BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J05

Length=432
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590508.1|  PREDICTED: crocetin glucosyltransferase, chl...    142   6e-37   
dbj|BAG80545.1|  UDP-glucose:glucosyltransferase                        139   4e-36   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_009778637.1|  PREDICTED: crocetin glucosyltransferase, chl...    139   7e-36   Nicotiana sylvestris
ref|XP_006349902.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    134   2e-34   Solanum tuberosum [potatoes]
ref|XP_009612652.1|  PREDICTED: crocetin glucosyltransferase, chl...    134   4e-34   
ref|XP_004252977.1|  PREDICTED: crocetin glucosyltransferase, chl...    132   2e-33   Solanum lycopersicum
ref|XP_004247895.1|  PREDICTED: crocetin glucosyltransferase, chl...    130   1e-32   Solanum lycopersicum
dbj|BAA19155.1|  glucosyl transferase                                   129   2e-32   Nicotiana tabacum [American tobacco]
ref|XP_009765809.1|  PREDICTED: crocetin glucosyltransferase, chl...    129   2e-32   Nicotiana sylvestris
ref|XP_004242781.1|  PREDICTED: crocetin glucosyltransferase, chl...    127   2e-31   Solanum lycopersicum
ref|XP_009612650.1|  PREDICTED: crocetin glucosyltransferase, chl...    124   1e-30   Nicotiana tomentosiformis
ref|XP_009787090.1|  PREDICTED: crocetin glucosyltransferase, chl...    124   2e-30   Nicotiana sylvestris
ref|XP_009622554.1|  PREDICTED: crocetin glucosyltransferase, chl...    123   4e-30   Nicotiana tomentosiformis
ref|XP_004247896.2|  PREDICTED: crocetin glucosyltransferase, chl...    119   1e-28   Solanum lycopersicum
ref|XP_006342284.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    117   4e-28   Solanum tuberosum [potatoes]
ref|XP_004229323.2|  PREDICTED: crocetin glucosyltransferase, chl...    115   1e-27   
dbj|BAG80537.1|  putative glycosyltransferase                           115   3e-27   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_003552552.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    114   7e-27   Glycine max [soybeans]
dbj|BAB88935.1|  glucosyltransferase                                    111   4e-26   Nicotiana tabacum [American tobacco]
emb|CDP15120.1|  unnamed protein product                                111   6e-26   Coffea canephora [robusta coffee]
emb|CBI39410.3|  unnamed protein product                                110   1e-25   Vitis vinifera
emb|CDP15119.1|  unnamed protein product                                109   2e-25   Coffea canephora [robusta coffee]
ref|XP_009601422.1|  PREDICTED: crocetin glucosyltransferase, chl...    108   4e-25   Nicotiana tomentosiformis
ref|XP_002263301.1|  PREDICTED: crocetin glucosyltransferase, chl...    108   4e-25   Vitis vinifera
gb|KJB28077.1|  hypothetical protein B456_005G025900                    108   5e-25   Gossypium raimondii
ref|XP_009790237.1|  PREDICTED: crocetin glucosyltransferase, chl...    107   9e-25   Nicotiana sylvestris
gb|EYU31586.1|  hypothetical protein MIMGU_mgv1a005918mg                107   1e-24   Erythranthe guttata [common monkey flower]
gb|EYU31587.1|  hypothetical protein MIMGU_mgv1a018203mg                107   1e-24   Erythranthe guttata [common monkey flower]
gb|KJB28079.1|  hypothetical protein B456_005G026100                    108   1e-24   Gossypium raimondii
gb|EYU32718.1|  hypothetical protein MIMGU_mgv1a005538mg                107   2e-24   Erythranthe guttata [common monkey flower]
ref|XP_011069457.1|  PREDICTED: crocetin glucosyltransferase, chl...    105   3e-24   Sesamum indicum [beniseed]
gb|AJM89728.1|  UDP-glucosyltransferase                                 106   3e-24   Leonurus japonicus [Chinese motherwort]
ref|XP_002868314.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    106   4e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_006414807.1|  hypothetical protein EUTSA_v10025167mg             105   5e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010673328.1|  PREDICTED: crocetin glucosyltransferase, chl...    105   6e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004247894.1|  PREDICTED: crocetin glucosyltransferase, chl...    105   9e-24   
ref|XP_007163802.1|  hypothetical protein PHAVU_001G265400g             105   1e-23   Phaseolus vulgaris [French bean]
ref|XP_006358760.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    104   2e-23   Solanum tuberosum [potatoes]
ref|XP_010650395.1|  PREDICTED: crocetin glucosyltransferase, chl...    104   2e-23   Vitis vinifera
emb|CAN67608.1|  hypothetical protein VITISV_036779                     104   2e-23   Vitis vinifera
ref|XP_002262883.1|  PREDICTED: crocetin glucosyltransferase, chl...    104   2e-23   Vitis vinifera
sp|F8WKW0.1|UGT1_GARJA  RecName: Full=Crocetin glucosyltransferas...    104   2e-23   Gardenia jasminoides
gb|KJB28076.1|  hypothetical protein B456_005G025700                    104   2e-23   Gossypium raimondii
dbj|BAM28983.1|  UDP-glucose crocetin glucosyltransferase               103   3e-23   Gardenia jasminoides
ref|XP_003632054.2|  PREDICTED: crocetin glucosyltransferase, chl...    103   3e-23   
ref|XP_007034186.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase      103   3e-23   
ref|XP_010246964.1|  PREDICTED: crocetin glucosyltransferase, chl...    103   3e-23   Nelumbo nucifera [Indian lotus]
gb|KDP32582.1|  hypothetical protein JCGZ_13132                         103   3e-23   Jatropha curcas
emb|CAN75179.1|  hypothetical protein VITISV_018406                     103   3e-23   Vitis vinifera
ref|XP_010246531.1|  PREDICTED: crocetin glucosyltransferase, chl...    103   3e-23   Nelumbo nucifera [Indian lotus]
ref|XP_007221319.1|  hypothetical protein PRUPE_ppa021645mg             103   4e-23   Prunus persica
ref|XP_010243149.1|  PREDICTED: crocetin glucosyltransferase, chl...    103   4e-23   Nelumbo nucifera [Indian lotus]
dbj|BAG80544.1|  UDP-glucose:glucosyltransferase                        103   5e-23   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_011020320.1|  PREDICTED: crocetin glucosyltransferase, chl...    103   6e-23   Populus euphratica
ref|XP_006368000.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    103   6e-23   Solanum tuberosum [potatoes]
ref|XP_010023602.1|  PREDICTED: crocetin glucosyltransferase, chl...    103   6e-23   
gb|KJB28075.1|  hypothetical protein B456_005G025600                    103   6e-23   Gossypium raimondii
emb|CBI39388.3|  unnamed protein product                                103   7e-23   Vitis vinifera
gb|AET04105.2|  UDP-glucose:glucosyltransferase, putative             99.0    8e-23   Medicago truncatula
ref|XP_010450127.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       102   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006282890.1|  hypothetical protein CARUB_v10007134mg             102   9e-23   Capsella rubella
ref|NP_193146.1|  anthocyanin 5-O-glucosyltransferase                   101   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAL69494.1|  putative glucosyltransferase                            101   2e-22   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98677.1|  glucosyltransferase like protein                       101   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458144.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    101   3e-22   Cucumis melo [Oriental melon]
gb|AAK54465.1|  cold-induced glucosyl transferase                       101   3e-22   Solanum sogarandinum
ref|XP_011081386.1|  PREDICTED: crocetin glucosyltransferase, chl...    101   3e-22   Sesamum indicum [beniseed]
ref|XP_010023609.1|  PREDICTED: crocetin glucosyltransferase, chl...    100   4e-22   Eucalyptus grandis [rose gum]
ref|XP_010023603.1|  PREDICTED: crocetin glucosyltransferase, chl...    100   4e-22   Eucalyptus grandis [rose gum]
gb|EYU31588.1|  hypothetical protein MIMGU_mgv1a005398mg                100   4e-22   Erythranthe guttata [common monkey flower]
ref|XP_002263975.1|  PREDICTED: crocetin glucosyltransferase, chl...    100   4e-22   Vitis vinifera
ref|XP_011101592.1|  PREDICTED: crocetin glucosyltransferase, chl...    100   4e-22   Sesamum indicum [beniseed]
gb|KFK36297.1|  hypothetical protein AALP_AA4G104100                    100   4e-22   Arabis alpina [alpine rockcress]
ref|XP_007099701.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase      100   5e-22   
gb|KJB28080.1|  hypothetical protein B456_005G026200                    100   7e-22   Gossypium raimondii
gb|KJB28073.1|  hypothetical protein B456_005G025400                    100   7e-22   Gossypium raimondii
ref|XP_010435193.1|  PREDICTED: UDP-glycosyltransferase 75C1-like     99.8    8e-22   Camelina sativa [gold-of-pleasure]
ref|XP_004140483.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     99.8    9e-22   Cucumis sativus [cucumbers]
ref|XP_011024782.1|  PREDICTED: crocetin glucosyltransferase, chl...  99.8    1e-21   Populus euphratica
emb|CDY27124.1|  BnaA08g07620D                                        99.4    1e-21   Brassica napus [oilseed rape]
ref|XP_009108098.1|  PREDICTED: UDP-glycosyltransferase 75C1          99.4    1e-21   Brassica rapa
ref|XP_002263700.1|  PREDICTED: crocetin glucosyltransferase, chl...  99.4    1e-21   Vitis vinifera
ref|XP_002301754.1|  hypothetical protein POPTR_0002s23770g           99.4    1e-21   
ref|XP_002267330.2|  PREDICTED: crocetin glucosyltransferase, chl...  99.8    2e-21   Vitis vinifera
ref|XP_004504379.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     99.4    2e-21   Cicer arietinum [garbanzo]
ref|XP_010246537.1|  PREDICTED: crocetin glucosyltransferase, chl...  99.4    2e-21   Nelumbo nucifera [Indian lotus]
emb|CDP15112.1|  unnamed protein product                              99.0    2e-21   Coffea canephora [robusta coffee]
ref|XP_003532736.2|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  99.4    2e-21   
ref|XP_003629629.1|  UDP-glucose glucosyltransferase                  97.4    2e-21   
ref|XP_009337747.1|  PREDICTED: crocetin glucosyltransferase, chl...  99.0    2e-21   Pyrus x bretschneideri [bai li]
ref|XP_010450109.1|  PREDICTED: UDP-glycosyltransferase 75C1          98.6    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002308970.1|  putative glucosyltransferase family protein      99.0    2e-21   
ref|XP_008348418.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  99.0    2e-21   Malus domestica [apple tree]
emb|CBI39391.3|  unnamed protein product                              97.4    3e-21   Vitis vinifera
gb|AFI71902.1|  flavonol 5-O-glucosyltransferase                      98.2    4e-21   Paeonia lactiflora [common garden peony]
ref|XP_008380634.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  98.2    4e-21   Malus domestica [apple tree]
ref|XP_006478536.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     96.3    4e-21   
gb|KJB28074.1|  hypothetical protein B456_005G025500                  98.2    4e-21   Gossypium raimondii
ref|XP_003629628.1|  UDP-glucose flavonoid 7-O-glucosyltransferase    97.8    4e-21   Medicago truncatula
ref|XP_003601705.1|  O-glucosyltransferase                            98.2    4e-21   Medicago truncatula
emb|CDY12370.1|  BnaC08g08350D                                        97.8    5e-21   Brassica napus [oilseed rape]
ref|XP_011033298.1|  PREDICTED: crocetin glucosyltransferase, chl...  97.8    5e-21   Populus euphratica
ref|XP_008380454.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  97.8    5e-21   Malus domestica [apple tree]
ref|XP_008380456.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  97.4    6e-21   Malus domestica [apple tree]
ref|XP_007221281.1|  hypothetical protein PRUPE_ppa005161mg           97.4    7e-21   Prunus persica
ref|XP_004298223.1|  PREDICTED: crocetin glucosyltransferase, chl...  97.4    7e-21   Fragaria vesca subsp. vesca
ref|XP_008222736.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  97.4    8e-21   Prunus mume [ume]
ref|XP_010650398.1|  PREDICTED: crocetin glucosyltransferase, chl...  97.1    1e-20   Vitis vinifera
ref|XP_002267526.1|  PREDICTED: crocetin glucosyltransferase, chl...  97.1    1e-20   Vitis vinifera
emb|CBI39411.3|  unnamed protein product                              95.5    1e-20   Vitis vinifera
ref|XP_002301753.1|  INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE ...  97.1    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010023605.1|  PREDICTED: crocetin glucosyltransferase, chl...  96.3    2e-20   Eucalyptus grandis [rose gum]
ref|XP_010650447.1|  PREDICTED: crocetin glucosyltransferase, chl...  97.4    2e-20   Vitis vinifera
ref|XP_003524180.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  95.9    2e-20   Glycine max [soybeans]
ref|XP_010023606.1|  PREDICTED: crocetin glucosyltransferase, chl...  95.9    2e-20   Eucalyptus grandis [rose gum]
ref|XP_002322699.1|  hypothetical protein POPTR_0016s05290g           95.9    3e-20   
ref|XP_003524181.2|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  95.9    3e-20   Glycine max [soybeans]
ref|XP_008359982.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     92.8    4e-20   
ref|XP_002321086.2|  INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE ...  95.1    4e-20   
ref|XP_009373578.1|  PREDICTED: crocetin glucosyltransferase, chl...  95.5    5e-20   
dbj|BAF75879.1|  glucosyltransferase                                  95.1    6e-20   Dianthus caryophyllus [carnation]
ref|XP_007221288.1|  hypothetical protein PRUPE_ppa016890mg           95.1    6e-20   Prunus persica
gb|AAY27090.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase         95.1    6e-20   Pyrus communis
emb|CDP21505.1|  unnamed protein product                              94.4    6e-20   Coffea canephora [robusta coffee]
ref|XP_003601706.1|  UDP-glucose glucosyltransferase                  94.7    7e-20   Medicago truncatula
ref|XP_002266800.1|  PREDICTED: crocetin glucosyltransferase, chl...  92.8    7e-20   Vitis vinifera
ref|XP_009373577.1|  PREDICTED: crocetin glucosyltransferase, chl...  94.7    8e-20   
emb|CDP21497.1|  unnamed protein product                              94.4    9e-20   Coffea canephora [robusta coffee]
ref|XP_008222735.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  94.4    1e-19   Prunus mume [ume]
gb|AAX16493.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase         94.0    1e-19   Malus domestica [apple tree]
ref|XP_008380455.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  94.0    1e-19   
ref|XP_006442000.1|  hypothetical protein CICLE_v10023445mg           94.0    2e-19   
dbj|BAA89009.1|  anthocyanin 5-O-glucosyltransferase                  93.6    2e-19   Petunia x hybrida [garden petunia]
ref|XP_009373576.1|  PREDICTED: crocetin glucosyltransferase, chl...  94.4    2e-19   
dbj|BAD90935.1|  monoterpene glucosyltransferase                      93.6    2e-19   Eucalyptus perriniana
ref|XP_006492998.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     93.2    2e-19   Citrus sinensis [apfelsine]
ref|XP_003531212.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  92.8    3e-19   Glycine max [soybeans]
ref|XP_006421040.1|  hypothetical protein CICLE_v10004909mg           92.8    3e-19   Citrus clementina [clementine]
ref|XP_007034187.1|  Indole-3-acetate beta-D-glucosyltransferase,...  92.8    3e-19   
ref|XP_010039943.1|  PREDICTED: crocetin glucosyltransferase, chl...  92.4    4e-19   Eucalyptus grandis [rose gum]
ref|XP_008362859.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     90.1    4e-19   
ref|XP_003601707.1|  UDP-glucuronosyltransferase 1-6                  92.8    4e-19   Medicago truncatula
ref|XP_010096066.1|  UDP-glycosyltransferase 75D1                     92.0    6e-19   Morus notabilis
dbj|BAD90934.1|  monoterpene glucosyltransferase                      92.0    6e-19   Eucalyptus perriniana
emb|CAN76093.1|  hypothetical protein VITISV_027116                   92.0    7e-19   Vitis vinifera
gb|KDO43225.1|  hypothetical protein CISIN_1g036740mg                 91.3    7e-19   Citrus sinensis [apfelsine]
dbj|BAF49286.1|  anthocyanin 5-O-glucosyltransferase                  91.7    9e-19   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_010039944.1|  PREDICTED: crocetin glucosyltransferase, chl...  91.7    9e-19   Eucalyptus grandis [rose gum]
dbj|BAF49285.1|  anthocyanin 5-O-glucosyltransferase                  91.7    9e-19   Eustoma exaltatum subsp. russellianum [bluebells]
gb|ABQ02258.1|  O-glucosyltransferase 3                               91.7    9e-19   Vitis labrusca [Concord grape]
ref|XP_010099953.1|  UDP-glycosyltransferase 75D1                     91.7    1e-18   Morus notabilis
emb|CAN77410.1|  hypothetical protein VITISV_038710                   89.0    2e-18   Vitis vinifera
ref|XP_006442002.1|  hypothetical protein CICLE_v10019912mg           90.9    2e-18   Citrus clementina [clementine]
ref|XP_006349903.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  90.5    2e-18   Solanum tuberosum [potatoes]
ref|XP_004297003.2|  PREDICTED: crocetin glucosyltransferase, chl...  90.9    2e-18   Fragaria vesca subsp. vesca
emb|CDP15111.1|  unnamed protein product                              90.5    2e-18   Coffea canephora [robusta coffee]
emb|CBI39398.3|  unnamed protein product                              90.1    2e-18   Vitis vinifera
ref|XP_010103920.1|  UDP-glycosyltransferase 75D1                     90.5    2e-18   Morus notabilis
ref|XP_002266628.2|  PREDICTED: crocetin glucosyltransferase, chl...  90.5    3e-18   
ref|XP_002266919.1|  PREDICTED: crocetin glucosyltransferase, chl...  90.1    3e-18   Vitis vinifera
ref|XP_008355875.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     88.2    4e-18   
ref|XP_002263498.1|  PREDICTED: crocetin glucosyltransferase, chl...  89.7    4e-18   Vitis vinifera
ref|XP_004252978.1|  PREDICTED: crocetin glucosyltransferase, chl...  89.7    4e-18   Solanum lycopersicum
ref|XP_009366234.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     89.7    5e-18   Pyrus x bretschneideri [bai li]
ref|XP_010039945.1|  PREDICTED: crocetin glucosyltransferase, chl...  89.4    5e-18   Eucalyptus grandis [rose gum]
emb|CAN62624.1|  hypothetical protein VITISV_001657                   89.4    5e-18   Vitis vinifera
ref|XP_002263422.1|  PREDICTED: crocetin glucosyltransferase, chl...  89.4    5e-18   Vitis vinifera
ref|XP_008384038.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     89.4    5e-18   
ref|XP_003517852.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     88.6    1e-17   Glycine max [soybeans]
ref|XP_003629627.1|  Indole-3-acetate beta-glucosyltransferase        88.6    1e-17   Medicago truncatula
ref|XP_009778639.1|  PREDICTED: crocetin glucosyltransferase, chl...  88.2    1e-17   Nicotiana sylvestris
gb|KDP32590.1|  hypothetical protein JCGZ_13140                       88.2    1e-17   Jatropha curcas
ref|NP_001063685.1|  Os09g0518200                                     88.2    2e-17   
gb|EAZ09772.1|  hypothetical protein OsI_32059                        88.2    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_004502258.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     87.8    2e-17   Cicer arietinum [garbanzo]
ref|XP_009604418.1|  PREDICTED: crocetin glucosyltransferase, chl...  87.8    2e-17   Nicotiana tomentosiformis
ref|XP_010023610.1|  PREDICTED: crocetin glucosyltransferase, chl...  87.8    2e-17   
emb|CDP03995.1|  unnamed protein product                              87.4    3e-17   Coffea canephora [robusta coffee]
emb|CAN62622.1|  hypothetical protein VITISV_001655                   87.0    4e-17   Vitis vinifera
emb|CDP06918.1|  unnamed protein product                              87.0    4e-17   Coffea canephora [robusta coffee]
ref|XP_010042881.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     84.3    5e-17   
ref|XP_004253165.1|  PREDICTED: crocetin glucosyltransferase, chl...  87.0    5e-17   Solanum lycopersicum
ref|XP_002266967.1|  PREDICTED: crocetin glucosyltransferase, chl...  87.0    5e-17   Vitis vinifera
ref|XP_010246963.1|  PREDICTED: crocetin glucosyltransferase, chl...  86.7    5e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010527436.1|  PREDICTED: UDP-glycosyltransferase 75C1 isof...  86.7    6e-17   Tarenaya hassleriana [spider flower]
ref|XP_006307449.1|  hypothetical protein CARUB_v10009073mg           86.3    7e-17   Capsella rubella
emb|CDP20001.1|  unnamed protein product                              86.3    7e-17   Coffea canephora [robusta coffee]
ref|XP_010068983.1|  PREDICTED: crocetin glucosyltransferase, chl...  86.3    8e-17   Eucalyptus grandis [rose gum]
ref|NP_172044.1|  UDP-glucosyl transferase 75B2                       86.3    8e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KCW76863.1|  hypothetical protein EUGRSUZ_D01218                   85.5    1e-16   Eucalyptus grandis [rose gum]
ref|XP_010069229.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  85.5    2e-16   
ref|XP_002516389.1|  UDP-glucosyltransferase, putative                85.1    2e-16   Ricinus communis
ref|XP_010052789.1|  PREDICTED: crocetin glucosyltransferase, chl...  85.1    2e-16   Eucalyptus grandis [rose gum]
ref|XP_007033645.1|  UDP-glucosyltransferase 74F2, putative           84.7    2e-16   
ref|XP_002892298.1|  UDP-glucosyl transferase 75B1                    85.1    2e-16   
gb|KJB18350.1|  hypothetical protein B456_003G047900                  84.7    2e-16   Gossypium raimondii
ref|XP_010485047.1|  PREDICTED: UDP-glycosyltransferase 75B1 isof...  84.7    2e-16   
ref|XP_007157504.1|  hypothetical protein PHAVU_002G075200g           84.3    3e-16   Phaseolus vulgaris [French bean]
dbj|BAF49300.1|  putative glycosyltransferase                         84.3    4e-16   Clitoria ternatea
gb|KFK42892.1|  hypothetical protein AALP_AA1G052200                  84.3    4e-16   Arabis alpina [alpine rockcress]
ref|XP_010485054.1|  PREDICTED: UDP-glycosyltransferase 75B1 isof...  84.3    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010457643.1|  PREDICTED: UDP-glycosyltransferase 75B1-like     84.0    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010069228.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     84.0    6e-16   Eucalyptus grandis [rose gum]
ref|XP_004298222.1|  PREDICTED: crocetin glucosyltransferase, chl...  84.0    6e-16   Fragaria vesca subsp. vesca
dbj|BAJ97695.1|  predicted protein                                    83.6    6e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007041388.1|  UDP-Glycosyltransferase superfamily protein      83.6    6e-16   
gb|KDP45201.1|  hypothetical protein JCGZ_15066                       83.2    8e-16   Jatropha curcas
gb|KHN28671.1|  UDP-glycosyltransferase 74B1                          83.2    8e-16   Glycine soja [wild soybean]
ref|XP_003519432.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     83.2    8e-16   Glycine max [soybeans]
gb|AHL68667.1|  UDP-glucose: anthocyanin 5-O-glucosyltransferase      83.2    8e-16   Vitis amurensis
gb|KDP35132.1|  hypothetical protein JCGZ_10666                       83.2    9e-16   Jatropha curcas
emb|CDY44260.1|  BnaC03g24520D                                        83.2    1e-15   Brassica napus [oilseed rape]
emb|CBI36304.3|  unnamed protein product                              81.6    1e-15   Vitis vinifera
sp|Q9ZR25.1|5GT_VERHY  RecName: Full=Anthocyanidin 3-O-glucoside ...  83.2    1e-15   Glandularia x hybrida [garden verbena]
ref|XP_004309287.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     81.6    1e-15   Fragaria vesca subsp. vesca
emb|CDP20003.1|  unnamed protein product                              82.8    1e-15   Coffea canephora [robusta coffee]
emb|CDP21504.1|  unnamed protein product                              82.8    1e-15   Coffea canephora [robusta coffee]
ref|XP_010069575.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     82.8    1e-15   Eucalyptus grandis [rose gum]
ref|XP_006418014.1|  hypothetical protein EUTSA_v10007593mg           82.4    2e-15   
ref|XP_006415092.1|  hypothetical protein EUTSA_v10007589mg           82.4    2e-15   Eutrema salsugineum [saltwater cress]
gb|EYU17634.1|  hypothetical protein MIMGU_mgv1a006216mg              82.4    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_002892295.1|  UDP-glucosyl transferase 75B2                    82.0    2e-15   Arabidopsis lyrata subsp. lyrata
ref|NP_563742.1|  UDP-glucosyltransferase 75B1                        82.0    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010101353.1|  UDP-glycosyltransferase 74F2                     82.0    2e-15   Morus notabilis
ref|XP_010650442.1|  PREDICTED: crocetin glucosyltransferase, chl...  80.9    2e-15   
gb|EYU27003.1|  hypothetical protein MIMGU_mgv1a024986mg              81.6    3e-15   Erythranthe guttata [common monkey flower]
gb|KDP45202.1|  hypothetical protein JCGZ_15067                       81.6    3e-15   Jatropha curcas
sp|Q9ZR26.1|5GT2_PERFR  RecName: Full=Anthocyanidin 3-O-glucoside...  81.6    3e-15   Perilla frutescens [beefsteak-mint]
