BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J06

Length=568
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP00005.1|  unnamed protein product                                146   2e-38   Coffea canephora [robusta coffee]
ref|XP_010102209.1|  Peroxisome biogenesis protein 12                   144   9e-38   
ref|XP_011084263.1|  PREDICTED: peroxisome biogenesis protein 12        144   2e-37   Sesamum indicum [beniseed]
gb|EYU33166.1|  hypothetical protein MIMGU_mgv1a007843mg                144   3e-37   Erythranthe guttata [common monkey flower]
dbj|BAH09867.1|  peroxin 12                                             142   7e-37   Nicotiana tabacum [American tobacco]
ref|XP_009623923.1|  PREDICTED: peroxisome biogenesis protein 12        142   8e-37   Nicotiana tomentosiformis
ref|XP_010043306.1|  PREDICTED: peroxisome biogenesis protein 12        141   2e-36   Eucalyptus grandis [rose gum]
ref|XP_007030377.1|  Peroxin-12                                         141   2e-36   
ref|XP_011038487.1|  PREDICTED: peroxisome biogenesis protein 12-...    141   3e-36   Populus euphratica
ref|XP_011036329.1|  PREDICTED: peroxisome biogenesis protein 12-...    140   3e-36   Populus euphratica
ref|XP_002319659.1|  peroxisome assembly protein 12                     140   3e-36   
ref|XP_004152815.1|  PREDICTED: peroxisome biogenesis protein 12-...    140   3e-36   Cucumis sativus [cucumbers]
ref|XP_002325774.1|  peroxisome assembly protein 12                     140   3e-36   
ref|XP_009779830.1|  PREDICTED: peroxisome biogenesis protein 12        140   4e-36   Nicotiana sylvestris
ref|XP_008441822.1|  PREDICTED: peroxisome biogenesis protein 12        140   4e-36   Cucumis melo [Oriental melon]
ref|XP_004239752.1|  PREDICTED: peroxisome biogenesis protein 12        140   4e-36   Solanum lycopersicum
ref|XP_006345902.1|  PREDICTED: peroxisome biogenesis protein 12-...    140   4e-36   Solanum tuberosum [potatoes]
ref|XP_008370751.1|  PREDICTED: peroxisome biogenesis protein 12-...    140   4e-36   
ref|XP_008218344.1|  PREDICTED: peroxisome biogenesis protein 12        140   4e-36   Prunus mume [ume]
ref|XP_006442641.1|  hypothetical protein CICLE_v10024089mg             140   5e-36   
ref|XP_011038486.1|  PREDICTED: peroxisome biogenesis protein 12-...    140   5e-36   Populus euphratica
ref|XP_007205312.1|  hypothetical protein PRUPE_ppa006828mg             140   5e-36   Prunus persica
gb|KDO45425.1|  hypothetical protein CISIN_1g0162131mg                  139   5e-36   Citrus sinensis [apfelsine]
ref|XP_006297857.1|  hypothetical protein CARUB_v10013898mg             140   6e-36   
ref|XP_010463922.1|  PREDICTED: peroxisome biogenesis protein 12-...    140   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006297858.1|  hypothetical protein CARUB_v10013898mg             140   6e-36   Capsella rubella
ref|XP_004302102.1|  PREDICTED: peroxisome biogenesis protein 12        140   7e-36   Fragaria vesca subsp. vesca
ref|XP_010485821.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisome b...    140   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010415110.1|  PREDICTED: peroxisome biogenesis protein 12-...    139   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002521990.1|  conserved hypothetical protein                     139   8e-36   Ricinus communis
ref|XP_010264914.1|  PREDICTED: peroxisome biogenesis protein 12        139   9e-36   Nelumbo nucifera [Indian lotus]
ref|XP_002882351.1|  peroxin-12                                         139   9e-36   Arabidopsis lyrata subsp. lyrata
gb|KJB44821.1|  hypothetical protein B456_007G274800                    139   1e-35   Gossypium raimondii
gb|KFK37861.1|  hypothetical protein AALP_AA3G038800                    139   1e-35   Arabis alpina [alpine rockcress]
gb|KDP23725.1|  hypothetical protein JCGZ_23558                         139   1e-35   Jatropha curcas
gb|EPS64416.1|  peroxin 12                                              138   1e-35   Genlisea aurea
ref|XP_006470919.1|  PREDICTED: peroxisome biogenesis protein 12-...    139   2e-35   Citrus sinensis [apfelsine]
ref|XP_008785165.1|  PREDICTED: peroxisome biogenesis protein 12        139   2e-35   Phoenix dactylifera
gb|KJB44819.1|  hypothetical protein B456_007G274800                    139   2e-35   Gossypium raimondii
ref|XP_010549665.1|  PREDICTED: peroxisome biogenesis protein 12        139   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_009343773.1|  PREDICTED: peroxisome biogenesis protein 12        139   2e-35   Pyrus x bretschneideri [bai li]
gb|AAF63777.1|  unknown protein                                         138   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920305.1|  PREDICTED: peroxisome biogenesis protein 12-...    138   2e-35   
ref|XP_009123989.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisome b...    138   3e-35   Brassica rapa
emb|CDX92069.1|  BnaC03g33710D                                          138   3e-35   
ref|NP_187096.2|  Peroxisome biogenesis protein 12                      138   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920304.1|  PREDICTED: peroxisome biogenesis protein 12-...    138   3e-35   Elaeis guineensis
emb|CDX74190.1|  BnaA03g28570D                                          137   4e-35   
ref|XP_010675142.1|  PREDICTED: peroxisome biogenesis protein 12        137   4e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009134765.1|  PREDICTED: peroxisome biogenesis protein 12        137   5e-35   Brassica rapa
ref|XP_009400186.1|  PREDICTED: peroxisome biogenesis protein 12        137   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006408186.1|  hypothetical protein EUTSA_v10020878mg             137   5e-35   Eutrema salsugineum [saltwater cress]
emb|CDY42925.1|  BnaC05g47260D                                          136   5e-35   Brassica napus [oilseed rape]
ref|XP_003554721.1|  PREDICTED: peroxisome biogenesis protein 12-...    137   7e-35   Glycine max [soybeans]
ref|XP_002264983.1|  PREDICTED: peroxisome biogenesis protein 12        137   7e-35   Vitis vinifera
ref|XP_003521768.1|  PREDICTED: peroxisome biogenesis protein 12-...    136   1e-34   Glycine max [soybeans]
emb|CDY49338.1|  BnaA05g33000D                                          136   2e-34   Brassica napus [oilseed rape]
dbj|BAJ94128.1|  predicted protein                                      135   4e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007147209.1|  hypothetical protein PHAVU_006G104800g             135   4e-34   Phaseolus vulgaris [French bean]
ref|XP_010934246.1|  PREDICTED: peroxisome biogenesis protein 12-...    135   5e-34   Elaeis guineensis
gb|AAK27808.1|AC022457_11  putative peroxin                             133   1e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67134.1|  hypothetical protein OsI_33961                          133   2e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001064809.1|  Os10g0467200                                       133   2e-33   
ref|XP_003574027.1|  PREDICTED: peroxisome biogenesis protein 12        133   3e-33   Brachypodium distachyon [annual false brome]
ref|XP_004497382.1|  PREDICTED: peroxisome biogenesis protein 12-...    132   4e-33   Cicer arietinum [garbanzo]
ref|XP_004497381.1|  PREDICTED: peroxisome biogenesis protein 12-...    132   5e-33   
ref|XP_004982920.1|  PREDICTED: peroxisome biogenesis protein 12-...    131   8e-33   
ref|XP_004982921.1|  PREDICTED: peroxisome biogenesis protein 12-...    131   1e-32   Setaria italica
ref|XP_002467112.1|  hypothetical protein SORBIDRAFT_01g019750          131   1e-32   Sorghum bicolor [broomcorn]
ref|XP_006661848.1|  PREDICTED: peroxisome biogenesis protein 12-...    130   2e-32   Oryza brachyantha
gb|EMS56254.1|  Peroxisome biogenesis protein 12                        130   3e-32   Triticum urartu
ref|XP_006857493.1|  hypothetical protein AMTR_s00067p00205070          129   5e-32   Amborella trichopoda
ref|XP_009333955.1|  PREDICTED: uncharacterized protein LOC103926801    125   2e-31   
gb|KEH44541.1|  peroxisome biogenesis protein                           127   2e-31   Medicago truncatula
ref|XP_003592818.1|  Peroxisome assembly protein                        127   3e-31   Medicago truncatula
ref|XP_008664901.1|  PREDICTED: peroxisome biogenesis protein 12        127   3e-31   Zea mays [maize]
gb|AFK38181.1|  unknown                                                 123   4e-31   Medicago truncatula
gb|EMT11947.1|  Peroxisome assembly protein 12                          124   3e-30   
gb|KHN43165.1|  Peroxisome biogenesis protein 12                        123   5e-30   Glycine soja [wild soybean]
ref|XP_002983224.1|  hypothetical protein SELMODRAFT_155680             122   2e-29   
ref|XP_002961339.1|  hypothetical protein SELMODRAFT_437729             122   3e-29   
ref|XP_001757098.1|  predicted protein                                  105   1e-23   
ref|XP_005651067.1|  hypothetical protein COCSUDRAFT_39598            84.0    8e-16   Coccomyxa subellipsoidea C-169
ref|XP_002500916.1|  peroxisomal protein importer family              80.1    2e-14   Micromonas commoda
ref|XP_002946144.1|  hypothetical protein VOLCADRAFT_127336           73.9    3e-12   Volvox carteri f. nagariensis
ref|XP_011399801.1|  Peroxisome assembly protein 12                   72.4    4e-12   Auxenochlorella protothecoides
ref|XP_003056078.1|  peroxisomal protein importer family              73.2    5e-12   Micromonas pusilla CCMP1545
ref|XP_001696296.1|  predicted protein                                73.6    1e-11   Chlamydomonas reinhardtii
ref|XP_005849598.1|  hypothetical protein CHLNCDRAFT_48657            70.1    6e-11   Chlorella variabilis
gb|EMD40663.1|  hypothetical protein CERSUDRAFT_45034                 65.9    2e-09   Gelatoporia subvermispora B
ref|XP_006383517.1|  hypothetical protein POPTR_0005s17810g           59.7    8e-09   
gb|KIZ01135.1|  Peroxisome assembly protein 12                        63.9    8e-09   Monoraphidium neglectum
gb|KDQ64948.1|  hypothetical protein JAAARDRAFT_167744                62.0    3e-08   Jaapia argillacea MUCL 33604
ref|XP_007337748.1|  hypothetical protein AURDEDRAFT_52475            62.0    3e-08   
gb|KIM83837.1|  hypothetical protein PILCRDRAFT_782063                61.6    4e-08   Piloderma croceum F 1598
ref|XP_003038254.1|  hypothetical protein SCHCODRAFT_49720            61.6    5e-08   Schizophyllum commune H4-8
emb|CDY30578.1|  BnaC07g04030D                                        59.7    7e-08   Brassica napus [oilseed rape]
gb|EFA82231.1|  RING zinc finger-containing protein                   60.8    8e-08   Heterostelium album PN500
gb|KIK43217.1|  hypothetical protein CY34DRAFT_804074                 60.5    9e-08   Suillus luteus UH-Slu-Lm8-n1
gb|EJT97716.1|  hypothetical protein DACRYDRAFT_119374                60.5    1e-07   Dacryopinax primogenitus
ref|XP_007329571.1|  hypothetical protein AGABI1DRAFT_120439          60.1    1e-07   Agaricus bisporus var. burnettii JB137-S8
ref|XP_007268527.1|  cyclin-dependent protein kinase inhibitor        60.8    1e-07   Fomitiporia mediterranea MF3/22
gb|KIY45911.1|  hypothetical protein FISHEDRAFT_76145                 59.7    2e-07   Fistulina hepatica ATCC 64428
gb|KII95930.1|  hypothetical protein PLICRDRAFT_96220                 59.3    2e-07   Plicaturopsis crispa FD-325 SS-3
gb|KIP12713.1|  hypothetical protein PHLGIDRAFT_97330                 58.9    3e-07   Phlebiopsis gigantea 11061_1 CR5-6
emb|CDO68720.1|  hypothetical protein BN946_scf184652.g47             58.9    3e-07   Trametes cinnabarina
ref|XP_007305583.1|  hypothetical protein STEHIDRAFT_169444           58.9    4e-07   Stereum hirsutum FP-91666 SS1
gb|KIJ56841.1|  hypothetical protein M422DRAFT_218554                 58.5    5e-07   Sphaerobolus stellatus SS14
ref|XP_007391908.1|  hypothetical protein PHACADRAFT_86095            58.5    5e-07   Phanerochaete carnosa HHB-10118-sp
ref|XP_008035317.1|  hypothetical protein TRAVEDRAFT_162312           58.5    5e-07   Trametes versicolor FP-101664 SS1
gb|KIJ70440.1|  hypothetical protein HYDPIDRAFT_23545                 59.3    5e-07   Hydnomerulius pinastri MD-312
gb|KIM67789.1|  hypothetical protein SCLCIDRAFT_1070521               57.8    7e-07   Scleroderma citrinum Foug A
gb|KIY72989.1|  hypothetical protein CYLTODRAFT_366806                57.8    7e-07   Cylindrobasidium torrendii FP15055 ss-10
dbj|GAA96706.1|  hypothetical protein E5Q_03377                       57.8    9e-07   Mixia osmundae IAM 14324
ref|XP_006956786.1|  hypothetical protein WALSEDRAFT_35907            57.0    1e-06   Wallemia mellicola CBS 633.66
ref|XP_001874754.1|  predicted protein                                57.0    1e-06   Laccaria bicolor S238N-H82
ref|XP_007768137.1|  hypothetical protein CONPUDRAFT_89908            57.8    2e-06   Coniophora puteana RWD-64-598 SS2
ref|XP_004336468.1|  Peroxisome assembly protein, putative            56.6    2e-06   Acanthamoeba castellanii str. Neff
emb|CCV00693.1|  unnamed protein product                              56.2    3e-06   Malassezia sympodialis ATCC 42132
ref|XP_001416251.1|  predicted protein                                56.2    3e-06   Ostreococcus lucimarinus CCE9901
ref|XP_001837408.2|  cyclin-dependent protein kinase inhibitor        56.6    3e-06   Coprinopsis cinerea okayama7#130
ref|XP_001730763.1|  hypothetical protein MGL_1762                    56.2    3e-06   Malassezia globosa CBS 7966
ref|XP_007381803.1|  hypothetical protein PUNSTDRAFT_64646            55.8    3e-06   Punctularia strigosozonata HHB-11173 SS5
gb|KIK65606.1|  hypothetical protein GYMLUDRAFT_159297                55.8    3e-06   Gymnopus luxurians FD-317 M1
gb|KIJ19886.1|  hypothetical protein PAXINDRAFT_126111                55.8    3e-06   Paxillus involutus ATCC 200175
gb|KIK08483.1|  hypothetical protein K443DRAFT_128386                 56.2    4e-06   Laccaria amethystina LaAM-08-1
gb|EPT02733.1|  hypothetical protein FOMPIDRAFT_55106                 55.5    4e-06   Fomitopsis pinicola FP-58527 SS1
ref|XP_011386209.1|  hypothetical protein UMAG_00297                  55.5    6e-06   Ustilago maydis 521
ref|XP_009543287.1|  peroxisome biosynthesis protein Pex12            55.1    6e-06   Heterobasidion irregulare TC 32-1
ref|XP_007846936.1|  cyclin-dependent protein kinase inhibitor        55.1    6e-06   
gb|KDQ14758.1|  hypothetical protein BOTBODRAFT_109632                55.1    8e-06   Botryobasidium botryosum FD-172 SS1
gb|EST09916.1|  hypothetical protein PSEUBRA_SCAF1g00349              55.1    8e-06   Kalmanozyma brasiliensis GHG001
ref|XP_007366127.1|  hypothetical protein DICSQDRAFT_60738            54.7    9e-06   Dichomitus squalens LYAD-421 SS1
gb|KFH68350.1|  hypothetical protein MVEG_05168                       54.7    9e-06   Mortierella verticillata NRRL 6337
gb|KIL68228.1|  hypothetical protein M378DRAFT_158769                 54.7    9e-06   Amanita muscaria Koide BX008
ref|XP_009267356.1|  Peroxisome assembly protein 12                   54.3    1e-05   Wallemia ichthyophaga EXF-994
gb|KJA24572.1|  hypothetical protein HYPSUDRAFT_136134                55.1    1e-05   Hypholoma sublateritium FD-334 SS-4
gb|KIN95684.1|  hypothetical protein M404DRAFT_1007286                54.3    1e-05   Pisolithus tinctorius Marx 270
emb|CCF54025.1|  related to Peroxisome assembly protein 12            54.3    1e-05   Ustilago hordei
ref|XP_007315338.1|  hypothetical protein SERLADRAFT_347438           54.3    1e-05   Serpula lacrymans var. lacrymans S7.9
ref|XP_002679960.1|  predicted protein                                53.5    2e-05   Naegleria gruberi strain NEG-M
gb|KIK99683.1|  hypothetical protein PAXRUDRAFT_131479                53.9    2e-05   Paxillus rubicundulus Ve08.2h10
gb|KDE02774.1|  hypothetical protein MVLG_06696                       53.5    2e-05   Microbotryum lychnidis-dioicae p1A1 Lamole
gb|KIM33527.1|  hypothetical protein M408DRAFT_14226                  53.1    3e-05   Serendipita vermifera MAFF 305830
emb|CBQ67699.1|  related to Peroxisome assembly protein 12            53.1    3e-05   Sporisorium reilianum SRZ2
emb|CDI51245.1|  related to Peroxisome assembly protein 12            53.1    4e-05   Melanopsichium pennsylvanicum 4
gb|KIM45907.1|  hypothetical protein M413DRAFT_23717                  53.1    4e-05   Hebeloma cylindrosporum h7
emb|CEG01249.1|  Peroxisome assembly protein 12                       52.4    5e-05   Ostreococcus tauri
ref|XP_003080059.1|  PEXC_ARATH Putative peroxisome assembly prot...  52.4    5e-05   
emb|CEG78635.1|  hypothetical protein RMATCC62417_13211               52.0    6e-05   Rhizopus microsporus
gb|EHK22226.1|  hypothetical protein TRIVIDRAFT_60901                 52.4    6e-05   Trichoderma virens Gv29-8
ref|XP_006962351.1|  predicted protein                                52.4    6e-05   Trichoderma reesei QM6a
emb|CEJ02808.1|  hypothetical protein RMCBS344292_16802               52.4    7e-05   Rhizopus microsporus
emb|CEJ02807.1|  hypothetical protein RMCBS344292_16802               52.4    7e-05   Rhizopus microsporus
gb|KDR83451.1|  hypothetical protein GALMADRAFT_274898                52.4    7e-05   Galerina marginata CBS 339.88
emb|CEG73332.1|  hypothetical protein RMATCC62417_08737               52.0    8e-05   Rhizopus microsporus
emb|CEI88974.1|  hypothetical protein RMCBS344292_03350               52.0    8e-05   Rhizopus microsporus
gb|KIK30837.1|  hypothetical protein PISMIDRAFT_639813                51.6    9e-05   Pisolithus microcarpus 441
gb|ETS63546.1|  hypothetical protein PaG_01841                        51.6    9e-05   Moesziomyces aphidis DSM 70725
dbj|GAK62373.1|  cyclin-dependent protein kinase inhibitor            51.6    1e-04   Moesziomyces antarcticus
emb|CCA68004.1|  related to Peroxisome assembly protein 12            51.2    1e-04   Serendipita indica DSM 11827
gb|KDQ29036.1|  hypothetical protein PLEOSDRAFT_1082916               51.6    1e-04   Pleurotus ostreatus PC15
dbj|GAC73527.1|  sphingomyelinase family protein                      51.2    2e-04   Moesziomyces antarcticus T-34
emb|CCM04807.1|  predicted protein                                    51.2    2e-04   Fibroporia radiculosa
gb|EIE91399.1|  hypothetical protein RO3G_16110                       50.4    2e-04   Rhizopus delemar RA 99-880
ref|XP_007876351.1|  hypothetical protein PFL1_00667                  50.4    3e-04   Anthracocystis flocculosa PF-1
emb|CCO27005.1|  Ankyrin repeat protein nuc-2                         50.4    3e-04   Rhizoctonia solani AG-1 IB
emb|CEL57860.1|  Peroxisome assembly protein 12 OS=Emericella nid...  50.1    3e-04   Rhizoctonia solani AG-1 IB
gb|EMD86253.1|  hypothetical protein COCHEDRAFT_1023980               49.7    3e-04   Bipolaris maydis C5
ref|XP_007807711.1|  peroxisome biosynthesis protein (PAS10/Perox...  50.1    4e-04   Metarhizium acridum CQMa 102
gb|KIW03350.1|  hypothetical protein PV09_05558                       50.1    4e-04   Verruconis gallopava
dbj|GAC95602.1|  hypothetical protein PHSY_003178                     50.1    4e-04   Pseudozyma hubeiensis SY62
ref|XP_007831053.1|  hypothetical protein PFICI_04281                 49.7    4e-04   Pestalotiopsis fici W106-1
emb|CDS04175.1|  hypothetical protein LRAMOSA07130                    49.7    5e-04   Lichtheimia ramosa
emb|CEP19375.1|  hypothetical protein                                 49.7    5e-04   Parasitella parasitica
gb|EHK43268.1|  hypothetical protein TRIATDRAFT_301162                49.7    5e-04   Trichoderma atroviride IMI 206040
emb|CDH49798.1|  related to peroxisome assembly protein 12            49.7    5e-04   Lichtheimia corymbifera JMRC:FSU:9682
dbj|GAN08985.1|  cyclin-dependent protein kinase inhibitor            48.9    7e-04   Mucor ambiguus
ref|XP_003305125.1|  hypothetical protein PTT_17874                   48.9    8e-04   
ref|XP_005704433.1|  peroxisomal membrane protein PEX12               48.9    8e-04   Galdieria sulphuraria
ref|XP_001942414.1|  peroxisome assembly protein 12                   48.9    8e-04   Pyrenophora tritici-repentis Pt-1C-BFP
gb|EUN27740.1|  hypothetical protein COCVIDRAFT_97438                 49.3    8e-04   Bipolaris victoriae FI3
ref|XP_007707512.1|  hypothetical protein COCCADRAFT_83746            49.3    9e-04   Bipolaris zeicola 26-R-13
ref|XP_007692979.1|  hypothetical protein COCMIDRAFT_108653           49.3    9e-04   Bipolaris oryzae ATCC 44560
ref|XP_008024804.1|  hypothetical protein SETTUDRAFT_150591           49.3    9e-04   Exserohilum turcica Et28A
gb|ENI06200.1|  hypothetical protein COCC4DRAFT_166382                48.9    0.001   Bipolaris maydis ATCC 48331



