Length=838

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 65/124 (52%), Gaps = 5/124 (4%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSL--MGRWDGEA-VCEYRGVVCDDKDYVVKIDVSGWSISGEFPGD  373
            ++ E   + K S    L  +  W+     C + G++C +  +V  ID+SG +ISGE    
Sbjct  30   EEIELLLSFKASINDPLGFLSNWNSSVDFCNWYGILCTNSSHVSSIDLSGKNISGEI-SP  88

Query  374  VCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDL  553
            V   LP +  + + +N    G PG+++ C  L  LN++  NLTGS+P  S    L ALDL
Sbjct  89   VLFGLPYIETVNLSNNALSXGIPGNISLCYSLRYLNLSNNNLTGSMPRGSA-SGLEALDL  147

Query  554  SYNL  565
            S N+
Sbjct  148  SNNV  151



>ref|XP_006353616.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=977

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (52%), Gaps = 5/126 (4%)
 Frame = +2

Query  197  LDDQSEFFTAMKKSFTGSL--MGRW-DGEAVCEYRGVVCD-DKDYVVKIDVSGWSISGEF  364
            L  +SE     K+     L  +  W D E+ C++ G+ CD +   V++I +   S+SG  
Sbjct  30   LTSESEALLHFKEQLNDPLNYLDSWKDSESPCKFYGITCDKNTGLVIEISLDNKSLSGVI  89

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
               + S L  L  L +  N   G  P  +T+C+ L+ LN+T  N+ G++PDLS L  L  
Sbjct  90   SPSIFS-LQSLTSLVLPSNALSGKLPSEVTNCTSLKVLNVTGNNMNGTIPDLSKLTNLEV  148

Query  545  LDLSYN  562
            LDLS N
Sbjct  149  LDLSIN  154



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 64/116 (55%), Gaps = 5/116 (4%)
 Frame = +2

Query  224  AMKKSFTGSLMGRWDGEA--VCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKL  397
            A   S +GS  G WD  A     + GV CD    VV +D+S  ++SG  P ++ S L  L
Sbjct  38   AASGSPSGSFAG-WDATADHCRSWAGVACDAAGRVVSLDISNLNLSGPIPPEL-SLLSGL  95

Query  398  RVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
            R L + +N F+G FP +L+S   L  L++   NLTG LP D++ L ALR L L  N
Sbjct  96   RYLNLSNNVFNGTFPSALSSLKNLRVLDIYNNNLTGVLPVDVADLPALRHLHLGGN  151



>gb|KCW83048.1| hypothetical protein EUGRSUZ_B00013, partial [Eucalyptus grandis]
Length=1044

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = +2

Query  254  MGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHG  433
            +  W+G + C +RG+ CD    VV  ++S ++I G       S+LP L  L + +NK  G
Sbjct  20   LSSWNGSSPCSWRGIDCDPLGSVVSFNLSSFAIRGTLHSLNFSHLPNLVTLSLPYNKLFG  79

Query  434  GFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
              P S+   S L  L +T  NL+G++P +L  L++L+ LDL+ N
Sbjct  80   NIPLSIGHLSKLIRLELTGNNLSGNIPIELGSLRSLQYLDLASN  123



>ref|XP_007018364.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7 
[Theobroma cacao]
 gb|EOY15589.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7 
[Theobroma cacao]
Length=987

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = +2

Query  221  TAMKKSFTGSLMGRWDG-EAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKL  397
            +A+ +S T +++  W+    VC + G+ C+ +  V +I++S   ++G  P D    LP L
Sbjct  39   SALNRSSTPNVLDSWEAANHVCSFHGITCNAEGSVKEIELSSQKLTGVLPLDSICQLPSL  98

Query  398  RVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
              L +GHN  +G     +++C  L+ L++     TGS PD+S L  L+ L L+
Sbjct  99   DKLSLGHNLLYGAITKDMSNCVKLQYLDLGNNLFTGSFPDISALSELQYLYLN  151


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +V+ID++   ISG+ P  +   L  L  L++ +N+  G  P SL SC+ +  +NM + +L
Sbjct  458  LVRIDLNNNQISGKLPHGI-GELKSLSSLKLQNNRLSGSIPESLGSCASISNINMASNSL  516

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G +P  L  L  L +++LS N
Sbjct  517  SGKIPSSLGSLPTLNSMNLSRN  538



>gb|KDP35915.1| hypothetical protein JCGZ_09887 [Jatropha curcas]
Length=1036

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 62/122 (51%), Gaps = 4/122 (3%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGS---LMGRWDGE-AVCEYRGVVCDDKDYVVKIDVSGWSISGEFPG  370
            D+ +    +K +F  S   +   W  E  VC + G++C++  +V +I++S   + G  P 
Sbjct  77   DERQILLNLKSAFKNSRTDVFNSWTQENPVCNFTGIICNNNGFVKEINLSRQQLVGVVPF  136

Query  371  DVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALD  550
            D    L  L ++ +G N  HG     L +C  L+ L++   + +G +PDLS L  LR L 
Sbjct  137  DSICSLQSLEIISMGSNFLHGSITEDLKNCRSLQVLHLGGNSFSGEVPDLSTLVELRILS  196

Query  551  LS  556
            L+
Sbjct  197  LN  198



>gb|KEH19869.1| LRR receptor-like kinase [Medicago truncatula]
Length=222

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (49%), Gaps = 27/121 (22%)
 Frame = +2

Query  278  VCEYRGVVCDDK-------------------------DYVVKIDVSGWSISGEFPGDVCS  382
            VC + GV CD++                          + V +D+   S  G+FP +VC 
Sbjct  61   VCNWVGVTCDERHGRVHSLILRNMSLKGIVSPNLGNLSFFVILDIKNNSFGGQFPIEVCR  120

Query  383  YLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPD-LSPLQALRALDLSY  559
             L +L+VL + +NKF GG P +L   S L+ L + A N TG +P+ +  LQ L+ LD S 
Sbjct  121  -LRRLKVLHISYNKFEGGIPAALGDLSQLQYLYLGANNFTGFIPESIGNLQWLKELDTSN  179

Query  560  N  562
            N
Sbjct  180  N  180



>ref|XP_006450029.1| hypothetical protein CICLE_v10013944mg [Citrus clementina]
 gb|ESR63269.1| hypothetical protein CICLE_v10013944mg [Citrus clementina]
Length=839

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query  308  DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMT  487
            +K  +  +D S  ++SGE P ++CS LP L  + +  N FHGG P +L++C +LE L+++
Sbjct  24   NKSSLQDLDFSYNALSGEIPANICSNLPFLESISLSQNMFHGGIPSTLSNCKYLEILSLS  83

Query  488  ATNLTGSLP-DLSPLQALRALDLSY  559
              NL G++P ++  L  L+ L L Y
Sbjct  84   INNLLGAIPKEIGNLTKLKELYLGY  108



>ref|XP_006852741.1| hypothetical protein AMTR_s00033p00104210 [Amborella trichopoda]
 gb|ERN14208.1| hypothetical protein AMTR_s00033p00104210 [Amborella trichopoda]
Length=967

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 66/130 (51%), Gaps = 1/130 (1%)
 Frame = +2

Query  176  SGSYQARLDDQSEFFTAMKKSFTGSLMGRWDGE-AVCEYRGVVCDDKDYVVKIDVSGWSI  352
            +GS+        E   ++ KS   SL+  W  + + C + G+ C+ +  V +I++S   +
Sbjct  20   TGSWAQDAPVMLELKASLLKSSATSLLDSWKNDTSPCNWTGIHCNLQGNVTEINLSSKRL  79

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQ  532
            +GE P +    L  L  L +G N  +G      T+C  L+ L++   + TGS PDLS L 
Sbjct  80   AGELPLESICGLASLEKLFMGKNSLYGNISNGFTNCKKLQYLDLAFNSFTGSFPDLSNLS  139

Query  533  ALRALDLSYN  562
             L+ L+LS N
Sbjct  140  ELKLLNLSDN  149


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +++I+ S   I GE P  +   LPKL  L +  NKF G  P ++ SC+ L ++N+    L
Sbjct  454  LIEINASVNEIEGEIPATI-GELPKLNKLHLQDNKFSGKIPDTIGSCASLSDINLAGNQL  512

Query  500  TGSLP-DLSPLQALRALDLSYN  562
             G +P  L+ +Q L +L+LS N
Sbjct  513  VGQIPASLASIQVLNSLNLSDN  534



>ref|XP_003589790.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES60041.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1167

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 66/128 (52%), Gaps = 13/128 (10%)
 Frame = +2

Query  185  YQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCD-DKDYVVKIDVSGWSISGE  361
            ++A LD+ S            +L+  W+G   C + G+ CD D   + K++++   + G 
Sbjct  43   WKASLDNNSR-----------ALLSSWNGNNPCSWEGITCDNDSKSINKVNLTDIGLKGT  91

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQAL  538
                  S LPK+R L + +N F+G  P  +   S L+ L+++  NL+G++P  +  L  L
Sbjct  92   LQSLNLSSLPKIRTLVLKNNSFYGAVPHHIGVMSNLDTLDLSLNNLSGNIPKSVGNLSKL  151

Query  539  RALDLSYN  562
              LDLS+N
Sbjct  152  SYLDLSFN  159



>ref|XP_010428087.1| PREDICTED: receptor-like protein kinase HSL1 [Camelina sativa]
Length=978

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 66/127 (52%), Gaps = 13/127 (10%)
 Frame = +2

Query  185  YQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDD-KDYVVKIDVSGWSISGE  361
            ++ RLDD      + K S           ++ C +RGV CD     V  I ++  ++SG 
Sbjct  42   FKNRLDDPHNVLQSWKPS-----------DSPCVFRGVTCDPISGEVTGISLANANLSGT  90

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALR  541
                + S L KL  L +  N   G  P  +T+C+ L+ LN+T+  L+G++P+LSPL+ L 
Sbjct  91   ISPSI-SALTKLTTLSLPSNFISGTIPPEITNCTNLKVLNLTSNRLSGTIPNLSPLKTLE  149

Query  542  ALDLSYN  562
             LD+S N
Sbjct  150  TLDISGN  156



>ref|XP_010064752.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=277

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (52%), Gaps = 12/128 (9%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGE  361
            +++++LD  S +            +  W+G + C +RG+ CD    VV  ++S  +I G 
Sbjct  55   TWKSKLDSGSRYN-----------LSSWNGSSPCSWRGIDCDPLGSVVSFNLSSSAIRGT  103

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQAL  538
                  S+LP L  L + +NK  G  P S+   S L  L +T  N +G++P +L  L++L
Sbjct  104  LHSLNFSHLPNLVTLSLPYNKLFGNIPMSIGHLSKLIRLELTGNNRSGNIPIELGSLRSL  163

Query  539  RALDLSYN  562
            + LDL+ N
Sbjct  164  QYLDLACN  171



>ref|XP_006421396.1| hypothetical protein CICLE_v10004247mg [Citrus clementina]
 gb|ESR34636.1| hypothetical protein CICLE_v10004247mg [Citrus clementina]
Length=970

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +++I ++    SGE P ++C+YLP L+ L +  N FHG  P +L+ C  L++LN+   NL
Sbjct  153  ILEILLTNNRFSGELPKNICNYLPYLKALFLNKNMFHGKIPSALSKCKQLQQLNLQFNNL  212

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G++P ++  L  L+ + L YN
Sbjct  213  SGAIPKEIGNLTMLKGIYLEYN  234



>ref|XP_010064748.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1139

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +2

Query  254  MGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHG  433
            +  W+G + C +RG+ CD    VV  ++S  +I G       S+LP L  L + +NK  G
Sbjct  68   LSSWNGSSPCSWRGIDCDPLGSVVSFNLSSSAIRGTLHSLNFSHLPNLVTLSLPYNKLFG  127

Query  434  GFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
              P S+   S L  L +T  NL+G++P +L  L++L+ LDL+ N
Sbjct  128  NIPVSIGHLSKLIRLELTGNNLSGNIPIELGSLRSLQYLDLASN  171



>gb|AFK43911.1| unknown [Medicago truncatula]
Length=231

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (49%), Gaps = 27/121 (22%)
 Frame = +2

Query  278  VCEYRGVVCDDK-------------------------DYVVKIDVSGWSISGEFPGDVCS  382
            VC + GV CD++                          + V +D+   S  G+FP +VC 
Sbjct  61   VCNWVGVTCDERHGRVHSLILRNMSLKGIVSPNLGNLSFFVILDIKNNSFGGQFPIEVCR  120

Query  383  YLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPD-LSPLQALRALDLSY  559
             L +L+VL + +NKF GG P +L   S L+ L + A N TG +P+ +  LQ L+ LD S 
Sbjct  121  -LRRLKVLHISYNKFEGGIPAALGDLSQLQYLYLGANNFTGFIPESIGNLQWLKELDTSN  179

Query  560  N  562
            N
Sbjct  180  N  180



>ref|XP_008439806.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
Length=996

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 67/127 (53%), Gaps = 6/127 (5%)
 Frame = +2

Query  197  LDDQSEFFTAMKKSFT--GSLMGRWDGEAV--CEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            L+ +     A K+S      +   W+      C + GV CDD+  V+ +++   +IS  F
Sbjct  19   LNQEGHILQAFKRSIEDRNHVFTSWNATDPDPCSWNGVTCDDRRQVISLELISSAISSTF  78

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSL-PDLSPLQALR  541
            P  +C  LP L  L + +N FH   P ++++CS LE L++    LTG + P ++ L+ LR
Sbjct  79   PLQLCK-LPHLLYLSLYNNTFHSILPPAISNCSTLEFLDLGQNLLTGPIPPSIADLRNLR  137