sp|Q9ZR27.1|5GT1_PERFR  RecName: Full=Anthocyanidin 3-O-glucoside...  81.6    3e-15   Perilla frutescens [beefsteak-mint]
dbj|BAK00438.1|  predicted protein                                    81.6    3e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP03926.1|  unnamed protein product                              81.6    3e-15   Coffea canephora [robusta coffee]
gb|KGN45711.1|  hypothetical protein Csa_6G007450                     81.3    4e-15   Cucumis sativus [cucumbers]
gb|EMS63606.1|  UDP-glycosyltransferase 74F2                          82.0    4e-15   Triticum urartu
ref|XP_010069572.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     81.3    5e-15   Eucalyptus grandis [rose gum]
gb|KCW57958.1|  hypothetical protein EUGRSUZ_H00692                   81.3    5e-15   Eucalyptus grandis [rose gum]
gb|EYU17631.1|  hypothetical protein MIMGU_mgv1a006064mg              81.3    5e-15   Erythranthe guttata [common monkey flower]
gb|ABL85474.1|  glycosyltransferase UGT75L4                           81.3    5e-15   Maclura pomifera
ref|XP_004307485.1|  PREDICTED: crocetin glucosyltransferase, chl...  80.9    6e-15   Fragaria vesca subsp. vesca
ref|XP_009119145.1|  PREDICTED: UDP-glycosyltransferase 75B1          80.9    6e-15   Brassica rapa
ref|XP_010100065.1|  UDP-glycosyltransferase 75D1                     80.5    6e-15   
emb|CDP20005.1|  unnamed protein product                              80.5    8e-15   Coffea canephora [robusta coffee]
gb|KFK39474.1|  hypothetical protein AALP_AA3G248900                  80.5    8e-15   Arabis alpina [alpine rockcress]
ref|XP_008793440.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  80.5    8e-15   Phoenix dactylifera
gb|KCW57960.1|  hypothetical protein EUGRSUZ_H00695                   80.1    8e-15   Eucalyptus grandis [rose gum]
gb|EAZ09773.1|  hypothetical protein OsI_32060                        77.8    9e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_007226459.1|  hypothetical protein PRUPE_ppa024612mg           80.5    1e-14   Prunus persica
dbj|BAF96596.1|  UDP-glucose:anthocysnin 5-O-glucosyltransferase      79.3    1e-14   Rosa hybrid cultivar
ref|XP_008458151.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  80.1    1e-14   Cucumis melo [Oriental melon]
ref|XP_006853436.1|  hypothetical protein AMTR_s00032p00176750        80.1    1e-14   Amborella trichopoda
gb|KJB27755.1|  hypothetical protein B456_005G008000                  80.1    1e-14   Gossypium raimondii
gb|EYU27002.1|  hypothetical protein MIMGU_mgv1a023035mg              80.1    1e-14   Erythranthe guttata [common monkey flower]
emb|CDY65144.1|  BnaC01g41850D                                        80.1    1e-14   Brassica napus [oilseed rape]
gb|AES96307.2|  UDP-glucosyltransferase family protein                80.1    1e-14   Medicago truncatula
emb|CDP03994.1|  unnamed protein product                              79.7    1e-14   Coffea canephora [robusta coffee]
emb|CDY47274.1|  BnaA10g03720D                                        79.7    2e-14   Brassica napus [oilseed rape]
emb|CDX83456.1|  BnaA03g20500D                                        79.7    2e-14   
ref|XP_009133636.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     79.7    2e-14   Brassica rapa
ref|XP_004298592.2|  PREDICTED: UDP-glycosyltransferase 74B1-like     79.7    2e-14   Fragaria vesca subsp. vesca
ref|XP_006478567.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     79.3    2e-14   
ref|XP_003613349.1|  UDP-glucose glucosyltransferase                  80.1    2e-14   
ref|XP_009781303.1|  PREDICTED: crocetin glucosyltransferase, chl...  79.3    2e-14   Nicotiana sylvestris
ref|XP_009146925.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     79.3    2e-14   Brassica rapa
ref|XP_006355935.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     79.3    2e-14   Solanum tuberosum [potatoes]
ref|NP_001063686.2|  Os09g0518400                                     80.1    2e-14   
emb|CDY22902.1|  BnaA01g18400D                                        79.0    3e-14   Brassica napus [oilseed rape]
ref|XP_002520220.1|  UDP-glucosyltransferase, putative                79.0    3e-14   Ricinus communis
gb|EYU17628.1|  hypothetical protein MIMGU_mgv1a020645mg              79.0    3e-14   Erythranthe guttata [common monkey flower]
ref|NP_001052234.1|  Os04g0204000                                     76.6    3e-14   
ref|XP_010091051.1|  UDP-glycosyltransferase                          79.0    3e-14   Morus notabilis
gb|EAZ09771.1|  hypothetical protein OsI_32058                        79.0    3e-14   Oryza sativa Indica Group [Indian rice]
emb|CDY65158.1|  BnaC03g72710D                                        78.6    3e-14   Brassica napus [oilseed rape]
ref|XP_006858833.1|  hypothetical protein AMTR_s00066p00178390        75.5    3e-14   
ref|XP_008243111.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     79.0    3e-14   
gb|AFJ52958.1|  UDP-glycosyltransferase 1                             78.6    4e-14   Linum usitatissimum
ref|XP_009142974.1|  PREDICTED: UDP-glycosyltransferase 74F2          78.6    4e-14   Brassica rapa
ref|XP_010069571.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     78.6    4e-14   Eucalyptus grandis [rose gum]
ref|XP_006294206.1|  hypothetical protein CARUB_v10023202mg           78.6    4e-14   Capsella rubella
ref|XP_011021104.1|  PREDICTED: crocetin glucosyltransferase, chl...  78.6    4e-14   Populus euphratica
ref|XP_007045533.1|  UDP-xylose phenolic glycosyltransferase, put...  78.6    4e-14   
ref|XP_009622557.1|  PREDICTED: crocetin glucosyltransferase, chl...  78.2    4e-14   
ref|XP_003613351.1|  N-hydroxythioamide S-beta-glucosyltransferase    78.6    5e-14   
emb|CDY17908.1|  BnaC04g03110D                                        78.2    5e-14   
ref|XP_011047643.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     78.2    5e-14   
gb|EYU31602.1|  hypothetical protein MIMGU_mgv1a021119mg              78.2    5e-14   
ref|XP_010549173.1|  PREDICTED: UDP-glycosyltransferase 75D1          78.2    5e-14   
ref|XP_010522273.1|  PREDICTED: UDP-glycosyltransferase 75B2-like     78.6    5e-14   
ref|XP_002309737.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  78.2    6e-14   
dbj|BAF49301.1|  putative glycosyltransferase                         78.2    6e-14   
dbj|BAP90370.1|  UDP-glycose: glycosyltransferase UGT75R1             78.2    6e-14   
gb|AFK36738.1|  unknown                                               77.8    7e-14   
ref|XP_010679006.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     77.8    7e-14   
ref|XP_002532442.1|  UDP-glucosyltransferase, putative                77.8    7e-14   
ref|XP_002267665.1|  PREDICTED: UDP-glycosyltransferase 74B1          77.8    7e-14   
emb|CDX83455.1|  BnaA03g20510D                                        77.8    7e-14   
ref|XP_002321569.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  77.8    7e-14   
ref|XP_004297014.1|  PREDICTED: crocetin glucosyltransferase, chl...  77.8    7e-14   
ref|XP_010506285.1|  PREDICTED: UDP-glycosyltransferase 74F2          77.8    8e-14   
gb|KDP31143.1|  hypothetical protein JCGZ_11519                       77.4    9e-14   
ref|XP_010915126.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...  78.6    9e-14   
gb|KEH25950.1|  UDP-glucosyltransferase family protein                77.4    9e-14   
gb|EEE70059.1|  hypothetical protein OsJ_30028                        77.8    9e-14   
ref|XP_011037065.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     77.4    9e-14   
ref|XP_007224980.1|  hypothetical protein PRUPE_ppa020679mg           77.4    9e-14   
ref|XP_008243112.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     77.4    1e-13   
dbj|BAD34403.1|  putative UDP-glucose:salicylic acid glucosyltran...  77.4    1e-13   
ref|NP_001063684.1|  Os09g0518000                                     77.4    1e-13   
ref|XP_010508370.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     77.4    1e-13   
ref|XP_007049529.1|  UDP-xylose phenolic glycosyltransferase, put...  77.4    1e-13   
ref|XP_006373420.1|  hypothetical protein POPTR_0017s13620g           77.4    1e-13   
gb|KCW82891.1|  hypothetical protein EUGRSUZ_C04261                   77.0    1e-13   
ref|XP_008245156.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     77.4    1e-13   
gb|KJB27754.1|  hypothetical protein B456_005G007900                  77.0    1e-13   
ref|XP_010069411.1|  PREDICTED: crocetin glucosyltransferase, chl...  77.0    1e-13   
ref|XP_010679007.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     77.0    1e-13   
emb|CAN68287.1|  hypothetical protein VITISV_017016                   77.0    1e-13   
ref|XP_011037069.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     77.0    1e-13   
ref|XP_004140604.1|  PREDICTED: UDP-glycosyltransferase 75C1-like     77.0    1e-13   
ref|XP_007203876.1|  hypothetical protein PRUPE_ppa005294mg           77.0    1e-13   
gb|KGN46579.1|  hypothetical protein Csa_6G109740                     77.0    1e-13   
gb|KCW59915.1|  hypothetical protein EUGRSUZ_H02639                   76.3    1e-13   
emb|CDY64613.1|  BnaAnng19430D                                        76.6    2e-13   
gb|ABK96547.1|  unknown                                               76.6    2e-13   
emb|CAB10333.1|  glucosyltransferase like protein                     76.6    2e-13   
ref|XP_009138617.1|  PREDICTED: UDP-glycosyltransferase 75B2-like     75.1    2e-13   
ref|XP_006285715.1|  hypothetical protein CARUB_v10007186mg           77.0    2e-13   
ref|XP_004162653.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     75.5    2e-13   
gb|KFK37204.1|  hypothetical protein AALP_AA4G227700                  76.6    2e-13   
gb|ACM66950.1|  flavonoid glucosyltransferase                         77.0    2e-13   
gb|AAB58497.1|  UDP-glucose:indole-3-acetate beta-D-glucosyltrans...  76.6    2e-13   
emb|CAD40017.2|  OSJNBa0052O21.2                                      75.5    2e-13   
ref|XP_002868197.1|  indole-3-acetate beta-D-glucosyltransferase      76.6    2e-13   
gb|AFJ52957.1|  UDP-glycosyltransferase 1                             76.6    2e-13   
ref|XP_004983225.1|  PREDICTED: crocetin glucosyltransferase 2-like   76.6    2e-13   
ref|NP_567471.1|  UDP-glucose:indole-3-acetate beta-D-glucosyltra...  76.6    2e-13   
ref|XP_002275194.2|  PREDICTED: UDP-glycosyltransferase 74E2          77.0    2e-13   
ref|XP_006442123.1|  hypothetical protein CICLE_v10020092mg           76.6    2e-13   
ref|XP_004957369.1|  PREDICTED: crocetin glucosyltransferase 2-like   76.6    2e-13   
ref|XP_008219026.1|  PREDICTED: UDP-glycosyltransferase 75C1-like     76.6    2e-13   
ref|XP_006355936.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     76.3    2e-13   
ref|XP_011047632.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     76.3    2e-13   
gb|EYU36923.1|  hypothetical protein MIMGU_mgv1a026563mg              76.3    2e-13   
gb|KDO38316.1|  hypothetical protein CISIN_1g027763mg                 73.6    2e-13   
gb|ADG45874.1|  UDP-glucosyltransferase                               76.3    2e-13   
ref|XP_010506287.1|  PREDICTED: UDP-glycosyltransferase 74F1 isof...  76.3    3e-13   
ref|XP_010517962.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     76.3    3e-13   
ref|XP_010101355.1|  UDP-glycosyltransferase 74F2                     76.3    3e-13   
ref|XP_004297667.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     76.3    3e-13   
ref|XP_006397555.1|  hypothetical protein EUTSA_v10001440mg           75.9    3e-13   
ref|XP_010517963.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     75.9    3e-13   
ref|XP_010039961.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     73.6    3e-13   
ref|XP_007199830.1|  hypothetical protein PRUPE_ppa005475mg           75.9    3e-13   
ref|XP_008236257.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     75.9    3e-13   
gb|KCW45598.1|  hypothetical protein EUGRSUZ_L006311                  73.6    3e-13   
ref|XP_008235864.1|  PREDICTED: UDP-glycosyltransferase 74E2-like     75.9    3e-13   
gb|KDO38317.1|  hypothetical protein CISIN_1g027763mg                 73.6    3e-13   
ref|XP_009133642.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     75.9    4e-13   
emb|CDY31602.1|  BnaA03g54500D                                        75.9    4e-13   
ref|XP_006296149.1|  hypothetical protein CARUB_v10025301mg           75.9    4e-13   
ref|XP_004239848.1|  PREDICTED: crocetin glucosyltransferase, chl...  75.9    4e-13   
ref|NP_973682.1|  UDP-glycosyltransferase 74 F1                       75.9    4e-13   
ref|XP_009765147.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  73.6    4e-13   
ref|XP_004167067.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     73.2    4e-13   
ref|NP_181912.1|  UDP-glycosyltransferase 74 F1                       75.5    4e-13   
ref|XP_009630994.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     75.5    4e-13   
ref|XP_002880070.1|  UDP-glucosyltransferase 74F2                     75.5    4e-13   
ref|XP_006397556.1|  hypothetical protein EUTSA_v10001441mg           75.5    4e-13   
ref|NP_181910.1|  UDP-glucosyltransferase 74F2                        75.5    4e-13   
ref|XP_009133637.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     75.5    4e-13   
ref|XP_010508369.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     75.5    5e-13   
gb|KJB27756.1|  hypothetical protein B456_005G008100                  75.5    5e-13   
emb|CDY65159.1|  BnaC03g72720D                                        73.9    5e-13   
ref|XP_004144399.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     75.5    5e-13   
ref|XP_007133505.1|  hypothetical protein PHAVU_011G184600g           75.5    5e-13   
ref|XP_010506284.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     75.5    5e-13   
emb|CDP15115.1|  unnamed protein product                              75.5    5e-13   
gb|AJA79079.1|  UDP-glycosyltransferase                               74.3    5e-13   
gb|EEE60508.1|  hypothetical protein OsJ_13814                        75.1    5e-13   
ref|XP_002310396.2|  hypothetical protein POPTR_0007s00860g           75.1    5e-13   
ref|XP_002278455.1|  PREDICTED: UDP-glycosyltransferase 74F2          75.5    5e-13   
ref|XP_004162387.1|  PREDICTED: UDP-glycosyltransferase 75C1-like     75.5    5e-13   
emb|CDP21774.1|  unnamed protein product                              74.7    6e-13   
ref|XP_010434952.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     75.1    6e-13   
ref|XP_010434517.1|  PREDICTED: UDP-glycosyltransferase 75D1          75.1    6e-13   
ref|XP_011043909.1|  PREDICTED: crocetin glucosyltransferase, chl...  75.5    6e-13   
gb|KFK37205.1|  hypothetical protein AALP_AA4G227800                  75.1    6e-13   
gb|KDP45197.1|  hypothetical protein JCGZ_15062                       75.1    6e-13   
gb|AFK49280.1|  unknown                                               72.8    6e-13   
ref|XP_003576736.1|  PREDICTED: crocetin glucosyltransferase 2-like   75.1    7e-13   
emb|CDY10124.1|  BnaC05g03670D                                        75.1    7e-13   
ref|XP_002880071.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  74.7    7e-13   
emb|CDY17907.1|  BnaC04g03120D                                        74.7    7e-13   
ref|XP_002310479.2|  putative glucosyltransferase family protein      74.7    7e-13   
gb|KFK37203.1|  hypothetical protein AALP_AA4G227600                  74.7    7e-13   
ref|XP_010037080.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     74.7    7e-13   
ref|XP_008460407.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     74.7    8e-13   
ref|XP_002305226.2|  hypothetical protein POPTR_0004s08200g           75.1    8e-13   
emb|CDM81835.1|  unnamed protein product                              74.7    8e-13   
gb|KCW57186.1|  hypothetical protein EUGRSUZ_H00001                   74.3    9e-13   
ref|XP_009783230.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     74.7    9e-13   
emb|CDX79797.1|  BnaA05g03590D                                        74.3    1e-12   
ref|XP_009142972.1|  PREDICTED: UDP-glycosyltransferase 74F1          74.3    1e-12   
emb|CDY64614.1|  BnaAnng19440D                                        74.3    1e-12   
gb|AAR06920.1|  UDP-glycosyltransferase 74G1                          74.3    1e-12   
gb|ACM09899.2|  glycosyltransferase                                   74.3    1e-12   
emb|CDP15113.1|  unnamed protein product                              74.3    1e-12   
ref|XP_010025793.1|  PREDICTED: crocetin glucosyltransferase, chl...  74.3    1e-12   
gb|ACD03250.1|  UDP-glycosyltransferase UGT74H5                       74.3    1e-12   
ref|XP_007049534.1|  UDP-xylose phenolic glycosyltransferase, put...  74.3    1e-12   
ref|XP_003578448.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     74.3    1e-12   
ref|XP_010672476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...  74.3    1e-12   
dbj|BAG80541.1|  UDP-glucose:glucosyltransferase                      74.3    1e-12   
ref|XP_010692817.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     74.3    1e-12   
ref|XP_009630995.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     73.9    1e-12   
gb|EYU29695.1|  hypothetical protein MIMGU_mgv1a006214mg              73.9    1e-12   
ref|XP_010524193.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     73.9    1e-12   
ref|XP_010037081.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     73.9    2e-12   
ref|XP_006478564.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     73.9    2e-12   
gb|KJB20645.1|  hypothetical protein B456_003G157800                  73.9    2e-12   
ref|XP_004162644.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     73.9    2e-12   
ref|XP_009590752.1|  PREDICTED: UDP-glycosyltransferase 74B1          73.9    2e-12   
ref|XP_010233316.1|  PREDICTED: crocetin glucosyltransferase, chl...  74.7    2e-12   
emb|CDP13108.1|  unnamed protein product                              73.6    2e-12   
ref|XP_010695870.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     73.9    2e-12   
gb|KEH25946.1|  UDP-glucosyltransferase family protein                73.9    2e-12   
ref|XP_007049526.1|  UDP-xylose phenolic glycosyltransferase, put...  73.9    2e-12   
emb|CAH66224.1|  H0825G02.1                                           72.8    2e-12   
ref|XP_008236256.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     73.9    2e-12   
ref|XP_004144461.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     73.9    2e-12   
ref|XP_006357097.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     72.8    2e-12   
ref|XP_006478556.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...  73.6    2e-12   
ref|XP_006478555.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...  73.6    2e-12   
emb|CDP12455.1|  unnamed protein product                              71.2    2e-12   
ref|XP_010672475.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...  73.6    2e-12   
ref|XP_009373249.1|  PREDICTED: crocetin glucosyltransferase, chl...  73.6    2e-12   
ref|XP_008458143.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  73.6    2e-12   
ref|XP_003565426.1|  PREDICTED: crocetin glucosyltransferase, chl...  73.6    3e-12   
gb|KEH25944.1|  UDP-glucosyltransferase family protein                73.2    3e-12   
ref|XP_004957373.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     73.2    3e-12   
ref|XP_009373248.1|  PREDICTED: crocetin glucosyltransferase, chl...  73.2    3e-12   
emb|CDP13110.1|  unnamed protein product                              73.2    3e-12   
ref|XP_008455273.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     73.2    3e-12   
gb|KHG30812.1|  hypothetical protein F383_15387                       73.2    3e-12   
ref|XP_003548080.2|  PREDICTED: UDP-glycosyltransferase 74E2-like     73.2    3e-12   
ref|XP_004957367.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     73.2    3e-12   
ref|XP_004137037.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     73.2    3e-12   
ref|XP_008788244.1|  PREDICTED: crocetin glucosyltransferase 2-li...  73.2    3e-12   
ref|XP_003565425.1|  PREDICTED: crocetin glucosyltransferase, chl...  73.2    3e-12   
ref|XP_008337182.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     70.9    3e-12   
ref|XP_008788243.1|  PREDICTED: crocetin glucosyltransferase 2-li...  73.2    3e-12   
dbj|BAJ95093.1|  predicted protein                                    73.2    3e-12   
ref|XP_009410732.1|  PREDICTED: crocetin glucosyltransferase 2-like   73.2    4e-12   
ref|XP_008236255.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     72.8    4e-12   
ref|XP_008793435.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  72.8    4e-12   
ref|XP_010039940.1|  PREDICTED: crocetin glucosyltransferase, chl...  72.8    4e-12   
ref|XP_008663072.1|  PREDICTED: crocetin glucosyltransferase 2-like   72.8    4e-12   
ref|XP_011086491.1|  PREDICTED: UDP-glycosyltransferase 74B1          72.8    4e-12   
ref|XP_007199115.1|  hypothetical protein PRUPE_ppa020804mg           72.8    4e-12   
ref|XP_008670324.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     72.8    4e-12   
ref|XP_010440288.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     72.8    4e-12   
emb|CDY09068.1|  BnaC08g10220D                                        72.8    4e-12   
ref|XP_009783229.1|  PREDICTED: UDP-glycosyltransferase 74F1-like     72.8    4e-12   
ref|XP_010679010.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...  72.8    5e-12   
gb|AFJ52962.1|  UDP-glycosyltransferase 1                             72.8    5e-12   
ref|XP_004289755.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     72.4    5e-12   
dbj|BAF03079.1|  UDP-glucose:flavonol 5-O-glucosyltransferase hom...  72.0    5e-12   
ref|XP_002532446.1|  UDP-glucosyltransferase, putative                70.1    5e-12   
ref|XP_009599369.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...  72.4    5e-12   
ref|XP_006282963.1|  hypothetical protein CARUB_v10007692mg           72.4    5e-12   
ref|XP_006365463.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...  72.4    6e-12   
ref|XP_008239719.1|  PREDICTED: UDP-glycosyltransferase 74B1-like     72.4    6e-12   
ref|XP_009403483.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...  72.4    6e-12   
ref|XP_004965984.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     72.4    6e-12   
ref|XP_003541519.1|  PREDICTED: UDP-glycosyltransferase 74E1-like     72.4    6e-12   
gb|KHN09954.1|  UDP-glycosyltransferase 74E1                          72.4    6e-12   
ref|NP_001266446.1|  hypothetical protein                             70.1    6e-12   
ref|XP_010679009.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...  72.0    7e-12   
ref|XP_002467184.1|  hypothetical protein SORBIDRAFT_01g021110        72.0    7e-12   
ref|XP_004290110.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     72.0    7e-12   
ref|XP_010242476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like     72.0    7e-12   
ref|XP_006414486.1|  hypothetical protein EUTSA_v10027441mg           72.0    8e-12   
ref|NP_001173794.1|  Os04g0206450                                     71.6    8e-12   
dbj|BAG80546.1|  UDP-glucose:glucosyltransferase                      72.0    8e-12   
emb|CBI39402.3|  unnamed protein product                              70.9    8e-12   
ref|XP_009362456.1|  PREDICTED: crocetin glucosyltransferase, chl...  72.0    8e-12   
emb|CAN74227.1|  hypothetical protein VITISV_041748                   72.0    8e-12   
ref|XP_007210590.1|  hypothetical protein PRUPE_ppa016463mg           72.0    8e-12   
ref|XP_007033647.1|  UDP-glycosyltransferase 74 F1, putative          72.0    8e-12   
ref|XP_009107848.1|  PREDICTED: UDP-glycosyltransferase 75D1-like     72.0    8e-12   
emb|CDY22742.1|  BnaA08g05720D                                        71.6    9e-12   
ref|XP_007041390.1|  UDP-Glycosyltransferase superfamily protein      71.6    9e-12   
emb|CDX68805.1|  BnaC01g06480D                                        71.6    9e-12   
emb|CDY21979.1|  BnaC09g00850D                                        71.6    9e-12   
ref|XP_008654639.1|  PREDICTED: uncharacterized protein LOC100274...  71.6    9e-12   
emb|CDY09069.1|  BnaC08g10230D                                        71.6    1e-11   
gb|EAY93060.1|  hypothetical protein OsI_14863                        70.9    1e-11   
ref|XP_010100517.1|  UDP-glycosyltransferase 74F2                     69.7    1e-11   
gb|KDO35889.1|  hypothetical protein CISIN_1g042896mg                 69.3    1e-11   
gb|KJB61182.1|  hypothetical protein B456_009G344800                  71.6    1e-11   
ref|XP_007200780.1|  hypothetical protein PRUPE_ppa023990mg           69.3    1e-11   
ref|XP_006295749.1|  hypothetical protein CARUB_v10024869mg           71.2    1e-11   