>emb|CDP00005.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLPSSLRAAL+YSLGVLA+RR F+HKILD+EDEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALTYSLGVLALRRPFIHKILDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASFA
Sbjct  61   LVLETHSLRTTDASFA  76



>ref|XP_010102209.1| Peroxisome biogenesis protein 12 [Morus notabilis]
 gb|EXB93152.1| Peroxisome biogenesis protein 12 [Morus notabilis]
Length=364

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR FLHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSVGVLALRRPFLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASFA
Sbjct  61   LVLETHSLRTTDASFA  76



>ref|XP_011084263.1| PREDICTED: peroxisome biogenesis protein 12 [Sesamum indicum]
Length=392

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLPSSLRAAL+YSLGV A+RR F+HKILD+EDEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALTYSLGVFALRRPFVHKILDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASFA
Sbjct  61   LVLETHSLRTTDASFA  76



>gb|EYU33166.1| hypothetical protein MIMGU_mgv1a007843mg [Erythranthe guttata]
Length=393

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLPSSLRAAL+YS GV A+RRSF+HKILD+EDEFF+LLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALTYSFGVFALRRSFIHKILDYEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASFA
Sbjct  61   LVLETHSLRTTDASFA  76



>dbj|BAH09867.1| peroxin 12 [Nicotiana tabacum]
Length=393

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLPSSLRAAL+YSLGVLA+RR F+HKILD+EDE FALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALTYSLGVLALRRPFIHKILDYEDECFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+D SFA
Sbjct  61   LVLETHSLRTTDGSFA  76



>ref|XP_009623923.1| PREDICTED: peroxisome biogenesis protein 12 [Nicotiana tomentosiformis]
Length=393

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLPSSLRAAL+YSLGVLA+RR F+HKILD+EDE FALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALTYSLGVLALRRPFIHKILDYEDECFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+D SFA
Sbjct  61   LVLETHSLRTTDGSFA  76



>ref|XP_010043306.1| PREDICTED: peroxisome biogenesis protein 12 [Eucalyptus grandis]
 gb|KCW85314.1| hypothetical protein EUGRSUZ_B02154 [Eucalyptus grandis]
Length=393

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP SLRAAL+YS+GVLA+RR FLHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPGSLRAALTYSVGVLALRRPFLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE+HSLRT+DASF+
Sbjct  61   LVLESHSLRTTDASFS  76



>ref|XP_007030377.1| Peroxin-12 [Theobroma cacao]
 gb|EOY10879.1| Peroxin-12 [Theobroma cacao]
Length=393

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEMAAAQQLPSSLR AL+YS+GVLA+RR FLHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMAAAQQLPSSLRGALTYSIGVLALRRPFLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>ref|XP_011038487.1| PREDICTED: peroxisome biogenesis protein 12-like isoform X2 [Populus 
euphratica]
Length=393

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GV+A+RR FLHK+LD EDEFF+LLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVMALRRPFLHKVLDCEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASFA
Sbjct  61   LVLETHSLRTTDASFA  76



>ref|XP_011036329.1| PREDICTED: peroxisome biogenesis protein 12-like [Populus euphratica]
Length=388

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR FLHK+LD EDEFF+LLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPFLHKVLDHEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>ref|XP_002319659.1| peroxisome assembly protein 12 [Populus trichocarpa]
 gb|EEE95582.1| peroxisome assembly protein 12 [Populus trichocarpa]
Length=393

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GV+A+RR FLHK+LD EDEFF+LLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVMALRRPFLHKVLDCEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASFA
Sbjct  61   LVLETHSLRTTDASFA  76



>ref|XP_004152815.1| PREDICTED: peroxisome biogenesis protein 12-like [Cucumis sativus]
 ref|XP_004155107.1| PREDICTED: peroxisome biogenesis protein 12-like [Cucumis sativus]
 gb|KGN61284.1| hypothetical protein Csa_2G075430 [Cucumis sativus]
Length=393

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR F HK+LD+EDEFF+LLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPFFHKVLDYEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>ref|XP_002325774.1| peroxisome assembly protein 12 [Populus trichocarpa]
 gb|EEF00156.1| peroxisome assembly protein 12 [Populus trichocarpa]
Length=388

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR FLHK+LD EDEFF+LLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPFLHKVLDHEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>ref|XP_009779830.1| PREDICTED: peroxisome biogenesis protein 12 [Nicotiana sylvestris]
Length=393

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLPSSLRAAL+YSLGVLA+RR  +HKILD+EDE FALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALTYSLGVLALRRPLIHKILDYEDECFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+D SFA
Sbjct  61   LVLETHSLRTTDGSFA  76



>ref|XP_008441822.1| PREDICTED: peroxisome biogenesis protein 12 [Cucumis melo]
Length=393

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR F HK+LD+EDEFF+LLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPFFHKVLDYEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>ref|XP_004239752.1| PREDICTED: peroxisome biogenesis protein 12 [Solanum lycopersicum]
Length=393

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLPSSLRAAL+YSLGVLA+RR F+HKILD+EDE FALL 
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALTYSLGVLALRRPFIHKILDYEDECFALLT  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+D SFA
Sbjct  61   LVLETHSLRTTDGSFA  76



>ref|XP_006345902.1| PREDICTED: peroxisome biogenesis protein 12-like [Solanum tuberosum]
Length=393