Query  542  ALDLSYN  562
             LDLS N
Sbjct  138  YLDLSGN  144


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 2/77 (3%)
 Frame = +2

Query  335  VSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP  514
            ++G  + GE P D  S L  L +L +  N   G FP +LT  + + ++ +   +L+G+LP
Sbjct  214  LTGCKLRGEIP-DTFSGLKNLVLLDLSSNNLTGAFPIALTELTHVTQIELFGNSLSGALP  272

Query  515  D-LSPLQALRALDLSYN  562
            D  S LQALR  D+S N
Sbjct  273  DTFSKLQALRMFDVSMN  289



>dbj|BAO76349.1| leucine-rich repeat family protein [Winogradskyella sp. PG-2]
Length=283

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 4/102 (4%)
 Frame = +2

Query  263  WD-GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGF  439
            WD  + + ++ G+  ++ D VV+I +S  +++G  P D+ S L  LRVL +  NK  G  
Sbjct  45   WDLKQPISDWYGLTIEN-DNVVEISLSFNNLNGNLPNDI-SALTALRVLNLSFNKLEGEL  102

Query  440  PGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
            P +LT  + LEEL + + N +GS+P D+  L  LR+L+L  N
Sbjct  103  PSTLTKITRLEELKLFSNNFSGSIPSDIGNLTNLRSLELYNN  144



>ref|XP_007020154.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7, 
putative [Theobroma cacao]
 gb|EOY17379.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7, 
putative [Theobroma cacao]
Length=473

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 61/113 (54%), Gaps = 1/113 (1%)
 Frame = +2

Query  221  TAMKKSFTGSLMGRWDG-EAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKL  397
            +A+ KS T +++  W+   +VC + G+ C+ +  V KI++S   + G  P D    L  L
Sbjct  39   SALNKSSTPNVLDSWEAANSVCSFNGITCNAEGSVKKIELSSQKLRGVLPLDSICQLQSL  98

Query  398  RVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
              L +G+N  +G     L++C  L+ L++     TGS PD+S L  L+ L L+
Sbjct  99   DKLSLGYNLLYGAITKDLSNCVKLQYLDLGNNLFTGSFPDISALSELQYLHLN  151



>gb|EAY76695.1| hypothetical protein OsI_04648 [Oryza sativa Indica Group]
Length=964

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 3/105 (3%)
 Frame = +2

Query  254  MGRWD-GEAVCEYRGVVCDDKDY-VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKF  427
            +G WD   + C++ GV CD     V+ I +S  S+SG       S L +LR L +G N  
Sbjct  46   LGNWDESHSPCQFYGVTCDQTSGGVIGISLSNTSLSGTIS-SSFSLLSQLRTLELGANSI  104

Query  428  HGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             G  P +L +C+ L+ LN++  +LTG LPDLS    L+ LDLS N
Sbjct  105  SGTIPAALANCTNLQVLNLSTNSLTGQLPDLSTFINLQVLDLSTN  149



>ref|NP_001044979.1| Os01g0878300 [Oryza sativa Japonica Group]
 dbj|BAC06203.1| putative leucine-rich receptor-like protein kinase [Oryza sativa 
Japonica Group]
 dbj|BAC07328.1| putative leucine-rich receptor-like protein kinase [Oryza sativa 
Japonica Group]
 dbj|BAF06893.1| Os01g0878300 [Oryza sativa Japonica Group]
 gb|EAZ14360.1| hypothetical protein OsJ_04280 [Oryza sativa Japonica Group]
 dbj|BAG91377.1| unnamed protein product [Oryza sativa Japonica Group]
Length=964

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 3/105 (3%)
 Frame = +2

Query  254  MGRWD-GEAVCEYRGVVCDDKDY-VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKF  427
            +G WD   + C++ GV CD     V+ I +S  S+SG       S L +LR L +G N  
Sbjct  46   LGNWDESHSPCQFYGVTCDQTSGGVIGISLSNASLSGTIS-SSFSLLSQLRTLELGANSI  104

Query  428  HGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             G  P +L +C+ L+ LN++  +LTG LPDLS    L+ LDLS N
Sbjct  105  SGTIPAALANCTNLQVLNLSTNSLTGQLPDLSTFINLQVLDLSTN  149



>ref|XP_003522732.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine 
max]
Length=983

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 63/123 (51%), Gaps = 4/123 (3%)
 Frame = +2

Query  191  ARLDDQSEFFTAMKKSFTGS---LMGRWDG-EAVCEYRGVVCDDKDYVVKIDVSGWSISG  358
            A+ +DQ +    +K S   S   L+  W+   +VC + GV C+  + V +I++S  ++SG
Sbjct  21   AQSEDQRQILLNLKSSLQNSNSKLLHSWNATNSVCTFHGVTCNSLNSVTEINLSNQTLSG  80

Query  359  EFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
              P D    LP L+ L  G N  +G     + +C  L  L++     +G  PD+SPL+ L
Sbjct  81   VLPFDSLCKLPSLQKLVFGFNNLNGNVSEDIRNCVNLRYLDLGNNLFSGPFPDISPLKQL  140

Query  539  RAL  547
            + L
Sbjct  141  QYL  143



>gb|KGN49260.1| hypothetical protein Csa_6G518150 [Cucumis sativus]
Length=1000

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 68/127 (54%), Gaps = 6/127 (5%)
 Frame = +2

Query  197  LDDQSEFFTAMKKSFT--GSLMGRWDGEAV--CEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            L+ +     A K+S    G+    W+      C + GV CD+   V+ +++   +IS  F
Sbjct  19   LNQEGHILQAFKRSIEDRGNAFSSWNATDPDPCLWNGVTCDEHRQVISLELISSAISSTF  78

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALR  541
            P  +C  LP L  L + +N FH   P ++++C+ LE L++    LTGS+P  ++ L+ LR
Sbjct  79   PLQLCK-LPHLLYLSLYNNTFHSILPPAISNCTTLEFLDLGQNLLTGSIPSSIADLRHLR  137

Query  542  ALDLSYN  562
             LDLS N
Sbjct  138  YLDLSGN  144



>ref|XP_008802938.1| PREDICTED: receptor-like protein kinase HAIKU2 [Phoenix dactylifera]
Length=1680

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query  281  CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
            C++ GV CDD   V+ I ++  S+SG+      S L  L  L +G N   G  P +L +C
Sbjct  70   CQFVGVTCDDSGQVIGISLANLSLSGKI-SPSVSVLHSLSSLDLGANAISGIVPAALANC  128

Query  461  SFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            + L+ LN++  +L G LPDLS LQ LR LDLS N
Sbjct  129  TNLQVLNLSTNSLIGQLPDLSTLQNLRVLDLSTN  162



>ref|XP_009780300.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana sylvestris]
Length=1001

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 3/107 (3%)
 Frame = +2

Query  248  SLMGRW-DGEAVCEYRGVVCD-DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHN  421
            S +  W D E  C++ G+ CD +   V +I +   SISG     + S L  L  L +  N
Sbjct  73   SYLDSWKDSETPCKFNGITCDQNTGLVTEISLDNKSISGVISPSIFS-LKSLTSLVLPSN  131

Query  422  KFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
               G  P  +T+C+ L+ LN+T  ++ G++PDLS L  L  LDLS N
Sbjct  132  SLSGNLPSEITNCTNLKILNVTGNDMNGTIPDLSKLTNLEVLDLSIN  178



>ref|XP_004140933.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Cucumis sativus]
 gb|KGN46082.1| hypothetical protein Csa_6G052080 [Cucumis sativus]
Length=976

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +2

Query  218  FTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKD-YVVKIDVSGWSISGEFPGDVCSYLPK  394
            F    K  TG L    D E+ C + G+ CD     VV+I +   S+SGE    + S L  
Sbjct  38   FKENLKDPTGFLNSWIDSESPCGFSGITCDRASGKVVEISLENKSLSGEISPSI-SVLQW  96

Query  395  LRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            L  L +  N   G  P  L +CS L  LN+T   +   +PDLS L+ L  LDLS N
Sbjct  97   LTTLSLASNHISGELPNQLINCSNLRVLNLTDNEMVKRIPDLSQLRKLEVLDLSIN  152



>ref|XP_008456679.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
 ref|XP_008456680.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
Length=976

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +2

Query  218  FTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKD-YVVKIDVSGWSISGEFPGDVCSYLPK  394
            F    K  TG L    D E+ C + G+ CD     VV+I +   S+SGE    + S L  
Sbjct  38   FKENLKDPTGFLNSWIDSESPCGFSGITCDRASGKVVEISLENKSLSGEISPSI-SVLQW  96

Query  395  LRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            L  L +  N   G  P  L +CS L  LN+T   +   +PDLS L+ L  LDLS N
Sbjct  97   LTTLSLASNHISGELPNQLINCSNLRVLNLTDNEMVKRIPDLSQLKKLEVLDLSIN  152



>ref|XP_004159444.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Cucumis sativus]
Length=976

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 56/116 (48%), Gaps = 2/116 (2%)
 Frame = +2

Query  218  FTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKD-YVVKIDVSGWSISGEFPGDVCSYLPK  394
            F    K  TG L    D E+ C + G+ CD     VV+I +   S+SGE    + S L  
Sbjct  38   FKENLKDPTGFLNSWIDSESPCGFSGITCDRASGKVVEISLENKSLSGEISPSI-SVLQW  96

Query  395  LRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            L  L +  N   G  P  L +CS L  LN+T   +   +PDLS L+ L  LDLS N
Sbjct  97   LTTLSLASNHISGELPNQLINCSNLRVLNLTDNEMVKRIPDLSQLRKLEVLDLSIN  152



>ref|XP_006489992.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
isoform X1 [Citrus sinensis]
Length=179

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +  I ++   +SGE P ++ SYLP L+ L +  N FHG  P +L+ C  L++LN+   NL
Sbjct  28   ISDIRLTNNRLSGELPKNIGSYLPYLKALFLDKNMFHGKIPSALSKCKQLQQLNLQFNNL  87

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G++P ++  L  L+ + L YN
Sbjct  88   SGAIPKEIGNLTMLKGIYLEYN  109



>gb|KDO37282.1| hypothetical protein CISIN_1g036127mg [Citrus sinensis]
Length=155

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +2

Query  329  IDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGS  508
            I ++   +SGE P ++ SYLP L+ L +  N FHG  P +L+ C  L++LN+   NL+G+
Sbjct  7    IRLTNNRLSGELPKNIGSYLPYLKALFLDKNMFHGKIPSALSKCKQLQQLNLQFNNLSGA  66

Query  509  LP-DLSPLQALRALDLSYN  562
            +P ++  L  L+ + L YN
Sbjct  67   IPKEIGNLTMLKGIYLEYN  85



>ref|XP_010322765.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=977

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 5/126 (4%)
 Frame = +2

Query  197  LDDQSEFFTAMKKSFTGSL--MGRW-DGEAVCEYRGVVCD-DKDYVVKIDVSGWSISGEF  364
            L  ++E     K+     L  +  W D E+ C++ G+ CD +   V++I +   S+SG  
Sbjct  30   LTSETEALLHFKEQLNDPLNYLDSWKDSESPCKFYGITCDKNTGLVIEISLDNKSLSGVI  89

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRA  544
               + S L  L  L +  N   G  P  +T+C+ L  LN+T  N+ G++PDLS L  L  
Sbjct  90   SPSIFS-LKSLTSLVLPSNALSGKLPSEVTNCTSLRVLNVTVNNMNGTIPDLSKLTNLEV  148

Query  545  LDLSYN  562
            LDLS N
Sbjct  149  LDLSIN  154



>gb|EMS54777.1| Receptor-like protein kinase HSL1 [Triticum urartu]
Length=752

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 3/105 (3%)
 Frame = +2

Query  254  MGRWD-GEAVCEYRGVVCDD-KDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKF  427
            M  WD   + C++ GV C +    V  + +S  S+SG       S L +L  L +  N  
Sbjct  56   MSNWDESHSPCQFHGVTCHEISGEVTGVSLSNASLSGTISPSF-SVLHQLHTLDLSANSI  114

Query  428  HGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             G  P +LT+C+ L+ LN++  +LTG LPDLS L  L+ LDLS N
Sbjct  115  SGIIPAALTNCTNLQVLNLSMNSLTGQLPDLSSLLKLQVLDLSTN  159



>ref|XP_010471238.1| PREDICTED: receptor-like protein kinase HSL1 [Camelina sativa]
Length=977

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 66/127 (52%), Gaps = 13/127 (10%)
 Frame = +2

Query  185  YQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDD-KDYVVKIDVSGWSISGE  361
            ++ RLDD      + K S           ++ C +RGV CD     V  I ++  ++SG 
Sbjct  40   FKNRLDDPHNVLQSWKPS-----------DSPCAFRGVTCDPISGEVTGISLANANLSGI  88

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALR  541
                + S L KL  L +  N   G  P  +T+C+ L+ LN+T+  L+G++P+LSPL+ L 
Sbjct  89   ISPSI-SALTKLTTLSLPFNFISGTIPPEITNCTNLKVLNLTSNRLSGTIPNLSPLKTLE  147

Query  542  ALDLSYN  562
             LD+S N
Sbjct  148  ILDISGN  154



>gb|KJB60054.1| hypothetical protein B456_009G287800 [Gossypium raimondii]
 gb|KJB60055.1| hypothetical protein B456_009G287800 [Gossypium raimondii]
Length=977

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 66/132 (50%), Gaps = 7/132 (5%)
 Frame = +2

Query  170  SVSGSYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDD-KDYVVKIDVSGW  346
            S+S   QA LD     F  M K     L    + E+ CE+ GV CD     V +I ++  
Sbjct  29   SLSIETQALLD-----FKNMLKDPLNVLDSWKESESPCEFFGVSCDPVSGNVTEISLANK  83