>ref|XP_009590508.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=463

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  74   DCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSD  253
            +C+VLLV +P QG INPC+QF+KRLV+LGV +TF TSL+  NR+   P+I G+ FA FSD
Sbjct  7    NCHVLLVTFPGQGNINPCIQFSKRLVKLGVNVTFSTSLTAFNRITNLPTIEGLTFAPFSD  66

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D  FKGS   + +FN S R  GS+ + DL+  +  QG+P  R+IYTT   WVG+LA
Sbjct  67   GFDGNFKGSTNNFHEFNKSFRTNGSEFVTDLVKTRKNQGNPFKRIIYTTLTGWVGLLA  124



>dbj|BAG80545.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=467

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +2

Query  71   KDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFS  250
             DC+VLLV +P QG INP LQFAKRLV LGVK+TF TSLS  NR+ + P+I G+ FA FS
Sbjct  6    NDCHVLLVTFPGQGHINPSLQFAKRLVNLGVKVTFSTSLSAFNRISKLPNIEGLSFAPFS  65

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D  FKGS  E+  F +SL + GS+ +  ++ +++ +G P +R+IYTT M WVG++A
Sbjct  66   DGYDGKFKGSMNEFDSFYSSLMSHGSEFVTQIIKSRVAEGHPFTRIIYTTIMAWVGVVA  124



>ref|XP_009778637.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
 ref|XP_009778638.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=463

 Score =   139 bits (349),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +2

Query  74   DCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSD  253
            DC+VLLV +P QG INPC+QF+KRLV+LGV +TF TSL+  NR+   P+I G+ FA FSD
Sbjct  7    DCHVLLVTFPGQGNINPCIQFSKRLVKLGVNVTFSTSLTAFNRIANLPTIEGLTFAPFSD  66

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D  FKGS   + +FN S R +GS+ + +L+  + ++G+P  R++YTT   WVG+LA
Sbjct  67   GFDGNFKGSMNNFHEFNNSFRTQGSEFVINLVKTRAKEGNPFKRIVYTTLTGWVGLLA  124



>ref|XP_006349902.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=459

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +2

Query  74   DCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSD  253
            DC+VL+V +  QG INPC+QF+K L++LGV +TF TSL+  NR+   P+I G+ FA FSD
Sbjct  7    DCHVLVVSFTGQGNINPCIQFSKNLIKLGVNVTFSTSLTAFNRISNLPTIQGLTFAPFSD  66

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D  F GS   + +FNASLR  G++ + +L+  + +QG P  R+IYTT   W+G+LA
Sbjct  67   GFDGNFNGSTNSFREFNASLRTHGTEFVTNLVEDRAKQGCPFKRIIYTTLTAWIGLLA  124



>ref|XP_009612652.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=481

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +2

Query  71   KDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFS  250
             +C+VLLV +P QG INP LQF+KRLV LGVK+TF TSL+  NR+   P+I G+ FA FS
Sbjct  6    NECHVLLVTFPGQGHINPSLQFSKRLVNLGVKVTFSTSLTAFNRINNLPTIEGLTFAPFS  65

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D  FKGS +E   F +SL + GS+ +  L+T +  +G P +R+IYTT M WVG++A
Sbjct  66   DGYDGKFKGSVDELHSFYSSLISHGSEFVTRLVTFRTAEGRPFTRIIYTTLMAWVGLVA  124



>ref|XP_004252977.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=463

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = +2

Query  74   DCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSD  253
            DC+VL+V +  QG INPC+QF+K L++LGV +TF TSL+  NR+   P+I G+ FA FSD
Sbjct  7    DCHVLVVSFTGQGNINPCIQFSKNLIKLGVNVTFSTSLTAFNRISNLPTIQGLTFAPFSD  66

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D  FKG      +FNASLR  G++ + +L+  + +QG P  R+IYTT   W+G+LA
Sbjct  67   GYDGNFKGPMNRIHEFNASLRTHGTEFVTNLVEDRAKQGCPFKRIIYTTLTAWIGLLA  124



>ref|XP_004247895.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=468

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  74   DCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSD  253
            DC+VLLV +P QG INP LQFAK+LV LG+ +TF TSL+  NR+ + P+I G+ F  FSD
Sbjct  7    DCHVLLVTFPGQGHINPSLQFAKKLVNLGLNVTFSTSLTAFNRISKLPNIEGLSFTPFSD  66

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D  F+GS +E+  F +SL + GS+ +  ++ ++  +G P  RVIYTT M WVGI+A
Sbjct  67   GYDGKFEGSLDEFESFYSSLVSHGSEFMTQIIESRAVEGRPFKRVIYTTLMAWVGIVA  124



>dbj|BAA19155.1| glucosyl transferase [Nicotiana tabacum]
Length=467

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  74   DCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSD  253
            +C+VL+ ++P QG INP LQF+K+L+ LGVK+T  +SLS  NR+   P I G+ FA FSD
Sbjct  7    ECHVLIALFPGQGHINPSLQFSKKLINLGVKVTLSSSLSAFNRIKNLPKIEGLTFAPFSD  66

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D  FKGS ++Y  FN+++++ GS+ I +L+ +K + G P +RVIYT  M W G +A
Sbjct  67   GYDGNFKGSFDDYHLFNSAIKSHGSEFIANLIKSKAKNGYPFTRVIYTILMDWAGSVA  124



>ref|XP_009765809.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X1 [Nicotiana sylvestris]
Length=485

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  74   DCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSD  253
            +C+VL+ ++P QG INP LQF+K+L+ LGVK+T  +SLS  NR+   P I G+ FA FSD
Sbjct  25   ECHVLIALFPGQGHINPSLQFSKKLINLGVKVTLSSSLSAFNRIKNLPKIEGLTFAPFSD  84

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D  FKGS ++Y  FN+++++ GS+ I +L+ +K + G P +RVIYT  M W G +A
Sbjct  85   GYDGNFKGSFDDYHLFNSAIKSHGSEFIANLIKSKAKNGYPFTRVIYTILMDWAGSVA  142



>ref|XP_004242781.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=466

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +2

Query  59   HMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDF  238
            +++  +C+VLLV YP  G INPCLQFAKRLV LGV++T+ TSLS  NR+   P+I G+ F
Sbjct  3    NLKKNNCHVLLVSYPILGHINPCLQFAKRLVNLGVQVTYCTSLSGFNRISNLPTIKGLSF  62

Query  239  ATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGS-PISRVIYTTFMPWV  415
            A FSDG+D GFKGS +EY  F  S++  GS+ + ++++    + +   +R+IYTT M WV
Sbjct  63   APFSDGYDGGFKGSFDEYHLFCNSMKTYGSEFVINMVSEHTTKKNLAFTRIIYTTLMAWV  122

Query  416  GILA  427
            G +A
Sbjct  123  GSVA  126



>ref|XP_009612650.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X1 [Nicotiana tomentosiformis]
Length=467

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = +2

Query  71   KDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFS  250
             DC+VL+ ++P QG INP  QF+K+L+ LGVK+T   SL+  NR+   P I G+ FA FS
Sbjct  6    NDCHVLIAIFPGQGHINPSFQFSKKLINLGVKVTLSCSLTAFNRIKNLPKIEGLTFAPFS  65

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D  FKGS ++Y   N++++  GS+ I +L+ +  + G P +RVIYT  M W G +A
Sbjct  66   DGYDGNFKGSFDDYHLLNSAIKTHGSEFIANLIKSNAENGCPFTRVIYTILMDWAGSVA  124



>ref|XP_009787090.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=466

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 87/123 (71%), Gaps = 4/123 (3%)
 Frame = +2

Query  71   KDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEP-PSIHGVDFATF  247
            ++C+VLLV +P+QGQINP LQFAKRL++LGV +TF TSLS +N M     SI G+ FA F
Sbjct  6    ENCHVLLVTFPSQGQINPSLQFAKRLIKLGVNVTFSTSLSALNCMSNNLSSIKGLTFAPF  65

Query  248  SDGWDAGFKG---SDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
            SDG+D G+     S +EY +F AS  A GS+ + ++   + ++G P SR+IYTT + WVG
Sbjct  66   SDGYDNGYPNVGKSLDEYREFYASFIALGSEFVSEIFADRAKEGRPFSRIIYTTVLSWVG  125