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLPSSLRAAL+YSLGVLA+RR F+HKILD+EDE FALL 
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALTYSLGVLALRRPFIHKILDYEDECFALLT  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+D SFA
Sbjct  61   LVLETHSLRTTDGSFA  76



>ref|XP_008370751.1| PREDICTED: peroxisome biogenesis protein 12-like [Malus domestica]
Length=394

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR FLH++LD+EDEFF+LLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPFLHRVLDYEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>ref|XP_008218344.1| PREDICTED: peroxisome biogenesis protein 12 [Prunus mume]
Length=393

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR FLH++LD+EDEFF+LLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPFLHRVLDYEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>ref|XP_006442641.1| hypothetical protein CICLE_v10024089mg, partial [Citrus clementina]
 gb|ESR55881.1| hypothetical protein CICLE_v10024089mg, partial [Citrus clementina]
Length=370

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAA++YS+GVLA+RR FLHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAAVTYSVGVLALRRPFLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LETHSLR +DASF+
Sbjct  61   LILETHSLRNTDASFS  76



>ref|XP_011038486.1| PREDICTED: peroxisome biogenesis protein 12-like isoform X1 [Populus 
euphratica]
Length=434

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GV+A+RR FLHK+LD EDEFF+LLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVMALRRPFLHKVLDCEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASFA
Sbjct  61   LVLETHSLRTTDASFA  76



>ref|XP_007205312.1| hypothetical protein PRUPE_ppa006828mg [Prunus persica]
 gb|EMJ06511.1| hypothetical protein PRUPE_ppa006828mg [Prunus persica]
Length=393

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR FLH++LD+EDEFF+LLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPFLHRVLDYEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>gb|KDO45425.1| hypothetical protein CISIN_1g0162131mg, partial [Citrus sinensis]
Length=370

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAA++YS+GVLA+RR FLHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAAVTYSVGVLALRRPFLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LETHSLR +DASF+
Sbjct  61   LILETHSLRNTDASFS  76



>ref|XP_006297857.1| hypothetical protein CARUB_v10013898mg [Capsella rubella]
 gb|EOA30755.1| hypothetical protein CARUB_v10013898mg [Capsella rubella]
Length=386

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEFFA LM
Sbjct  1    MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFFAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+DASFA
Sbjct  61   LILEGHSLRTTDASFA  76



>ref|XP_010463922.1| PREDICTED: peroxisome biogenesis protein 12-like [Camelina sativa]
Length=393

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEFFA LM
Sbjct  1    MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFFAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+DASFA
Sbjct  61   LILEGHSLRTTDASFA  76



>ref|XP_006297858.1| hypothetical protein CARUB_v10013898mg [Capsella rubella]
 gb|EOA30756.1| hypothetical protein CARUB_v10013898mg [Capsella rubella]
Length=393

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEFFA LM
Sbjct  1    MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFFAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+DASFA
Sbjct  61   LILEGHSLRTTDASFA  76



>ref|XP_004302102.1| PREDICTED: peroxisome biogenesis protein 12 [Fragaria vesca subsp. 
vesca]
Length=393

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR FLH++LD+EDEFFA LM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSVGVLALRRPFLHRVLDYEDEFFAFLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>ref|XP_010485821.1| PREDICTED: LOW QUALITY PROTEIN: peroxisome biogenesis protein 
12-like [Camelina sativa]
Length=393

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEFFA LM
Sbjct  1    MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFFAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+DASFA
Sbjct  61   LILEGHSLRTTDASFA  76



>ref|XP_010415110.1| PREDICTED: peroxisome biogenesis protein 12-like [Camelina sativa]
Length=393

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEFFA LM
Sbjct  1    MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFFAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+DASFA
Sbjct  61   LILEGHSLRTTDASFA  76



>ref|XP_002521990.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40394.1| conserved hypothetical protein [Ricinus communis]
Length=393

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR  LHK+LD+EDEFFAL M
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPTSLRAALTYSIGVLALRRPLLHKVLDYEDEFFALFM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>ref|XP_010264914.1| PREDICTED: peroxisome biogenesis protein 12 [Nelumbo nucifera]
Length=393

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR FLHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPFLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            ++LE HSLRT+DASF+
Sbjct  61   MILEGHSLRTTDASFS  76



>ref|XP_002882351.1| peroxin-12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58610.1| peroxin-12 [Arabidopsis lyrata subsp. lyrata]
Length=393

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEFFA LM
Sbjct  1    MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFFAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+DASFA
Sbjct  61   LILEGHSLRTTDASFA  76



>gb|KJB44821.1| hypothetical protein B456_007G274800 [Gossypium raimondii]
Length=377

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEMAAAQQLP+SLR AL+YS+GVLA+RR FLHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMAAAQQLPASLRGALTYSIGVLALRRPFLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLR +DASF+
Sbjct  61   LVLETHSLRNTDASFS  76



>gb|KFK37861.1| hypothetical protein AALP_AA3G038800 [Arabis alpina]
Length=393

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEFFA LM
Sbjct  1    MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFFASLM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+DASFA
Sbjct  61   LILEGHSLRTTDASFA  76



>gb|KDP23725.1| hypothetical protein JCGZ_23558 [Jatropha curcas]
Length=387

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR  LHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPLLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLR +DASF+
Sbjct  61   LVLETHSLRITDASFS  76



>gb|EPS64416.1| peroxin 12, partial [Genlisea aurea]
Length=329

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 1/77 (1%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG GTRPTFFEMAAAQQLPSSLR+AL+YSLGVLA+RR F+HKILD+EDEFFALLM
Sbjct  1    MLFQVGGLGTRPTFFEMAAAQQLPSSLRSALTYSLGVLALRRPFIHKILDYEDEFFALLM  60

Query  520  LVLETHSLRTS-DASFA  567
            LVLETHSLRTS DASFA
Sbjct  61   LVLETHSLRTSADASFA  77



>ref|XP_006470919.1| PREDICTED: peroxisome biogenesis protein 12-like [Citrus sinensis]
Length=393

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAA++YS+GVLA+RR FLHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGKGTRPTFFEMAAAQQLPASLRAAVTYSVGVLALRRPFLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLR +DASF+
Sbjct  61   LVLETHSLRNTDASFS  76



>ref|XP_008785165.1| PREDICTED: peroxisome biogenesis protein 12 [Phoenix dactylifera]
Length=394

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RR FLHK+LD++DEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRPFLHKVLDYDDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            +VLE+HSLRT+DASF+
Sbjct  61   MVLESHSLRTTDASFS  76



>gb|KJB44819.1| hypothetical protein B456_007G274800 [Gossypium raimondii]
Length=392

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEMAAAQQLP+SLR AL+YS+GVLA+RR FLHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMAAAQQLPASLRGALTYSIGVLALRRPFLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLR +DASF+
Sbjct  61   LVLETHSLRNTDASFS  76



>ref|XP_010549665.1| PREDICTED: peroxisome biogenesis protein 12 [Tarenaya hassleriana]
Length=393

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RR FLHKILD+EDEFFA+LM
Sbjct  1    MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRPFLHKILDYEDEFFAVLM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+DASFA
Sbjct  61   LILEGHSLRTTDASFA  76



>ref|XP_009343773.1| PREDICTED: peroxisome biogenesis protein 12 [Pyrus x bretschneideri]
Length=394

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQ+GGQGTRPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR FLH++LD+EDEFF+LLM
Sbjct  1    MLFQLGGQGTRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPFLHRVLDYEDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>gb|AAF63777.1| unknown protein [Arabidopsis thaliana]
Length=372

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEFFA LM
Sbjct  1    MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFFAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+D SFA
Sbjct  61   LILEGHSLRTTDGSFA  76



>ref|XP_010920305.1| PREDICTED: peroxisome biogenesis protein 12-like isoform X2 [Elaeis 
guineensis]
Length=374

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RR FLHK+LD++DEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRPFLHKVLDYDDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            +VLE HSLRT+DASF+
Sbjct  61   MVLEAHSLRTTDASFS  76



>ref|XP_009123989.1| PREDICTED: LOW QUALITY PROTEIN: peroxisome biogenesis protein 
12 [Brassica rapa]
Length=412

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG GTRPTFFEMAAAQQLPSSLRAAL+YSLGV A+RRSFLH+ILD+EDEFFA LM
Sbjct  1    MLFQVGGDGTRPTFFEMAAAQQLPSSLRAALTYSLGVFALRRSFLHRILDYEDEFFAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+DASFA
Sbjct  61   LILEGHSLRTTDASFA  76



>emb|CDX92069.1| BnaC03g33710D [Brassica napus]
Length=389

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEF+A LM
Sbjct  1    MLFQVGGDGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFYAALM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE HSLRT+DASFA
Sbjct  61   LVLEGHSLRTTDASFA  76



>ref|NP_187096.2| Peroxisome biogenesis protein 12 [Arabidopsis thaliana]
 sp|Q9M841.2|PEX12_ARATH RecName: Full=Peroxisome biogenesis protein 12; AltName: Full=Peroxin-12; 
Short=AtPEX12; AltName: Full=Pex12p; AltName: Full=Protein 
ABERRANT PEROXISOME MORPHOLOGY 4 [Arabidopsis thaliana]
 gb|AEE74085.1| Peroxisome biogenesis protein 12 [Arabidopsis thaliana]
Length=393

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEFFA LM
Sbjct  1    MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFFAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+D SFA
Sbjct  61   LILEGHSLRTTDGSFA  76



>ref|XP_010920304.1| PREDICTED: peroxisome biogenesis protein 12-like isoform X1 [Elaeis 
guineensis]
Length=394

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RR FLHK+LD++DEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRPFLHKVLDYDDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            +VLE HSLRT+DASF+
Sbjct  61   MVLEAHSLRTTDASFS  76



>emb|CDX74190.1| BnaA03g28570D [Brassica napus]
Length=389

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEF+A LM
Sbjct  1    MLFQVGGDGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFYAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+DASFA
Sbjct  61   LILEGHSLRTTDASFA  76



>ref|XP_010675142.1| PREDICTED: peroxisome biogenesis protein 12 [Beta vulgaris subsp. 
vulgaris]
Length=393

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG+RPTFFEMAAAQQLPSSLRAAL+YSLGV+A+RR  LHK+LD+EDEFFA+LM
Sbjct  1    MLFQVGGQGSRPTFFEMAAAQQLPSSLRAALTYSLGVMALRRPILHKVLDYEDEFFAMLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLETHS+RT+DASF+
Sbjct  61   FVLETHSMRTTDASFS  76



>ref|XP_009134765.1| PREDICTED: peroxisome biogenesis protein 12 [Brassica rapa]
Length=389

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEF+A LM
Sbjct  1    MLFQVGGDGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFYAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+DASFA
Sbjct  61   LILEGHSLRTTDASFA  76



>ref|XP_009400186.1| PREDICTED: peroxisome biogenesis protein 12 [Musa acuminata subsp. 
malaccensis]
Length=394

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEMAAAQQLP+SLRAAL+YSLGV A+RR FLHK+LD++DEFF+LLM
Sbjct  1    MLFQVGGQGARPTFFEMAAAQQLPASLRAALTYSLGVFALRRPFLHKVLDYDDEFFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLETHSLRT+DASF+
Sbjct  61   LVLETHSLRTTDASFS  76



>ref|XP_006408186.1| hypothetical protein EUTSA_v10020878mg [Eutrema salsugineum]
 gb|ESQ49639.1| hypothetical protein EUTSA_v10020878mg [Eutrema salsugineum]
Length=395

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG+GTRPTFFEMAAAQQLP+SLRAAL+YSLGV A+RRSFLHKILD+EDEF+A LM
Sbjct  1    MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFYAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT+D+SFA
Sbjct  61   LILEGHSLRTTDSSFA  76



>emb|CDY42925.1| BnaC05g47260D [Brassica napus]
Length=345

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG GTRPTFFEMAAAQQLP+SLRA+L+YSLGV A+RRSFLH+ILD+EDEFFA LM
Sbjct  1    MLFQVGGDGTRPTFFEMAAAQQLPASLRASLTYSLGVFALRRSFLHRILDYEDEFFASLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE HSLRT+DASFA
Sbjct  61   LVLEGHSLRTTDASFA  76



>ref|XP_003554721.1| PREDICTED: peroxisome biogenesis protein 12-like [Glycine max]
Length=377

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG+RPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR FLHK+LDFEDE FALLM
Sbjct  1    MLFQVGGQGSRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPFLHKLLDFEDESFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE+H+LRT+DASF+
Sbjct  61   LVLESHTLRTTDASFS  76



>ref|XP_002264983.1| PREDICTED: peroxisome biogenesis protein 12 [Vitis vinifera]
 emb|CBI22341.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAAL+YS+GVLA+RR FLH++LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLRAALTYSIGVLALRRPFLHRVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE+HSLRT+DASF+
Sbjct  61   LVLESHSLRTTDASFS  76



>ref|XP_003521768.1| PREDICTED: peroxisome biogenesis protein 12-like [Glycine max]
 gb|KHN31492.1| Peroxisome biogenesis protein 12 [Glycine soja]
Length=386

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG+RPTFFEMAAAQQLP+SLRAAL+YS+GVLA+RR FLHK+LDFEDE FALLM
Sbjct  1    MLFQVGGQGSRPTFFEMAAAQQLPASLRAALTYSIGVLALRRPFLHKLLDFEDESFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE+H+LRT+DASF+
Sbjct  61   LVLESHTLRTTDASFS  76



>emb|CDY49338.1| BnaA05g33000D [Brassica napus]
Length=383

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG GTRPTFFEMAAAQQLPSSLRAAL+YSLGV A+RRSFLH+ILD+EDEF+A LM
Sbjct  1    MLFQVGGDGTRPTFFEMAAAQQLPSSLRAALTYSLGVFALRRSFLHRILDYEDEFYAALM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE HSLRT++ASFA
Sbjct  61   LILEGHSLRTTEASFA  76



>dbj|BAJ94128.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96836.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAALSYSLGV A+RR FLHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPTSLRAALSYSLGVFALRRPFLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLE+HSLRT+D SF+
Sbjct  61   SVLESHSLRTTDGSFS  76