Query  347  SISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSP  526
            S+SGE    + S L  L+ + +  N   G  P  L  CS L  LN++   + G++PDLS 
Sbjct  84   SLSGEISPSI-STLGNLKTIYLPQNLISGKLPPQLNHCSNLRVLNLSWNGMIGTIPDLSG  142

Query  527  LQALRALDLSYN  562
            LQ L+ LDLS N
Sbjct  143  LQNLKVLDLSVN  154



>ref|XP_006489958.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Citrus sinensis]
Length=1003

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            ++ I ++   +SGE P ++C+YLP L+ L +  N  HG  P +L++C  L++L++   NL
Sbjct  153  ILDIRLTNNRLSGELPKNICNYLPYLKALFLDKNMLHGKIPSALSNCKQLQQLHLQFNNL  212

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G++P ++  L  L+ +DL YN
Sbjct  213  SGAIPKEIGNLTMLKWIDLGYN  234



>ref|NP_001235554.1| receptor protein kinase-like protein [Glycine max]
 gb|ACM89602.1| receptor protein kinase-like protein [Glycine max]
Length=983

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 62/127 (49%), Gaps = 11/127 (9%)
 Frame = +2

Query  185  YQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            ++  LD+QS+           SL     G + C ++G+VCD+   V  I+V+   + G  
Sbjct  11   WRESLDNQSQ----------ASLSSWTSGVSPCRWKGIVCDESISVTAINVTNLGLQGTL  60

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALR  541
                 S  PKL  L + HN F G  P  + + S + +L M+A N +G +P  +  L +L 
Sbjct  61   HTLNFSSFPKLLTLDISHNSFSGTIPQQIANLSSVSQLIMSANNFSGPIPISMMKLASLS  120

Query  542  ALDLSYN  562
             L+L YN
Sbjct  121  ILNLEYN  127



>gb|KHG27129.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=977

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 64/119 (54%), Gaps = 5/119 (4%)
 Frame = +2

Query  212  EFFTAMKKSFTGSLMGRW-DGEAVCEYRGVVCDD-KDYVVKIDVSGWSISGEFPGDVCSY  385
            EF   +K     +++  W + E+ CE+ GV CD     V++I ++  S+SGE    + S 
Sbjct  39   EFKNMLKDPL--NVLDSWKESESPCEFFGVSCDPVSGNVIEISLANKSLSGEISPSI-ST  95

Query  386  LPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
            L  L+ + +  N   G  P  L  CS L  LN++   + G++PDLS LQ L+ LDLS N
Sbjct  96   LGNLKTIYLPQNLISGKLPPQLNHCSNLRVLNLSWNGMIGTIPDLSGLQNLKVLDLSVN  154



>ref|XP_004292067.1| PREDICTED: receptor-like protein kinase HAIKU2 [Fragaria vesca 
subsp. vesca]
Length=979

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (52%), Gaps = 1/106 (1%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGSLMGRWDGEA-VCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVC  379
            DQ     A  ++   +L   W+ E   C + G+VC+  + V +I++S  ++SG  P D  
Sbjct  32   DQLLKIKASLETSNPTLFSSWNQETPTCNFTGIVCNSNELVSEINLSQQNLSGSLPFDAL  91

Query  380  SYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPD  517
              LP+L+ L  G N  HG     L  C+ L+EL++   + TG +P+
Sbjct  92   CSLPELKKLSFGSNFLHGSLTKDLKKCTNLQELDLGKNSFTGEVPE  137



>ref|XP_011002775.1| PREDICTED: receptor-like protein kinase HAIKU2 [Populus euphratica]
Length=988

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 4/126 (3%)
 Frame = +2

Query  191  ARLDDQSEFFTAMKKSFTGS---LMGRWDGE-AVCEYRGVVCDDKDYVVKIDVSGWSISG  358
             + DDQ +     K +   S   +   W  E +VC + G+VC++  +V +I++    + G
Sbjct  26   TKSDDQFQILLKFKSAVQHSKTNVFTTWTRENSVCNFTGIVCNENGFVTEINLPQQQLEG  85

Query  359  EFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
              P D    L  L  + +G N  HGG    L  C+ L+ L++   +  G +PDL  LQ L
Sbjct  86   VLPFDAICGLRSLEKISMGSNFLHGGITEDLKHCTSLQVLDLGNNSFAGKVPDLFTLQQL  145

Query  539  RALDLS  556
            + L L+
Sbjct  146  KILSLN  151



>gb|KHM99087.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=983

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 62/127 (49%), Gaps = 11/127 (9%)
 Frame = +2

Query  185  YQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            ++  LD+QS+           SL     G + C ++G+VCD+   V  I+V+   + G  
Sbjct  11   WRESLDNQSQ----------ASLSSWTSGVSPCRWKGIVCDESISVTAINVTNLGLQGTL  60

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALR  541
                 S  PKL  L + HN F G  P  + + S + +L M+A N +G +P  +  L +L 
Sbjct  61   HTLNFSSFPKLLTLDISHNSFSGTIPQQIANLSSVSQLIMSANNFSGPIPISMMKLASLS  120

Query  542  ALDLSYN  562
             L+L YN
Sbjct  121  ILNLEYN  127



>ref|XP_008382378.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=973

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 0/94 (0%)
 Frame = +2

Query  275  AVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLT  454
             VC + G+VC     V +I++S  ++SG  P      LP L+ L +G N  +G     L 
Sbjct  60   GVCNFTGIVCSSDGLVSQINLSQQNLSGFLPLHAICSLPSLKKLSLGSNGLYGSLTDDLK  119

Query  455  SCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
            +C+ LE+L++   + TG +PDLS L  L  L L+
Sbjct  120  NCTSLEQLDLGKNSFTGKVPDLSALTKLTLLSLN  153



>ref|XP_010064692.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=472

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 65/128 (51%), Gaps = 12/128 (9%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGE  361
            ++++ LD QS +            +  W+G   C +RG+ CD    VV ++VS  +I G 
Sbjct  46   TWKSELDSQSHYT-----------LSSWNGSNPCSWRGIDCDPPGSVVSLNVSDSAIHGT  94

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQAL  538
                  S LPKL  L++ +N   G  P S+   + L  L+++  + +G++P  L  L++L
Sbjct  95   LRHLNFSLLPKLVTLKLANNSLFGNIPPSMALLAKLTHLDLSRNHFSGNIPAQLGSLRSL  154

Query  539  RALDLSYN  562
            + L LS N
Sbjct  155  QVLKLSNN  162



>ref|XP_008372891.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=973

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +2

Query  275  AVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLT  454
             VC + G+VCD   +V +I++S  ++SG  P      LP L+ L +G N  HG     L 
Sbjct  60   GVCNFTGIVCDSDGFVSEINLSQQNLSGFLPLHAICSLPSLKKLSLGSNGLHGSLTDDLK  119

Query  455  SCSFLEELNMTATNLTGSLPD  517
            +CS LE+L++   + TG +PD
Sbjct  120  NCSSLEQLDLGKNSFTGRVPD  140



>gb|KDO51477.1| hypothetical protein CISIN_1g045571mg, partial [Citrus sinensis]
Length=260

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +2

Query  308  DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMT  487
            +K  +  +D S  ++SGE P ++CS LP L  + +  N FHGG P +L+ C++L+ L+++
Sbjct  71   NKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLS  130

Query  488  ATNLTGSLP-DLSPLQALRALDLSYN  562
              + +G++P D+  L  L  L L  N
Sbjct  131  FNDFSGAIPKDIGNLTKLMELYLGRN  156



>ref|XP_006591868.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Glycine max]
Length=970

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 4/112 (4%)
 Frame = +2

Query  233  KSFTGSLMGRWDGEAVCEYRGVVCDD-KDYVVKIDVSGWSISGE-FPGDVCSYLPKLRVL  406
            K  + SL    + ++ C++ G+ CD     V +I +   S+SG+ FP    S L  L+VL
Sbjct  46   KDSSNSLASWNESDSPCKFYGITCDPVSGRVTEISLDNKSLSGDIFPS--LSILQSLQVL  103

Query  407  RVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             +  N   G  P  ++ C+ L  LN+T   L G++PDLS L++L+ LDLS N
Sbjct  104  SLPSNLISGKLPSEISRCTSLRVLNLTGNQLVGAIPDLSGLRSLQVLDLSAN  155


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 15/116 (13%)
 Frame = +2

Query  218  FTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKL  397
            F+  + SFTG++ G +   +  E              ID+S    SG+FP  +C    KL
Sbjct  319  FSIYRNSFTGTIPGNFGRFSPLE-------------SIDISENQFSGDFPKFLCEN-RKL  364

Query  398  RVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPD-LSPLQALRALDLSYN  562
            R L    N F G FP S  +C  L+   ++   L+G +PD +  +  +  +DL+YN
Sbjct  365  RFLLALQNNFSGTFPESYVTCKSLKRFRISMNRLSGKIPDEVWAIPYVEIIDLAYN  420



>ref|NP_001241340.1| receptor-like protein kinase HSL1-like [Glycine max]
 gb|ACM89538.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN32461.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=955

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 4/112 (4%)
 Frame = +2

Query  233  KSFTGSLMGRWDGEAVCEYRGVVCDD-KDYVVKIDVSGWSISGE-FPGDVCSYLPKLRVL  406
            K  + SL    + ++ C++ G+ CD     V +I +   S+SG+ FP    S L  L+VL
Sbjct  31   KDSSNSLASWNESDSPCKFYGITCDPVSGRVTEISLDNKSLSGDIFPS--LSILQSLQVL  88

Query  407  RVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             +  N   G  P  ++ C+ L  LN+T   L G++PDLS L++L+ LDLS N
Sbjct  89   SLPSNLISGKLPSEISRCTSLRVLNLTGNQLVGAIPDLSGLRSLQVLDLSAN  140


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 15/116 (13%)
 Frame = +2

Query  218  FTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKL  397
            F+  + SFTG++ G +   +  E              ID+S    SG+FP  +C    KL
Sbjct  304  FSIYRNSFTGTIPGNFGRFSPLE-------------SIDISENQFSGDFPKFLCEN-RKL  349

Query  398  RVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPD-LSPLQALRALDLSYN  562
            R L    N F G FP S  +C  L+   ++   L+G +PD +  +  +  +DL+YN
Sbjct  350  RFLLALQNNFSGTFPESYVTCKSLKRFRISMNRLSGKIPDEVWAIPYVEIIDLAYN  405



>ref|XP_009596212.1| PREDICTED: receptor-like protein kinase isoform X2 [Nicotiana 
tomentosiformis]
Length=1100

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 56/95 (59%), Gaps = 2/95 (2%)
 Frame = +2

Query  281  CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
            C + GV CD K ++  +++SG+ ISG+  G    +L +LR + +G N F G  P  L +C
Sbjct  56   CSWVGVECDRKQFITSLNLSGYGISGQL-GPEIGHLQRLRTIDLGVNAFFGSIPSQLGNC  114

Query  461  SFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
            + L+ L+++    TG +P +L  LQ+L  ++L  N
Sbjct  115  TLLDYLDLSYNAFTGQIPQNLGNLQSLTYINLFSN  149



>gb|KCW84032.1| hypothetical protein EUGRSUZ_B00906 [Eucalyptus grandis]
Length=935

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 67/133 (50%), Gaps = 3/133 (2%)
 Frame = +2

Query  173  VSGSYQARLDDQSEFFTAMKKSFTGS--LMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGW  346
             S + Q R ++     T   K  +GS   +  W+G   C +RG+ CD    V  +++S  
Sbjct  16   ASATNQTRYEEVEALLTWKSKLDSGSRFTLSSWNGTNPCSWRGINCDSLGSVASLNLSNS  75

Query  347  SISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLS  523
            +I G       S LP L    + +N F G  P S+ + + L  L+++  NL+G++P  L 
Sbjct  76   TIHGTLHYLNFSRLPNLIAFTLANNSFFGKIPLSMANLAKLTYLDLSRNNLSGNIPTQLG  135

Query  524  PLQALRALDLSYN  562
             L++LR L+LS N
Sbjct  136  SLRSLRDLNLSNN  148



>gb|KCW68815.1| hypothetical protein EUGRSUZ_F024152, partial [Eucalyptus grandis]
Length=492

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (52%), Gaps = 12/128 (9%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGE  361
            +++++LD  S +            +  W+G + C +RG+ CD    VV  ++S  +I G 
Sbjct  55   TWKSKLDSGSRYN-----------LSSWNGSSPCSWRGIDCDPLGSVVSFNLSSSAIRGT  103

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQAL  538
                  S+LP L  L + +NK  G  P S+   S L  L +T  N +G++P +L  L++L
Sbjct  104  LHSLNFSHLPNLVTLSLPYNKLFGNIPMSIGHLSKLIRLELTGNNRSGNIPIELGSLRSL  163

Query  539  RALDLSYN  562
            + LDL+ N
Sbjct  164  QYLDLACN  171



>ref|XP_006427073.1| hypothetical protein CICLE_v10027424mg, partial [Citrus clementina]
 gb|ESR40313.1| hypothetical protein CICLE_v10027424mg, partial [Citrus clementina]
Length=250

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +2

Query  308  DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMT  487
            +K  +  +D S  ++SGE P ++CS LP L  + +  N FHGG P +L++C++L++L+++
Sbjct  143  NKSSLQHLDFSFNTLSGEIPANICSNLPFLEYISLSQNMFHGGIPSTLSNCTYLQKLSLS  202

Query  488  ATNLTGSLP-DLSPLQALRALDLSYN  562
              +  G++P ++  L  L+ L L  N
Sbjct  203  LNDFWGAIPKEIGNLTKLKELYLGRN  228