Query  419  ILA  427
            I+A
Sbjct  126  IVA  128



>ref|XP_009622554.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=467

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 89/126 (71%), Gaps = 5/126 (4%)
 Frame = +2

Query  65   EMKD-CNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEP-PSIHGVDF  238
            ++KD C+VLLV +P+QGQINP LQFAKRL++LGV +TF TSLS +N +    PS+ G+  
Sbjct  3    KLKDNCHVLLVTFPSQGQINPSLQFAKRLIKLGVNVTFSTSLSALNCISNNLPSVEGLTL  62

Query  239  ATFSDGWDAGFKG---SDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMP  409
            A FSDG+D G+     S +EY +F AS  A GS+ + ++ T + ++G P SR+IYT  + 
Sbjct  63   APFSDGYDNGYPNVGKSLDEYREFYASFIALGSEFVSEIFTDRAKEGRPFSRIIYTAVLS  122

Query  410  WVGILA  427
            WVGI+A
Sbjct  123  WVGIVA  128



>ref|XP_004247896.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=476

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 87/130 (67%), Gaps = 0/130 (0%)
 Frame = +2

Query  38   YP*RLEDHMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPP  217
            +P +  ++M     +VL+V++PAQG INP LQ +KRL++LG+K+T  TSLS  N++   P
Sbjct  15   FPTKKMENMRNDKSHVLIVIFPAQGHINPSLQLSKRLIDLGIKVTLSTSLSAFNKIKILP  74

Query  218  SIHGVDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYT  397
            +I G+ FA FSDG+D  FKGS  E+  + +S+++ GS+ I +L+ +  +  +P + VIYT
Sbjct  75   NIEGLSFAPFSDGYDGNFKGSFNEFHLYYSSIKSHGSEFIFNLIKSNAKNCTPFTHVIYT  134

Query  398  TFMPWVGILA  427
              M W  ++A
Sbjct  135  VVMEWTALVA  144



>ref|XP_006342284.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=467

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            +VL+ ++P QGQINPCLQF+K+L+ LG+++T  TSLS  +++ + P++ G+ FA FSDG+
Sbjct  10   HVLIALFPGQGQINPCLQFSKQLINLGIEVTLTTSLSAFSKIKKLPNVEGLSFAPFSDGY  69

Query  260  DAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D  F+  S +++  F +S++++GSK I +L+ +  + G+P S VIYT  M WVG++A
Sbjct  70   DGKFQLSSVDDFYLFYSSVKSRGSKFIFNLIQSNAKNGTPFSHVIYTIIMEWVGLVA  126



>ref|XP_004229323.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=467

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +2

Query  59   HMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDF  238
            +++++  +VL+ ++P QGQINPCLQF+K+L+ LG+ +T  TSLS  +++   P++ G+ F
Sbjct  3    NLKIEKSHVLIALFPGQGQINPCLQFSKQLINLGIGVTLTTSLSAFSKLKCLPNVEGLSF  62

Query  239  ATFSDGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
            A FSDG+D  F+  S +++  F +S+++ GSK I +L+ +  + G+P S VIYT  M WV
Sbjct  63   APFSDGYDGQFQLSSVDDFHMFYSSVKSHGSKFIFNLIQSNAKNGTPFSHVIYTIIMEWV  122

Query  416  GILA  427
            G++A
Sbjct  123  GLVA  126



>dbj|BAG80537.1| putative glycosyltransferase [Lycium barbarum]
Length=471

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = +2

Query  56   DHMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVD  235
            ++++ +  +VL+ ++P QG INP LQ +K+L++LGV++T  +SLS  N++ + P+I G+ 
Sbjct  2    ENLKNEKSHVLIAIFPGQGHINPSLQLSKQLIKLGVEVTLSSSLSAFNKIKKLPNIQGLR  61

Query  236  FATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
            FA FSDG+D  FKGS +EY   N+S+ + GS+ I +L+ +  + G P S VIYT  M W 
Sbjct  62   FAPFSDGYDGKFKGSFDEYHLLNSSIMSHGSEFILNLIKSNSKNGPPFSHVIYTPLMDWA  121

Query  416  GILA  427
            G +A
Sbjct  122  GSVA  125



>ref|XP_003552552.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Glycine max]
Length=465

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWDA  265
            LL+ YP QG INP +QFAKRLV +GV +TF TSL +  RM + P+I G+ FATFSDG+D 
Sbjct  7    LLITYPIQGHINPSIQFAKRLVSMGVHVTFATSLYLHRRMLKKPTIPGLSFATFSDGYDD  66

Query  266  GFKGSDEEYL-QFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+K +D+  L  + + L+ +GS+ + +++TA  Q+G P + + YT  +PW   +A
Sbjct  67   GYKATDDSSLSSYMSELKRRGSEFLRNIITAAKQEGQPFTCLAYTILLPWAAKVA  121



>dbj|BAB88935.1| glucosyltransferase [Nicotiana tabacum]
Length=470

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI---HGVDFATFS  250
            +VLLV +PAQG INPCLQFAKRL+ +G+++TF TS+    RM +  +     G++FA FS
Sbjct  5    HVLLVTFPAQGHINPCLQFAKRLIRMGIEVTFATSVFAHRRMAKTTTSTLSKGLNFAAFS  64

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D GFK  + +   + + ++++GSK ++D++     +G P++ ++Y+  +PW   +A
Sbjct  65   DGYDDGFKADEHDSQHYMSEIKSRGSKTLKDIILKSSDEGRPVTSLVYSLLLPWAAKVA  123



>emb|CDP15120.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 82/127 (65%), Gaps = 13/127 (10%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRM-------PEPPSIH  226
            M++C+ L+V +P QG INP LQFAKRL +LGV+ TF TSL  +NRM       PE  SI 
Sbjct  1    MENCHFLVVTFPGQGHINPTLQFAKRLAKLGVRTTFSTSLGAINRMSRASDSLPEKLSI-  59

Query  227  GVDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFM  406
                  FSDG+D G+  +D++  ++  SL  +GS+ +++L+ A+  +G PI+ V+Y   M
Sbjct  60   ----VAFSDGYDQGWT-TDDDVQEYMTSLVTRGSQTLKELIMAQSNEGRPITHVVYAILM  114

Query  407  PWVGILA  427
            PWVG +A
Sbjct  115  PWVGQVA  121



>emb|CBI39410.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = +2

Query  65   EMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFAT  244
            ++    +LLV YPAQG INP LQ AK L   G  +TF+TS S   RM +PP++ G++F T
Sbjct  27   QIMQAQILLVTYPAQGHINPSLQLAKLLTRAGAHVTFVTSSSASTRMSKPPTLEGLEFVT  86

Query  245  FSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            FSDG+D GFK  D +   F + L   GS+A+ +L+ A+  +G P + ++Y   +PWV  +
Sbjct  87   FSDGYDHGFKHGD-DLQNFMSELDRLGSQALTELIVARANEGRPFTCLLYGIIIPWVAEV  145

Query  425  A  427
            A
Sbjct  146  A  146



>emb|CDP15119.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 81/127 (64%), Gaps = 13/127 (10%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRM-------PEPPSIH  226
            M+ C+ L+V +PAQG INP LQFAKRL +LGVK TF TSL  +NRM       PE  SI 
Sbjct  1    MEKCHFLIVTFPAQGHINPTLQFAKRLAKLGVKTTFSTSLGAINRMNKASGSLPEKLSI-  59

Query  227  GVDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFM  406
                  FSDG+D G+  +D ++ ++  S   +GS+ +++L+ A+  +G PI+ V+YT  M
Sbjct  60   ----VAFSDGYDHGWNPND-DFGRYMTSAATRGSQTLKELIMAQSNEGHPITHVVYTILM  114

Query  407  PWVGILA  427
             WVG +A
Sbjct  115  SWVGQVA  121



>ref|XP_009601422.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=470

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 79/119 (66%), Gaps = 3/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI---HGVDFATFS  250
            +VLLV +PAQG INPCLQFA RL+ +G+++TF TS+    RM +  +     G++FA FS
Sbjct  5    HVLLVTFPAQGHINPCLQFANRLIRMGIEVTFATSVFAHRRMAKTTTFTLSKGLNFAAFS  64

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D GFK  + +   + + ++++GS+ ++D++     +G P++ ++Y+  +PW   +A
Sbjct  65   DGYDDGFKADEHDSQHYMSEIKSRGSETLKDIILKSSDEGRPVTSLVYSLLLPWAAKVA  123



>ref|XP_002263301.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=464

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = +2

Query  83   VLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            +LLV YPAQG INP LQ AK L   G  +TF+TS S   RM +PP++ G++F TFSDG+D
Sbjct  5    ILLVTYPAQGHINPSLQLAKLLTRAGAHVTFVTSSSASTRMSKPPTLEGLEFVTFSDGYD  64

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D +   F + L   GS+A+ +L+ A+  +G P + ++Y   +PWV  +A
Sbjct  65   HGFKHGD-DLQNFMSELDRLGSQALTELIVARANEGRPFTCLLYGIIIPWVAEVA  118



>gb|KJB28077.1| hypothetical protein B456_005G025900 [Gossypium raimondii]
Length=469

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 78/122 (64%), Gaps = 5/122 (4%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + LLV +PAQG INP LQFAK L+ +GV++TF+T +S   RM + P+  G+ F  F
Sbjct  1    MSQPHFLLVTFPAQGHINPTLQFAKHLIRIGVRVTFITCISAHRRMTKVPTAQGLTFLPF  60

Query  248  SDGWDAGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            SDG+D GF+  D  E YL   + LR +G +AI + +T+   +G P++ ++YT F+ W   
Sbjct  61   SDGYDDGFQPGDDIEHYL---SELRRRGKEAISEFITSSENEGKPVTCIVYTLFIHWASE  117

Query  422  LA  427
            +A
Sbjct  118  VA  119



>ref|XP_009790237.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=468

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 79/119 (66%), Gaps = 3/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI---HGVDFATFS  250
            +VLLV +PAQG INPCLQFA RL+ +G+++TF TSL    RM +  +     G++FA FS
Sbjct  5    HVLLVTFPAQGHINPCLQFAMRLIRMGIEVTFATSLFAHRRMAKTATSTLPKGLNFAPFS  64

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D GFK  + +   + + ++++GS+ ++D++     +G P++ ++Y+  +PW   +A
Sbjct  65   DGYDDGFKADEHDSQHYMSEIKSRGSETLKDIILKSSDEGRPVTSLVYSLLLPWAANVA  123



>gb|EYU31586.1| hypothetical protein MIMGU_mgv1a005918mg [Erythranthe guttata]
Length=465

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPS--IHGVDFATFSD  253
            +VLLV +P QG INP LQFAKRL  +G+K+TF TSL    RM    +    GV FA FSD
Sbjct  6    HVLLVTFPVQGHINPSLQFAKRLTAMGIKVTFATSLYARRRMSRTAAGLPKGVTFAAFSD  65

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D GF   +++  ++   +R++GS+++ D + A  +QG P+++++YT  +PW   +A
Sbjct  66   GYDDGFNPGNDDAGKYMTEIRSRGSQSLRDTILAAAEQGCPVTQLVYTLLLPWAPEVA  123



>gb|EYU31587.1| hypothetical protein MIMGU_mgv1a018203mg [Erythranthe guttata]
Length=465

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPS--IHGVDFATFSD  253
            +VLLV +P QG INP LQFAKRL  +G+K+TF TSL    RM    +    GV FA FSD
Sbjct  6    HVLLVTFPVQGHINPSLQFAKRLTAMGIKVTFATSLYARRRMSRTAAGLPKGVTFAAFSD  65

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D GF   +++  ++   +R++GS+++ D + A  +QG P+++++YT  +PW   +A
Sbjct  66   GYDDGFNPGNDDAGKYMTEIRSRGSQSLRDTILAAAEQGCPVTQLVYTLLLPWAPEVA  123



>gb|KJB28079.1| hypothetical protein B456_005G026100, partial [Gossypium raimondii]
Length=535

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 78/122 (64%), Gaps = 5/122 (4%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + LLV +PAQG INP LQFAK L+ +GV++TF+T +S   RM + P+  G+ F  F
Sbjct  63   MSQLHFLLVTFPAQGHINPTLQFAKHLIRIGVRVTFITCISARRRMSKVPTAQGLTFLPF  122

Query  248  SDGWDAGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            SDG+D GF+  D  + YL   + LR +G +AI + +T+   +G P++ ++YT F+ W   
Sbjct  123  SDGYDDGFQPCDDIDHYL---SELRRRGKEAISEFITSSENEGKPVTCIVYTLFIHWASE  179

Query  422  LA  427
            +A
Sbjct  180  VA  181



>gb|EYU32718.1| hypothetical protein MIMGU_mgv1a005538mg [Erythranthe guttata]
Length=480

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 4/116 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            +VLLV +PAQG INP LQFAKRL +LGV +TFLTS S V RM    +   ++FA+FSDG+
Sbjct  8    HVLLVTFPAQGHINPSLQFAKRLAKLGVAVTFLTSSSAVRRMTT--TAAAINFASFSDGF  65

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G+  S++E   F A+LR  GSKA+ED + A   +  P SRVIYT  +PW G +A
Sbjct  66   DGGW--SNDETQNFMAALRTHGSKAVEDAVAAAAAENRPFSRVIYTLLVPWAGQVA  119



>ref|XP_011069457.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like, 
partial [Sesamum indicum]
Length=372

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 80/123 (65%), Gaps = 4/123 (3%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI---HGVDF  238
            M   +VLLV +PAQG INP LQFAKRL+++G+++TF TSL    RM +  +     G+ F
Sbjct  1    MSRRHVLLVTFPAQGHINPSLQFAKRLIDMGIEVTFATSLYARRRMEKTAARDLPKGLSF  60

Query  239  ATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
            A FSDG+D GF  SD+   ++   +R++G+K ++D   +  +QG P++ +IYT  +PW  
Sbjct  61   AAFSDGYDDGFTMSDDPR-KYMTEIRSRGAKTLKDTALSAAEQGRPVTCLIYTLLLPWAS  119

Query  419  ILA  427
             +A
Sbjct  120  EVA  122



>gb|AJM89728.1| UDP-glucosyltransferase [Leonurus japonicus]
Length=455

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIH-GVDFAT  244
            M+  +VLLV  PA G INP LQFAKRL+ +G+ +TF+TS+    RM     ++ G+ F +
Sbjct  1    MERRHVLLVTIPALGHINPALQFAKRLINMGIHVTFVTSVYARRRMAAAAHVNNGLTFTS  60

Query  245  FSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            FSDG+D GFK   ++  ++   +R++GSKA+ D + A  +QG PI+R++YT  +PW   +
Sbjct  61   FSDGYDDGFKPGTDDAKKYMVEIRSQGSKALRDTIAAAAEQGRPITRLVYTLLLPWAAEV  120

Query  425  A  427
            A
Sbjct  121  A  121



>ref|XP_002868314.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44573.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=453

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 74/116 (64%), Gaps = 1/116 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV +PAQG INP LQ A RL+  G  +T+ T++S   RM EPPS  G+ FA F+DG+
Sbjct  12   HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPSTKGLSFAWFTDGF  71

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G K  +++ + + + L+  GS A+ D++ A L    PI+ VIY+  +PWV  +A
Sbjct  72   DDGLKSLEDQKI-YMSELKRCGSNALRDIIRANLDATEPITGVIYSVLVPWVSTVA  126



>ref|XP_006414807.1| hypothetical protein EUTSA_v10025167mg [Eutrema salsugineum]
 gb|ESQ56260.1| hypothetical protein EUTSA_v10025167mg [Eutrema salsugineum]
Length=455

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV +PAQG INP LQ A RL+  G  +T+ T++S + RM EPPS  G+ +A FSDG+
Sbjct  12   HYLLVTFPAQGHINPALQLANRLIHHGATVTYATAVSALRRMGEPPSAQGLSYAWFSDGF  71

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQG-SPISRVIYTTFMPWVGILA  427
            D G K  +++ + + + L+ +GS A+ D++ A L  G + I+ VIY+  +PWV  +A
Sbjct  72   DDGLKSFEDQKI-YMSELKRRGSDALSDIIRANLHDGATTITTVIYSVLVPWVSTVA  127



>ref|XP_010673328.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = +2

Query  62   MEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFA  241
            ME +  + LLV +PAQG +NP LQFAKRL+  G  +TF T+ S      +     G+ FA
Sbjct  1    MEEQKPHFLLVTFPAQGHVNPALQFAKRLLRTGAHVTFSTAASAHRCFDKAKIPSGMSFA  60

Query  242  TFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            TFSDG+DAGF+ +D + L + ++ R +G++ +  LL   + +G P++ ++YT  +PWV  
Sbjct  61   TFSDGYDAGFRATDGDVLDYLSTFRQRGAETLATLLENSVAEGRPVTCLVYTLLLPWVAE  120

Query  422  LA  427
            +A
Sbjct  121  VA  122



>ref|XP_004247894.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=470

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 80/119 (67%), Gaps = 3/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE---PPSIHGVDFATFS  250
            +VLLV +PAQG INP LQFAKRL+E+G+++TF TS+    RM +     +  G++ A FS
Sbjct  5    HVLLVTFPAQGHINPSLQFAKRLIEMGIEVTFTTSVFAHRRMAKIAASTAPKGLNLAAFS  64

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D GFK + ++  ++ + +R++GS+ + D++     +G P++ ++YT  +PW   +A
Sbjct  65   DGFDDGFKSNVDDSKRYMSEIRSRGSQTLRDVILKSSDEGRPVTSLVYTLLLPWAAEVA  123



>ref|XP_007163802.1| hypothetical protein PHAVU_001G265400g [Phaseolus vulgaris]
 gb|ESW35796.1| hypothetical protein PHAVU_001G265400g [Phaseolus vulgaris]
Length=531

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWDA  265
            LLV YP QG INP +QFAKRL  +GV +TF TS  +  RM    ++ G+ F TFSDG+D 
Sbjct  67   LLVTYPVQGHINPAIQFAKRLTAIGVHVTFATSTFLHRRMINKLTVPGLTFVTFSDGYDD  126

Query  266  GFKGS-DEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G++G+ D   + + A L+ +GS+   +++T+  Q+G P + V YT  +PWV  +A
Sbjct  127  GYEGTNDSNVISYMAELKLRGSEFFRNIITSAKQEGKPFTCVAYTLMLPWVAKVA  181



>ref|XP_006358760.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=473

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 81/119 (68%), Gaps = 3/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIH---GVDFATFS  250
            +VLLV +PAQG INP LQFAKRL+++G+++TF TS+    RM +  + +   G++ A FS
Sbjct  5    HVLLVTFPAQGHINPSLQFAKRLIKMGIEVTFTTSVFAHRRMAKTAASNAPKGLNLAAFS  64

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D GFK + ++  ++ + +R++GS+ + D++     +G P++ ++YT  +PW   +A
Sbjct  65   DGFDDGFKSNVDDSKRYMSEIRSRGSQTLRDIILKSSDEGRPVTSLVYTLLLPWAAEVA  123



>ref|XP_010650395.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=497

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 75/121 (62%), Gaps = 3/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + +++ YPAQG INP LQ AKRL+ +G  +TF+TS     RM + P++ G+ F TF
Sbjct  33   MTQPHFIVITYPAQGHINPSLQLAKRLIRVGAHVTFVTSTYASERMAKTPTMDGLKFVTF  92