>ref|XP_007147209.1| hypothetical protein PHAVU_006G104800g [Phaseolus vulgaris]
 gb|ESW19203.1| hypothetical protein PHAVU_006G104800g [Phaseolus vulgaris]
Length=386

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG+RPTFFEMAAAQQLP+SLR AL+YS+GVLA+RR FLHK+LDFEDE FALLM
Sbjct  1    MLFQVGGQGSRPTFFEMAAAQQLPASLRGALTYSIGVLALRRPFLHKLLDFEDESFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE+H+LRT+DASF+
Sbjct  61   LVLESHTLRTTDASFS  76



>ref|XP_010934246.1| PREDICTED: peroxisome biogenesis protein 12-like [Elaeis guineensis]
Length=394

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQGTRPTFFEMAAAQQLP SLRAAL+YSLGV A+R  FLHK+LD+ DEFFALLM
Sbjct  1    MLFQVGGQGTRPTFFEMAAAQQLPDSLRAALTYSLGVFALRMPFLHKVLDYNDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            +VLE+HSLRT+DASF+
Sbjct  61   MVLESHSLRTTDASFS  76



>gb|AAK27808.1|AC022457_11 putative peroxin [Oryza sativa Japonica Group]
Length=369

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAALSYSLGV A+RR  LHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLRAALSYSLGVFALRRPLLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLE+HSLRT+D SF+
Sbjct  61   AVLESHSLRTTDGSFS  76



>gb|EEC67134.1| hypothetical protein OsI_33961 [Oryza sativa Indica Group]
Length=394

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAALSYSLGV A+RR  LHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLRAALSYSLGVFALRRPLLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLE+HSLRT+D SF+
Sbjct  61   AVLESHSLRTTDGSFS  76



>ref|NP_001064809.1| Os10g0467200 [Oryza sativa Japonica Group]
 gb|ABB47772.1| Pex2/Pex12 amino terminal region family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26723.1| Os10g0467200 [Oryza sativa Japonica Group]
 dbj|BAG92395.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51106.1| hypothetical protein OsJ_31837 [Oryza sativa Japonica Group]
Length=394

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAALSYSLGV A+RR  LHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLRAALSYSLGVFALRRPLLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLE+HSLRT+D SF+
Sbjct  61   AVLESHSLRTTDGSFS  76



>ref|XP_003574027.1| PREDICTED: peroxisome biogenesis protein 12 [Brachypodium distachyon]
Length=394

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAAL+YSLGV A+RR FLH ILD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLRAALTYSLGVFALRRPFLHNILDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLE+HSLRT+D SF+
Sbjct  61   AVLESHSLRTTDGSFS  76



>ref|XP_004497382.1| PREDICTED: peroxisome biogenesis protein 12-like isoform X2 [Cicer 
arietinum]
Length=379

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG+RPTFFEMAAA+QLP SLRAAL+YS+GVLA+RR FLH+ LD+EDE FALLM
Sbjct  1    MLFQVGGQGSRPTFFEMAAAEQLPRSLRAALTYSIGVLALRRPFLHRFLDYEDESFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE HSLRT+DASF+
Sbjct  61   LVLEAHSLRTTDASFS  76



>ref|XP_004497381.1| PREDICTED: peroxisome biogenesis protein 12-like isoform X1 [Cicer 
arietinum]
Length=387

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG+RPTFFEMAAA+QLP SLRAAL+YS+GVLA+RR FLH+ LD+EDE FALLM
Sbjct  1    MLFQVGGQGSRPTFFEMAAAEQLPRSLRAALTYSIGVLALRRPFLHRFLDYEDESFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE HSLRT+DASF+
Sbjct  61   LVLEAHSLRTTDASFS  76



>ref|XP_004982920.1| PREDICTED: peroxisome biogenesis protein 12-like isoform X1 [Setaria 
italica]
Length=401

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAAL+YSLGV A+RR  LHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLRAALTYSLGVFALRRPLLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLE+HSLRT+D SF+
Sbjct  61   GVLESHSLRTTDGSFS  76



>ref|XP_004982921.1| PREDICTED: peroxisome biogenesis protein 12-like isoform X2 [Setaria 
italica]
Length=393

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAAL+YSLGV A+RR  LHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLRAALTYSLGVFALRRPLLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLE+HSLRT+D SF+
Sbjct  61   GVLESHSLRTTDGSFS  76



>ref|XP_002467112.1| hypothetical protein SORBIDRAFT_01g019750 [Sorghum bicolor]
 gb|EER94110.1| hypothetical protein SORBIDRAFT_01g019750 [Sorghum bicolor]
Length=394

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAAL+YSLGV A+RR  LHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLRAALTYSLGVFALRRPLLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLE+HSLRT+D SF+
Sbjct  61   GVLESHSLRTTDGSFS  76



>ref|XP_006661848.1| PREDICTED: peroxisome biogenesis protein 12-like [Oryza brachyantha]
Length=394

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SL AALSYSLGV A+RR  LHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLHAALSYSLGVFALRRPILHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLE+HSLRT+D SF+
Sbjct  61   AVLESHSLRTTDGSFS  76



>gb|EMS56254.1| Peroxisome biogenesis protein 12 [Triticum urartu]
Length=395

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAALSYS GV A+RR  LHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLRAALSYSFGVFALRRPSLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLE+HSLRT+D SF+
Sbjct  61   SVLESHSLRTTDGSFS  76



>ref|XP_006857493.1| hypothetical protein AMTR_s00067p00205070 [Amborella trichopoda]
 gb|ERN18960.1| hypothetical protein AMTR_s00067p00205070 [Amborella trichopoda]
Length=391

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGG G RPTFFEMAA QQLP SLRAAL+YS GVLA RR F HK+LD++DEFFA+LM
Sbjct  1    MLFQVGGHGKRPTFFEMAATQQLPPSLRAALTYSFGVLAQRRPFFHKVLDYDDEFFAMLM  60

Query  520  LVLETHSLRTSDASFA  567
            +VLETHSLRT++ASF+
Sbjct  61   IVLETHSLRTTEASFS  76



>ref|XP_009333955.1| PREDICTED: uncharacterized protein LOC103926801 [Pyrus x bretschneideri]
Length=270

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  334  RRMLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFAL  513
            ++MLFQ GGQGTRPTFFEM AAQQLP+SLRA L+YS+ VLA+RR FLH++LD+EDEFF+L
Sbjct  47   KKMLFQAGGQGTRPTFFEMEAAQQLPASLRATLTYSISVLALRRPFLHRVLDYEDEFFSL  106

Query  514  LMLVLETHSLRTS  552
            LMLVLETHSLRT+
Sbjct  107  LMLVLETHSLRTT  119



>gb|KEH44541.1| peroxisome biogenesis protein [Medicago truncatula]
Length=372

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG+RPTFFEMAAA+QLP SLRAAL+YS+GVLA+R  FLHK+LD+E E F+LLM
Sbjct  1    MLFQVGGQGSRPTFFEMAAAEQLPRSLRAALTYSIGVLALRTPFLHKLLDYEHESFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE HSLRT+DASF+
Sbjct  61   LVLEAHSLRTTDASFS  76



>ref|XP_003592818.1| Peroxisome assembly protein [Medicago truncatula]
 gb|AES63069.1| peroxisome biogenesis protein [Medicago truncatula]
Length=370

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG+RPTFFEMAAA+QLP SLRAAL+YS+GVLA+R  FLHK+LD+E E F+LLM
Sbjct  1    MLFQVGGQGSRPTFFEMAAAEQLPRSLRAALTYSIGVLALRTPFLHKLLDYEHESFSLLM  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE HSLRT+DASF+
Sbjct  61   LVLEAHSLRTTDASFS  76



>ref|XP_008664901.1| PREDICTED: peroxisome biogenesis protein 12 [Zea mays]
 tpg|DAA49704.1| TPA: putative peroxisome assembly protein [Zea mays]
Length=394

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAAL+YSLGV A+RR  LH +LD+ED+FFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLRAALTYSLGVFALRRPLLHTVLDYEDDFFALLM  60

Query  520  LVLETHSLRTSDASFA  567
             VLE+HSLRT+D SF+
Sbjct  61   GVLESHSLRTTDGSFS  76



>gb|AFK38181.1| unknown [Medicago truncatula]
Length=217

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG+RPTFFEMAAA+QLP SLRAAL+YS+GVLA+R  FLHK+LD+E E F+LL+
Sbjct  1    MLFQVGGQGSRPTFFEMAAAEQLPRSLRAALTYSIGVLALRTPFLHKLLDYEHESFSLLV  60

Query  520  LVLETHSLRTSDASFA  567
            LVLE HSLRT+D SF+
Sbjct  61   LVLEAHSLRTTDVSFS  76



>gb|EMT11947.1| Peroxisome assembly protein 12 [Aegilops tauschii]
Length=364

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG RPTFFEM+AAQQLP+SLRAALSYS GV A+RR  LHK+LD+EDEFFALLM
Sbjct  1    MLFQVGGQGARPTFFEMSAAQQLPASLRAALSYSFGVFALRRPSLHKVLDYEDEFFALLM  60

Query  520  LVLETHSLRTSDAS  561
             VLE+HSLRT+  S
Sbjct  61   SVLESHSLRTTGYS  74



>gb|KHN43165.1| Peroxisome biogenesis protein 12 [Glycine soja]
Length=373

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 70/76 (92%), Gaps = 4/76 (5%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            MLFQVGGQG+RPTFFEMA    LP+SLRAAL+YS+GVLA+RR FLHK+LDFEDE FALLM
Sbjct  1    MLFQVGGQGSRPTFFEMA----LPASLRAALTYSIGVLALRRPFLHKLLDFEDESFALLM  56

Query  520  LVLETHSLRTSDASFA  567
            LVLE+H+LRT+DASF+
Sbjct  57   LVLESHTLRTTDASFS  72



>ref|XP_002983224.1| hypothetical protein SELMODRAFT_155680 [Selaginella moellendorffii]
 gb|EFJ15566.1| hypothetical protein SELMODRAFT_155680 [Selaginella moellendorffii]
Length=376

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            ML QVGG+G RPTFFEM AAQQLP SLRAAL YSLGV+A RR  +H++LD+ DEFFA LM
Sbjct  1    MLMQVGGEGDRPTFFEMVAAQQLPESLRAALMYSLGVIAQRRPIVHRVLDYSDEFFAFLM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE H++RT+DASFA
Sbjct  61   LILEAHNVRTADASFA  76



>ref|XP_002961339.1| hypothetical protein SELMODRAFT_437729 [Selaginella moellendorffii]
 gb|EFJ38878.1| hypothetical protein SELMODRAFT_437729 [Selaginella moellendorffii]
Length=376

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            ML QVGG+G RPTFFEM AAQQLP SLRAAL YSLGV+A RR  +H++LD+ DEFFA LM
Sbjct  1    MLMQVGGEGDRPTFFEMVAAQQLPESLRAALMYSLGVIAQRRPIVHRVLDYSDEFFAFLM  60

Query  520  LVLETHSLRTSDASFA  567
            L+LE H++RT+DASFA
Sbjct  61   LILEAHNVRTADASFA  76



>ref|XP_001757098.1| predicted protein [Physcomitrella patens]
 gb|EDQ77957.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            ML QVGG G RPTFFEM+A + LP+SLRAAL Y LGV+A RR  LH++LDF DE +A LM
Sbjct  1    MLMQVGGDGARPTFFEMSATEHLPTSLRAALLYFLGVMAQRRPILHRVLDFSDEGYAALM  60

Query  520  LVLETHSLRTSDASFA  567
             +LE HSL+T+D+SFA
Sbjct  61   FLLEFHSLKTTDSSFA  76



>ref|XP_005651067.1| hypothetical protein COCSUDRAFT_39598 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26523.1| hypothetical protein COCSUDRAFT_39598 [Coccomyxa subellipsoidea 
C-169]
Length=384

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQG-TRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLMLVL  528
            VGG G TRPTFFE+ AA +L  SLRAA+ YSL V A RR  LH++LD+EDEFFAL+   L
Sbjct  6    VGGDGSTRPTFFELIAADRLMPSLRAAVIYSLSVFAQRRPVLHRVLDWEDEFFALVTAFL  65

Query  529  ETHSLRTSDASFA  567
            +  SL  S A+FA
Sbjct  66   DRQSLANSSATFA  78



>ref|XP_002500916.1| peroxisomal protein importer family [Micromonas sp. RCC299]
 gb|ACO62174.1| peroxisomal protein importer family [Micromonas sp. RCC299]
Length=407

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            M FQV    +RPTFFE+ A  +L  SLRAAL YSL  LA RR  + +ILD E E FALLM
Sbjct  1    MQFQVDAGDSRPTFFELVATDRLVPSLRAALVYSLRTLAERRPGVTRILDHEAEAFALLM  60

Query  520  LVLETHSLRTSDASFA  567
            L++E HS  TSD S A
Sbjct  61   LLVEAHSFATSDGSLA  76



>ref|XP_002946144.1| hypothetical protein VOLCADRAFT_127336 [Volvox carteri f. nagariensis]
 gb|EFJ53139.1| hypothetical protein VOLCADRAFT_127336 [Volvox carteri f. nagariensis]
Length=424

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +1

Query  340  MLFQVGG-QGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALL  516
            M   +GG + ++PT+FE+ AA +L  SL+AA+ Y+L V + R  +++++L+++DE FALL
Sbjct  1    MFVHLGGDENSKPTYFEVIAADRLVPSLKAAVIYALSVFSQRHPWVYRLLNYDDEVFALL  60

Query  517  MLVLETHSLRTSDASFA  567
             LVL+ HSL +SD++F+
Sbjct  61   TLVLDGHSLLSSDSTFS  77



>ref|XP_011399801.1| Peroxisome assembly protein 12 [Auxenochlorella protothecoides]
 gb|KFM26853.1| Peroxisome assembly protein 12 [Auxenochlorella protothecoides]
Length=309

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGT-RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLMLVL  528
            VGG+ + RPTFFE+ AA +L  SL+AA++YSL V A RR  L ++LD EDE F L+   L
Sbjct  6    VGGEASSRPTFFELVAADRLLPSLKAAIAYSLSVYAQRRPSLLRLLDHEDELFFLISAWL  65