>ref|XP_004955463.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230-like [Setaria italica]
Length=1105

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 51/95 (54%), Gaps = 2/95 (2%)
 Frame = +2

Query  281  CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
            CE+ G+ C     V  + + G ++ GE    VC+ LP+L VL V  N   G  P  L +C
Sbjct  60   CEWAGIACSAGGEVTGVTLHGLNLHGELSAAVCA-LPRLAVLNVSKNALGGAIPPGLAAC  118

Query  461  SFLEELNMTATNLTGSL-PDLSPLQALRALDLSYN  562
            + LE L+++   L G + P+L  L+ LR L LS N
Sbjct  119  AALEVLDLSTNALRGGVPPELCALRGLRRLFLSEN  153


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = +2

Query  329  IDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGS  508
            +D+S   ++G  P  +C Y  KL  L +G N+F G  P  L +C  L +L +    LTGS
Sbjct  412  LDLSDNQLTGSIPPHLCKY-QKLMFLSLGSNRFIGNIPPGLKACRTLTQLRLGGNMLTGS  470

Query  509  LP-DLSPLQALRALDLSYN  562
            LP +LS LQ L +L+++ N
Sbjct  471  LPVELSLLQNLTSLEMNQN  489



>ref|XP_009596210.1| PREDICTED: receptor-like protein kinase isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009596211.1| PREDICTED: receptor-like protein kinase isoform X1 [Nicotiana 
tomentosiformis]
Length=1105

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 56/95 (59%), Gaps = 2/95 (2%)
 Frame = +2

Query  281  CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
            C + GV CD K ++  +++SG+ ISG+  G    +L +LR + +G N F G  P  L +C
Sbjct  56   CSWVGVECDRKQFITSLNLSGYGISGQL-GPEIGHLQRLRTIDLGVNAFFGSIPSQLGNC  114

Query  461  SFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
            + L+ L+++    TG +P +L  LQ+L  ++L  N
Sbjct  115  TLLDYLDLSYNAFTGQIPQNLGNLQSLTYINLFSN  149



>ref|XP_004952135.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2-like 
[Setaria italica]
Length=1032

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (45%), Gaps = 26/147 (18%)
 Frame = +2

Query  191  ARLDDQSEFFTAMKKSFTGSL--MGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            A   D+     A+K  F  SL  +  W G + C +  V C+    V ++++SG ++SG+ 
Sbjct  24   AAAGDERAALLALKAGFVDSLGALADWKGSSHCSWTAVGCNAAGLVDRLNLSGKNLSGKV  83

Query  365  PGDVC-----------------------SYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEE  475
              DV                        + L KL+V  V  N F G FP  L+SC+ L  
Sbjct  84   TDDVLRLPSLTVLNLSSNAFAVALPKSFAALSKLQVFDVSQNSFEGAFPAGLSSCADLAI  143

Query  476  LNMTATNLTGSLP-DLSPLQALRALDL  553
            +N +  N  G+LP DL+   +L  +DL
Sbjct  144  VNASGNNFVGALPADLANATSLETIDL  170



>gb|ADB85326.1| putative receptor protein kinase [Phyllostachys edulis]
Length=265

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 56/109 (51%), Gaps = 3/109 (3%)
 Frame = +2

Query  242  TGSLMGRWDGEAV-CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGH  418
            TG+L    +G A  C + GV C  +  VV +DV+G ++SG  P    S L  L  L V  
Sbjct  39   TGALASWANGTASHCAWAGVTCSTRGTVVGLDVAGLNLSGALP-PALSRLRGLFRLSVAA  97

Query  419  NKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
            N F G  P SL    FL  LN++     GS P  L+ L++LR LDL  N
Sbjct  98   NAFSGPIPASLARLQFLVHLNLSNNAFDGSFPAPLARLRSLRVLDLYNN  146



>ref|XP_002461464.1| hypothetical protein SORBIDRAFT_02g003080 [Sorghum bicolor]
 gb|EER97985.1| hypothetical protein SORBIDRAFT_02g003080 [Sorghum bicolor]
Length=1231

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 53/104 (51%), Gaps = 4/104 (4%)
 Frame = +2

Query  263  WDGEAV--CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGG  436
            W G     C + G+ C     V  + + G ++ G     VC+ LP+L VL V  N   G 
Sbjct  179  WGGAGAGPCGWAGIACSTAGEVTGVTLHGLNLQGGLSAAVCA-LPRLAVLNVSKNALKGP  237

Query  437  FPGSLTSCSFLEELNMTATNLTGSL-PDLSPLQALRALDLSYNL  565
             P  L +C+ LE L+++   L G++ PDL  L ALR L LS NL
Sbjct  238  IPQGLAACAALEVLDLSTNALHGAVPPDLCALPALRRLFLSENL  281


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +2

Query  326  KIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTG  505
            ++++   +++G  P  V S L +LRV+R G N+  G  P  LT C+ LE L +   +L G
Sbjct  298  ELEIYSNNLTGRIPASV-SALQRLRVIRAGLNQLSGPIPVELTECASLEVLGLAQNHLAG  356

Query  506  SLP-DLSPLQALRALDLSYN  562
             LP +LS L+ L  L L  N
Sbjct  357  ELPRELSRLKNLTTLILWQN  376


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 2/79 (3%)
 Frame = +2

Query  329  IDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGS  508
            +D+S   ++G  P  +C Y  KL  L +G N   G  P  + +C  L +L +    LTGS
Sbjct  539  LDLSDNQLTGSIPPHLCKY-QKLMFLSLGSNHLIGNIPQGVKTCKTLTQLRLGGNMLTGS  597

Query  509  LP-DLSPLQALRALDLSYN  562
            LP +LS LQ L +L+++ N
Sbjct  598  LPVELSLLQNLTSLEMNQN  616



>gb|KCW83107.1| hypothetical protein EUGRSUZ_B00060 [Eucalyptus grandis]
Length=1022

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (51%), Gaps = 12/128 (9%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGE  361
            ++++ LD+QS +            +  W G   C +RG+ CD    VV +++S  +I G 
Sbjct  37   TWKSELDNQSRYT-----------LSSWSGSNPCTWRGINCDHPGSVVNLNLSDSAIHGT  85

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQAL  538
                  S LP L VL++ +N   G  P S+   + L  L+++  NL+G++P  L  L+ L
Sbjct  86   LHHLNFSLLPNLVVLKLANNSLFGNIPPSMALLAKLTHLDLSQNNLSGNIPTQLGSLRFL  145

Query  539  RALDLSYN  562
            + L LS N
Sbjct  146  QVLKLSDN  153



>ref|XP_009346454.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=973

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 0/94 (0%)
 Frame = +2

Query  275  AVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLT  454
             VC + G+VC     V +I++S  ++SG  P      LP L+ L +G N  +G     L 
Sbjct  60   GVCNFTGIVCGSDGLVSQINLSRQNLSGFLPLHAICSLPSLKKLSLGSNGLYGSLTDDLK  119

Query  455  SCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
            +C+ LE+L++   + TG +PDLS L  L  L L+
Sbjct  120  NCTSLEQLDLGKNSFTGKVPDLSALTKLTLLSLN  153



>ref|XP_006345275.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Solanum tuberosum]
Length=322

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = +2

Query  329  IDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGS  508
            +D+S  S SGE P DV S L +LR L + +N F G FP S+ S + LE L+M++ +L+G 
Sbjct  228  LDLSSNSFSGEIP-DVFSNLKELRTLHLSNNSFIGSFPSSILSLTHLEYLDMSSNSLSGP  286

Query  509  LP-DLSPLQALRALDLSYN  562
            LP + S LQ L ++DL+YN
Sbjct  287  LPSNPSMLQKLTSVDLTYN  305



>ref|NP_177363.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAG51800.1|AC067754_16 leucine-rich receptor-like protein kinase, putative; 28019-31149 
[Arabidopsis thaliana]
 gb|ACN59272.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE35286.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=977

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 13/127 (10%)
 Frame = +2

Query  185  YQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDD-KDYVVKIDVSGWSISGE  361
            ++ RLDD      + K S           ++ C +RG+ CD     V+ I +   ++SG 
Sbjct  41   FKNRLDDSHNILQSWKPS-----------DSPCVFRGITCDPLSGEVIGISLGNVNLSGT  89

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALR  541
                + S L KL  L +  N   G  P  + +C  L+ LN+T+  L+G++P+LSPL++L 
Sbjct  90   ISPSI-SALTKLSTLSLPSNFISGRIPPEIVNCKNLKVLNLTSNRLSGTIPNLSPLKSLE  148

Query  542  ALDLSYN  562
             LD+S N
Sbjct  149  ILDISGN  155



>ref|XP_006386429.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP64226.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=986

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 2/113 (2%)
 Frame = +2

Query  221  TAMKKSFTGSLMGRWD-GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKL  397
            T++KKS T  +   WD  + +CE+ G+ C+    V +I++SG ++ G  P D    L  L
Sbjct  39   TSLKKSNT-HVFDSWDSNKPICEFTGITCNSDKSVKEIELSGQNLEGVLPLDSICQLQSL  97

Query  398  RVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
              L  G+N  HG     L +C+ L+ L++     TG  PD+S L  L+ L L+
Sbjct  98   DKLSFGYNFLHGTITNYLNNCTKLQYLDLGNNLFTGPFPDISSLSQLQHLYLN  150



>ref|XP_009385796.1| PREDICTED: probable inactive receptor kinase At1g27190 [Musa 
acuminata subsp. malaccensis]
Length=611

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +2

Query  329  IDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGS  508
            +D+S  +ISG  P ++CS+LP L  L + +N+F GG P +L++C FL  L +    L G+
Sbjct  103  LDLSSNTISGPIPNELCSWLPYLVTLDLSNNQFTGGIPPTLSNCRFLNTLVLAGNQLQGA  162

Query  509  LP-DLSPLQALRALDLSYN  562
            +P  LS L  L  LDLS N
Sbjct  163  IPATLSQLNRLTHLDLSSN  181



>ref|XP_010414844.1| PREDICTED: receptor-like protein kinase HSL1 isoform X3 [Camelina 
sativa]
 ref|XP_010414845.1| PREDICTED: receptor-like protein kinase HSL1 isoform X3 [Camelina 
sativa]
Length=976

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 66/127 (52%), Gaps = 13/127 (10%)
 Frame = +2

Query  185  YQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDD-KDYVVKIDVSGWSISGE  361
            ++ RL+D      + K S           ++ C +RGV CD     V  I ++  ++SG 
Sbjct  40   FKNRLEDPHNVLQSWKPS-----------DSPCVFRGVTCDPISGEVTGISLANANLSGT  88

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALR  541
                + S L KL  L +  N   G  P  +T+C+ L+ LN+T+  L+G++P+LSPL+ L 
Sbjct  89   ISPSI-SALTKLTTLSLPSNFISGTIPPEITNCTNLKVLNLTSNRLSGTIPNLSPLKTLE  147

Query  542  ALDLSYN  562
             LD+S N
Sbjct  148  ILDISGN  154



>ref|XP_010414842.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Camelina 
sativa]
 ref|XP_010414843.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Camelina 
sativa]
Length=976

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 66/127 (52%), Gaps = 13/127 (10%)
 Frame = +2

Query  185  YQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDD-KDYVVKIDVSGWSISGE  361
            ++ RL+D      + K S           ++ C +RGV CD     V  I ++  ++SG 
Sbjct  40   FKNRLEDPHNVLQSWKPS-----------DSPCVFRGVTCDPISGEVTGISLANANLSGT  88

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALR  541
                + S L KL  L +  N   G  P  +T+C+ L+ LN+T+  L+G++P+LSPL+ L 
Sbjct  89   ISPSI-SALTKLTTLSLPSNFISGTIPPEITNCTNLKVLNLTSNRLSGTIPNLSPLKTLE  147

Query  542  ALDLSYN  562
             LD+S N
Sbjct  148  ILDISGN  154



>ref|XP_003636112.1| LRR receptor-like serine/threonine-protein kinase EFR [Medicago 
truncatula]
 gb|KEH19865.1| LRR receptor-like kinase [Medicago truncatula]
Length=233

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 63/131 (48%), Gaps = 28/131 (21%)
 Frame = +2

Query  251  LMGRWD-GEAVCEYRGVVCDDK-------------------------DYVVKIDVSGWSI  352
            L   W    +VC + GV CD++                          ++V +D+   S 
Sbjct  52   LANNWSTSSSVCNWVGVTCDERHNRVHSLILQNMSLRGTVSPNLGNLSFLVILDLKNNSF  111

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPD-LSPL  529
             G+FP +VC  L +L+VL + +N+F GG P +L   S L+ L + A N TG +P+ +  L
Sbjct  112  GGQFPTEVCR-LRRLKVLHISYNEFEGGIPAALWDLSQLQYLYLGANNFTGFIPESIGNL  170

Query  530  QALRALDLSYN  562
            + L+ LD S N
Sbjct  171  RWLKELDTSNN  181



>dbj|BAF00973.1| putative leucine-rich receptor-like protein kinase [Arabidopsis 
thaliana]
Length=977

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 81/178 (46%), Gaps = 43/178 (24%)
 Frame = +2

Query  32   FLLFLSLQQLNHHNFFPPFSSSRDQKKTNKKMALHRIAIllllllYSVSGSYQARLDDQS  211
            FLLF+          FPP     + + T +K AL R               ++ RLDD  
Sbjct  20   FLLFI----------FPP-----NVESTVEKQALFR---------------FKNRLDDSH  49

Query  212  EFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDD-KDYVVKIDVSGWSISGEFPGDVCSYL  388
                + K S           ++ C +RG+ CD     V+ I +   ++SG     + S L
Sbjct  50   NILQSWKPS-----------DSPCVFRGITCDPLSGEVIGISLGNVNLSGTISPSI-SAL  97