Query  248  SDGWDAGFKGSDEEYLQ-FNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
             DG D+G K SD   LQ F + L   GS+A+ DLL A   +G P++ +IY   +PWV  +
Sbjct  93   PDGCDSGLKQSDA--LQGFMSELERLGSQALTDLLIASANEGRPVACIIYGILIPWVAEV  150

Query  425  A  427
            A
Sbjct  151  A  151



>emb|CAN67608.1| hypothetical protein VITISV_036779 [Vitis vinifera]
Length=469

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWDA  265
            LLV +PAQG INP LQFAKR++  G +++F TS+S   RM + P++ G+ F  FSDG+D 
Sbjct  7    LLVTFPAQGHINPALQFAKRMIRTGAEVSFATSVSAHRRMAKRPNLEGLQFVPFSDGYDD  66

Query  266  GFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            GFK SD +  Q+ + ++ +GS+ + +++     +G P + +++T  +PW   +A
Sbjct  67   GFKSSD-DIQQYMSEIKRRGSETLREIVVRNSDEGRPFTCIVHTLLVPWAAEVA  119



>ref|XP_002262883.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=469

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWDA  265
            LLV +PAQG INP LQFAKR++  G +++F TS+S   RM + P++ G+ F  FSDG+D 
Sbjct  7    LLVTFPAQGHINPALQFAKRMIRTGAEVSFATSVSAHRRMAKRPNLEGLQFVPFSDGYDD  66

Query  266  GFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            GFK SD +  Q+ + ++ +GS+ + +++     +G P + +++T  +PW   +A
Sbjct  67   GFKSSD-DIQQYMSEIKRRGSETLREIVVRNSDEGRPFTCIVHTLLVPWAAEVA  119



>sp|F8WKW0.1|UGT1_GARJA RecName: Full=Crocetin glucosyltransferase, chloroplastic; AltName: 
Full=UDP-glucose glucosyltransferase 1; Short=GjUGT1; 
AltName: Full=UDP-glycosyltransferase 75L6; Flags: Precursor 
[Gardenia jasminoides]
 dbj|BAK55736.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=474

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPP--SIHGVDFATFSD  253
            +VLL+ YPAQG INP LQFA+RL+ +G+++T  TS+  ++RM +    +  G+ FATFSD
Sbjct  6    HVLLITYPAQGHINPALQFAQRLLRMGIQVTLATSVYALSRMKKSSGSTPKGLTFATFSD  65

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D GF+    ++ ++ +SL  +GS  + +++     QG P++ ++YT  +PW   +A
Sbjct  66   GYDDGFRPKGVDHTEYMSSLAKQGSNTLRNVINTSADQGCPVTCLVYTLLLPWAATVA  123



>gb|KJB28076.1| hypothetical protein B456_005G025700 [Gossypium raimondii]
Length=469

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + LLV YPAQG INP LQFA+ L+ +GV++TF+T +S   RM + P+  G+ F  F
Sbjct  1    MSQPHFLLVTYPAQGHINPTLQFARHLIRIGVRVTFITCISARRRMTKVPTAQGLTFLPF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D GF+  D +   + +    +G +AI + +T+   +G P++ ++YT F+ W   +A
Sbjct  61   SDGYDDGFQPGD-DVDHYRSEFTRRGKEAISEFITSGENEGKPVTCIVYTLFIHWATEVA  119



>dbj|BAM28983.1| UDP-glucose crocetin glucosyltransferase [Gardenia jasminoides]
Length=474

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPP--SIHGVDFATFSD  253
            +VLL+ YPAQG INP LQFA+RL+ +G+++T  TS+  ++RM +    +  G+ FATFSD
Sbjct  6    HVLLITYPAQGHINPALQFAQRLLRMGIQVTLATSVYALSRMTKSSGSTPKGLTFATFSD  65

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D GF+    ++ ++ +SL  +GS  + +++     QG P++ ++YT  +PW   +A
Sbjct  66   GYDDGFRPKGVDHTEYMSSLAKQGSNTLRNVINTSADQGCPVTCLVYTLLLPWAATVA  123



>ref|XP_003632054.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=465

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + +++ YPAQG INP LQ AKRL+  G  +TF+TS     RM + P++ G+ F TF
Sbjct  1    MTQPHFIVITYPAQGHINPSLQLAKRLIRAGAHVTFVTSTYASERMTKTPTMDGLKFVTF  60

Query  248  SDGWDAGFKGSDEEYLQ-FNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
             DG D+G K SD   LQ F + L   GS+A+ DLL A   +G P++ +IY   +PWV  +
Sbjct  61   PDGCDSGLKQSDA--LQGFMSELERLGSQALTDLLIASANEGRPVTCIIYGILIPWVAEV  118

Query  425  A  427
            A
Sbjct  119  A  119



>ref|XP_007034186.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
 gb|EOY05112.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
Length=465

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + LLV YPAQG INP LQFAK L+ +GV++TF T +S   RM + PS  G+ F TF
Sbjct  1    MPQPHFLLVTYPAQGHINPTLQFAKCLIRIGVRVTFTTCVSARRRMTKVPSAQGLSFLTF  60

Query  248  SDGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            SDG+D G K G D+++  + +  R +G + + D++     +G P++ ++Y+  +PW
Sbjct  61   SDGYDDGLKPGDDKDH--YMSEFRRRGKENLNDIVVGSDNEGKPVTCIVYSLLLPW  114



>ref|XP_010246964.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=476

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 75/117 (64%), Gaps = 1/117 (1%)
 Frame = +2

Query  77   CNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDG  256
            C+ LLV +PAQG INP LQFAKRL   GV++TF+TS+S    M   P+   + +  FSDG
Sbjct  5    CHFLLVTFPAQGHINPALQFAKRLTLTGVQVTFVTSVSAFRLMTNLPTQDALTYFPFSDG  64

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            +D G K SD ++  F + LR +GS+A+ D + +  ++  P++ +IYT  +PW   +A
Sbjct  65   YDDGCKSSD-DFDNFMSELRCRGSQALTDYVESSAKERRPVTCLIYTILLPWAAEVA  120



>gb|KDP32582.1| hypothetical protein JCGZ_13132 [Jatropha curcas]
Length=463

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV +P QG INP LQFAKRL+ +GV++T  TS     RM +     G+   TFSDG+
Sbjct  5    HFLLVTFPTQGHINPALQFAKRLIRIGVEVTLATSAYAKRRMTKTSFPKGLSLTTFSDGY  64

Query  260  DAGFKGSDEE-YLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G+KGSD + + ++ + +R +GS+ + DL+     +G P++ ++YT  +PW   +A
Sbjct  65   DDGYKGSDSDAHDKYMSEIRLRGSETLSDLIITSANEGKPVTCLVYTLLLPWAAEVA  121



>emb|CAN75179.1| hypothetical protein VITISV_018406 [Vitis vinifera]
Length=497

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + +++ YPAQG INP LQ AKRL+  G  +TF+TS     RM + P++ G+ F TF
Sbjct  33   MTQPHFIVITYPAQGHINPSLQLAKRLIRAGAHVTFVTSTYASERMAKTPTMDGLKFVTF  92

Query  248  SDGWDAGFKGSDEEYLQ-FNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
             DG D+G K SD   LQ F + L   GS+A+ DLL A   +G P++ +IY   +PWV  +
Sbjct  93   PDGCDSGLKQSDA--LQGFMSELERLGSQALTDLLIASANEGRPVACIIYGILIPWVAEV  150

Query  425  A  427
            A
Sbjct  151  A  151



>ref|XP_010246531.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=471

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + LLV +PAQG INP LQFAKRL+ +G ++TF TS+S   RM    +  G+ FA F
Sbjct  1    MSHPHFLLVTFPAQGHINPSLQFAKRLIRIGAQVTFATSVSAHRRMSNACNPDGLTFAPF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D GFK +D     F + L+ +GS+ + +L+ +  ++G P+S +++T  +PW   +A
Sbjct  61   SDGYDDGFKLTD-SVEHFLSELKRRGSETLRELILSLAREGRPVSCLVHTLLLPWAADVA  119



>ref|XP_007221319.1| hypothetical protein PRUPE_ppa021645mg [Prunus persica]
 gb|EMJ22518.1| hypothetical protein PRUPE_ppa021645mg [Prunus persica]
Length=474

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LL+ +PAQG INP LQFAK L+   G  +T++T LS   R+    + HG+ ++ FSDG+D
Sbjct  7    LLLTFPAQGHINPSLQFAKHLIRTTGAHVTYVTCLSAHRRLGNGSTPHGLTYSLFSDGYD  66

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D+ Y  + + LR +G++AI DL+ +  ++G P + +IYT  +PW  ++A
Sbjct  67   NGFKDGDD-YDHYMSELRRRGAQAITDLIVSSAKEGRPYTCLIYTILLPWAAVVA  120



>ref|XP_010243149.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=471

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + LLV +PAQG INP LQFAKRL+ +G ++TF TS+S   RM    +  G+ FA F
Sbjct  1    MSHPHFLLVTFPAQGHINPSLQFAKRLIRIGAQVTFATSVSAHRRMSNACNPDGLTFAPF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D GFK +D     F + L+ +GS+ + +L+ +  ++G P+S +++T  +PW   +A
Sbjct  61   SDGYDDGFKLTD-SVEHFLSELKRRGSETLRELILSLAREGRPVSCLVHTLLLPWAADVA  119



>dbj|BAG80544.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=469

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 78/119 (66%), Gaps = 3/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI---HGVDFATFS  250
            +VLLV +PAQG INP LQFAKRL++LG+++TF TS+    RM +  +     G++F  FS
Sbjct  5    HVLLVTFPAQGHINPSLQFAKRLIKLGIEVTFATSVFAHRRMTKTAASTAPEGLNFVAFS  64

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D GFK   ++  ++ + +R++GS+ + D++      G P++ ++YT  +PW   +A
Sbjct  65   DGFDDGFKLDTDDGKRYMSEIRSRGSQTLRDIILKSSDDGRPVTSLVYTLLLPWAAEVA  123



>ref|XP_011020320.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=472

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI-HGVDFATFSDG  256
            ++LLV +PAQG INP LQFAKRLV +G  +TF TS+    RM +  +   G+ FA F DG
Sbjct  9    HILLVTFPAQGHINPALQFAKRLVAIGAHVTFSTSMGAARRMSKTGTYPEGLSFAAFDDG  68

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             + GF+ SD+    F   LR  GSK++ +L+ A  + G P +RV+Y+  +PWV  +A
Sbjct  69   SEHGFRPSDDINHYF-TELRLVGSKSLAELIVASSKNGRPFTRVVYSNLIPWVAKVA  124



>ref|XP_006368000.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=473

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 79/119 (66%), Gaps = 3/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI---HGVDFATFS  250
            +VLLV +PAQG INP LQFAKRL+++G+++TF TS+    RM +  +     G++ A FS
Sbjct  5    HVLLVTFPAQGHINPSLQFAKRLIKMGIEVTFTTSIFAHRRMAKTAASTAPKGLNLAAFS  64

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D GFK + ++   + + +R++GS+ + D++     +G P++ ++YT  +PW   +A
Sbjct  65   DGFDDGFKSNVDDSKCYMSEIRSRGSQTLRDIILKSSDEGRPVTSLVYTLLLPWAAEVA  123



>ref|XP_010023602.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=470

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE-PPSIHGVDFATFSDG  256
            + LLV +PAQG INP LQFAKRL+  G ++TF TS+S  +RM +   S  G+ FA FSDG
Sbjct  5    HFLLVTFPAQGHINPALQFAKRLLRSGAEVTFATSVSACHRMSKGRASPEGLHFAPFSDG  64

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            +D GFK  D    QF + LR +GS+ ++DL+ +   +G P + ++Y+  +PW   +A
Sbjct  65   YDDGFKMGD-NVSQFMSELRHRGSEKLKDLMASSAGEGRPYTCLVYSLLLPWAAEVA  120



>gb|KJB28075.1| hypothetical protein B456_005G025600 [Gossypium raimondii]
Length=467

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 77/122 (63%), Gaps = 5/122 (4%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + LLV  PAQG INP LQFAK L+ +GV++TF+T +S  +RM + P+  G+ F  F
Sbjct  1    MSQPHFLLVASPAQGHINPTLQFAKHLIRIGVRVTFITCISARSRMTKVPTAQGLTFLPF  60

Query  248  SDGWDAGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            SDG+D GF+  D  + YL   + LR +G +AI + LT+   +G P++ ++Y+ F  W   
Sbjct  61   SDGYDDGFQLRDDIDHYL---SELRRRGKEAISEFLTSSENEGKPVTCIVYSPFNHWATE  117

Query  422  LA  427
            +A
Sbjct  118  VA  119



>emb|CBI39388.3| unnamed protein product [Vitis vinifera]
Length=597

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + +++ YPAQG INP LQ AKRL+  G  +TF+TS     RM + P++ G+ F TF
Sbjct  106  MTQPHFIVITYPAQGHINPSLQLAKRLIRAGAHVTFVTSTYASERMTKTPTMDGLKFVTF  165

Query  248  SDGWDAGFKGSDEEYLQ-FNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
             DG D+G K SD   LQ F + L   GS+A+ DLL A   +G P++ +IY   +PWV  +
Sbjct  166  PDGCDSGLKQSDA--LQGFMSELERLGSQALTDLLIASANEGRPVTCIIYGILIPWVAEV  223

Query  425  A  427
            A
Sbjct  224  A  224



>gb|AET04105.2| UDP-glucose:glucosyltransferase, putative [Medicago truncatula]
Length=160

 Score = 99.0 bits (245),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 72/123 (59%), Gaps = 1/123 (1%)
 Frame = +2

Query  62   MEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFA  241
            M      +LL+ YP QG INP  QFAKRLV LG  +T  T+L + NR+   P++  + + 
Sbjct  1    MPHHRHRILLIPYPVQGHINPTFQFAKRLVALGAHVTLSTTLHMHNRLTNKPTLPNLSYL  60

Query  242  TFSDGWDAGFKGS-DEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
             FSDG+D GFK +  E YL +++ L   GS+ I++L+    Q+G P + ++++  + W  
Sbjct  61   PFSDGYDDGFKATGTENYLHYSSELTRCGSEFIKNLILKNSQEGKPFTFLVHSILLQWAA  120

Query  419  ILA  427
              A
Sbjct  121  KTA  123



>ref|XP_010450127.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Camelina sativa]
Length=454

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 73/117 (62%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV +PAQG INP LQ A RL+  G  +T+ T++S   RM EPPS  G+ FA F+DG+
Sbjct  13   HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMREPPSTKGLSFAWFTDGF  72

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQG-SPISRVIYTTFMPWVGILA  427
            D G K S ++ + + + L+  GS  + D++ A L     PI+ VIY+ F+PW   +A
Sbjct  73   DDGVKSSKDQKI-YMSELKRCGSNGLSDIIRANLDANLEPITGVIYSVFVPWAATVA  128



>ref|XP_006282890.1| hypothetical protein CARUB_v10007134mg [Capsella rubella]
 gb|EOA15788.1| hypothetical protein CARUB_v10007134mg [Capsella rubella]
Length=456

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV +PAQG INP LQ A RL+  G  +T+ T++S   RM EPPS  G+ FA F+DG+
Sbjct  13   HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPSTKGLSFAWFTDGF  72

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQ-QGSPISRVIYTTFMPWVGILA  427
            D G K  +++ + + + L+  GS A+ D++ A L  +  PI+ VIY+  +PWV  +A
Sbjct  73   DDGLKSFEDQKI-YTSELKRCGSNALRDIIRANLDSKTEPITGVIYSVLVPWVSSVA  128



>ref|NP_193146.1| anthocyanin 5-O-glucosyltransferase [Arabidopsis thaliana]
 sp|Q0WW21.2|U75C1_ARATH RecName: Full=UDP-glycosyltransferase 75C1; AltName: Full=Anthocyanin 
5-O-glucosyltransferase; AltName: Full=UDP glucose:anthocyanin 
5-O-glucosyltransferase [Arabidopsis thaliana]
 emb|CAB10189.1| glucosyltransferase like protein [Arabidopsis thaliana]
 emb|CAB78452.1| glucosyltransferase like protein [Arabidopsis thaliana]
 gb|AAL32667.1| glucosyltransferase [Arabidopsis thaliana]
 gb|AAM47973.1| glucosyltransferase [Arabidopsis thaliana]
 gb|AAM91686.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AEE83370.1| anthocyanin 5-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AHL38699.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=456

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV +PAQG INP LQ A RL+  G  +T+ T++S   RM EPPS  G+ FA F+DG+
Sbjct  13   HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAVSAHRRMGEPPSTKGLSFAWFTDGF  72

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQ---QGSPISRVIYTTFMPWVGILA  427
            D G K  +++ + + + L+  GS A+ D++ A L    +  PI+ VIY+  +PWV  +A
Sbjct  73   DDGLKSFEDQKI-YMSELKRCGSNALRDIIKANLDATTETEPITGVIYSVLVPWVSTVA  130



>gb|AAL69494.1| putative glucosyltransferase [Arabidopsis thaliana]
Length=466

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV +PAQG INP LQ A RL+  G  +T+ T++S   RM EPPS  G+ FA F+DG+
Sbjct  23   HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAVSAHRRMGEPPSTKGLSFAWFTDGF  82

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQ---QGSPISRVIYTTFMPWVGILA  427
            D G K  +++ + + + L+  GS A+ D++ A L    +  PI+ VIY+  +PWV  +A
Sbjct  83   DDGLKSFEDQKI-YMSELKRCGSNALRDIIKANLDATTETEPITGVIYSVLVPWVSTVA  140



>dbj|BAE98677.1| glucosyltransferase like protein [Arabidopsis thaliana]
Length=456

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV +PAQG INP LQ A RL+  G  +T+ T++S   RM EPPS  G+ FA F+DG+
Sbjct  13   HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAVSAHRRMGEPPSTKGLSFAWFTDGF  72

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQ---QGSPISRVIYTTFMPWVGILA  427
            D G K  +++ + + + L+  GS A+ D++ A L    +  PI+ VIY+  +PWV  +A
Sbjct  73   DDGLKSFEDQKI-YMSELKRCGSNALRDIIKANLDATTETEPITGVIYSVLVPWVSTVA  130



>ref|XP_008458144.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Cucumis melo]
Length=468

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = +2

Query  83   VLLVMYPAQGQINPCLQFAKRLVELG-VKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            VLL+ Y AQG INP LQ AKRL+  G + +TFLTSLS   RM + P++  + FA+FSDG+
Sbjct  12   VLLITYSAQGHINPTLQLAKRLIRHGDLHVTFLTSLSAYRRMGQTPTLPHLSFASFSDGY  71

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D GFK  D +   + + L   GS A+++++     QG P + ++Y+  +PWV  +A
Sbjct  72   DDGFKPGD-DIDHYVSELERCGSDALKNIIQESRNQGQPFTCIVYSILLPWVATVA  126



>gb|AAK54465.1| cold-induced glucosyl transferase [Solanum sogarandinum]
Length=473

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 79/119 (66%), Gaps = 3/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI---HGVDFATFS  250
            +VLLV +P QG INP LQFAK+L+++G+++TF TS+    RM +  +     G++ A FS
Sbjct  5    HVLLVTFPTQGHINPSLQFAKKLIKMGIEVTFTTSVFAHRRMAKTATSTAPKGLNLAAFS  64

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D GFK + ++  ++ + +R++GS+ + D++     +G P++ ++YT  +PW   +A
Sbjct  65   DGFDDGFKSNVDDSKRYMSEIRSRGSQTLRDIILKSSDEGRPVTSLVYTLLLPWAAEVA  123