Query  529  ETHSLRTSDASFA  567
               SLR SDASFA
Sbjct  66   HRGSLRASDASFA  78



>ref|XP_003056078.1| peroxisomal protein importer family [Micromonas pusilla CCMP1545]
 gb|EEH59454.1| peroxisomal protein importer family [Micromonas pusilla CCMP1545]
Length=370

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLM  519
            M F V     RPTFFE+ AA +L SSLR+AL YS+ VL  RR     ILD EDE FA  M
Sbjct  1    MQFPVNASQQRPTFFELVAADRLVSSLRSALVYSMRVLVSRRPSSSWILDREDECFAAFM  60

Query  520  LVLETHSLRTSDASFA  567
             ++ETH+  TS+ S A
Sbjct  61   TLVETHAFATSNGSMA  76



>ref|XP_001696296.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP08273.1| predicted protein [Chlamydomonas reinhardtii]
Length=722

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +1

Query  340  MLFQVGG-QGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALL  516
            M   +GG + ++PT+FE+ AA +L  SL+AA+ Y+L V + R+ ++H++L+++DE FALL
Sbjct  1    MFVNLGGDESSKPTYFEVVAADRLVPSLKAAVIYALSVFSQRQPWVHRLLNYDDEVFALL  60

Query  517  MLVLETHSLRTSDASFA  567
             L L+ HSL ++D++F+
Sbjct  61   TLALDGHSLFSTDSTFS  77



>ref|XP_005849598.1| hypothetical protein CHLNCDRAFT_48657 [Chlorella variabilis]
 gb|EFN57496.1| hypothetical protein CHLNCDRAFT_48657 [Chlorella variabilis]
Length=392

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLMLVLET  534
            G  G RPTFFE+ AA++L  SL+AA+ YSL V A RR  LH +LD EDE F LL + L+ 
Sbjct  8    GDAGVRPTFFELVAAEKLMPSLKAAVLYSLSVYAQRRPALHHLLDREDELFFLLSMALDR  67

Query  535  HSLRTSDASFA  567
             +L  +  SFA
Sbjct  68   QALAANGGSFA  78



>gb|EMD40663.1| hypothetical protein CERSUDRAFT_45034 [Ceriporiopsis subvermispora 
B]
Length=374

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VGG  +RPT FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+ALLML +
Sbjct  7    VGGDTSRPTLFELVAQEQLRDLLQPALKYILAVFAQRYPRYLLRIVNRHEEFYALLMLFV  66

Query  529  ETHSLRTSDASFA  567
            E H LR   ASFA
Sbjct  67   ERHYLRRHGASFA  79



>ref|XP_006383517.1| hypothetical protein POPTR_0005s17810g [Populus trichocarpa]
 gb|ERP61314.1| hypothetical protein POPTR_0005s17810g [Populus trichocarpa]
Length=68

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  340  MLFQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGV  450
            MLFQVGG GTRPTFF+M AAQQL ++LRA L+YS+ +
Sbjct  1    MLFQVGGHGTRPTFFKMVAAQQLTATLRAGLTYSISI  37



>gb|KIZ01135.1| Peroxisome assembly protein 12 [Monoraphidium neglectum]
Length=386

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLMLVLET  534
            G  G++PTFFE+ AA +L  SLRAA+ YSL V   RR+++ ++L+ EDE  AL++L+L+ 
Sbjct  8    GDAGSKPTFFEVYAADKLVPSLRAAVIYSLSVFGQRRAWVQRLLEREDEVVALVVLLLDR  67

Query  535  HSLRTSDASFA  567
            HSLR  + +FA
Sbjct  68   HSLRALEGTFA  78



>gb|KDQ64948.1| hypothetical protein JAAARDRAFT_167744 [Jaapia argillacea MUCL 
33604]
Length=368

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +1

Query  349  QVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLV  525
             VGG   +P+ FE+ A +QL   L+ AL Y L V A R   +L ++++  +EF+AL+M  
Sbjct  6    NVGGDPLKPSLFELVAQEQLRDLLQPALKYVLSVFAQRYPRYLLRLVNRHEEFYALVMFF  65

Query  526  LETHSLRTSDASFA  567
            +E H LRT +ASFA
Sbjct  66   VERHYLRTHNASFA  79



>ref|XP_007337748.1| hypothetical protein AURDEDRAFT_52475 [Auricularia delicata TFB-10046 
SS5]
 gb|EJD53924.1| hypothetical protein AURDEDRAFT_52475 [Auricularia delicata TFB-10046 
SS5]
Length=364

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A +QL   L+ AL Y L VLA R   +L +I++  +EF+AL+ML +E H LR
Sbjct  13   RPSIFELVAQEQLRDLLQPALKYVLSVLAQRNPRYLLRIVNRHEEFYALIMLYVEQHYLR  72

Query  547  TSDASFA  567
            T  ASFA
Sbjct  73   TRGASFA  79



>gb|KIM83837.1| hypothetical protein PILCRDRAFT_782063 [Piloderma croceum F 1598]
Length=378

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            +GG   +P+ FE+ A +QL   L+ AL Y L V A R   +L ++++  +EF+AL+ML +
Sbjct  7    IGGDPLKPSLFELVAQEQLRDLLQPALKYVLAVFAQRYPRYLLRLVNRHEEFYALIMLFV  66

Query  529  ETHSLRTSDASFA  567
            E H LR  DASF+
Sbjct  67   ERHYLRKYDASFS  79



>ref|XP_003038254.1| hypothetical protein SCHCODRAFT_49720 [Schizophyllum commune 
H4-8]
 gb|EFJ03352.1| hypothetical protein SCHCODRAFT_49720 [Schizophyllum commune 
H4-8]
Length=372

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLE  531
            GG   +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+AL+ML++E
Sbjct  8    GGDPLKPSIFELVAQEQLRDLLQPALKYVLAVFAQRYPRYLIRIVNRHEEFYALIMLIVE  67

Query  532  THSLRTSDASFA  567
             + LR  +ASFA
Sbjct  68   RYYLRKHNASFA  79



>emb|CDY30578.1| BnaC07g04030D [Brassica napus]
Length=231

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  460  RRSFLHKILDFEDEFFALLMLVLETHSLRTSDASFA  567
            RRSFLHKILD+EDEFFA LML+LE HSLRT+   FA
Sbjct  70   RRSFLHKILDYEDEFFAALMLILEGHSLRTTYVLFA  105



>gb|EFA82231.1| RING zinc finger-containing protein [Polysphondylium pallidum 
PN500]
Length=390

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLMLVLET  534
             G   RP+FFEM A  Q+  S + AL Y   VL+ R S    I+ + DEFF  ++L+LE 
Sbjct  11   NGDPNRPSFFEMFAQHQMMPSFKPALKYIFTVLSQRNSKFEIIVKYHDEFFYSMLLLLEY  70

Query  535  HSLRTSDASFA  567
            H L+  + SF+
Sbjct  71   HYLKYYEGSFS  81



>gb|KIK43217.1| hypothetical protein CY34DRAFT_804074 [Suillus luteus UH-Slu-Lm8-n1]
Length=369

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VGG   +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A +ML +
Sbjct  7    VGGDPLKPSLFELVAQEQLRDLLQPALKYVLAVFAQRYPRYLIRIVNRHEEFYAFIMLFV  66

Query  529  ETHSLRTSDASFA  567
            E H LR  +ASF+
Sbjct  67   ERHYLRKHNASFS  79



>gb|EJT97716.1| hypothetical protein DACRYDRAFT_119374 [Dacryopinax sp. DJM-731 
SS1]
Length=370

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +1

Query  352  VGGQGT-RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLV  525
            +G   T RP+ FE+ A +QL   L+ A+ Y L   A R   +L +I++  +EF+ALLMLV
Sbjct  7    IGASDTQRPSLFELLAQEQLRDLLQPAVKYVLAFFAQRYPRYLLRIVNRHEEFYALLMLV  66

Query  526  LETHSLRTSDASFA  567
            +E H LRT++ASF+
Sbjct  67   IERHYLRTTNASFS  80



>ref|XP_007329571.1| hypothetical protein AGABI1DRAFT_120439 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM80418.1| hypothetical protein AGABI1DRAFT_120439 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=370

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VG    +P+FFE+ A +QL   L+ AL Y L V A R   +L KI++  +EF+A  MLV+
Sbjct  7    VGSDPLKPSFFELIAQEQLRDLLQPALKYVLAVFAQRYPRYLLKIVNRHEEFYAATMLVV  66

Query  529  ETHSLRTSDASFA  567
            E++ L+  +ASFA
Sbjct  67   ESYYLKKHNASFA  79



>ref|XP_007268527.1| cyclin-dependent protein kinase inhibitor [Fomitiporia mediterranea 
MF3/22]
 gb|EJD01250.1| cyclin-dependent protein kinase inhibitor [Fomitiporia mediterranea 
MF3/22]
Length=1480

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +1

Query  349  QVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLV  525
             +G   +RP+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+ALLM  
Sbjct  6    DIGTDPSRPSLFELVAQEQLRDLLQPALKYVLSVFAQRYPRYLLRIVNRHEEFYALLMFF  65

Query  526  LETHSLRTSDASFA  567
            +E H LRT  ASFA
Sbjct  66   VEKHYLRTHAASFA  79



>gb|KIY45911.1| hypothetical protein FISHEDRAFT_76145 [Fistulina hepatica ATCC 
64428]
Length=380

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
             G    +P+ FE+ A +QL   L+ AL Y L  LA R   +L +I+   +EF+ALLMLV+
Sbjct  7    TGSDPLKPSLFELVAQEQLRDLLQPALKYVLAFLAQRYPRYLLRIVTRHEEFYALLMLVV  66

Query  529  ETHSLRTSDASFA  567
            E H LR  +ASFA
Sbjct  67   ERHYLRKHNASFA  79



>gb|KII95930.1| hypothetical protein PLICRDRAFT_96220 [Plicaturopsis crispa FD-325 
SS-3]
Length=390

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            +GG   +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A +ML +
Sbjct  7    IGGDTLKPSLFELVAQEQLRDLLQPALKYVLAVFAQRYPRYLLRIVNRHEEFYATIMLFV  66

Query  529  ETHSLRTSDASFA  567
            E H LR  +ASF+
Sbjct  67   ERHYLRKHNASFS  79



>gb|KIP12713.1| hypothetical protein PHLGIDRAFT_97330 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=372

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VGG   +P+ FE+ A +QL   L+ A+ Y L V A R   +L +I++  +EF+A+LML +
Sbjct  7    VGGDPLKPSLFELVAQEQLRDLLQPAVKYVLSVFAQRYPRYLLRIVNRHEEFYAVLMLFV  66

Query  529  ETHSLRTSDASFA  567
            E H LR   A+FA
Sbjct  67   ERHYLRKHGAAFA  79



>emb|CDO68720.1| hypothetical protein BN946_scf184652.g47 [Trametes cinnabarina]
Length=365

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VG    +PT FE+ A +QL   L+ AL Y L V A     +L +I++  +EF+ALLM  +
Sbjct  7    VGDDPLKPTLFELVAQEQLRDLLQPALKYVLSVFAQSYPRYLLRIVNRHEEFYALLMFFV  66

Query  529  ETHSLRTSDASFA  567
            E H LRT  ASFA
Sbjct  67   ERHYLRTQGASFA  79



>ref|XP_007305583.1| hypothetical protein STEHIDRAFT_169444 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM85557.1| hypothetical protein STEHIDRAFT_169444 [Stereum hirsutum FP-91666 
SS1]
Length=374

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = +1

Query  352  VGGQGT-RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLV  525
            VGG+   +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+AL+ML 
Sbjct  8    VGGENPLKPSLFELIAQEQLRDLLQPALKYVLSVFAQRYPRYLLRIVNRHEEFYALIMLF  67

Query  526  LETHSLRTSDASFA  567
            +E H LR  +ASF+
Sbjct  68   VERHYLRQHNASFS  81



>gb|KIJ56841.1| hypothetical protein M422DRAFT_218554 [Sphaerobolus stellatus 
SS14]
Length=370

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VG    RP+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+AL+M  +
Sbjct  7    VGSDPQRPSIFELVAQEQLRDLLQPALKYVLAVFAHRHPRYLLRIVNRHEEFYALIMFFV  66

Query  529  ETHSLRTSDASFA  567
            E H L+   ASFA
Sbjct  67   ERHYLKAEGASFA  79



>ref|XP_007391908.1| hypothetical protein PHACADRAFT_86095 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM59344.1| hypothetical protein PHACADRAFT_86095 [Phanerochaete carnosa 
HHB-10118-sp]
Length=370

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VGG   +P+ FE+ A +QL   L+ AL Y L V A R   +L ++++  +EF+A LML +
Sbjct  7    VGGDQLKPSLFELVAQEQLRDLLQPALKYILSVFAQRYPRYLLRLVNRHEEFYATLMLFV  66

Query  529  ETHSLRTSDASFA  567
            E H LR   ASFA
Sbjct  67   ERHYLRKHGASFA  79



>ref|XP_008035317.1| hypothetical protein TRAVEDRAFT_162312 [Trametes versicolor FP-101664 
SS1]
 gb|EIW61287.1| hypothetical protein TRAVEDRAFT_162312 [Trametes versicolor FP-101664 
SS1]
Length=365

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VG    +PT FE+ A +QL   L+ AL Y L V A     +L +I++  +EF+ALLM  +
Sbjct  7    VGEDPLKPTLFELVAQEQLRDLLQPALKYVLSVFAQSYPRYLLRIVNRHEEFYALLMFFV  66

Query  529  ETHSLRTSDASFA  567
            E H LRT  ASFA
Sbjct  67   ERHYLRTQGASFA  79



>gb|KIJ70440.1| hypothetical protein HYDPIDRAFT_23545 [Hydnomerulius pinastri 
MD-312]
Length=1466

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            +GG   +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A++M  +
Sbjct  7    IGGDPLKPSLFELIAQEQLRDLLQPALKYVLAVFAQRYPRYLIRIVNRHEEFYAMIMFFV  66