Query  389  PKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             KL  L +  N   G  P  + +C  L+ LN+T+  L+G++P+LSPL++L  LD+S N
Sbjct  98   TKLSTLSLPSNFISGRIPPEIVNCKNLKVLNLTSNRLSGTIPNLSPLKSLEILDISGN  155



>gb|KEH38645.1| verticillium wilt disease resistance protein [Medicago truncatula]
Length=931

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 68/128 (53%), Gaps = 10/128 (8%)
 Frame = +2

Query  197  LDDQSEFFTAMKKSFT-----GSLMGRWD-GEAVCEYRGVVCDDKDYVVKIDVSGWSISG  358
            + DQ      +K + T        +  W+  +  CE+ GV C++K +V+ +D+S   I+G
Sbjct  29   IGDQQSLLLQLKNNLTFNSTISKKLVHWNISKPCCEWNGVTCNNKGHVIALDLSHEFING  88

Query  359  EFPGDVCSYLPKLRVLRVGHN-KFHGGFPGSLTSCSFLEELNMTATNLTGSLPD-LSPLQ  532
            +FP ++   +P L+VL V +N   HG  P      S L  LN++ TN +G +PD +  L+
Sbjct  89   KFPIEIFQ-IPSLQVLDVSYNLGLHGSLPNFPHQGS-LHNLNLSHTNFSGPIPDSIHNLR  146

Query  533  ALRALDLS  556
             L  LDLS
Sbjct  147  QLSTLDLS  154



>ref|XP_010268649.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nelumbo nucifera]
Length=1004

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 66/127 (52%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  SGSYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSIS  355
            S      +D+  +  TA++KS T            C++ GV+C     V  ID+S   + 
Sbjct  29   SSCIAGEIDNLLKLKTALQKSDTHVFDSWTPNGNPCKFDGVICGLDGSVTGIDLSNNRLV  88

Query  356  GEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQA  535
            G  P D    LP L++L +G+N  +G    +L +C+ L++L++   + +G++PDLS L  
Sbjct  89   GVLPLDSICQLPSLQMLSLGNNLLYGSITENLKNCTRLKQLDIGFNSFSGTVPDLSSLSE  148

Query  536  LRALDLS  556
            L+ L L+
Sbjct  149  LQVLSLN  155



>gb|KCW83054.1| hypothetical protein EUGRSUZ_B000191, partial [Eucalyptus grandis]
Length=1093

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (52%), Gaps = 12/128 (9%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGE  361
            +++++LD  S +            +  W+G + C +RG+ CD    VV  ++S  +I G 
Sbjct  7    TWKSKLDSGSRYN-----------LSSWNGSSPCSWRGIDCDPLGSVVSFNLSSSAIRGT  55

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQAL  538
                  S+LP L  L + +NK  G  P S+   S L  L +   NL+G++P +L  L++L
Sbjct  56   LHSLNFSHLPNLVTLSLPYNKLFGNIPVSIGHLSKLIRLELIGNNLSGNIPIELGSLRSL  115

Query  539  RALDLSYN  562
            + LDL+ N
Sbjct  116  QYLDLASN  123



>ref|XP_008236214.1| PREDICTED: receptor-like protein kinase HAIKU2, partial [Prunus 
mume]
Length=950

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +2

Query  194  RLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGD  373
             LD   +  TA++ S         +   +C + GVVC+    V +I++S   +SG  P D
Sbjct  13   ELDPLFKLKTALQNSNPSVFTSWTEATPICNFTGVVCNSNGLVSEINLSQQKLSGFLPFD  72

Query  374  VCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDL  553
                L  L+ L +G N  +G     L +C+ LE+L++   + TG +PDLS L  L  L L
Sbjct  73   SICSLQYLKKLSLGWNGLYGSLTDDLKNCTSLEQLDLGNNSFTGKVPDLSSLSQLTFLSL  132

Query  554  S  556
            +
Sbjct  133  N  133



>gb|EYU20424.1| hypothetical protein MIMGU_mgv1a021116mg, partial [Erythranthe 
guttata]
Length=606

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = +2

Query  281  CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
            C++ G+ C D  +V KI++ G ++SG+ P  +   LP ++ + + +N+  G  P +L+SC
Sbjct  63   CKWNGITCFDSSHVSKIELPGKNLSGKIPNSIFE-LPHIQSIDLSNNQLFGEIPYNLSSC  121

Query  461  SFLEELNMTATNLTGSLPDLSPLQALRALDLSYNL  565
              L  LN+++ NLTG +P +  L  L   DLS N+
Sbjct  122  YSLRYLNLSSNNLTGLIP-IGRLPFLETFDLSNNM  155


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 12/126 (10%)
 Frame = +2

Query  206  QSEFFTAMKKSFTGSLMGRWD------GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFP  367
            ++EFF  +  SF  + +   D         + E  G   D    ++++ +SG  +SG+ P
Sbjct  465  KNEFFGELPDSFGSNSLENLDLSGNRFSGGIPEKFGEFSD----IMEMRLSGNELSGKIP  520

Query  368  GDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRA  544
             D  SY  KL  L + HN   G  P S  S   L +L+++   LTG +P +L  +++L  
Sbjct  521  -DQLSYCKKLVSLDLSHNHLAGEIPTSFASMPVLGQLDLSVNELTGKIPSNLGEVESLVQ  579

Query  545  LDLSYN  562
            +++SYN
Sbjct  580  VNISYN  585



>ref|XP_009408032.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g24230 [Musa acuminata subsp. malaccensis]
Length=856

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 60/119 (50%), Gaps = 4/119 (3%)
 Frame = +2

Query  209  SEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYL  388
            S+FF  MK + + +         VC +RGV CD ++ VV +  SG+  SG  P      L
Sbjct  33   SDFFRKMKVAPSSA---EGSSSRVCSWRGVSCDGQERVVSLVASGFGFSGPIPESTIGKL  89

Query  389  PKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
             +LRVL + HN   G         S L  LN++   +TG LP +L   + + +LDLS+N
Sbjct  90   SELRVLDLSHNNITGLSLDFAEPGSSLRSLNLSWNKITGPLPSNLGNFKLMESLDLSHN  148



>ref|XP_007023086.1| Leucine-rich repeat receptor protein kinase PEPR1, putative isoform 
1 [Theobroma cacao]
 ref|XP_007023087.1| Leucine-rich repeat receptor protein kinase PEPR1, putative isoform 
1 [Theobroma cacao]
 ref|XP_007023088.1| Leucine-rich repeat receptor protein kinase PEPR1, putative isoform 
1 [Theobroma cacao]
 gb|EOY25708.1| Leucine-rich repeat receptor protein kinase PEPR1, putative isoform 
1 [Theobroma cacao]
 gb|EOY25709.1| Leucine-rich repeat receptor protein kinase PEPR1, putative isoform 
1 [Theobroma cacao]
 gb|EOY25710.1| Leucine-rich repeat receptor protein kinase PEPR1, putative isoform 
1 [Theobroma cacao]
Length=1110

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 58/95 (61%), Gaps = 2/95 (2%)
 Frame = +2

Query  281  CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSC  460
            C++ G+ CD+ ++V+ ++++G++ISG+  G   + L +L  L +  N F G  P  L +C
Sbjct  60   CKWVGIACDNSNHVLTLNLTGFAISGQL-GPQIAGLSRLSTLDLSSNNFSGAIPSGLANC  118

Query  461  SFLEELNMTATNLTGSLPD-LSPLQALRALDLSYN  562
            + L  L+++A   TGS+PD  + LQ L  L+L  N
Sbjct  119  TSLIHLDLSANGFTGSIPDSFNYLQKLSFLNLYSN  153



>gb|KDO48827.1| hypothetical protein CISIN_1g044860mg, partial [Citrus sinensis]
Length=279

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +2

Query  308  DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMT  487
            +K  +  +D S  ++SGE P ++CS LP L  + +  N FHGG P +L++C++L++L+++
Sbjct  123  NKSSLQHLDFSFNTLSGEIPANICSNLPFLEYISLSQNMFHGGIPSTLSNCTYLQKLSLS  182

Query  488  ATNLTGSLP-DLSPLQALRALDLSYN  562
              +  G++P ++  L  L+ L L  N
Sbjct  183  LNDFWGAIPKEIGNLTKLKELYLGRN  208



>ref|XP_010443528.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g58150 [Camelina sativa]
Length=783

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 65/124 (52%), Gaps = 17/124 (14%)
 Frame = +2

Query  209  SEFFTAMK----KSFTGSLMGRWDGEAVCEYRGVV-CDDKDYVVKIDVSGWSISGEFPGD  373
            S FF+A+K     +F+ S          C + GVV CD +D V+ I  SG  +SG  P +
Sbjct  32   SHFFSALKLPQAHTFSSS----------CSWPGVVLCDSRDNVLHITASGLDLSGSIPDN  81

Query  374  VCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALD  550
                + KL+ L +  NK     P  L S SFLE LN+++  ++  LP ++    +L+ LD
Sbjct  82   TIGKMSKLQTLDLSGNKI-TSLPSDLWSLSFLETLNLSSNQISERLPSNIGNFMSLQTLD  140

Query  551  LSYN  562
            LS+N
Sbjct  141  LSFN  144



>gb|KJB36070.1| hypothetical protein B456_006G139200 [Gossypium raimondii]
Length=885

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = +2

Query  281  CEYRGVVCDDKD--YVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLT  454
            C + G+ C      YV  ID+   ++SGE P  +C  LP L  L +  N F+   P  L+
Sbjct  57   CNWTGITCIPTPSLYVSSIDLQSLNLSGEIPSSICE-LPYLSHLNLADNLFNQPIPLHLS  115

Query  455  SCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             CS LE LN++   + G++PD     AL+ LDLS N
Sbjct  116  ECSSLETLNLSKNLIWGTIPDQISFDALKVLDLSKN  151



>ref|XP_006427075.1| hypothetical protein CICLE_v100269282mg, partial [Citrus clementina]
 gb|ESR40315.1| hypothetical protein CICLE_v100269282mg, partial [Citrus clementina]
Length=393

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +2

Query  311  KDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTA  490
            K  +  +D S  ++SGE P ++CS LP L  L +  N FHGG P +L++C++L++L +  
Sbjct  125  KSSLQHLDFSHNTLSGEIPANICSSLPFLDFLSLQENMFHGGIPSTLSNCTYLQKLGLVY  184

Query  491  TNLTGSLP-DLSPLQALRALDLSYN  562
             N +G++P ++  L  L+ L L  N
Sbjct  185  NNFSGAIPKEIGNLTKLKILYLGGN  209



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 61/131 (47%), Gaps = 25/131 (19%)
 Frame = +2

Query  245  GSLMGRWDGEAV-CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDV---------------  376
            G+ +G WD     C + GV CDD   VV +D+SG ++SG  P  V               
Sbjct  45   GAALGPWDATTDHCSWPGVTCDDAGAVVSLDLSGRNLSGLLPPAVGRLRSLLRLSAAANS  104

Query  377  --------CSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPL  529
                     + LP LR L + +N F+G FP  L   + L  L++   NLTG LP +L+ L
Sbjct  105  FSGPIPSELALLPALRHLNLSNNIFNGSFPAPLARLADLRVLDLYNNNLTGPLPRELAAL  164

Query  530  QALRALDLSYN  562
              LR + L  N
Sbjct  165  PQLRHIHLGGN  175



>ref|XP_004299841.2| PREDICTED: receptor-like protein kinase HAIKU2 [Fragaria vesca 
subsp. vesca]
Length=1022

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 53/107 (50%), Gaps = 5/107 (5%)
 Frame = +2

Query  251  LMGRWDGEAV-----CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVG  415
            L   WD  +      C + G+ C+  + V++ID+S   +SG  P D    LP L  L  G
Sbjct  80   LFSTWDSSSTANYSFCSFTGITCNGVNSVLEIDLSNKKLSGSLPLDSICQLPSLEKLAFG  139

Query  416  HNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
             N  HG     L +C+ L+ L++     +GS+PD+S L  L  L L+
Sbjct  140  SNFLHGTITEDLRNCTTLKYLDLGNNMFSGSVPDISSLSKLEHLHLN  186



>ref|XP_010045705.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1048

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 67/133 (50%), Gaps = 3/133 (2%)
 Frame = +2

Query  173  VSGSYQARLDDQSEFFTAMKKSFTGS--LMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGW  346
             S + Q R ++     T   K  +GS   +  W+G   C +RG+ CD    V  +++S  
Sbjct  39   ASATNQTRYEEVEALLTWKSKLDSGSRFTLSSWNGTNPCSWRGINCDSLGSVASLNLSNS  98

Query  347  SISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLS  523
            +I G       S LP L    + +N F G  P S+ + + L  L+++  NL+G++P  L 
Sbjct  99   TIHGTLHYLNFSRLPNLIAFTLANNSFFGKIPLSMANLAKLTYLDLSRNNLSGNIPTQLG  158

Query  524  PLQALRALDLSYN  562
             L++LR L+LS N
Sbjct  159  SLRSLRDLNLSNN  171



>ref|XP_006494783.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Citrus sinensis]
Length=1206

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +2

Query  308  DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMT  487
            +K  +  +D S  ++SGE P ++CS LP L  L +  N FHGG P +L++C++L++L + 
Sbjct  277  NKSSLQHLDFSHNTLSGEIPANICSSLPFLDFLSLQENMFHGGIPSTLSNCTYLQKLGLV  336

Query  488  ATNLTGSLP-DLSPLQALRALDLSYN  562
              N +G++P ++  L  L+ L L  N
Sbjct  337  YNNFSGAIPKEIGNLTKLKILYLGGN  362