>ref|XP_011081386.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Sesamum 
indicum]
Length=475

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 77/123 (63%), Gaps = 4/123 (3%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPS---IHGVDF  238
            M   +VLLV +PAQG INP LQFAKRLV +G+++TF TS+    RM E        G+ F
Sbjct  1    MSPRHVLLVTFPAQGHINPSLQFAKRLVNMGIEVTFATSVYAQRRMEETADGDLPKGLKF  60

Query  239  ATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
              +SDG+D GF  SD+   ++   +R++ SK ++D + A  ++G PIS  I+T  +PWV 
Sbjct  61   TPYSDGYDDGFTFSDDGK-KYMMEIRSRASKTLKDTVMAAAKRGRPISCFIHTLLLPWVS  119

Query  419  ILA  427
             +A
Sbjct  120  KVA  122



>ref|XP_010023609.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59919.1| hypothetical protein EUGRSUZ_H02643 [Eucalyptus grandis]
Length=465

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 75/123 (61%), Gaps = 6/123 (5%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI-HGVDFAT  244
            M   + LLV +P QG INP LQFAKRLV +G  +TF T++    RM E  SI  G+ FA+
Sbjct  1    MAPPHFLLVTFPGQGHINPSLQFAKRLVRVGAHVTFATAIRARPRMAESESIPEGLSFAS  60

Query  245  FSDGWDAGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
            FSDG+D GF   D  EEY+     ++ +G++ + DL+ + L+ G   S V+YT  +PW  
Sbjct  61   FSDGYDDGFDNWDEMEEYMD---KIKRRGTETLSDLIASNLKSGRRFSGVLYTILLPWAA  117

Query  419  ILA  427
             +A
Sbjct  118  EVA  120



>ref|XP_010023603.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59914.1| hypothetical protein EUGRSUZ_H02638 [Eucalyptus grandis]
Length=470

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE-PPSIHGVDFATFSDG  256
            + LLV +PAQG INP LQFAKRL+  G ++TF TS+S    M +   S  G+ FA FSDG
Sbjct  5    HFLLVTFPAQGHINPALQFAKRLLGSGAEVTFATSISACRHMSKGRASPEGLHFAAFSDG  64

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            +D G K  D    QF + LR +GS+ + DL+ +K+ +G P + ++Y+  +PW   +A
Sbjct  65   YDDGLKTGD-NVSQFMSELRRRGSEKLRDLIASKVGEGRPYTCLVYSLLLPWAAEVA  120



>gb|EYU31588.1| hypothetical protein MIMGU_mgv1a005398mg [Erythranthe guttata]
Length=485

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 79/123 (64%), Gaps = 12/123 (10%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNR-------MPEPPSIHGVDF  238
            +VLLV +PAQG INP LQFAKRL  +G+K+TF TSL    R       +P+     GV F
Sbjct  25   HVLLVTFPAQGHINPSLQFAKRLTAIGIKVTFATSLYARRRMARTAAGLPK-----GVTF  79

Query  239  ATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
            A FSDG+D GF   +++  ++   +R++GS+++ D + A  +QG P+++++Y+  +PW  
Sbjct  80   AAFSDGYDDGFNPGNDDAGKYMTEIRSRGSQSLRDTILAAAEQGRPVTQLVYSLLLPWAP  139

Query  419  ILA  427
             +A
Sbjct  140  EVA  142



>ref|XP_002263975.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=463

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 70/115 (61%), Gaps = 1/115 (1%)
 Frame = +2

Query  83   VLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            +LLV YPAQG INP LQ AK L+  G  +TF+TS S   RM + P++ G++F TFSDG+D
Sbjct  5    ILLVTYPAQGHINPSLQLAKLLIRAGAHVTFVTSSSAGTRMSKSPTLDGLEFVTFSDGYD  64

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GF   D     F + L   GS A+  L+ A+  +G P + ++Y   +PWV  +A
Sbjct  65   HGFDHGD-GLQNFMSELERLGSPALTKLIMARANEGRPFTCLLYGMLIPWVAEVA  118



>ref|XP_011101592.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Sesamum 
indicum]
Length=472

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI---HGVDF  238
            M   +VLLV +P QG INP LQFAK+L+ +G+++TF T++    RM +  +     G+ F
Sbjct  1    MASHHVLLVTFPVQGHINPALQFAKKLINMGIEVTFATTVLARQRMEKAAASSLPKGLTF  60

Query  239  ATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
            A FSDG D GFK S++   ++   +R +G+K+++D + +  +QG PI+ +IYT  +PW  
Sbjct  61   AAFSDGLDDGFKASNDPQ-KYMREIRRRGTKSLKDTVLSAAEQGRPITCLIYTLLLPWAS  119

Query  419  ILA  427
             +A
Sbjct  120  EVA  122



>gb|KFK36297.1| hypothetical protein AALP_AA4G104100 [Arabis alpina]
Length=456

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV +P QG INP LQ A RL+  G  +T+ T++S + RM EPPS+ G+ +A F+DG+
Sbjct  12   HYLLVTFPGQGHINPALQLANRLIHHGATVTYSTAVSALRRMGEPPSVKGLSYAWFTDGF  71

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGS-PISRVIYTTFMPWVGILA  427
            D G K  +++ +   + L+  GS A+ +++   L  G+ PI+ VIY+  +PWV  +A
Sbjct  72   DDGLKSFEDQKIHM-SELKRHGSDALSNIIKTNLDGGTEPITGVIYSLLVPWVSTVA  127



>ref|XP_007099701.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
 gb|EOY20331.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
Length=466

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + L+V YP QG INP LQFAK L+ +G ++TF TS+S   RM + PS  G+ F TF
Sbjct  1    MPQRHFLVVTYPNQGHINPTLQFAKCLIRIGARVTFTTSVSARRRMTKVPSAQGLSFLTF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
            SDG+D G K  D++   + +  R +G + + DL+ +  ++G P++ ++++  +PW 
Sbjct  61   SDGYDDGLKPGDDKG-HYMSEFRRRGKENLNDLVVSSDKEGKPVTCIVHSLLLPWA  115



>gb|KJB28080.1| hypothetical protein B456_005G026200 [Gossypium raimondii]
Length=542

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 76/122 (62%), Gaps = 5/122 (4%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + LLV +PAQG INP LQFAK L+ +GV++TF+T +S   RM + P+  G+ F  F
Sbjct  67   MSQPHFLLVTFPAQGHINPTLQFAKHLIRIGVRVTFITCISAHRRMSKVPTAQGLTFLPF  126

Query  248  SDGWDAGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            SDG+D   +  D  + YL   + LR +G +A+ + +T+   +G P++ ++YT F+ W   
Sbjct  127  SDGYDDECQPGDDIDHYL---SELRRRGKEAVSEFITSSENEGKPVTCIVYTLFIHWASE  183

Query  422  LA  427
            +A
Sbjct  184  VA  185



>gb|KJB28073.1| hypothetical protein B456_005G025400 [Gossypium raimondii]
Length=469

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + ++V YPAQG INP LQFAK L+ LGV++T++TS+S   RM + P+  G+ F  F
Sbjct  1    MPQPHFIVVTYPAQGHINPTLQFAKHLIRLGVRVTYITSISASRRMTKVPTAEGLSFLPF  60

Query  248  SDGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            SDG+D G K G D ++  + +  + +G  AI + +T+   +G PI+ ++Y+  + W   +
Sbjct  61   SDGYDYGIKPGDDTDH--YLSEFKRRGKDAISEYITSSENEGKPITCIVYSLCLHWAAEV  118

Query  425  A  427
            A
Sbjct  119  A  119



>ref|XP_010435193.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Camelina sativa]
Length=454

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 73/117 (62%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV +PAQG INP LQ A RL+  G  +T+ T++S   RM EPPS  G+ FA F+DG+
Sbjct  13   HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPSTKGLSFAWFTDGF  72

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGS-PISRVIYTTFMPWVGILA  427
            D G K S ++ + + + L+  GS  + D++ A L   + PI+ VIY+  +PW   +A
Sbjct  73   DDGVKSSKDQKI-YMSELKRFGSNGLSDIIRANLDASTEPITGVIYSVLVPWAATVA  128



>ref|XP_004140483.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cucumis sativus]
 ref|XP_004162374.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cucumis sativus]
 gb|KGN46580.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Cucumis sativus]
Length=467

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELG-VKLTFLTSLSVVNRMPEPPSIHGVDFATFSDG  256
            +VLLV + AQG INP LQ AKRL   G + +TFL SLS   RM   P++  + FA+FSDG
Sbjct  12   HVLLVTHCAQGHINPTLQLAKRLTRHGDLHVTFLISLSAYRRMGHTPTLPHITFASFSDG  71

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            +D GFK SD+  L + + L  +GS A+++++     +G P + ++Y+  +PWV  +A
Sbjct  72   YDDGFKPSDDIKL-YISELERRGSDALKNIIQESRNKGQPFTCIVYSILIPWVATVA  127



>ref|XP_011024782.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=468

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 1/116 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LL+ YPAQG INP LQFAK L  +GV +T +TSLS   RM +     GV F TFSDG+
Sbjct  6    HFLLLTYPAQGHINPALQFAKGLTRIGVLVTLVTSLSAGRRMSKTLFPDGVSFVTFSDGY  65

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D GFK  D+    F + L+ +GS+ + +L+    ++G P++ ++YT  + W   +A
Sbjct  66   DDGFKPEDDRD-HFTSELKRRGSQTLNELIVDSAKEGKPVTCLVYTMLLQWAAEVA  120



>emb|CDY27124.1| BnaA08g07620D [Brassica napus]
Length=454

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 74/119 (62%), Gaps = 4/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + L+V +PAQG INP L+ A RL+  G  +T+ T++S + RM EPPS  G+ +A FSDG+
Sbjct  13   HYLIVTFPAQGHINPALKLANRLIHHGATITYATTISALRRMGEPPSTEGLSYAWFSDGF  72

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGS---PISRVIYTTFMPWVGILA  427
            D G K S E+   + +  + +GS A+ DL+ A L   +   PI+ VIY+  +PW   +A
Sbjct  73   DEGPK-SFEDQKNYMSEFKRRGSDALSDLIRANLDGNAAKHPITGVIYSVLVPWASTVA  130



>ref|XP_009108098.1| PREDICTED: UDP-glycosyltransferase 75C1 [Brassica rapa]
Length=454

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 74/119 (62%), Gaps = 4/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + L+V +PAQG INP L+ A RL+  G  +T+ T++S + RM EPPS  G+ +A FSDG+
Sbjct  13   HYLIVTFPAQGHINPALKLANRLIHHGATITYATTISALRRMGEPPSTEGLSYAWFSDGF  72

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGS---PISRVIYTTFMPWVGILA  427
            D G K S E+   + +  + +GS A+ DL+ A L   +   PI+ VIY+  +PW   +A
Sbjct  73   DEGPK-SFEDQKNYMSEFKRRGSDALSDLIRANLDGNAAKHPITGVIYSVLVPWASTVA  130



>ref|XP_002263700.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=469

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + LLV +PAQG INP LQFAKR++  G +++F TS+S   RM +  +  G++F  F
Sbjct  1    MGSPHFLLVTFPAQGHINPALQFAKRIIRTGAQVSFATSVSAHRRMAKRSTPEGLNFVPF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D GFK +D +   + + ++ +GS+ + +++     +G P + ++YT  +PW   +A
Sbjct  61   SDGYDDGFKPTD-DVQHYMSEIKRRGSETLREIVVRNADEGQPFTCIVYTLLLPWAAEVA  119



>ref|XP_002301754.1| hypothetical protein POPTR_0002s23770g [Populus trichocarpa]
 gb|EEE81027.1| hypothetical protein POPTR_0002s23770g [Populus trichocarpa]
Length=469

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 72/116 (62%), Gaps = 1/116 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LL+ YPAQG INP LQFAK L  +G  +T +TSLS   RM +     G+ F TFSDG+
Sbjct  6    HFLLLTYPAQGHINPALQFAKGLTRIGALVTLVTSLSAGRRMSKTLFPDGLSFVTFSDGY  65

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D GFK  D+    F + L+ +GS+ + +L+    ++G P++ ++YT F+ W   +A
Sbjct  66   DDGFKPEDDRE-HFKSELKRRGSQTLNELIVDSAKEGKPVTCLVYTMFLHWAAEVA  120



>ref|XP_002267330.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=497

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + +++ YPAQG INP LQ AKRL+  G  +TF+TS     RM + P++ G+ F TF
Sbjct  33   MTQPHFIVITYPAQGHINPSLQLAKRLIRAGAHVTFVTSTYAGERMAKTPTMDGLKFVTF  92

Query  248  SDGWDAGFKGSDEEYLQ-FNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
             DG D+G K SD   LQ F + L   GS+A+  LL A   +G P++ +IY   +PWV  +
Sbjct  93   PDGCDSGLKQSDA--LQGFMSELERLGSQALIGLLIASANEGRPVTCIIYGILIPWVAEV  150

Query  425  A  427
            A
Sbjct  151  A  151



>ref|XP_004504379.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cicer arietinum]
 gb|AGU14114.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 73/114 (64%), Gaps = 1/114 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            ++LL+ YP QG INP  QFAKRL+ LG  +T  T+L + NR+   P++  + +  FSDG+
Sbjct  6    HILLIPYPVQGHINPAFQFAKRLISLGAHVTLSTTLHMHNRITHKPTLPNLSYLPFSDGY  65

Query  260  DAGFKGS-DEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
            D GF+ +  + YL + +  + +GS+ I +L+ +  Q+G+P + ++Y+  +PW  
Sbjct  66   DDGFQSTGTDAYLLYTSEFKRRGSEFIANLILSNSQKGTPFTCLVYSLLLPWAA  119



>ref|XP_010246537.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=472

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 78/122 (64%), Gaps = 5/122 (4%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + L+V +PAQG INP LQFAKRL+ +G ++TF TS+S   RM    +  G+ FA F
Sbjct  1    MSPPHFLVVTFPAQGHINPSLQFAKRLIGIGAQVTFATSVSAHRRMLNACNPDGLTFAPF  60

Query  248  SDGWDAGFK--GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            SDG D GFK  GS E +L   + L+ +GS+ + +L+ +  ++G P++ ++YT  +PW   
Sbjct  61   SDGHDDGFKPIGSIEHFL---SELKRRGSETLRELILSLAREGCPVTCLVYTLLLPWAAD  117

Query  422  LA  427
            +A
Sbjct  118  VA  119



>emb|CDP15112.1| unnamed protein product [Coffea canephora]
Length=469

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 76/118 (64%), Gaps = 2/118 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE-PPSI-HGVDFATFSD  253
            +VLLV YPAQG INP LQFAKRL+ + V++TF TS+  ++RM +   SI  G+ FA FSD
Sbjct  6    HVLLVTYPAQGHINPSLQFAKRLLRMDVQVTFATSVFALSRMTKFSGSIPKGLSFAPFSD  65

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+D GF+    E  ++ + +  +GS  + +++     QG P++ ++YT  +PW   +A
Sbjct  66   GYDDGFQPKGVEPTEYMSGIEKQGSNTLRNVINTSADQGRPVTCLVYTLLLPWAATVA  123



>ref|XP_003532736.2| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=512

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWDA  265
            LLV YPAQ  INP LQ AKRL+ +G  +T L +L V  R+   P+I G+ F  FSDG+DA
Sbjct  41   LLVTYPAQSHINPALQLAKRLIAMGAHVTILLTLHVYRRISNKPTIPGLSFLPFSDGYDA  100

Query  266  GF---KGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            GF     +D ++  + + L+ + S  + +L+ +   +G P + ++YT  +PWV  +A
Sbjct  101  GFDALHATDSDFFLYESQLKHRTSDLLSNLILSSASEGRPFTCLLYTLLLPWVADVA  157



>ref|XP_003629629.1| UDP-glucose glucosyltransferase [Medicago truncatula]
Length=304

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = +2

Query  83   VLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            +LL+ YP QG INP  QFAKRLV LG  +T  T+L + NR+   P++  + +  FSDG+D
Sbjct  8    ILLIPYPVQGHINPTFQFAKRLVALGAHVTLSTTLHMHNRLTNKPTLPNLSYLPFSDGYD  67

Query  263  AGFKGS-DEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK +  E YL +++ L   GS+ I++L+    Q+G P + ++++  + W    A
Sbjct  68   DGFKATGTENYLHYSSELTRCGSEFIKNLILKNSQEGKPFTFLVHSILLQWAAKTA  123



>ref|XP_009337747.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=474

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV YPAQG INP LQFAKRL+   G  +TF+TSLS  +R+       G+ +A FSDG+D
Sbjct  7    LLVTYPAQGHINPSLQFAKRLINATGAHVTFITSLSAHHRIGNGSIPDGLTYAPFSDGYD  66

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D+    + + LR  G++AI DL+ +   +G P + ++YT  +PW   +A
Sbjct  67   DGFK-PDDNIDHYFSELRRCGAQAITDLVVSSANEGHPYTCLVYTILLPWAADVA  120



>ref|XP_010450109.1| PREDICTED: UDP-glycosyltransferase 75C1 [Camelina sativa]
Length=454

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 72/117 (62%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV +PAQG INP LQ A RL+  G  +T+ T++S   RM EPPS  G+ FA F+DG+
Sbjct  13   HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPSTKGLSFAWFTDGF  72

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGS-PISRVIYTTFMPWVGILA  427
            D G K S ++ + + + L+  GS  + D++   L   + PI+ VIY+  +PW   +A
Sbjct  73   DDGVKSSKDQKI-YMSELKRCGSNGLSDIIRVNLDANTEPITGVIYSVLVPWAATVA  128



>ref|XP_002308970.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE92493.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=472

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 73/117 (62%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI-HGVDFATFSDG  256
            ++LLV +PAQG INP LQFAKRLV +G  +TF TS+    RM +  +   G+ FA F DG
Sbjct  9    HILLVTFPAQGHINPALQFAKRLVAIGAHVTFSTSMGAARRMSKTGTYPKGLSFAAFDDG  68

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             + GF+ SD+    F   LR  GSK++ +L+ A  + G P + V+Y+  +PWV  +A
Sbjct  69   SEHGFRPSDDIDHYF-TELRLVGSKSLAELIAASSKNGRPFTCVVYSNLVPWVAKVA  124



>ref|XP_008348418.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV YPAQG INP LQFAKRL+   G  +TF+TSLS  +R+       G+ +A FSDG+D
Sbjct  7    LLVTYPAQGHINPSLQFAKRLINTTGAHVTFITSLSAHHRIGNGSIPDGLTYAPFSDGYD  66

Query  263  AGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D  + YL   + LR  G++AI DL+ +   +G P + ++YT  +PW   +A
Sbjct  67   DGFKPGDNIDHYL---SELRHHGAQAITDLVVSSENEGHPYTCMVYTILLPWAADVA  120



>emb|CBI39391.3| unnamed protein product [Vitis vinifera]
Length=403

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 78/131 (60%), Gaps = 3/131 (2%)
 Frame = +2

Query  38   YP*RLEDHMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPP  217
            +P     ++     ++L+V  P+QG INP LQ AK L+  G  +TF TS S   RM + P
Sbjct  68   FPYHCHTNLTTMHPHILIVTLPSQGHINPTLQLAKLLIRAGAHVTFFTSTSAGTRMSKSP  127