Query  529  ETHSLRTSDASFA  567
            E H LR  +ASFA
Sbjct  67   ERHYLRKHNASFA  79



>gb|KIM67789.1| hypothetical protein SCLCIDRAFT_1070521 [Scleroderma citrinum 
Foug A]
Length=369

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            +GG   +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A++ML +
Sbjct  7    IGGDPLKPSLFELIAQEQLRDLLQPALKYVLAVFAQRYPRYLIRIVNRHEEFYAMIMLFV  66

Query  529  ETHSLRTSDASFA  567
            E H L   +ASFA
Sbjct  67   ERHYLLKYNASFA  79



>gb|KIY72989.1| hypothetical protein CYLTODRAFT_366806 [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=372

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +1

Query  349  QVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLV  525
             VG    +P+ FE+ + +QL   L+ AL Y L V A R   +L +I++  +EF+ALLMLV
Sbjct  6    NVGLDTLKPSLFELVSQEQLRDLLQPALKYVLSVFAQRYPRYLLRIVNKHEEFYALLMLV  65

Query  526  LETHSLRTSDASFA  567
            +E H L   +ASFA
Sbjct  66   VERHYLTKHNASFA  79



>dbj|GAA96706.1| hypothetical protein E5Q_03377 [Mixia osmundae IAM 14324]
 gb|KEI36659.1| hypothetical protein L969DRAFT_105726 [Mixia osmundae IAM 14324]
Length=394

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLE  531
            G    RP+FFE+AA +QL   L   + Y L VLA RR  +L +I++  DEF+AL M  +E
Sbjct  10   GPDRYRPSFFELAAQEQLRELLPPVIKYILSVLAQRRPRYLLRIVNRHDEFYALTMYFVE  69

Query  532  THSLRTSDASFA  567
             + LR   ASFA
Sbjct  70   RYYLREWGASFA  81



>ref|XP_006956786.1| hypothetical protein WALSEDRAFT_35907 [Wallemia sebi CBS 633.66]
 gb|EIM23409.1| hypothetical protein WALSEDRAFT_35907 [Wallemia sebi CBS 633.66]
Length=355

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +1

Query  340  MLFQVGGQGT-RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFAL  513
            M +Q+    T RP+ FE+ A  +L   L+ A+ Y L +LA R   +L ++++  +EF+AL
Sbjct  1    MDYQLQSSYTERPSLFELFAQDELTDLLQPAVKYVLSILATRYPRYLLRLVNKHEEFYAL  60

Query  514  LMLVLETHSLRTSDASFA  567
            +ML++E+H LRT +ASF 
Sbjct  61   IMLIVESHYLRTQNASFT  78



>ref|XP_001874754.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR14195.1| predicted protein [Laccaria bicolor S238N-H82]
Length=374

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VG    +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A++M ++
Sbjct  7    VGEDPLKPSLFELIAQEQLKDLLQPALKYVLAVFAQRYPRYLLRIVNRHEEFYAVIMFIV  66

Query  529  ETHSLRTSDASFA  567
            E H L+  +ASF+
Sbjct  67   ERHYLKKHNASFS  79



>ref|XP_007768137.1| hypothetical protein CONPUDRAFT_89908 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW82491.1| hypothetical protein CONPUDRAFT_89908 [Coniophora puteana RWD-64-598 
SS2]
Length=1621

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLE  531
            GG   +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +E +AL ML++E
Sbjct  9    GGDPLKPSLFELVAQEQLRDLLQPALKYVLAVFAQRYPRYLIRIVNRHEELYALAMLLVE  68

Query  532  THSLRTSDASFA  567
             H LR  +ASFA
Sbjct  69   RHYLRKHNASFA  80



>ref|XP_004336468.1| Peroxisome assembly protein, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR14455.1| Peroxisome assembly protein, putative [Acanthamoeba castellanii 
str. Neff]
Length=400

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +1

Query  358  GQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLMLVLETH  537
            G+  RP+FFEM A Q+L      AL Y+L V A+R   L   +   DE F  L L+LE H
Sbjct  9    GEAQRPSFFEMVAQQELLPFFGPALKYALSVAAVRWPRLEWGVTHHDELFYGLRLLLEAH  68

Query  538  SLRTSDASFA  567
             LR  DASF+
Sbjct  69   HLRRHDASFS  78



>emb|CCV00693.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=422

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+FFE+ A +QL   L+ A+ Y L VLA R   +L +I++  DE ++LLML +E H L 
Sbjct  21   RPSFFELIAQEQLSQLLKPAIRYVLTVLAQRHPRYLLRIVNRFDEIYSLLMLAVERHYLY  80

Query  547  TSDASF  564
            T +ASF
Sbjct  81   TWNASF  86



>ref|XP_001416251.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94544.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=433

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS--FLHKILDFEDEFFALLMLVLETHSL  543
            RPTFFE+ AA++L  SL+ AL+Y+LG LA   +  F H  LD  DE FA L  + E  S 
Sbjct  52   RPTFFELIAAERLAPSLKGALAYALGTLANAGAPGFAHYALDRGDEVFAALTFLAELKSF  111

Query  544  RTSDASFA  567
             + D S A
Sbjct  112  ASGDGSLA  119



>ref|XP_001837408.2| cyclin-dependent protein kinase inhibitor [Coprinopsis cinerea 
okayama7#130]
 gb|EAU84324.2| cyclin-dependent protein kinase inhibitor [Coprinopsis cinerea 
okayama7#130]
Length=1481

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            +G    +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+AL+MLV+
Sbjct  7    LGSDPLKPSLFEVIAQEQLKDLLQPALKYVLAVFAQRYPRYLIRIVNRHEEFYALIMLVV  66

Query  529  ETHSLRTSDASFA  567
            E H L   +ASF+
Sbjct  67   ERHYLTKHNASFS  79



>ref|XP_001730763.1| hypothetical protein MGL_1762 [Malassezia globosa CBS 7966]
 gb|EDP43549.1| hypothetical protein MGL_1762 [Malassezia globosa CBS 7966]
Length=427

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+FFE+ A +QL   L+ A+ Y L VLA     +L +I++  DE +A+LML +E H LR
Sbjct  21   RPSFFELIAQKQLSDLLKPAIRYVLTVLAQHYPRYLLRIVNRFDELYAVLMLAVERHYLR  80

Query  547  TSDASF  564
            T +ASF
Sbjct  81   TWNASF  86



>ref|XP_007381803.1| hypothetical protein PUNSTDRAFT_64646 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN10291.1| hypothetical protein PUNSTDRAFT_64646 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=371

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VG    +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A +M  +
Sbjct  7    VGSDPLKPSLFELVAQEQLRDLLQPALKYVLSVFAQRYPRYLLRIVNRHEEFYAFIMFFV  66

Query  529  ETHSLRTSDASFA  567
            E H LRT  ASF+
Sbjct  67   ERHFLRTHGASFS  79



>gb|KIK65606.1| hypothetical protein GYMLUDRAFT_159297 [Gymnopus luxurians FD-317 
M1]
Length=369

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLE  531
            G    +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A +ML +E
Sbjct  8    GADPLKPSLFELVAQEQLRDLLQPALKYVLAVFAQRYPRYLLRIVNRHEEFYAFIMLFVE  67

Query  532  THSLRTSDASFA  567
             H LR   ASFA
Sbjct  68   RHYLRKHGASFA  79



>gb|KIJ19886.1| hypothetical protein PAXINDRAFT_126111 [Paxillus involutus ATCC 
200175]
Length=369

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            +GG   +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A++M  +
Sbjct  7    MGGDPLKPSLFELIAQEQLRDLLQPALKYVLAVFAQRYPRYLIRIVNRHEEFYAMIMFFV  66

Query  529  ETHSLRTSDASFA  567
            E H L   +ASFA
Sbjct  67   ERHYLYKHNASFA  79



>gb|KIK08483.1| hypothetical protein K443DRAFT_128386 [Laccaria amethystina LaAM-08-1]
Length=1455

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VG    +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A++M ++
Sbjct  7    VGEDPLKPSLFELIAQEQLKDLLQPALKYVLAVFAQRYPRYLLRIVNRHEEFYAVIMFIV  66

Query  529  ETHSLRTSDASFA  567
            E H L+  +ASF+
Sbjct  67   ERHYLKKHNASFS  79



>gb|EPT02733.1| hypothetical protein FOMPIDRAFT_55106 [Fomitopsis pinicola FP-58527 
SS1]
Length=376

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLE  531
            G    +PT FE+ A +QL   L+ AL Y L V A R   +L ++++  +EF+ALLM  +E
Sbjct  8    GDDPLKPTLFELVAQEQLRDLLQPALKYVLSVFAQRYPRYLLRVVNRHEEFYALLMFFVE  67

Query  532  THSLRTSDASFA  567
             H LR   ASF+
Sbjct  68   RHYLRKYGASFS  79



>ref|XP_011386209.1| hypothetical protein UMAG_00297 [Ustilago maydis 521]
 gb|KIS71869.1| hypothetical protein UMAG_00297 [Ustilago maydis 521]
Length=447

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  373  PTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLRT  549
            P+FFE+AA  QL   ++ A+ Y + VLA R   +L +I+++ DE +ALLM  +E+H LR 
Sbjct  22   PSFFELAAQSQLSELIKPAVRYVVAVLAQRNPRYLLRIVNWFDEVYALLMTAVESHYLRV  81

Query  550  SDASFA  567
              +SF+
Sbjct  82   WGSSFS  87



>ref|XP_009543287.1| peroxisome biosynthesis protein Pex12 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW84466.1| peroxisome biosynthesis protein Pex12 [Heterobasidion irregulare 
TC 32-1]
Length=382

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLE  531
            GG   +P+ FE+ A +QL   L+ AL Y L V A R   +L ++++  +EF+A +M  +E
Sbjct  8    GGDPLKPSVFELIAQEQLRDLLQPALKYVLSVFAQRYPRYLLRVVNRHEEFYAAIMFFIE  67

Query  532  THSLRTSDASFA  567
             H LR  +ASF+
Sbjct  68   RHYLRKYNASFS  79



>ref|XP_007846936.1| cyclin-dependent protein kinase inhibitor [Moniliophthora roreri 
MCA 2997]
 gb|ESK93715.1| cyclin-dependent protein kinase inhibitor [Moniliophthora roreri 
MCA 2997]
Length=368

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A +ML++E H LR
Sbjct  14   KPSLFELVAQEQLKDLLQPALKYVLAVFAQRYPRYLLRIVNRHEEFYAFVMLLVERHYLR  73

Query  547  TSDASFA  567
              +ASF+
Sbjct  74   KHNASFS  80



>gb|KDQ14758.1| hypothetical protein BOTBODRAFT_109632 [Botryobasidium botryosum 
FD-172 SS1]
Length=381

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLE  531
            GG   RP+ FE+ A +QL   L+ AL Y L V A     +L ++++  +EF+AL+M  +E
Sbjct  9    GGDPHRPSLFELVAQEQLRDLLQPALKYVLSVFAQSYPRYLLRVVNKHEEFYALMMFFVE  68

Query  532  THSLRTSDASFA  567
             + LR  +ASFA
Sbjct  69   RYYLREHNASFA  80



>gb|EST09916.1| hypothetical protein PSEUBRA_SCAF1g00349 [Pseudozyma brasiliensis 
GHG001]
Length=439

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +1

Query  373  PTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLRT  549
            P+FFE+AA  QL   ++ A+ Y L VLA R   +L ++++  DE +ALLM  +ETH LR 
Sbjct  22   PSFFELAAQSQLQDLIKPAIRYVLAVLAQRNPRYLLRLVNRFDEVYALLMAGIETHYLRV  81

Query  550  SDASFA  567
              +SFA
Sbjct  82   WGSSFA  87



>ref|XP_007366127.1| hypothetical protein DICSQDRAFT_60738 [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF61298.1| hypothetical protein DICSQDRAFT_60738 [Dichomitus squalens LYAD-421 
SS1]
Length=372

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLE  531
            G    +PT FE+ A +QL   L+ AL Y L V A     +L +I++  +EF+ALLM  +E
Sbjct  8    GDDPLKPTLFELVAQEQLRDLLQPALKYVLSVFAQSYPRYLLRIVNKHEEFYALLMFFVE  67

Query  532  THSLRTSDASFA  567
             H LR   ASFA
Sbjct  68   RHYLRAHGASFA  79



>gb|KFH68350.1| hypothetical protein MVEG_05168 [Mortierella verticillata NRRL 
6337]
Length=391

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLE  531
            G Q  RP+ FE+ A  ++   L  AL Y + V A R   +L +I++  +EF+A+LM  +E
Sbjct  10   GAQADRPSLFELIAQDKMREMLEPALRYVIAVYAQRYPRYLIRIVNRYEEFYAILMFFVE  69

Query  532  THSLRTSDASFA  567
             H LR   ASFA
Sbjct  70   RHYLREYGASFA  81



>gb|KIL68228.1| hypothetical protein M378DRAFT_158769 [Amanita muscaria Koide 
BX008]
Length=371

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            +G    +P+ FE+ A +QL   L+ AL Y   V A R   +L +I++  +EF+A +ML++
Sbjct  7    IGSDVLKPSLFELIAQEQLRDLLQPALKYVFVVFAQRYPRYLLRIVNRHEEFYAFIMLIV  66

Query  529  ETHSLRTSDASFA  567
            E + LR  +ASFA
Sbjct  67   ERYYLRKHNASFA  79



>ref|XP_009267356.1| Peroxisome assembly protein 12 [Wallemia ichthyophaga EXF-994]
 gb|EOR01636.1| Peroxisome assembly protein 12 [Wallemia ichthyophaga EXF-994]
Length=353

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            +P+ FE+ A ++L   L+ A+ Y L +LA R   +L ++++  +E +AL+MLV+E+H LR
Sbjct  13   KPSLFELFAQEELTDLLQPAVKYVLSILATRYPRYLIRLVNRHEELYALVMLVVESHYLR  72

Query  547  TSDASFA  567
            T +ASF 
Sbjct  73   TENASFT  79



>gb|KJA24572.1| hypothetical protein HYPSUDRAFT_136134 [Hypholoma sublateritium 
FD-334 SS-4]
Length=1490