>ref|XP_006842942.1| hypothetical protein AMTR_s00075p00179970 [Amborella trichopoda]
 gb|ERN04617.1| hypothetical protein AMTR_s00075p00179970 [Amborella trichopoda]
Length=414

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 61/127 (48%), Gaps = 4/127 (3%)
 Frame = +2

Query  191  ARLDDQSEFFTAMKKSFTGSLMGRWD--GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            A  +D S    A + S  G     W+    + C + GV+CDDK  VV + + G  +SG  
Sbjct  23   AESEDASALL-AFRSSIRGVRYLPWNMTQSSPCSWLGVICDDKGRVVALKLPGKGLSGTI  81

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPD-LSPLQALR  541
            P      L  L +L +  N F G  P  +  C+ L  L + + +L+G++PD L  L  L 
Sbjct  82   PSMTLGNLTHLTILSLRFNGFLGALPSDIVKCTNLRSLYLQSNHLSGNIPDFLFQLHNLV  141

Query  542  ALDLSYN  562
             LDL+ N
Sbjct  142  NLDLAMN  148



>gb|AFW73724.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=999

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 66/128 (52%), Gaps = 9/128 (7%)
 Frame = +2

Query  203  DQSEFFTAMKKSFT--GSLMGRWDGEAV----CEYRGVVCDDKDY-VVKIDVSGWSISGE  361
            D  E    +KKSF   G+ +  W G+      C +RGV+CD+  + V  +++SG ++ GE
Sbjct  25   DDGETLLEIKKSFRDGGNALYDWSGDGASPGYCSWRGVLCDNVTFAVAALNLSGLNLEGE  84

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQAL  538
                + S L +L  + +  N   G  P  +  CS LE L++++ NL G +P  +S L+ L
Sbjct  85   ISAAIGS-LQRLVSIDLKSNGLSGQIPDEIGDCSLLETLDLSSNNLEGDIPFSMSKLKHL  143

Query  539  RALDLSYN  562
              L L  N
Sbjct  144  ENLILKNN  151



>gb|KEH19902.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=348

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 62/131 (47%), Gaps = 28/131 (21%)
 Frame = +2

Query  251  LMGRWD-GEAVCEYRGVVCDDK-------------------------DYVVKIDVSGWSI  352
            L   W    +VC + GV CD++                          ++V +D+   S 
Sbjct  51   LANNWSTSSSVCSWVGVTCDERHGRVHSLILQNMSLRGIVSPNLGNMSFLVILDLKNNSF  110

Query  353  SGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPD-LSPL  529
            SG+FP ++C  L KLRVL + +NKF GG P +L   S L+ L + A N +G +P  +  L
Sbjct  111  SGQFPKELCR-LHKLRVLHISYNKFEGGIPAALGDLSQLQYLYLGANNFSGFVPQSIGKL  169

Query  530  QALRALDLSYN  562
            + L+ LD   N
Sbjct  170  RQLKELDTIQN  180



>ref|XP_002263151.3| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Vitis vinifera]
Length=1005

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 6/108 (6%)
 Frame = +2

Query  254  MGRW--DGEAVCEYRGVVCDDKDY-VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNK  424
            +G W    +  C++ G+ CD K + VV ID+SG+ +SG FP   C  +  L+ L +  N 
Sbjct  71   LGDWVPTSDDPCKWTGIACDYKTHAVVSIDLSGFGVSGGFPSGFCR-IQTLQNLSLADNN  129

Query  425  FHGGFPGSLTS-CSFLEELNMTATNLTGSLPDLSP-LQALRALDLSYN  562
             +G     L S C  L  LN+++  LTG LP+  P   +L  LDLS+N
Sbjct  130  LNGSLTSELVSPCFHLHSLNLSSNELTGELPEFVPEFGSLLILDLSFN  177



>ref|NP_001048946.2| Os03g0145000 [Oryza sativa Japonica Group]
 gb|AAO17351.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF93945.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ25561.1| hypothetical protein OsJ_09387 [Oryza sativa Japonica Group]
 dbj|BAF10860.2| Os03g0145000 [Oryza sativa Japonica Group]
Length=1030

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 60/143 (42%), Gaps = 28/143 (20%)
 Frame = +2

Query  203  DQSEFFTAMKKSFT---GSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGD  373
            D++    A+K S     G L G W     C ++GV CD +  V  ++++  ++SG  P D
Sbjct  29   DEAAALLAIKASLVDPLGELKG-WSSAPHCTWKGVRCDARGAVTGLNLAAMNLSGAIPDD  87

Query  374  VCSY-----------------------LPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNM  484
            +                          +P LR L V  N F G FP  L +C+ L  LN 
Sbjct  88   ILGLAGLTSIVLQSNAFDGELPPVLVSIPTLRELDVSDNNFKGRFPAGLGACASLTHLNA  147

Query  485  TATNLTGSLP-DLSPLQALRALD  550
            +  N  G LP D+    AL  LD
Sbjct  148  SGNNFAGPLPADIGNATALETLD  170



>ref|XP_002271143.2| PREDICTED: receptor-like protein kinase HAIKU2 [Vitis vinifera]
Length=975

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +2

Query  212  EFFTAMKKSFTGSLMGRW-DGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYL  388
            +F +A++KS T S+   W  G +V  + G+VC+   +V +I +    + G  P D    L
Sbjct  36   KFKSALEKSNT-SVFDTWTQGNSVRNFTGIVCNSNGFVTEILLPEQQLEGVLPFDSICEL  94

Query  389  PKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
              L  + +G N  HGG    L +CS L+ L++     TG++P+LS L  L+ L+L+
Sbjct  95   KSLEKIDLGANVLHGGIGEGLKNCSQLQYLDLGVNFFTGTVPELSSLSGLKFLNLN  150



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 66/128 (52%), Gaps = 8/128 (6%)
 Frame = +2

Query  185  YQARLDDQSEFFTAMKKSFTGSLMGRWDGEA-VCEYRGVVCDDKDYVVKIDVSGWSISGE  361
            Y+A L  +S    A     T  L+  W+     C + GV CD++ +V  +D++G  +SG 
Sbjct  28   YRALLSLRSAITDA-----TPPLLTSWNSSTPYCSWLGVTCDNRRHVTSLDLTGLDLSGP  82

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQAL  538
               DV ++LP L  L +  NKF G  P SL++ S L  LN++      + P +LS LQ L
Sbjct  83   LSADV-AHLPFLSNLSLASNKFSGPIPPSLSALSGLRFLNLSNNVFNETFPSELSRLQNL  141

Query  539  RALDLSYN  562
              LDL  N
Sbjct  142  EVLDLYNN  149



>ref|XP_002531997.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30396.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=988

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 77/155 (50%), Gaps = 13/155 (8%)
 Frame = +2

Query  134  HRIAIllllllYSVSGSYQ--ARLDDQSEFFTAMKKSFTGSLMGRWDGEAV-------CE  286
            H+I  + L++LY+VS S+     L   SE    +K +      G+ +   V       C+
Sbjct  3    HQIFKISLVVLYAVSFSFSLVVSLTGDSEILIRVKNAQLDDRDGKLNDWVVSRTDHSPCK  62

Query  287  YRGVVCDD-KDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPG-SLTSC  460
            + GV CD   + VV ID+SG +++G FP   C  +  L+ L +  N F+G     +L+ C
Sbjct  63   WTGVTCDSVNNTVVSIDLSGLNVAGGFPTGFCR-IQTLKNLTLADNFFNGSLTSRALSPC  121

Query  461  SFLEELNMTATNLTGSLPDLSP-LQALRALDLSYN  562
              L  LN++A    G LPD  P    LR LDLS N
Sbjct  122  QHLHVLNLSANIFVGELPDFPPDFANLRVLDLSCN  156



>ref|XP_006468120.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like isoform X2 [Citrus sinensis]
Length=1051

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +2

Query  308  DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMT  487
            +K  +  +D S  ++SGE P ++CS LP L  + +  N FHG  P +L++C +LE L+++
Sbjct  151  NKSSLQHLDFSYNALSGEIPANICSNLPFLESISLSQNMFHGRIPSALSNCKYLEILSLS  210

Query  488  ATNLTGSLP-DLSPLQALRALDLSY  559
              NL G++P ++  L  L+ L L Y
Sbjct  211  INNLLGAIPKEIGNLTKLKELYLGY  235



>dbj|BAJ88113.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=683

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 3/105 (3%)
 Frame = +2

Query  254  MGRWD-GEAVCEYRGVVCDD-KDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKF  427
            +  WD   + C++ GV C+     V  + +S  S+SG       S L +LR L +  N  
Sbjct  46   LSNWDESHSPCQFHGVTCNKISGEVTGVSLSNASLSGTISPSF-SLLHQLRTLDLSANSI  104

Query  428  HGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
             G  P +LT+C+ L+ LN++  +LTG L DLS L  L+ LDLS N
Sbjct  105  SGIIPAALTNCTNLQVLNLSMNSLTGQLHDLSSLLKLQVLDLSTN  149



>gb|EPS70847.1| hypothetical protein M569_03906 [Genlisea aurea]
Length=1055

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (54%), Gaps = 7/115 (6%)
 Frame = +2

Query  236  SFTGSLMG-----RWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLR  400
            +F+G L G      W     C++ GV+C D   V+ + +SG S++GE   D  S L +L 
Sbjct  36   NFSGQLTGGSVKFSWSSSDCCQWEGVICGDAGRVIMLKLSGRSLAGEI-SDSISMLDRLT  94

Query  401  VLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGS-LPDLSPLQALRALDLSYN  562
            ++ + HN   G  P +L++   L+ L++    L GS    LS L ++R+L+LS N
Sbjct  95   LIDLSHNMLDGNLPPTLSNLKQLQVLDLAHNMLVGSPFGSLSGLNSIRSLNLSGN  149



>gb|KDO36330.1| hypothetical protein CISIN_1g035904mg, partial [Citrus sinensis]
Length=291

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 1/100 (1%)
 Frame = +2

Query  266  DGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPG  445
            D +    +   +  +   +  ID +  S+SGE P ++ SYLP L+ L +  N FHG  P 
Sbjct  107  DNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPS  166

Query  446  SLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
            +L++C  L+ L+++  + TG++P ++  L  L  L L YN
Sbjct  167  TLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYN  206



>gb|EAY88517.1| hypothetical protein OsI_09989 [Oryza sativa Indica Group]
Length=1030

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 60/143 (42%), Gaps = 28/143 (20%)
 Frame = +2

Query  203  DQSEFFTAMKKSFT---GSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGD  373
            D++    A+K S     G L G W     C ++GV CD +  V  ++++  ++SG  P D
Sbjct  29   DEAAALLAIKASLVDPLGELKG-WSSPPHCTWKGVRCDARGAVTGLNLAAMNLSGAIPDD  87

Query  374  VCSY-----------------------LPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNM  484
            +                          +P LR L V  N F G FP  L +C+ L  LN 
Sbjct  88   ILGLAGLTSIVLQSNAFDGELPPVLVSIPTLRELDVSDNNFKGRFPAGLGACASLTHLNA  147

Query  485  TATNLTGSLP-DLSPLQALRALD  550
            +  N  G LP D+    AL  LD
Sbjct  148  SGNNFAGPLPADIGNATALETLD  170



>gb|KDO42499.1| hypothetical protein CISIN_1g023193mg [Citrus sinensis]
Length=286

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +2

Query  308  DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMT  487
            +K  +  +D +  ++S E P ++CS LP L +L +  N FHGG P +L++C++L++L++ 
Sbjct  151  NKSSLQLLDFAHNTLSDEIPANICSNLPFLEILSLSQNMFHGGIPSTLSNCTYLQKLSLP  210

Query  488  ATNLTGSLP-DLSPLQALRALDLSYN  562
              + +G++P ++  L  L+ L L  N
Sbjct  211  YNDFSGAIPKEIGNLNKLKRLYLGRN  236



>gb|AFW76643.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1034

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 63/121 (52%), Gaps = 9/121 (7%)
 Frame = +2

Query  218  FTAMKKSF--TGSLMGRWDGEAVCEYRGVVCDDKDY-VVKIDVSGWSISGEFPGDV--CS  382
               +KKSF   G+++  W G+  C +RGV+CD+  + V  +D+    +SG+ P ++  CS
Sbjct  103  LVEIKKSFRNVGNVLYDWAGDDYCSWRGVLCDNVTFAVAALDLKSNGLSGQIPDEIGDCS  162

Query  383  YLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPD-LSPLQALRALDLSY  559
                LR L    N   G  P S++    LE L +    L G++P  LS L  L+ LDL+ 
Sbjct  163  ---SLRTLDFSFNNLDGDIPFSISKLKHLENLILKNNQLIGAIPSTLSQLPNLKILDLAQ  219

Query  560  N  562
            N
Sbjct  220  N  220



>gb|KDO48988.1| hypothetical protein CISIN_1g036229mg [Citrus sinensis]
Length=982

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +2

Query  308  DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMT  487
            +K  +  +D S  ++SGE P ++CS LP L  + +  N FHG  P +L++C +LE L+++
Sbjct  151  NKSSLQHLDFSYNALSGEIPANICSNLPFLESISLSQNMFHGRIPSALSNCKYLEILSLS  210

Query  488  ATNLTGSLP-DLSPLQALRALDLSY  559
              NL G++P ++  L  L+ L L Y
Sbjct  211  INNLLGAIPKEIGNLTKLKELYLGY  235



>ref|XP_008339015.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=986

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (49%), Gaps = 5/123 (4%)
 Frame = +2