Query  218  SIHGVDFATFSDGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIY  394
            ++ G++FATFSDG+D G K G D E  +F + +   GS+A+ +L+ A   +G P + ++Y
Sbjct  128  NLDGLEFATFSDGYDHGLKQGDDVE--KFMSQIERLGSQALIELIMASANEGRPFACLLY  185

Query  395  TTFMPWVGILA  427
               +PWV  +A
Sbjct  186  GVQIPWVAEVA  196



>gb|AFI71902.1| flavonol 5-O-glucosyltransferase [Paeonia lactiflora]
Length=465

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 79/122 (65%), Gaps = 4/122 (3%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE-PPSIHGVDFAT  244
            M   + LL+ +PAQG INP LQFAKRL++L   +TF+TS+S   ++ +  PS+  + FAT
Sbjct  1    MAHHHFLLITFPAQGHINPALQFAKRLIKLDAHVTFVTSISAHRQITKTTPSLGNLSFAT  60

Query  245  FSDGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            FSDG+D G K G D  +  + + LR + S+A+ +L+     +G P++ +IY+  +PW G 
Sbjct  61   FSDGYDEGTKAGYDARH--YMSELRRRSSEALPELIENCANEGRPVTCLIYSLLLPWAGK  118

Query  422  LA  427
            +A
Sbjct  119  VA  120



>ref|XP_008380634.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Malus domestica]
Length=472

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV YPAQGQINP LQF KRL+   G  +T++TSLS  + +       G+ +A FSDG+D
Sbjct  7    LLVTYPAQGQINPSLQFVKRLINTTGAHVTYVTSLSARHCLDNGSIPDGLTYAPFSDGYD  66

Query  263  AGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GF   D  + YL   + LR +G++AI DL+ +   +G P + ++YT+F+PWV  +A
Sbjct  67   DGFMPGDSIDNYL---SELRRRGAQAITDLVVSSANEGHPYTCLVYTSFLPWVAEVA  120



>ref|XP_006478536.1| PREDICTED: UDP-glycosyltransferase 75D1-like, partial [Citrus 
sinensis]
Length=263

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIH-GVDFATFSDG  256
            + LL+ +P QG INP LQFA+RL  +G ++TF T++S   RMP  P+   G+ FA+FSDG
Sbjct  8    HFLLLTFPIQGHINPSLQFARRLTRIGTRVTFATAISAYRRMPNNPTAEDGLSFASFSDG  67

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQ-GSPISRVIYTTFMPWVGILA  427
            +D GF     +   F +  + + S+A+ +L+TA   + G P + ++Y   + W   +A
Sbjct  68   YDDGFNSKQNDRTHFMSEFKRRSSEALAELITASQNEGGQPFTCLVYPQLLTWAAEVA  125



>gb|KJB28074.1| hypothetical protein B456_005G025500 [Gossypium raimondii]
Length=469

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 74/118 (63%), Gaps = 5/118 (4%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + ++V YPAQG INP LQFA+ L+ +GV++T++TS+S   RM + P+  G+ F  FSDG+
Sbjct  5    HFIVVTYPAQGHINPTLQFAQHLIRIGVRVTYITSISASRRMTKVPTAEGLSFLPFSDGY  64

Query  260  DAGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G K  D  + YL   +  + +G  AI + +T+   +G PI+ ++Y+  + W   +A
Sbjct  65   DDGIKPGDDIDHYL---SEFKRRGKDAISEFITSSENEGKPITCIVYSLCLHWAAEVA  119



>ref|XP_003629628.1| UDP-glucose flavonoid 7-O-glucosyltransferase [Medicago truncatula]
 gb|AET04104.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=465

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = +2

Query  83   VLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            +LLV YP QG INP  +FAKRL+ LG  +T  T++ + NR+   P++  + +  FSDG+D
Sbjct  5    ILLVPYPVQGHINPAFEFAKRLITLGAHVTISTTVHMHNRITNKPTLPNLSYYPFSDGYD  64

Query  263  AGFKGS-DEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
             GFKG+  + YL+++A  + +GS+ + D++    Q+G+P + ++++  + W  
Sbjct  65   DGFKGTGSDAYLEYHAEFQRRGSEFVSDIILKNSQEGTPFTCLVHSLLLQWAA  117



>ref|XP_003601705.1| O-glucosyltransferase [Medicago truncatula]
 gb|AES71956.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=478

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = +2

Query  71   KDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFS  250
            ++ + L++ YP QG INP LQF KRL+ LG K+TF T++ + +R+   P+I G+ FATFS
Sbjct  3    QNHHFLIITYPLQGHINPALQFTKRLISLGAKVTFATTIHLYSRLINKPTIPGLSFATFS  62

Query  251  DGWDAGFKG-SDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            DG+D G K   DE+ + + +    +GS+ + +++ +  Q+  P + +IYT  + W
Sbjct  63   DGYDDGQKSFGDEDIVSYMSEFTRRGSEFLTNIILSSKQENHPFTCLIYTLILSW  117



>emb|CDY12370.1| BnaC08g08350D [Brassica napus]
Length=457

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 74/119 (62%), Gaps = 4/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + L+V +PAQG INP ++ A RL+  G  +T+ T++S + RM EPPS  G+ +A FSDG+
Sbjct  13   HYLIVTFPAQGHINPAIKLANRLIHHGATITYATTISALRRMGEPPSTEGLSYAWFSDGF  72

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGS---PISRVIYTTFMPWVGILA  427
            D G K S E+   + +  + +GS A+ D++ A L   +   PI+ VIY+  +PW   +A
Sbjct  73   DEGPK-SFEDQKNYMSEFKRRGSDALSDIIRANLDGNAATEPITGVIYSVLVPWASTVA  130



>ref|XP_011033298.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=468

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 73/117 (62%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI-HGVDFATFSDG  256
            ++LLV +PAQG INP LQFAKRLV +G  +TF TS+    RM +  +   G+ FA F DG
Sbjct  6    HILLVTFPAQGHINPALQFAKRLVAIGAHVTFATSMGAKRRMSKSGTYPKGLYFAAFDDG  65

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             + GF+ SD+    F + LR  GSK++ DL+    + G P + V+Y+  +PWV  +A
Sbjct  66   SEHGFRPSDDIEHYF-SELRRVGSKSLADLICQGPKNGGPFTCVVYSNLIPWVAKVA  121



>ref|XP_008380454.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV +PAQG INP LQFAKRL+   G  +TF+T LS  +R+       G+ ++ FSDG+D
Sbjct  7    LLVTFPAQGHINPSLQFAKRLINTTGAHVTFVTCLSARHRIGNDSIPDGLTYSLFSDGYD  66

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GF  ++     +   LR +G++AI DL+ +   +G P + ++YTTF+PW   +A
Sbjct  67   DGFNRTNNND-HYALELRRRGAQAITDLVVSSANEGHPYTCLVYTTFLPWAADVA  120



>ref|XP_008380456.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 71/115 (62%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV YPAQG INP LQFAKRL+   G  +TF+TS S  +R+       G+ +A FSDG+D
Sbjct  7    LLVTYPAQGHINPSLQFAKRLINTTGAHVTFVTSFSAHHRIGNGSIPDGLTYAPFSDGYD  66

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D     + + LR +G++AI DL+ +   +G P + ++YT  +PW   +A
Sbjct  67   DGFKPGD-NIDHYWSELRRRGAQAITDLVVSSANEGHPYTCLVYTILLPWAADVA  120



>ref|XP_007221281.1| hypothetical protein PRUPE_ppa005161mg [Prunus persica]
 gb|EMJ22480.1| hypothetical protein PRUPE_ppa005161mg [Prunus persica]
Length=474

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 72/110 (65%), Gaps = 2/110 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV +PAQG INP LQFAK LV   G  +T++TSLS  +R+    + HG+ ++ +SDG+D
Sbjct  7    LLVTFPAQGHINPSLQFAKHLVRTTGAHVTYVTSLSAQSRIGNGSTPHGLTYSLYSDGYD  66

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
             GFK  D +   + + LR  G++AI DL+ +  ++G P + +IYT  +PW
Sbjct  67   NGFKDGD-DIDHYMSELRRCGAQAITDLIVSSAKEGRPYTCLIYTILLPW  115



>ref|XP_004298223.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=473

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 73/122 (60%), Gaps = 2/122 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRMPEPPSI-HGVDFA  241
            M     LLV +PAQG INP LQF KRL+      +TF+T+LS   R+    S+  G+ FA
Sbjct  1    MTQHRFLLVTFPAQGHINPSLQFVKRLIRTTDADMTFVTALSAHRRIANGSSMPRGLTFA  60

Query  242  TFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
             FSDG+D GFK  D +   + + LR +GS+AI D++ +   +G P + ++YT  + WV  
Sbjct  61   PFSDGYDDGFKPGDIDIHHYMSELRRRGSQAITDIVMSSANEGRPYTCIVYTILLSWVAK  120

Query  422  LA  427
            +A
Sbjct  121  VA  122



>ref|XP_008222736.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Prunus mume]
Length=474

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            L+V +PAQG INP LQFAK LV   G  +T++TSLS  +R+    + +G+ ++ +SDG+D
Sbjct  7    LIVTFPAQGHINPSLQFAKHLVRTTGAHVTYVTSLSAHSRIGNGSTPYGLTYSLYSDGYD  66

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D+    + + +R +G++AI DL+ +  ++G P + +IYT  +PW  + A
Sbjct  67   NGFKDGDD-IDHYMSEIRRRGAQAITDLIVSSAKEGRPYTCLIYTILLPWAAVAA  120



>ref|XP_010650398.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=463

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 1/115 (1%)
 Frame = +2

Query  83   VLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            +LLV YPAQG INP LQ AK L+  G  +TF+TS S   RM   P++ G++F TFSDG+D
Sbjct  5    ILLVTYPAQGHINPSLQLAKLLIRAGAHVTFVTSSSAGTRMSISPTLDGLEFVTFSDGYD  64

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
              F   D     F + L   GS A+ +L+ A+  +G P + ++Y   +PWV  +A
Sbjct  65   HRFNHGD-GLQNFMSELERLGSPALTELIMARANEGRPFTCLLYGMLIPWVAEVA  118



>ref|XP_002267526.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=465

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            ++L+V  P+QG INP LQ AK L+  G  +TF TS S   RM + P++ G++FATFSDG+
Sbjct  4    HILIVTLPSQGHINPTLQLAKLLIRAGAHVTFFTSTSAGTRMSKSPNLDGLEFATFSDGY  63

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G K  D +  +F + +   GS+A+ +L+ A   +G P + ++Y   +PWV  +A
Sbjct  64   DHGLKQGD-DVEKFMSQIERLGSQALIELIMASANEGRPFACLLYGVQIPWVAEVA  118



>emb|CBI39411.3| unnamed protein product [Vitis vinifera]
Length=290

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = +2

Query  92   VMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWDAGF  271
            + YPAQG INP LQ AK L+  G  +TF+TS S   RM + P++ G++F TFSDG+D GF
Sbjct  12   LTYPAQGHINPSLQLAKLLIRAGAHVTFVTSSSAGTRMSKSPTLDGLEFVTFSDGYDHGF  71

Query  272  KGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
               D     F + L   GS A+  L+ A+  +G P + ++Y   +PWV  +A
Sbjct  72   DHGD-GLQNFMSELERLGSPALTKLIMARANEGRPFTCLLYGMLIPWVAEVA  122



>ref|XP_002301753.1| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|ABK96313.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81026.1| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
Length=472

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LL+ YPAQG INP LQFAK L  +G  +T +TSLS   RM +     G+ F TFSDG+
Sbjct  6    HFLLLTYPAQGHINPALQFAKGLTRIGALVTLVTSLSAGRRMSKTLFPDGLSFVTFSDGY  65

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D GFK  D+    F + L+ +GS+ + +L+    ++G P++ ++YT  + W   +A
Sbjct  66   DDGFKPEDDRD-HFTSELKRRGSQTLNELIVDSAKEGKPVTCLVYTMLLHWASEVA  120



>ref|XP_010023605.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59916.1| hypothetical protein EUGRSUZ_H02640 [Eucalyptus grandis]
Length=463

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 8/120 (7%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE---PPSIHGVDFATFS  250
            + LLV +P QG INP LQFAKRLV +G  +TF T++    RM E   PP   G+ FA+FS
Sbjct  5    HFLLVTFPGQGHINPSLQFAKRLVRVGAHVTFATAIRAHLRMAESKSPP--EGLSFASFS  62

Query  251  DGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D G K G D E   +   L+ +GS+ + DL+ + L+ G  +  V YTT +PWV  +A
Sbjct  63   DGYDEGVKEGQDIEV--YMDDLKRRGSETLSDLIASNLENGLRLLGVFYTTVLPWVADVA  120



>ref|XP_010650447.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=665

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWDA  265
            LL+ YPAQG INP LQFAKRL+ +G+++T +T +S ++RM + PS  G+ F TF DG+ A
Sbjct  7    LLITYPAQGHINPTLQFAKRLIRMGMEVTLVTGVSALSRMAKAPSSAGLTFTTFPDGY-A  65

Query  266  GFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
             +  +  ++    + ++  GS+A+ D++    +QG P++ +++T  +PWV
Sbjct  66   EWDKARADFSHQLSEIKRSGSQALTDIILRSAEQGRPVTCLVHTLLLPWV  115



>ref|XP_003524180.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Glycine max]
Length=460

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 70/114 (61%), Gaps = 2/114 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWDA  265
            L+VMYPAQG INP  QFAKRLV LG  +T  T++ +  R+   P++  + F  FSDG+D 
Sbjct  7    LIVMYPAQGHINPAFQFAKRLVSLGAHVTVSTTVHMHRRITNKPTLPHLSFLPFSDGYDD  66

Query  266  GFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            G+  +D  Y    +  + +GS+ + +L+ +K Q+G P + +++T  +PW    A
Sbjct  67   GYTSTD--YALQASEFKRRGSEFVTNLIASKAQEGHPFTCLVHTVLLPWAARAA  118



>ref|XP_010023606.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59917.1| hypothetical protein EUGRSUZ_H02641 [Eucalyptus grandis]
Length=463

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 8/120 (7%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE---PPSIHGVDFATFS  250
            + LLV +P QG INP LQFAKRLV +G  +TF+T++    R  E   PP   G+ FA+FS
Sbjct  5    HFLLVTFPGQGHINPSLQFAKRLVRVGAHVTFVTAIRAHLRTAESKSPP--EGLSFASFS  62

Query  251  DGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D G K G D E   +   L+ +GS+ + DL+ + L+ G  +  V YTT +PWV  +A
Sbjct  63   DGYDEGVKEGQDLEV--YMDDLKRRGSETLSDLIASNLENGRRLLGVFYTTLLPWVADVA  120



>ref|XP_002322699.1| hypothetical protein POPTR_0016s05290g [Populus trichocarpa]
 gb|EEF04460.1| hypothetical protein POPTR_0016s05290g [Populus trichocarpa]
Length=471

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 73/117 (62%), Gaps = 2/117 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI-HGVDFATFSDG  256
            ++LLV +PAQG INP LQFAKRLV +G  +TF TS+    RM +  +   G+ FA F DG
Sbjct  9    HILLVTFPAQGHINPALQFAKRLVAMGAHVTFATSMGAKRRMSKSGTYPKGLYFAAFDDG  68

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             + GF+ SD+    F + LR  GSK++ DL+    + G P + V+++  +PWV  +A
Sbjct  69   SEHGFRPSDDIEHYF-SELRHVGSKSLADLICQVPKNGGPFTCVVHSNLIPWVAKVA  124



>ref|XP_003524181.2| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=488

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 70/112 (63%), Gaps = 3/112 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWDA  265
            LLV+YP QGQINP LQFAKRL  +G ++T   +L +  RM    ++ G+  A FSDG+D 
Sbjct  33   LLVIYPGQGQINPALQFAKRLTAMGARVTIPITLDMHRRMTNTTAVPGLSLAPFSDGYDD  92

Query  266  GF---KGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            GF   +G+D +Y  + + L+ + S  + +L+ +   +G P + ++YT  +PW
Sbjct  93   GFHAIRGTDSDYNLYASELKRRASVFVSNLILSSANEGHPFTCLLYTLLVPW  144



>ref|XP_008359982.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Malus domestica]
Length=218

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 69/115 (60%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGV-KLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV YPAQG INP LQ+AKRL+      +TF+TSLS  + +       G+ +A FSDG+D
Sbjct  7    LLVTYPAQGHINPSLQYAKRLINTTCAHVTFVTSLSAHHHIGNGSIPDGLTYAPFSDGYD  66

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D     + + LR  G++AI DL+ A   +G P + ++Y+  +PW   +A
Sbjct  67   DGFKPGD-NIDHYMSELRHHGAQAITDLVVASANEGHPYTCLVYSLLLPWSAGMA  120



>ref|XP_002321086.2| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|EEE99401.2| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
Length=467

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 71/115 (62%), Gaps = 1/115 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            +K  + LLV  P QG INP +QFAKRL  +G ++T  T+LS   RM +     G+ F TF
Sbjct  2    IKQPHFLLVTLPLQGHINPSVQFAKRLTLIGARVTLATALSAQRRMSKTLFPDGLSFVTF  61

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            SDG+D G K  D+  + + + L+ +GS+ + +L+    ++G PI+ ++YT  +PW
Sbjct  62   SDGYDDGLKPEDDR-VHYMSELKRRGSQTLNELIVDSAKEGKPITCLVYTVLLPW  115



>ref|XP_009373578.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=481

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV YPAQG INP LQFAKRL+   G  +T++TSLS   R+       G+ +A FSDG+D
Sbjct  7    LLVTYPAQGHINPSLQFAKRLINTTGAHVTYVTSLSANRRIGNVSIPDGLTYAPFSDGYD  66

Query  263  AGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D  ++Y+   + LR +G +AI DL+ A   +G P + ++Y+  +PW   +A
Sbjct  67   DGFKPGDNIDDYM---SELRRRGVQAITDLVVASANEGHPYTCLVYSLIVPWAAGVA  120



>dbj|BAF75879.1| glucosyltransferase [Dianthus caryophyllus]
Length=475

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 71/115 (62%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSI-HGVDFATFSDGWD  262
            LLV +PAQG INP L+FAKRL+  GV +T  TS+S  NR  E   +  G+ FA FSDG+D
Sbjct  11   LLVTFPAQGHINPALEFAKRLLRAGVDVTLATSVS-GNRCLEKAKVPEGLRFAAFSDGYD  69

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GF+ +D+  L + +  +  GS+++ D+L     +G  ++ + YT  +PW   +A
Sbjct  70   DGFRPNDDSVLTYMSKFKQNGSRSLADVLNKARDEGKKVTCLAYTLLLPWAAEVA  124



>ref|XP_007221288.1| hypothetical protein PRUPE_ppa016890mg [Prunus persica]
 gb|EMJ22487.1| hypothetical protein PRUPE_ppa016890mg [Prunus persica]
Length=474

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            L + YPAQG INP LQ AKRL+   G ++T++TSL    R+    + +G+ +A +SDG+D
Sbjct  7    LFLTYPAQGHINPALQLAKRLIRNTGAQVTYVTSLYAYRRIVNGSTPNGLTYAPYSDGYD  66

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK SD +   + + LR  GS+ I DL+ +  ++G P + ++YT  +PW   LA
Sbjct  67   DGFKFSD-DVDHYMSELRRAGSQVITDLVASSAKEGHPYTCLVYTILLPWAADLA  120



>gb|AAY27090.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Pyrus communis]
Length=481