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLE  531
            G    +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A +ML++E
Sbjct  8    GTDPLKPSLFELLAQEQLKDLLQPALKYVLAVFAQRYPRYLLRIVNRHEEFYACIMLIVE  67

Query  532  THSLRTSDASFA  567
             H L   +ASF+
Sbjct  68   KHYLEKHNASFS  79



>gb|KIN95684.1| hypothetical protein M404DRAFT_1007286 [Pisolithus tinctorius 
Marx 270]
Length=369

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            +GG   +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A +ML +
Sbjct  7    IGGDPLKPSLFELIAQEQLRDLLQPALKYVLAVFAQRYPRYLIRIVNRHEEFYAAIMLFV  66

Query  529  ETHSLRTSDASFA  567
            E + L   +ASFA
Sbjct  67   ERYYLLKYNASFA  79



>emb|CCF54025.1| related to Peroxisome assembly protein 12 [Ustilago hordei]
Length=456

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  373  PTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLRT  549
            P+FFE+AA  QL   ++ A+ Y L VLA R   +L +I++  DE +A LM  +ETH LR 
Sbjct  22   PSFFELAAQSQLSDLIKPAVRYVLAVLAQRNPRYLLRIVNRFDELYAFLMAAIETHYLRL  81

Query  550  SDASFA  567
              ASF+
Sbjct  82   WGASFS  87



>ref|XP_007315338.1| hypothetical protein SERLADRAFT_347438 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO01590.1| hypothetical protein SERLA73DRAFT_48482 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO27247.1| hypothetical protein SERLADRAFT_347438 [Serpula lacrymans var. 
lacrymans S7.9]
Length=379

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLE  531
            G    +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A +M  +E
Sbjct  8    GEDPLKPSLFELVAQEQLRDLLQPALKYVLAVFAQRYPRYLIRIVNRHEEFYAFIMFFVE  67

Query  532  THSLRTSDASFA  567
             H LR  +ASF+
Sbjct  68   RHYLRKHNASFS  79



>ref|XP_002679960.1| predicted protein [Naegleria gruberi]
 gb|EFC47216.1| predicted protein [Naegleria gruberi]
Length=369

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLMLVLETHSLRT  549
            +PTFFE+   +++ S L++AL Y L + A R      IL + DE F +L LV+E H L  
Sbjct  3    QPTFFEIMTQERMISGLKSALRYILSMAAQRNFRYLNILKYYDELFGILQLVIERHFLSN  62

Query  550  SDASFA  567
             D+SFA
Sbjct  63   FDSSFA  68



>gb|KIK99683.1| hypothetical protein PAXRUDRAFT_131479 [Paxillus rubicundulus 
Ve08.2h10]
Length=1468

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMR--RSFLHKILDFEDEFFALLMLV  525
            +GG   +P+ FE+ A +QL   L+ AL Y L V A R  R  +H I++  +EF+A++M  
Sbjct  7    MGGDPLKPSLFELIAQEQLRDLLQPALKYVLAVFAQRYPRYLIH-IVNRHEEFYAMIMFF  65

Query  526  LETHSLRTSDASFA  567
            +E H L   +ASFA
Sbjct  66   VERHYLYKHNASFA  79



>gb|KDE02774.1| hypothetical protein MVLG_06696 [Microbotryum violaceum p1A1 
Lamole]
Length=455

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 3/78 (4%)
 Frame = +1

Query  343  LFQVGG--QGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFAL  513
            L  VGG     RP+FFE+AA +QL   L   + Y L V A R   +L  I++  DEFFA+
Sbjct  77   LSDVGGGEDRHRPSFFELAAQEQLRDLLAPVVRYILSVFAQRNPRYLLWIVNRHDEFFAV  136

Query  514  LMLVLETHSLRTSDASFA  567
            +M  +E H L+   ASFA
Sbjct  137  VMFFVERHYLKAWGASFA  154



>gb|KIM33527.1| hypothetical protein M408DRAFT_14226 [Serendipita vermifera MAFF 
305830]
Length=362

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            +P+ FE+ A +QL   L+ A+ Y LGV A +   +L +I +  +EF+A +ML++E H L+
Sbjct  13   KPSIFELIAQEQLRDLLQPAVKYVLGVFAQQYPRYLIRIFNKHEEFYAAIMLIVERHYLK  72

Query  547  TSDASFA  567
               ASFA
Sbjct  73   KHGASFA  79



>emb|CBQ67699.1| related to Peroxisome assembly protein 12 [Sporisorium reilianum 
SRZ2]
Length=430

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  373  PTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLRT  549
            P+FFE+AA  QL   ++ A+ Y L VLA R   +L ++++  DE +AL M  +ETH LR 
Sbjct  22   PSFFELAAQSQLQELIKPAVRYVLAVLAQRNPRYLLRVVNSFDEVYALAMAGIETHYLRV  81

Query  550  SDASFA  567
              +SFA
Sbjct  82   WGSSFA  87



>emb|CDI51245.1| related to Peroxisome assembly protein 12 [Melanopsichium pennsylvanicum 
4]
Length=474

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  373  PTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLRT  549
            P+FFE+AA  QL   ++ A+ Y L VLA R   +L +I++  DE +ALLM  +E H LR 
Sbjct  22   PSFFELAAQSQLQELIKPAVRYVLAVLAQRNPRYLLQIVNRFDEVYALLMAGIELHYLRI  81

Query  550  SDASFA  567
              +SFA
Sbjct  82   WGSSFA  87



>gb|KIM45907.1| hypothetical protein M413DRAFT_23717 [Hebeloma cylindrosporum 
h7]
Length=1360

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+AL+M ++E H L+
Sbjct  13   KPSLFELLAQEQLRDLLQPALKYVLAVFAQRYPRYLLRIVNRHEEFYALIMFIVEKHYLK  72

Query  547  TSDASFA  567
              +ASF+
Sbjct  73   KHNASFS  79



>emb|CEG01249.1| Peroxisome assembly protein 12 [Ostreococcus tauri]
Length=433

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRR--SFLHKILDFEDEFFALLMLVLETHSL  543
            RPTFFE+ AA++L  SL+ AL+Y+LG LA     +  H  ++  +E FALL L  E  + 
Sbjct  53   RPTFFELIAAERLVPSLKGALAYTLGTLANAGAPTLAHSAMNRGEEVFALLTLCAELRAF  112

Query  544  RTSDASFA  567
             + D S A
Sbjct  113  ASGDGSLA  120



>ref|XP_003080059.1| PEXC_ARATH Putative peroxisome assembly protein 12 (ISS) [Ostreococcus 
tauri]
Length=412

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRR--SFLHKILDFEDEFFALLMLVLETHSL  543
            RPTFFE+ AA++L  SL+ AL+Y+LG LA     +  H  ++  +E FALL L  E  + 
Sbjct  53   RPTFFELIAAERLVPSLKGALAYTLGTLANAGAPTLAHSAMNRGEEVFALLTLCAELRAF  112

Query  544  RTSDASFA  567
             + D S A
Sbjct  113  ASGDGSLA  120



>emb|CEG78635.1| hypothetical protein RMATCC62417_13211 [Rhizopus microsporus]
Length=245

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A  +L   L+ A+ Y L + A R    L +I++  +EF+ALLML++E H L+
Sbjct  15   RPSLFELVAQDKLKELLQPAIQYVLAIYAQRYPRLLLRIVNNHEEFYALLMLLIERHYLK  74

Query  547  TSDASFA  567
                SFA
Sbjct  75   EWSGSFA  81



>gb|EHK22226.1| hypothetical protein TRIVIDRAFT_60901 [Trichoderma virens Gv29-8]
Length=424

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +1

Query  364  GTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHS  540
            G +P+ FE+ + QQL S L   L Y L V   R   +L +IL+  DE +ALLML +E H 
Sbjct  13   GQKPSLFEVLSEQQLNSLLPPTLRYLLTVATHRHPRYLLRILNSFDELYALLMLAVERHY  72

Query  541  LRTSDASF  564
            LRT   SF
Sbjct  73   LRTRGGSF  80



>ref|XP_006962351.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR51970.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS05418.1| hypothetical protein M419DRAFT_126977 [Trichoderma reesei RUT 
C-30]
Length=430

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +1

Query  364  GTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHS  540
            G +P+ FE+ + QQL S L   L Y L V   R   +L +IL+  DE +ALLML +E H 
Sbjct  13   GQKPSLFEVLSEQQLNSLLPPTLRYLLTVATHRHPRYLLRILNSFDELYALLMLAVERHY  72

Query  541  LRTSDASF  564
            LRT   SF
Sbjct  73   LRTRGGSF  80



>emb|CEJ02808.1| hypothetical protein RMCBS344292_16802 [Rhizopus microsporus]
Length=760

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRR-SFLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A  +L   L+ A+ Y L + A R    L +I++  +EF+ALLML++E H L+
Sbjct  15   RPSLFELVAQDKLKELLQPAIQYVLAIYAQRYPRLLLRIVNNHEEFYALLMLLIERHYLK  74

Query  547  TSDASFA  567
                SFA
Sbjct  75   EWSGSFA  81



>emb|CEJ02807.1| hypothetical protein RMCBS344292_16802 [Rhizopus microsporus]
Length=790

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRR-SFLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A  +L   L+ A+ Y L + A R    L +I++  +EF+ALLML++E H L+
Sbjct  15   RPSLFELVAQDKLKELLQPAIQYVLAIYAQRYPRLLLRIVNNHEEFYALLMLLIERHYLK  74

Query  547  TSDASFA  567
                SFA
Sbjct  75   EWSGSFA  81



>gb|KDR83451.1| hypothetical protein GALMADRAFT_274898 [Galerina marginata CBS 
339.88]
Length=1495

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 47/77 (61%), Gaps = 6/77 (8%)
 Frame = +1

Query  355  GGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVL-----AMRRS-FLHKILDFEDEFFALL  516
            G    +P+ FE+ A +QL   L+ AL Y L V+     A R   +L +I++  +EF+AL+
Sbjct  8    GSDPLKPSLFELLAQEQLRDLLQPALKYVLAVIWKTVFAQRYPRYLLRIVNRHEEFYALV  67

Query  517  MLVLETHSLRTSDASFA  567
            ML++E H L+  +ASF+
Sbjct  68   MLIVENHYLKKQNASFS  84



>emb|CEG73332.1| hypothetical protein RMATCC62417_08737 [Rhizopus microsporus]
Length=377

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A  +L   L+ A+ Y L + A R    L +I++  +EF+ALLML++E H L+
Sbjct  15   RPSLFELVAQDKLKELLQPAIQYVLAIYAQRYPRLLLRIVNNHEEFYALLMLLIERHYLK  74

Query  547  TSDASFA  567
                SFA
Sbjct  75   EWSGSFA  81



>emb|CEI88974.1| hypothetical protein RMCBS344292_03350 [Rhizopus microsporus]
Length=377

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A  +L   L+ A+ Y L + A R    L +I++  +EF+ALLML++E H L+
Sbjct  15   RPSLFELVAQDKLKELLQPAIQYVLAIYAQRYPRLLLRIVNNHEEFYALLMLLIERHYLK  74

Query  547  TSDASFA  567
                SFA
Sbjct  75   EWSGSFA  81



>gb|KIK30837.1| hypothetical protein PISMIDRAFT_639813 [Pisolithus microcarpus 
441]
Length=369

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            +GG   +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A +M  +
Sbjct  7    IGGDPLKPSLFELIAQEQLRDLLQPALKYVLVVFAQRYPRYLIRIVNRHEEFYAAIMFFV  66

Query  529  ETHSLRTSDASFA  567
            E + L   +ASFA
Sbjct  67   ERYYLLKYNASFA  79



>gb|ETS63546.1| hypothetical protein PaG_01841 [Pseudozyma aphidis DSM 70725]
Length=430

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  373  PTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLRT  549
            P+FFE+AA  QL   ++ A+ Y L VLA R   +L ++++  DE +ALLM  +E H LR 
Sbjct  22   PSFFELAAQAQLQDLIKPAVRYVLAVLAQRSPRYLLRVVNSFDELYALLMGGIELHYLRV  81

Query  550  SDASFA  567
              +SFA
Sbjct  82   WGSSFA  87



>dbj|GAK62373.1| cyclin-dependent protein kinase inhibitor [Pseudozyma antarctica]
Length=428

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  373  PTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLRT  549
            P+FFE+AA  QL   ++ A+ Y L VLA R   +L ++++  DE +ALLM  +E H LR 
Sbjct  22   PSFFELAAQAQLQDLIKPAVRYVLAVLAQRSPRYLLRVVNSFDELYALLMGGIELHYLRV  81

Query  550  SDASFA  567
              +SFA
Sbjct  82   WGSSFA  87



>emb|CCA68004.1| related to Peroxisome assembly protein 12 [Piriformospora indica 
DSM 11827]
Length=358

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A +QL   L+ A+ Y L   A R   +L +I +  +E +AL+MLV+E H L+
Sbjct  13   RPSIFELIAQEQLRDLLQPAVKYVLAHFAQRYPRYLIRIFNKHEELYALIMLVVERHYLK  72

Query  547  TSDASFA  567
              +ASFA
Sbjct  73   LHNASFA  79



>gb|KDQ29036.1| hypothetical protein PLEOSDRAFT_1082916 [Pleurotus ostreatus 
PC15]
Length=1207

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
            VG    +P+ FE+ A +QL   L+ AL Y L V A R   +L +I++  +EF+A +M  +
Sbjct  20   VGTDPLKPSLFELVAQEQLRDLLQPALKYVLAVFAQRYPRYLLRIVNRHEEFYAAIMFFV  79

Query  529  ETHSLRTSDASFA  567
            E H L   +ASF+
Sbjct  80   EKHYLIKHNASFS  92



>dbj|GAC73527.1| sphingomyelinase family protein [Pseudozyma antarctica T-34]
Length=954

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +1

Query  373  PTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLRT  549
            P+FFE+AA  QL   ++ A+ Y L VLA R   +L ++++  DE +ALLM  +E H LR 
Sbjct  546  PSFFELAAQAQLQDLIKPAVRYVLAVLAQRSPRYLLRVVNSFDELYALLMGGIELHYLRV  605