Query  203  DQSEFFTAMKKSFTGS----LMGRWDGEA-VCEYRGVVCDDKDYVVKIDVSGWSISGEFP  367
            D+ +    +K +F GS    +   W+  + VC + G+ C++  +V  ID+S  ++SG   
Sbjct  30   DELQILLTLKSAFQGSNTNNIFNTWNSTSXVCSFTGIACNENGFVRDIDLSNQNLSGFLA  89

Query  368  GDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRAL  547
             D    L  L  L +G N   G     L +C  L+ L++   + +GS PD+S L  L  L
Sbjct  90   ADAICQLKSLETLSLGFNFLDGTIKEBLNNCVNLKYLDLGHNSFSGSFPDISSLSRLEHL  149

Query  548  DLS  556
             L+
Sbjct  150  HLN  152



>ref|XP_006468119.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like isoform X1 [Citrus sinensis]
Length=1077

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +2

Query  308  DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMT  487
            +K  +  +D S  ++SGE P ++CS LP L  + +  N FHG  P +L++C +LE L+++
Sbjct  151  NKSSLQHLDFSYNALSGEIPANICSNLPFLESISLSQNMFHGRIPSALSNCKYLEILSLS  210

Query  488  ATNLTGSLP-DLSPLQALRALDLSY  559
              NL G++P ++  L  L+ L L Y
Sbjct  211  INNLLGAIPKEIGNLTKLKELYLGY  235



>emb|CAN65551.1| hypothetical protein VITISV_033329 [Vitis vinifera]
Length=1253

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +2

Query  212  EFFTAMKKSFTGSLMGRW-DGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYL  388
            +F +A++KS T S+   W  G +V  + G+VC+   +V +I +    + G  P D    L
Sbjct  36   KFKSALEKSNT-SVFDTWTQGNSVRNFTGIVCNSNGFVTEILLPEQQLEGVLPFDSICEL  94

Query  389  PKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLS  556
              L  + +G N  HGG    L +CS L+ L++     TG++P+LS L  L+ L+L+
Sbjct  95   KSLEKIDLGANVLHGGIGEGLKNCSQLQYLDLGVNFFTGTVPELSSLSGLKFLNLN  150



>gb|KJB54982.1| hypothetical protein B456_009G056800 [Gossypium raimondii]
Length=1094

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 66/128 (52%), Gaps = 12/128 (9%)
 Frame = +2

Query  185  YQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            ++A LD+QS+           S +  WDG   C + G++CD    V ++ +S + + G+ 
Sbjct  53   WKASLDNQSQ-----------SSLSSWDGNGHCNWTGIICDKSRRVHQLKLSRFGLKGKL  101

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALR  541
             G   S  PKL V+ +  N   G  P  + + S L  L++++ NL+G +P ++  L+++ 
Sbjct  102  HGFSFSSFPKLNVIDLSSNYLRGTIPSGVGNLSRLTYLDLSSNNLSGYIPFEIGKLRSIS  161

Query  542  ALDLSYNL  565
             L L  N+
Sbjct  162  ELYLESNI  169



>ref|XP_010483372.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At5g58150 [Camelina sativa]
Length=808

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 64/121 (53%), Gaps = 11/121 (9%)
 Frame = +2

Query  209  SEFFTAMK--KSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCS  382
            S FF+A+K  ++ T S    W G        VVCD +D V+ I  SG ++SG  P +   
Sbjct  58   SHFFSALKLPQAHTFSSSCSWPGV-------VVCDIRDNVLHISASGLNLSGSIPDNTIG  110

Query  383  YLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSY  559
             + KL+ L +  NK     P  L S SFLE LN+++  ++  LP ++    +L  LDLS+
Sbjct  111  KMSKLQTLDLSGNKI-TSLPSDLWSLSFLETLNLSSNRISEPLPSNIGNFMSLETLDLSF  169

Query  560  N  562
            N
Sbjct  170  N  170



>ref|XP_008455491.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
Length=982

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 56/96 (58%), Gaps = 3/96 (3%)
 Frame = +2

Query  281  CEYRGVVCDDKDY-VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTS  457
            C + G+ CD   + V+ +D+S + +SG FP  +C  LP L  L + +N  +   P  + S
Sbjct  58   CNWSGITCDSLTHSVIAVDLSDFQLSGTFPTFICR-LPSLSSLSLSNNAINASLPDDVAS  116

Query  458  CSFLEELNMTATNLTGSLPD-LSPLQALRALDLSYN  562
            CS L  LNM+   L GS+PD +S +  LR+LDLS N
Sbjct  117  CSGLHLLNMSQNLLAGSIPDGISKISNLRSLDLSGN  152



>ref|XP_004235511.1| PREDICTED: receptor-like protein kinase [Solanum lycopersicum]
Length=1125

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 68/148 (46%), Gaps = 5/148 (3%)
 Frame = +2

Query  77   FPPFSSSRDQKKTNKKMALHRIAIllllllYSVSGSYQARLDDQSEFFTAMKKSFTGSLM  256
            F  F S + +     K+A+H + I      +SVS      L        ++   + G + 
Sbjct  8    FSSFPSKKKKTFLIMKIAVHNL-IFFYCCYFSVSAFAVCGLTSDGTALVSLSSDWIG-VP  65

Query  257  GRWDGEAV--CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFH  430
              W+      C + GV CDD  +V  +++SG+ ISG+  G   +YL  L  + + +N F 
Sbjct  66   SSWNASDTNPCSWVGVECDDNHFVTSLNLSGYDISGQL-GPEIAYLKHLLTMDLSYNAFS  124

Query  431  GGFPGSLTSCSFLEELNMTATNLTGSLP  514
               P  LT+C+ L  L+++    TG +P
Sbjct  125  ASIPSQLTNCTLLRYLDLSYNTFTGEIP  152



>gb|KHG14193.1| hypothetical protein F383_07227 [Gossypium arboreum]
Length=886

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = +2

Query  281  CEYRGVVCDDKD--YVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLT  454
            C + G+ C      YV  ID+   ++SGE P  +C  LP L  L +  N F+   P  L+
Sbjct  57   CNWTGITCIPTPSLYVSSIDLQSLNLSGEIPSSICE-LPYLSHLNLADNLFNQPIPLHLS  115

Query  455  SCSFLEELNMTATNLTGSLPD-LSPLQALRALDLSYN  562
             CS LE LN++   + G++PD +S   AL+ LDLS N
Sbjct  116  ECSSLETLNLSKNLIWGTIPDQISQFDALKVLDLSKN  152



>ref|XP_001759642.1| predicted protein [Physcomitrella patens]
 gb|EDQ75554.1| predicted protein [Physcomitrella patens]
Length=901

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (52%), Gaps = 4/108 (4%)
 Frame = +2

Query  248  SLMGRWDGEAV--CEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHN  421
            S +  W  E    CE+ G+ CD   +V  I++    +SG    ++   L KLR+L +  N
Sbjct  54   STLRTWKSEDSYPCEWSGISCDKNSHVTSINLRNAGLSGTIALEL-HRLRKLRILILSEN  112

Query  422  KFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
             F G  P  L+    L +L +   NLTGS+P +LS L  LR  DLSYN
Sbjct  113  NFSGPIPPQLSEIGSLWKLKLDHNNLTGSIPGELSHLSNLRIFDLSYN  160



>ref|XP_007026631.1| LRR receptor-like serine/threonine-protein kinase GSO1, putative 
[Theobroma cacao]
 gb|EOY07133.1| LRR receptor-like serine/threonine-protein kinase GSO1, putative 
[Theobroma cacao]
Length=1060

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 11/136 (8%)
 Frame = +2

Query  170  SVSGSYQARLDDQSEFFTAMKKSFTGSL---MGRWDGEA-VCEYRGVVCDDKDYVVKIDV  337
            SVSG  Q+   DQ E    +K +   +L   + +W+     C + GV CD    V+++D+
Sbjct  25   SVSGQCQS---DQQELLLGLKIALNSTLSVKLMKWNQSTDCCSWDGVSCDAGGRVIELDL  81

Query  338  SGWSISGEFPGDVCSY--LPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSL  511
            S  SISG      CS   L  L+ L + +N+F   FP      + L  LN++A   TG +
Sbjct  82   SNQSISGAIESS-CSLFRLQHLQRLNLAYNEFISAFPSEFDKLANLTYLNLSAAGFTGQI  140

Query  512  P-DLSPLQALRALDLS  556
            P ++S +  L  LDLS
Sbjct  141  PIEISYMTKLVTLDLS  156



>ref|XP_004974753.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1-like 
[Setaria italica]
Length=572

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 66/134 (49%), Gaps = 4/134 (3%)
 Frame = +2

Query  173  VSGSYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAV--CEYRGVVCDDKDYVVKIDVSGW  346
            V+ S+    D Q+    +       S+   W       C + GV CD+++ V+ +D++  
Sbjct  16   VTSSWSLSSDGQALLALSRNLILPSSIRSNWSASDATPCTWNGVGCDERNIVISLDLTSS  75

Query  347  SISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLS  523
             +SG    ++C  L  L++L +  N   G  P  L +CS LE+L+++   L+G++P  + 
Sbjct  76   GVSGSLGPEIC-RLKYLQILSLSGNNISGSIPPELGNCSMLEQLDLSQNFLSGNIPASMG  134

Query  524  PLQALRALDLSYNL  565
             L+ L  L L  NL
Sbjct  135  NLKRLSQLSLYSNL  148


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (52%), Gaps = 1/81 (1%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +VK+D +  S  G  P ++CS    LR+L +G N   G  P  +++C  LE   +   N 
Sbjct  427  LVKVDFTNNSFVGGIPPNICSG-KTLRILDLGSNHLTGSIPSGVSNCPSLERFILQGNNF  485

Query  500  TGSLPDLSPLQALRALDLSYN  562
            +G +P+    + L  +DLS N
Sbjct  486  SGHIPEFRNCKGLSYIDLSRN  506



>ref|XP_006658283.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230-like [Oryza brachyantha]
Length=1124

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 54/104 (52%), Gaps = 4/104 (4%)
 Frame = +2

Query  263  WD--GEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGG  436
            WD  G   C + G+ C     V  + + G ++ GE    VC+ LP+L VL V  N   G 
Sbjct  71   WDAAGGDPCGWPGIACSPALEVTAVTLHGLNLHGELSAAVCA-LPRLEVLNVSKNALSGA  129

Query  437  FPGSLTSCSFLEELNMTATNLTGSL-PDLSPLQALRALDLSYNL  565
             P  L+ C  L+ L+++  +  GS+ P+L  L +LR L LS NL
Sbjct  130  LPAGLSGCRALQVLDLSTNSFHGSIPPELCGLPSLRQLFLSENL  173



>gb|KCW75741.1| hypothetical protein EUGRSUZ_D00120 [Eucalyptus grandis]
Length=1023

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +2

Query  254  MGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHG  433
            +  W+G + C +RG+ CD    VV +++S  +I G       S+LP L  L + +N   G
Sbjct  66   LSSWNGSSPCSWRGIDCDPLGSVVSLNLSFSAIHGTLHSLNFSHLPNLVTLSLPYNNLFG  125

Query  434  GFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
              P S+   S L  L +   NL+G++P +L  L++L+ LDLS N
Sbjct  126  NIPLSIGHLSKLIRLELIGNNLSGNIPIELGSLRSLQYLDLSRN  169



>ref|XP_008466102.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
Length=982

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (49%), Gaps = 4/123 (3%)
 Frame = +2

Query  200  DDQSEFFTAMKKSF---TGSLMGRWDGE-AVCEYRGVVCDDKDYVVKIDVSGWSISGEFP  367
            DDQ +  T +K S      ++   W  +  +C + G+VCD + +V +ID+S  ++SG  P
Sbjct  25   DDQRQILTKLKSSLHTSNSNVFHTWTLQNPICSFSGIVCDSRGFVTQIDLSQQALSGVVP  84

Query  368  GDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRAL  547
             D    LP L  L +  N   G    SL +C  L+ L+++    + S P +  L  L  L
Sbjct  85   FDSLCQLPALEKLALRSNSLSGEITNSLNNCVKLKYLDLSGNFFSSSFPSIHSLSGLEFL  144

Query  548  DLS  556
             L+
Sbjct  145  YLN  147



>ref|XP_003630689.1| Leucine-rich repeat receptor protein kinase EXS [Medicago truncatula]
 gb|AET05165.1| LRR/extensin [Medicago truncatula]
Length=402

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 8/136 (6%)
 Frame = +2

Query  176  SGSYQARLDDQSEFFTAMKKSFTG---SLMGRWDGEAVCEYRGVVCD---DKDYVVKIDV  337
            SGS  + L++  +   A K S T     ++  W G  VC Y+G+ CD   +  +V  ID+
Sbjct  50   SGSSVSNLNNAYKALQAWKSSITDDPLKILDTWVGPNVCSYKGIFCDTTSNTPFVAGIDL  109

Query  338  SGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPD  517
            +  ++ G    ++ S L  + +L +  NKF G  P +     FL+EL+++   L+GS P 
Sbjct  110  NHANLQGTLVKEL-SLLSAITLLHLNTNKFSGTVPETFKDFIFLQELDLSNNQLSGSFPI  168

Query  518  LS-PLQALRALDLSYN  562
            ++  + +L  LDL +N
Sbjct  169  VTLDMPSLIYLDLRFN  184



>ref|XP_007142376.1| hypothetical protein PHAVU_008G275000g [Phaseolus vulgaris]
 gb|ESW14370.1| hypothetical protein PHAVU_008G275000g [Phaseolus vulgaris]
Length=607

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (53%), Gaps = 2/108 (2%)
 Frame = +2

Query  248  SLMGRWDGEAVCEYRGVVCD-DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNK  424
            +L+G      + +  GV CD +   +V I +   ++SG    D    L KLRVL + +N 
Sbjct  52   TLVGSPSHLCLAKLNGVRCDSNATNIVHIRLENLNLSGTIDADSLCMLQKLRVLSLANNN  111