Query  550  SDASFA  567
              +SFA
Sbjct  606  WGSSFA  611



>emb|CCM04807.1| predicted protein [Fibroporia radiculosa]
Length=1481

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 18/90 (20%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMR------------------RSFLH  477
            VGG   +PT FE+ A +QL   L+ A+ Y L V  M                     +L 
Sbjct  7    VGGDPYKPTLFELFAQEQLRDLLQPAVKYVLSVRCMYYFLDIPSVTVQKIFAQSYPRYLL  66

Query  478  KILDFEDEFFALLMLVLETHSLRTSDASFA  567
            ++++  +EF+ALLML +E H LRT  ASF+
Sbjct  67   RVVNRHEEFYALLMLFVERHFLRTHGASFS  96



>gb|EIE91399.1| hypothetical protein RO3G_16110 [Rhizopus delemar RA 99-880]
Length=398

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A  +L   L+ A+ Y L + A R    L +I++  +EF+A++ML++E H L+
Sbjct  15   RPSLFELVAQDKLKELLQPAIQYVLAIYAQRYPRLLLRIVNNHEEFYAIMMLLIERHYLK  74

Query  547  TSDASFA  567
                SFA
Sbjct  75   EWSGSFA  81



>ref|XP_007876351.1| hypothetical protein PFL1_00667 [Pseudozyma flocculosa PF-1]
 gb|EPQ32472.1| hypothetical protein PFL1_00667 [Pseudozyma flocculosa PF-1]
Length=462

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +1

Query  373  PTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLRT  549
            P+FFE+AA+ QL   ++ A  Y L VLA R    L +I++  DE + L+ML +E H L T
Sbjct  20   PSFFELAASDQLRDLIKPAARYILAVLAQRNPRHLIRIVNHFDEVYHLVMLGVERHYLST  79

Query  550  SDASFA  567
              ASFA
Sbjct  80   WGASFA  85



>emb|CCO27005.1| Ankyrin repeat protein nuc-2 [Rhizoctonia solani AG-1 IB]
Length=1189

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  367  TRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSL  543
             RP+  E+ A +QL  +L+ A+ Y L V A +   +L ++++  +EF+++LML++E H L
Sbjct  13   NRPSLLELIAQEQLRDTLQPAIKYILAVFAQQYPRYLIRLVNRFEEFYSVLMLIVERHYL  72

Query  544  RTSDASFA  567
            +T  ASFA
Sbjct  73   KTHGASFA  80



>emb|CEL57860.1| Peroxisome assembly protein 12 OS=Emericella nidulans (strain 
FGSC A4 / ATCC 38163 / CBS 112,46 / NRRL 194 / M139) GN=PEX12 
PE=3 SV=1 [Rhizoctonia solani AG-1 IB]
Length=366

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  352  VGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVL  528
             G    RP+  E+ A +QL  +L+ A+ Y L V A +   +L ++++  +EF ++LML++
Sbjct  8    TGLDPNRPSLLELIAQEQLRDTLQPAIKYILAVFAQQYPRYLIRLVNRFEEFHSVLMLIV  67

Query  529  ETHSLRTSDASFA  567
            E H L+T  ASFA
Sbjct  68   ERHYLKTHGASFA  80



>gb|EMD86253.1| hypothetical protein COCHEDRAFT_1023980, partial [Bipolaris maydis 
C5]
Length=224

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +1

Query  349  QVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLV  525
            Q G    +P+ FE+ + QQL S L  +L Y L V   R   +L  +L+  DE +ALLML+
Sbjct  8    QHGIDDLKPSLFELLSEQQLSSLLPPSLRYLLAVATPRYPRYLLPVLNSFDEVYALLMLL  67

Query  526  LETHSLRTSDASF  564
            +E H LRT   SF
Sbjct  68   VERHFLRTYGGSF  80



>ref|XP_007807711.1| peroxisome biosynthesis protein (PAS10/Peroxin-12), putative 
[Metarhizium acridum CQMa 102]
 gb|EFY92735.1| peroxisome biosynthesis protein (PAS10/Peroxin-12), putative 
[Metarhizium acridum CQMa 102]
Length=426

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 1/67 (1%)
 Frame = +1

Query  367  TRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSL  543
             +P+ FE+ + QQL   L   L Y L V   R   +L +IL+  DE +AL MLV+E H L
Sbjct  14   NKPSLFEVLSEQQLNGLLPPTLRYLLTVATQRHPRYLLRILNSFDELYALCMLVVERHYL  73

Query  544  RTSDASF  564
            RT   SF
Sbjct  74   RTRGGSF  80



>gb|KIW03350.1| hypothetical protein PV09_05558 [Verruconis gallopava]
Length=450

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +1

Query  346  FQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLML  522
             Q G    +P+ FE+ + QQL S L  +L Y L V   R   +L ++L+  DE +ALLML
Sbjct  7    LQGGVDELKPSLFELLSEQQLSSLLPPSLRYVLAVATHRHPRYLLRVLNSFDELYALLML  66

Query  523  VLETHSLRTSDASF  564
            V+E + L+T   SF
Sbjct  67   VVERYYLKTYGGSF  80



>dbj|GAC95602.1| hypothetical protein PHSY_003178 [Pseudozyma hubeiensis SY62]
Length=451

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +1

Query  373  PTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLRT  549
            P+FFE+AA  QL   ++ A+ Y L VLA R   +L + ++  DE +ALLM  +ETH L  
Sbjct  22   PSFFELAAQSQLSDLIKPAVRYVLAVLAQRNPRYLLRAVNSFDEIYALLMAGIETHYLTV  81

Query  550  SDASFA  567
              +SF+
Sbjct  82   WGSSFS  87



>ref|XP_007831053.1| hypothetical protein PFICI_04281 [Pestalotiopsis fici W106-1]
 gb|ETS82405.1| hypothetical protein PFICI_04281 [Pestalotiopsis fici W106-1]
Length=427

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            +P+ FE+ + QQL S L   L Y L VL  R   +L + L+  DE +AL+ML++E H LR
Sbjct  15   KPSLFEILSEQQLNSLLPPTLRYLLTVLTQRYPRYLLRALNSFDELYALVMLIVERHYLR  74

Query  547  TSDASF  564
            T   SF
Sbjct  75   TRGGSF  80



>emb|CDS04175.1| hypothetical protein LRAMOSA07130 [Absidia idahoensis var. thermophila]
Length=392

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A Q+L   L+ A+ Y++ + A R    L ++++  +EF+A+LML +E H L+
Sbjct  15   RPSLFELDAQQKLRELLQPAVQYAVAIYAQRYPRLLIRLVNHHEEFYAILMLFIERHYLK  74

Query  547  TSDASFA  567
                SFA
Sbjct  75   EWGGSFA  81



>emb|CEP19375.1| hypothetical protein [Parasitella parasitica]
Length=384

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A ++L   L+ A+ Y L V A R    L +I++  +EF+A +ML++E H L+
Sbjct  15   RPSLFELVAQEKLKELLQPAVQYVLAVYAQRYPRLLLRIVNNHEEFYAAIMLLVERHYLK  74

Query  547  TSDASFA  567
                SFA
Sbjct  75   EWGGSFA  81



>gb|EHK43268.1| hypothetical protein TRIATDRAFT_301162 [Trichoderma atroviride 
IMI 206040]
Length=428

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +1

Query  364  GTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHS  540
            G +P+ FE+ + QQL   L   L Y L V   R   +L +IL+  DE +AL+ML +E H 
Sbjct  13   GQKPSLFEVLSEQQLNGLLPPTLRYLLVVATHRHPRYLLRILNSFDELYALVMLAVERHY  72

Query  541  LRTSDASF  564
            LRT   SF
Sbjct  73   LRTRGGSF  80



>emb|CDH49798.1| related to peroxisome assembly protein 12 [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=392

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A Q+L   L+ A+ Y++ + A R    L ++++  +EF+A+LML +E H L+
Sbjct  15   RPSLFELDAQQKLRELLQPAVQYAVAIYAQRYPRLLIRLVNHHEEFYAILMLFIERHYLK  74

Query  547  TSDASFA  567
                SFA
Sbjct  75   EWGGSFA  81



>dbj|GAN08985.1| cyclin-dependent protein kinase inhibitor [Mucor ambiguus]
Length=383

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLMLVLETHSLR  546
            RP+ FE+ A ++L   L+ A+ Y L + A R    L ++++  +EF+A LML++E H L+
Sbjct  15   RPSLFELVAQEKLKELLQPAVQYVLAIYAQRYPRLLLRVVNNHEEFYAALMLLVERHYLK  74

Query  547  TSDASFA  567
                SFA
Sbjct  75   EWGGSFA  81



>ref|XP_003305125.1| hypothetical protein PTT_17874 [Pyrenophora teres f. teres 0-1]
 gb|EFQ86777.1| hypothetical protein PTT_17874 [Pyrenophora teres f. teres 0-1]
Length=466

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +1

Query  346  FQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLML  522
             Q G    +P+ FE+ + QQL S L  +L Y L V   R   +L  IL+  DE +ALLML
Sbjct  7    LQHGIDDLKPSLFELLSEQQLASLLPPSLRYLLAVSTHRYPRYLLPILNSFDEVYALLML  66

Query  523  VLETHSLRTSDASF  564
            ++E H LRT   SF
Sbjct  67   LVERHFLRTYGGSF  80



>ref|XP_005704433.1| peroxisomal membrane protein PEX12 [Galdieria sulphuraria]
 gb|EME27913.1| peroxisomal membrane protein PEX12 [Galdieria sulphuraria]
Length=344

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  370  RPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRSFLHKILDFEDEFFALLMLVLETHSLRT  549
            RP++FEM A ++L  +L+ AL + L V A R S L  +    DE F LL  +LE +SLR 
Sbjct  12   RPSYFEMFAQERLLPTLKPALRFVLQVFAQRHSSLVPVAMKSDELFTLLHFLLELNSLRK  71

Query  550  SDASFA  567
            + AS A
Sbjct  72   NQASCA  77



>ref|XP_001942414.1| peroxisome assembly protein 12 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU46239.1| peroxisome assembly protein 12 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=465

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +1

Query  346  FQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLML  522
             Q G    +P+ FE+ + QQL S L  +L Y L V   R   +L  IL+  DE +ALLML
Sbjct  7    LQHGIDDLKPSLFELLSEQQLASLLPPSLRYLLAVSTHRYPRYLLPILNSFDEVYALLML  66

Query  523  VLETHSLRTSDASF  564
            ++E H LRT   SF
Sbjct  67   LVERHFLRTYGGSF  80



>gb|EUN27740.1| hypothetical protein COCVIDRAFT_97438 [Bipolaris victoriae FI3]
Length=1132

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +1

Query  346  FQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLML  522
             Q G    +P+ FE+ + QQL S L  +L Y L V   R   +L  +L+  DE +ALLML
Sbjct  7    LQHGIDDLKPSLFELLSEQQLSSLLPPSLRYLLAVATPRYPRYLLPVLNSFDEVYALLML  66

Query  523  VLETHSLRTSDASF  564
            ++E H LRT   SF
Sbjct  67   LVERHFLRTYGGSF  80



>ref|XP_007707512.1| hypothetical protein COCCADRAFT_83746 [Bipolaris zeicola 26-R-13]
 gb|EUC38192.1| hypothetical protein COCCADRAFT_83746 [Bipolaris zeicola 26-R-13]
Length=1132

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +1

Query  346  FQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLML  522
             Q G    +P+ FE+ + QQL S L  +L Y L V   R   +L  +L+  DE +ALLML
Sbjct  7    LQHGIDDLKPSLFELLSEQQLSSLLPPSLRYLLAVATPRYPRYLLPVLNSFDEVYALLML  66

Query  523  VLETHSLRTSDASF  564
            ++E H LRT   SF
Sbjct  67   LVERHFLRTYGGSF  80



>ref|XP_007692979.1| hypothetical protein COCMIDRAFT_108653 [Bipolaris oryzae ATCC 
44560]
 gb|EUC40495.1| hypothetical protein COCMIDRAFT_108653 [Bipolaris oryzae ATCC 
44560]
Length=1118

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +1

Query  346  FQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLML  522
             Q G    +P+ FE+ + QQL S L  +L Y L V   R   +L  +L+  DE +ALLML
Sbjct  7    LQHGIDDLKPSLFELLSEQQLSSLLPPSLRYLLAVATPRYPRYLLPVLNSFDEVYALLML  66

Query  523  VLETHSLRTSDASF  564
            ++E H LRT   SF
Sbjct  67   LVERHFLRTYGGSF  80



>ref|XP_008024804.1| hypothetical protein SETTUDRAFT_150591 [Setosphaeria turcica 
Et28A]
 gb|EOA87581.1| hypothetical protein SETTUDRAFT_150591 [Setosphaeria turcica 
Et28A]
Length=1153

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +1

Query  346  FQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLML  522
             Q G    +P+ FE+ + QQL S L  +L Y L V   R   +L  +L+  DE +ALLML
Sbjct  7    LQHGIDDLKPSLFELLSEQQLASLLPPSLRYLLAVATPRYPRYLLPVLNSFDEVYALLML  66

Query  523  VLETHSLRTSDASF  564
            ++E H LRT   SF
Sbjct  67   LVERHFLRTYGGSF  80



>gb|ENI06200.1| hypothetical protein COCC4DRAFT_166382 [Bipolaris maydis ATCC 
48331]
Length=1116

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +1

Query  346  FQVGGQGTRPTFFEMAAAQQLPSSLRAALSYSLGVLAMRRS-FLHKILDFEDEFFALLML  522
             Q G    +P+ FE+ + QQL S L  +L Y L V   R   +L  +L+  DE +ALLML
Sbjct  7    LQHGIDDLKPSLFELLSEQQLSSLLPPSLRYLLAVATPRYPRYLLPVLNSFDEVYALLML  66

Query  523  VLETHSLRTSDASF  564
            ++E H LRT   SF
Sbjct  67   LVERHFLRTYGGSF  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960