Query  425  FHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYNL  565
              G  P S+  C+ L  LN+T   L+G LP  L+ L+ LR LD+S N+
Sbjct  112  IRGTIPPSILHCTRLTHLNLTNNQLSGRLPMALTKLKDLRNLDISNNM  159



>gb|KCW75740.1| hypothetical protein EUGRSUZ_D00120 [Eucalyptus grandis]
Length=1020

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +2

Query  254  MGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHG  433
            +  W+G + C +RG+ CD    VV +++S  +I G       S+LP L  L + +N   G
Sbjct  66   LSSWNGSSPCSWRGIDCDPLGSVVSLNLSFSAIHGTLHSLNFSHLPNLVTLSLPYNNLFG  125

Query  434  GFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
              P S+   S L  L +   NL+G++P +L  L++L+ LDLS N
Sbjct  126  NIPLSIGHLSKLIRLELIGNNLSGNIPIELGSLRSLQYLDLSRN  169



>ref|XP_002314669.2| hypothetical protein POPTR_0010s09310g, partial [Populus trichocarpa]
 gb|EEF00840.2| hypothetical protein POPTR_0010s09310g, partial [Populus trichocarpa]
Length=361

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 61/122 (50%), Gaps = 12/122 (10%)
 Frame = +2

Query  218  FTAMKKSFTGSLMGRWDGEAVCEYRGVVC----DDKDY--VVKIDVSGWSISGEFPGDVC  379
             T+  K+FT +    W G  VC Y GV C    DD+D   V  ID++   I+G  P D+ 
Sbjct  55   ITSDPKNFTSN----WCGPNVCNYTGVYCAPAPDDRDTLTVAGIDLNHAKIAGSLPEDL-  109

Query  380  SYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLS-PLQALRALDLS  556
              L  L +  +  N+F G  PGS    + L EL+++    +G  P +   L +L+ LD+ 
Sbjct  110  GLLTDLALFHINSNRFFGSIPGSFCELNLLYELDVSNNQFSGKFPSVVLSLPSLKFLDIR  169

Query  557  YN  562
            YN
Sbjct  170  YN  171



>ref|XP_003552234.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like isoform X1 [Glycine max]
Length=1074

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 83/187 (44%), Gaps = 28/187 (15%)
 Frame = +2

Query  5    MPSLFPIYIFLLFLSLQQLNHHNFFPPFSSSRDQKKTNKKMALHRIAIllllllYSVSGS  184
            +PS + + I +LF +       +   P S+S   ++T     L                 
Sbjct  13   LPSFWLLLIVMLFCAFTVATSRHATIPSSASLTLQQTEANALL----------------K  56

Query  185  YQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEF  364
            ++A L +QS+           +L+  W G + C + G+ CD    V  I+++   + G  
Sbjct  57   WKASLHNQSQ-----------ALLSSWGGNSPCNWLGIACDHTKSVSNINLTRIGLRGTL  105

Query  365  PGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALR  541
                 S LP +  L + +N  +G  P  +   S L  LN++  +L+G +P +++ L +LR
Sbjct  106  QTLSFSSLPNILTLDMSNNSLNGSIPPQIRMLSKLTHLNLSDNHLSGEIPFEITQLVSLR  165

Query  542  ALDLSYN  562
             LDL++N
Sbjct  166  ILDLAHN  172



>ref|XP_006421394.1| hypothetical protein CICLE_v10006797mg, partial [Citrus clementina]
 gb|ESR34634.1| hypothetical protein CICLE_v10006797mg, partial [Citrus clementina]
Length=759

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +2

Query  320  VVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNL  499
            +V+I ++    SGE P ++C+YLP L+ L +  N FH   P +L+ C  L++LN+   NL
Sbjct  145  IVEIRLTNNRFSGELPKNICNYLPHLKALFLDKNMFHSKIPSALSKCKQLQQLNLQFNNL  204

Query  500  TGSLP-DLSPLQALRALDLSYN  562
            +G++P ++  L  L+ + L  N
Sbjct  205  SGAIPKEIGNLTMLKGISLLCN  226



>ref|XP_004302375.1| PREDICTED: probable inactive receptor kinase At1g27190 [Fragaria 
vesca subsp. vesca]
Length=596

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 76/161 (47%), Gaps = 34/161 (21%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSL--MGRWDGEA-----VCEYRGVVC-DDKDYVV----  325
            SYQA ++D  +    +K++F   L  +  WD        VC + G+ C +D++  +    
Sbjct  21   SYQAVVEDDVKCLKGIKEAFNDPLGKLDSWDFTNSSVGFVCHFVGISCWNDRENRIYNLE  80

Query  326  ---------------------KIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFP  442
                                  +D+ G  ++G  P D+CS+LP L  L +  N+F G  P
Sbjct  81   LRDMSLSGTIPQSIEYCISLQNLDLGGNDLNGMIPKDLCSWLPYLVTLDLSGNEFTGPIP  140

Query  443  GSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
              L++C+FL  L ++   L+GS+P +LS L  L+   ++ N
Sbjct  141  VDLSNCTFLNNLILSDNKLSGSIPYELSSLNRLKKFSVANN  181



>gb|KDO40366.1| hypothetical protein CISIN_1g037027mg, partial [Citrus sinensis]
Length=205

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +2

Query  308  DKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMT  487
            +K  +  +D+S  ++SGE P ++CS LP L  + +  N FHGG P +L+ C++L+ L ++
Sbjct  93   NKSSLQDLDLSYNALSGEIPANICSNLPFLEYISLSQNMFHGGIPSALSKCTYLQILGLS  152

Query  488  ATNLTGSLP-DLSPLQALRALDLSYN  562
              + +G++P ++  +  L+ L L  N
Sbjct  153  FNDFSGAIPKEIGNVTKLKELYLVRN  178



>ref|XP_004963298.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Setaria 
italica]
Length=987

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 53/105 (50%), Gaps = 5/105 (5%)
 Frame = +2

Query  263  WDGEAV--CEYRGVVCDDKDYVVKIDVSGWSISG-EFP-GDVCSYLPKLRVLRVGHNKFH  430
            WD  A   C + GV C     V  + +   ++S    P  D+C+ LP L  L +  N   
Sbjct  52   WDATAADPCTFTGVACGTGRVVTGVSLRALNVSAASVPFADLCAALPSLTTLSLPENSLG  111

Query  431  GGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYNL  565
            G   G +  C+ L+ELN+     + ++PDLSPL  LR L++S NL
Sbjct  112  GAIDG-VVGCAALQELNLAFNGFSSTVPDLSPLTRLRRLNVSSNL  155


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = +2

Query  329  IDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGS  508
            IDVS  ++SG  P D+C     L++L +  N F GG P +  SC  L    ++   LTG 
Sbjct  344  IDVSTNALSGPIPPDMCKQGTMLKLL-ILENSFSGGIPATYASCKTLVRFRVSKNRLTGE  402

Query  509  LPD-LSPLQALRALDLSYN  562
            +PD L  L  +  LDL+ N
Sbjct  403  VPDGLWALPNVNVLDLAEN  421



>ref|WP_020569811.1| hypothetical protein [Lewinella persica]
Length=1396

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 54/95 (57%), Gaps = 2/95 (2%)
 Frame = +2

Query  278   VCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTS  457
             VC++ GV C   D V ++++   +++G  P ++ S L +L VL +G N   GG P SL +
Sbjct  1010  VCDWVGVTCLG-DRVQRLELRENALAGPIPAEI-SELGRLEVLSLGRNGLTGGLPASLFT  1067

Query  458   CSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
               FLE + +    L G++PD S   +LR L L YN
Sbjct  1068  LRFLETIELEFNELMGTVPDFSESASLRRLALQYN  1102



>ref|XP_010064755.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=704

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 67/128 (52%), Gaps = 12/128 (9%)
 Frame = +2

Query  182  SYQARLDDQSEFFTAMKKSFTGSLMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGE  361
            +++++LD +S +            +  W+G + C +RG+ CD    VV +++S  +I G 
Sbjct  55   TWKSKLDSESRYN-----------LSSWNGTSPCSWRGIDCDPLGSVVSLNLSFSAIRGT  103

Query  362  FPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQAL  538
                  S+LP L  L + +N   G  P S+   S L  L +   NL+G++P +L  L++L
Sbjct  104  LHSLNFSHLPNLVTLSLPYNNLFGNIPLSIGHLSKLIRLELFQNNLSGNIPIELGSLRSL  163

Query  539  RALDLSYN  562
            + LDLS N
Sbjct  164  QYLDLSDN  171



>ref|XP_003526519.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine 
max]
 gb|KHN09043.1| Receptor-like protein kinase HAIKU2 [Glycine soja]
Length=983

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 4/123 (3%)
 Frame = +2

Query  191  ARLDDQSEFFTAMKKSFTGS---LMGRWDG-EAVCEYRGVVCDDKDYVVKIDVSGWSISG  358
            A+ +DQ +    +K +   S   L   W+   +VC + GV C+  + V +I++S  ++SG
Sbjct  20   AQSEDQRQILLNLKSTLHNSNSKLFHSWNATNSVCTFLGVTCNSLNSVTEINLSNQTLSG  79

Query  359  EFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQAL  538
              P D    LP L+ L  G+N  +G     + +C  L+ L++     +G  PD+SPL+ +
Sbjct  80   VLPFDSLCKLPSLQKLVFGYNYLNGKVSEDIRNCVKLQYLDLGNNLFSGPFPDISPLKQM  139

Query  539  RAL  547
            + L
Sbjct  140  QYL  142



>ref|XP_010054208.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=1157

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +2

Query  254  MGRWDGEAVCEYRGVVCDDKDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHG  433
            +  W+G + C +RG+ CD    VV +++S  +I G       S+LP L  L + +N   G
Sbjct  66   LSSWNGSSPCSWRGIDCDPLGSVVSLNLSFSAIHGTLHSLNFSHLPNLVTLSLPYNNLFG  125

Query  434  GFPGSLTSCSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
              P S+   S L  L +   NL+G++P +L  L++L+ LDLS N
Sbjct  126  NIPLSIGHLSKLIRLELIGNNLSGNIPIELGSLRSLQYLDLSRN  169



>gb|EYU34350.1| hypothetical protein MIMGU_mgv1a020582mg, partial [Erythranthe 
guttata]
Length=844

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 3/96 (3%)
 Frame = +2

Query  281  CEYRGVVCDDK-DYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTS  457
            C +RGV CDD  +Y+ K D SG+ +SG  P      L KL  L + +N+     P    S
Sbjct  34   CSWRGVFCDDNGEYIFKFDASGFGLSGPIPDTTIGKLTKLHTLNLSNNRIT-ALPDDFWS  92

Query  458  CSFLEELNMTATNLTGSLP-DLSPLQALRALDLSYN  562
             + LE LN++   ++G LP ++     L++LDLS+N
Sbjct  93   LTSLENLNLSFNQISGVLPSNVGNFVQLQSLDLSHN  128



>ref|XP_010045748.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
 gb|KCW84071.1| hypothetical protein EUGRSUZ_B00951 [Eucalyptus grandis]
Length=1091

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 67/133 (50%), Gaps = 3/133 (2%)
 Frame = +2

Query  173  VSGSYQARLDDQSEFFTAMKKSFTGS--LMGRWDGEAVCEYRGVVCDDKDYVVKIDVSGW  346
             S + Q R ++     T   K  +GS   +  W+G   C +RG+ CD    V  +++S  
Sbjct  39   ASATNQTRYEEVEALLTWKSKLDSGSRFTLSSWNGTNPCSWRGINCDSLGSVASLNLSNS  98

Query  347  SISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGSLP-DLS  523
             I G       S LP L  L + +N F G  P S+ + + L  L+++  NL+G++P  L 
Sbjct  99   IIHGTLHYLNFSQLPNLIALTLTNNSFFGKIPLSMANLAKLTYLDLSRNNLSGNIPTQLG  158

Query  524  PLQALRALDLSYN  562
             L++LR L++S N
Sbjct  159  LLRSLRDLNISNN  171



>gb|KHG27799.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=976

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 60/107 (56%), Gaps = 3/107 (3%)
 Frame = +2

Query  248  SLMGRW-DGEAVCEYRGVVCDD-KDYVVKIDVSGWSISGEFPGDVCSYLPKLRVLRVGHN  421
            +++G W + ++ C++ GV CD     V +I ++G S++GE    + S L  L  L + HN
Sbjct  50   NVLGSWKESDSACKFYGVTCDPVSGNVTEISLAGKSLAGEISPSI-SMLNSLETLFLPHN  108

Query  422  KFHGGFPGSLTSCSFLEELNMTATNLTGSLPDLSPLQALRALDLSYN  562
               G  P  +  CS L  LN++   + G +P+LS L++L  L L++N
Sbjct  109  SISGELPDQINHCSNLRVLNISWNKMVGIIPNLSGLKSLEILGLAFN  155



>ref|XP_004976562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Setaria italica]
Length=1163

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = +2

Query  329  IDVSGWSISGEFPGDVCSYLPKLRVLRVGHNKFHGGFPGSLTSCSFLEELNMTATNLTGS  508
            +++SG S +G  P     YLP L+VL   HN+  G  P  L +CS L  L ++   LTGS
Sbjct  571  LNLSGNSFTGSIPA-TYGYLPSLQVLSASHNRISGELPAELANCSNLTVLEISGNQLTGS  629

Query  509  LP-DLSPLQALRALDLSYN  562
            +P DLS L  L  LDLSYN
Sbjct  630  IPSDLSRLGELEELDLSYN  648



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920