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV YPAQG INP LQFAKRL    G  +T++TSLS   R+       G+ +A FSDG+D
Sbjct  7    LLVTYPAQGHINPSLQFAKRLTNTTGAHVTYVTSLSAHRRIGNGSIPDGLTYAPFSDGYD  66

Query  263  AGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
             GFK  D  ++Y+   + LR +G++AI DL+ A   +G P + ++Y+  +PW
Sbjct  67   DGFKPGDNIDDYM---SELRHRGAQAITDLVVASANEGHPYTCLVYSLIVPW  115



>emb|CDP21505.1| unnamed protein product, partial [Coffea canephora]
Length=442

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 71/123 (58%), Gaps = 0/123 (0%)
 Frame = +2

Query  62   MEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFA  241
            M +K  + L+   PAQG INP LQ AK L   G ++TF T++  ++R+  PP+  G+ FA
Sbjct  1    MNIKHQHFLITALPAQGHINPTLQLAKNLARAGAQVTFATTVYGLSRIKNPPASIGLSFA  60

Query  242  TFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            +FSDG+D      + ++  F + ++  GSK +   + A   +G P++  IYT  +PWV  
Sbjct  61   SFSDGYDDAESMKNRDFACFLSDVKCFGSKDLTKFIQASSNEGRPVTFAIYTVLLPWVAE  120

Query  422  LAG  430
            +A 
Sbjct  121  VAS  123



>ref|XP_003601706.1| UDP-glucose glucosyltransferase [Medicago truncatula]
 gb|AES71957.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=472

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 76/120 (63%), Gaps = 1/120 (1%)
 Frame = +2

Query  71   KDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFS  250
            ++ + L++ YP  G INP LQFAKRL+ LG ++TF T++ +  R+    +I G+ FATFS
Sbjct  3    QNHHFLIITYPLHGHINPALQFAKRLISLGAQVTFATTIYLHTRLTNKSTISGLSFATFS  62

Query  251  DGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG D G K  S+E+++ +   L+ + S+ + +++ +  Q+G P + + Y   +PWV  +A
Sbjct  63   DGHDDGPKFESNEDFVTYEYELKRRCSEFLTNIILSGKQEGRPFTCLAYGIIIPWVAKVA  122



>ref|XP_002266800.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=257

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 68/120 (57%), Gaps = 0/120 (0%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + L++ +P QG INP LQ AKRL+  G  +TF  S+S   RMP+ P++ G+    F
Sbjct  1    MGQHHFLIISHPLQGHINPALQLAKRLIRTGAHVTFAVSVSAHRRMPKDPTLPGLTLVPF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D G K S++    + + ++  GS+ +  +      QG P++ +++T  + W   LA
Sbjct  61   SDGYDDGLKYSNDHAQHYMSEIKRCGSETLRRITAMSADQGRPVTCLLHTILLTWAAELA  120



>ref|XP_009373577.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=474

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            L++ +PAQG INP LQFAKRL+   G  +TF+T LS  +R+       G+ ++ FSDG+D
Sbjct  7    LVLTFPAQGHINPSLQFAKRLINTTGAHVTFVTCLSARHRIDNDSIPDGLTYSLFSDGYD  66

Query  263  AGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GF  +D  ++Y+   + LR +G++AI DL+ +  ++G P + ++YT  +PW   +A
Sbjct  67   NGFNSADNIDDYM---SELRRRGAQAISDLVVSSAKEGHPYTCLVYTILLPWAADVA  120



>emb|CDP21497.1| unnamed protein product [Coffea canephora]
Length=464

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 73/122 (60%), Gaps = 0/122 (0%)
 Frame = +2

Query  62   MEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFA  241
            M++K  + L+   PAQG INP LQ AK L   G ++TF T++  ++R+   P+ +G+ FA
Sbjct  1    MDIKHQHFLVTAIPAQGHINPTLQLAKNLARAGAQVTFATTVYGLSRIKNRPASNGLSFA  60

Query  242  TFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            +FSDG+D      + ++  F + ++  GSK +  L+ A   +G P++  IYT  +PWV  
Sbjct  61   SFSDGYDDEKSMKNRDFACFLSDVKCFGSKDLTKLIQASSNEGRPVTFAIYTILLPWVAE  120

Query  422  LA  427
            LA
Sbjct  121  LA  122



>ref|XP_008222735.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Prunus mume]
Length=473

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV +PAQG INP LQFAK L+   G  +T++TSLS    +    + HG+ ++ FS G+D
Sbjct  7    LLVTFPAQGHINPSLQFAKHLIRTTGAHVTYVTSLSAHGCIGNGSTPHGLTYSLFSHGYD  66

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D+    +   L+ +G++AI DL+ +  ++G P + +IYT  +PW  ++A
Sbjct  67   NGFKDGDD-IDHYMLELKRRGAQAITDLIVSSAKEGRPYTCLIYTILLPWAAVVA  120



>gb|AAX16493.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Malus domestica]
Length=481

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV +PAQG INP LQFAKRL+   G  +T++TSLS   R+       G+ +A FSDG+D
Sbjct  7    LLVTFPAQGHINPSLQFAKRLINTTGAHVTYVTSLSAHRRIGNGSIPDGLTYAPFSDGYD  66

Query  263  AGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D  ++Y+   + LR +G +AI DL+ A   +G P + ++Y+  +PW   +A
Sbjct  67   DGFKPGDNVDDYM---SELRRRGVQAITDLVVASANEGHPYTCLVYSLLLPWSAGMA  120



>ref|XP_008380455.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=481

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV +PAQG INP LQFAKRL+   G  +T++TSLS   R+       G+ +A FSDG+D
Sbjct  7    LLVTFPAQGHINPSLQFAKRLINTTGAHVTYVTSLSAHRRIGNGSIPDGLTYAPFSDGYD  66

Query  263  AGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D  ++Y+   + LR +G +AI DL+ A   +G P + ++Y+  +PW   +A
Sbjct  67   DGFKPGDNIDDYM---SELRRRGVQAITDLVVASANEGHPYTCLVYSLLLPWSAGMA  120



>ref|XP_006442000.1| hypothetical protein CICLE_v10023445mg [Citrus clementina]
 gb|ESR55240.1| hypothetical protein CICLE_v10023445mg [Citrus clementina]
Length=500

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 74/126 (59%), Gaps = 3/126 (2%)
 Frame = +2

Query  59   HMEMKDC-NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIH-GV  232
            HME +   + LL+ +P QG INP LQFA+RL  +G ++TF T++S    MP  P+   G+
Sbjct  16   HMEQQQQPHFLLLTFPIQGHINPSLQFARRLTRIGTRVTFATAISAYRLMPNNPTAEDGL  75

Query  233  DFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQ-GSPISRVIYTTFMP  409
             FA+FSDG+D GF     +   F +  + + S+A+ +L+TA   + G P + ++Y   + 
Sbjct  76   SFASFSDGYDDGFNSKQNDQTHFMSEFKRRSSEALAELITASRNEGGQPFTCLVYPQLLI  135

Query  410  WVGILA  427
            W   +A
Sbjct  136  WAAEVA  141



>dbj|BAA89009.1| anthocyanin 5-O-glucosyltransferase [Petunia x hybrida]
Length=468

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIH---GVDFATFS  250
            +V+L  +PAQG INP LQFAK LV++G+++TF TS+   +RM E   ++   G++F  FS
Sbjct  5    HVILTTFPAQGHINPALQFAKNLVKMGIEVTFSTSIYAQSRMDEKSILNAPKGLNFIPFS  64

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D GF  S +    + + LR  GS+ ++ ++    + G PI+ ++Y+ F+PW   +A
Sbjct  65   DGFDEGFDHSKDPVF-YMSQLRKCGSETVKKIILTCSENGQPITCLLYSIFLPWAAEVA  122



>ref|XP_009373576.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=572

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 70/115 (61%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV YPAQG INP  QFAKRL+   G ++TF+T LS  +R+       G+ +A FSDG+D
Sbjct  105  LLVTYPAQGHINPSFQFAKRLINTTGAQVTFVTCLSASHRVGNDSIPDGLTYALFSDGYD  164

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             GFK  D     + + LR +G++AI DL+ +   +G P + ++ T  +PW   +A
Sbjct  165  DGFKPGD-NIDHYMSELRRRGTQAITDLVVSSANEGHPYTCLVCTILLPWAANVA  218



>dbj|BAD90935.1| monoterpene glucosyltransferase [Eucalyptus perriniana]
Length=467

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   N L+V +PAQG INP LQFAKRL+  G  +TF T+ S   RM +     G+ FA+F
Sbjct  1    MAPLNYLVVAFPAQGLINPALQFAKRLLHAGAHVTFATAASAYRRMAKSDPPQGLSFASF  60

Query  248  SDGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            SDG + G + G D E  Q+ A     GS+ + DL+   L +G     + YTT +PW G +
Sbjct  61   SDGSEEGLRPGIDFE--QYMADAERLGSETLRDLVVTSLNEGRKFECMFYTTIVPWAGQV  118

Query  425  A  427
            A
Sbjct  119  A  119



>ref|XP_006492998.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Citrus sinensis]
Length=470

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIH-GVDFATFSDG  256
            + LLV +PAQG INP LQ A+RL+ +G ++TF T++    RM   P+   G+ FA+FSDG
Sbjct  12   HFLLVTFPAQGHINPALQLARRLIRIGTRVTFATTIFAYRRMANSPTPEDGLSFASFSDG  71

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGS-PISRVIYTTFMPWVGILA  427
            +D GF     +  ++ +  + + S+A+ +L+T    QG+ P + ++Y+  +PW   +A
Sbjct  72   YDDGFNSKQIDPRRYVSEFKRRSSEALTELITGSENQGAQPFTCLVYSLLLPWTAEVA  129



>ref|XP_003531212.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=465

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 72/115 (63%), Gaps = 4/115 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWDA  265
            LL++YPAQG I+P  Q AKRLV LG  +T  T++ +  R+   P++  + F  FSDG+D 
Sbjct  7    LLILYPAQGHIHPAFQLAKRLVSLGAHVTVSTTVHMHRRITNKPTLPHLSFLPFSDGYDD  66

Query  266  GFKGSDEEYLQFNASL-RAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            GF  SD      +AS+ + +GS+ + +L+ +  Q+G P + ++YTT + WV  +A
Sbjct  67   GFTSSD---FSLHASVFKRRGSEFVTNLILSNAQEGHPFTCLVYTTLLSWVAEVA  118



>ref|XP_006421040.1| hypothetical protein CICLE_v10004909mg [Citrus clementina]
 gb|ESR34280.1| hypothetical protein CICLE_v10004909mg [Citrus clementina]
 gb|KDO49186.1| hypothetical protein CISIN_1g041902mg [Citrus sinensis]
Length=470

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIH-GVDFATFSDG  256
            + LLV +PAQG INP LQ A+RL+ +G ++TF T++    RM   P+   G+ FA+FSDG
Sbjct  12   HFLLVTFPAQGHINPALQLARRLIRIGTRVTFATTIFAYRRMANSPTPEDGLSFASFSDG  71

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGS-PISRVIYTTFMPWVGILA  427
            +D GF     +  ++ +  + + S+A+ +++T    QG+ P + ++Y+  +PW   +A
Sbjct  72   YDDGFNSKQNDPRRYVSEFKRRSSEALTEIITGSENQGAQPFTCLVYSLLLPWTAEVA  129



>ref|XP_007034187.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 ref|XP_007034188.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 ref|XP_007034189.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05113.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05114.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05115.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
Length=463

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 74/121 (61%), Gaps = 2/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDF-AT  244
            M   +VLLV  P QG INP LQFAKRL+ LG+++TF T++S + RM     + G+ + A 
Sbjct  2    MAQPHVLLVTLPGQGHINPSLQFAKRLIHLGLRVTFATAVSAIRRMKPMSPLEGLTYVAA  61

Query  245  FSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            +SDG+D G K  D +  ++    R KG + + + + A +++G   + ++Y   MPWV ++
Sbjct  62   YSDGYDDGLKPGD-DIDRYILESRRKGLETLSEFIGASIEEGIRFTCIVYGIMMPWVALV  120

Query  425  A  427
            A
Sbjct  121  A  121



>ref|XP_010039943.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45602.1| hypothetical protein EUGRSUZ_L00634 [Eucalyptus grandis]
Length=467

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 71/121 (59%), Gaps = 3/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   N L+V +PAQG INP LQFAKRL+  G  +TF T+ S   RM +     G+ FA+F
Sbjct  1    MAPLNYLVVAFPAQGLINPALQFAKRLLRTGAHVTFATAGSAYRRMAKSDPPEGLSFASF  60

Query  248  SDGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            SDG + G + G D E+  + A +   GS+ + DL+   L +G   + + YTT +PWV  +
Sbjct  61   SDGSEEGLRPGIDPEH--YMADVVRLGSETLRDLVVTSLNEGCKFACIFYTTIIPWVAQV  118

Query  425  A  427
            A
Sbjct  119  A  119



>ref|XP_008362859.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Malus domestica]
Length=217

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 76/134 (57%), Gaps = 9/134 (7%)
 Frame = +2

Query  50   LEDHMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHG  229
            +ED+   +  +VL+V YPAQG INP LQF+KR+   G+K+T   ++ + N + +P S   
Sbjct  1    MEDNKGYR-AHVLVVPYPAQGHINPFLQFSKRVASKGIKVTLANTIFIANSL-QPKSSGS  58

Query  230  VDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMP  409
            V F T SDG+D G     E   ++ + + A GSK + +L+T       PI+ ++Y  F+P
Sbjct  59   VHFDTISDGYDEGGFARAESIDEYLSRMEAVGSKTLAELITKHQNSPHPINCIVYDPFLP  118

Query  410  WV-------GILAG  430
            W        G+LAG
Sbjct  119  WALEVAKQFGVLAG  132



>ref|XP_003601707.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula]
 gb|AES71958.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=479

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = +2

Query  71   KDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFS  250
            ++ + L++ YP  G INP LQFAKRL+  G ++TF T++ +   +   P+I G+ FATFS
Sbjct  3    QNHHFLIITYPLHGHINPALQFAKRLISFGAQVTFATTIYLHTGLINKPTIPGLSFATFS  62

Query  251  DGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D G    S+E+++ + + L+   S+ + +++ +  Q+G P + + Y   +PWV  +A
Sbjct  63   DGYDDGKNFESNEDFIAYRSELKCHCSEFLTNIILSGKQEGRPFTCLAYGIIIPWVAKVA  122



>ref|XP_010096066.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXC42235.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=475

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 75/129 (58%), Gaps = 16/129 (12%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE--------------PPSI  223
            LLV++PA G +NP LQ A+RLV +G ++TF+T++    RM                PP  
Sbjct  7    LLVVFPAHGHVNPALQLARRLVLIGCEVTFVTTVRAHRRMITKGGGTDDNNDNNFTPP--  64

Query  224  HGVDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTF  403
            +G+ F  FSDG+D GF     ++  ++  LR++GS+A+ DL+ +   +G P + +IYT  
Sbjct  65   NGMSFTQFSDGYDDGFGPKAIDFTVYSLELRSRGSQALIDLVDSSKNEGRPYTCMIYTFI  124

Query  404  MPWVGILAG  430
            MPWV  +A 
Sbjct  125  MPWVADVAA  133



>dbj|BAD90934.1| monoterpene glucosyltransferase [Eucalyptus perriniana]
Length=467

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   N L+V +PAQG INP LQ AKRL+  G  +TF T+ S   RM +     G+ FA+F
Sbjct  1    MAPLNYLVVAFPAQGLINPALQIAKRLLHAGAHVTFATAGSAYRRMAKSDPPEGLSFASF  60

Query  248  SDGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            SDG D G K G D  + Q+   +   GS+ + DL+   L +G   + + YTT +PWV  +
Sbjct  61   SDGSDEGLKPGID--FNQYMVDVERLGSETLRDLVVTSLNEGRKFACIFYTTIIPWVAQV  118

Query  425  A  427
            A
Sbjct  119  A  119



>emb|CAN76093.1| hypothetical protein VITISV_027116 [Vitis vinifera]
Length=466

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 68/120 (57%), Gaps = 0/120 (0%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + L++ +P QG INP LQ AKRL+  G  +TF  S+S   RMP+ P++ G+    F
Sbjct  1    MGQHHFLIISHPLQGHINPALQLAKRLIRTGAHVTFAVSVSAHRRMPKDPTLPGLTLVPF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D G K S++    + + ++  GS+ +  +      QG P++ +++T  + W   LA
Sbjct  61   SDGYDDGLKYSNDHAQHYMSEIKRCGSETLRRITAMSADQGRPVTCLLHTILLTWAAELA  120



>gb|KDO43225.1| hypothetical protein CISIN_1g036740mg, partial [Citrus sinensis]
Length=424

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 70/118 (59%), Gaps = 2/118 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIH-GVDFATFSDG  256
            + LL+ +P QG INP LQFA+RL  +G ++TF  ++S   RM   P+   G+ FA+FSDG
Sbjct  8    HFLLLTFPIQGHINPSLQFARRLTRIGTRVTFAIAISAYRRMANNPTPEDGLSFASFSDG  67

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQ-GSPISRVIYTTFMPWVGILA  427
            +D GF     +   + +  + + S+A+ +L+TA   + G P + ++Y   +PW   +A
Sbjct  68   YDDGFNSKQNDRKHYMSEFKRRSSEALAELITASQNEGGQPFTCLVYPQLLPWAAEVA  125



>dbj|BAF49286.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
 dbj|BAF49287.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
Length=463

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 9/120 (8%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   ++LLV++PAQG I+P LQ A +LV  G++LTFLTS     RM +P +I G++F  F
Sbjct  1    MSTPHILLVVFPAQGHISPALQLAMKLVAQGIQLTFLTSSFAEARMSKPTNISGLNFVYF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             +      KG D     +   LR  GS+ ++D++ + +  G PISR++YTT +PW   +A
Sbjct  61   PE----VTKGKD-----YMFELRKHGSQTLKDIILSSINVGLPISRILYTTLLPWAADIA  111



>ref|XP_010039944.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45603.1| hypothetical protein EUGRSUZ_L00635 [Eucalyptus grandis]
Length=467

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 71/121 (59%), Gaps = 3/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   N L+V +PAQG INP LQ AKRL+  G  +TF T+ S  +RM +     G+ FA+F
Sbjct  1    MAPLNYLVVAFPAQGLINPALQLAKRLLHTGAHVTFATAGSAYHRMAKSDPPEGLSFASF  60

Query  248  SDGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            SDG + G + G D E  Q+ A +   GS+ + DL+   L +G   + + YTT +PWV  +
Sbjct  61   SDGSEEGLRPGIDLE--QYMADIVRLGSETLRDLVVTSLNEGCKFACIFYTTIIPWVAQV  118

Query  425  A  427
            A
Sbjct  119  A  119



>dbj|BAF49285.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
Length=463

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 9/120 (8%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   ++LLV++PAQG I+P LQ A +LV  G++LTFLTS     RM +P +I G++F  F
Sbjct  1    MSTPHILLVVFPAQGHISPALQLAMKLVAQGIQLTFLTSSFAEARMSKPTNISGLNFVYF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             +      KG D     +   LR  GS+ ++D++ + +  G PISR++YTT +PW   +A
Sbjct  61   PE----VTKGKD-----YMFELRKHGSQTLKDIILSSINVGLPISRILYTTLLPWAADIA  111



>gb|ABQ02258.1| O-glucosyltransferase 3 [Vitis labrusca]
Length=464

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 68/120 (57%), Gaps = 0/120 (0%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + L++ +P QG INP LQ AKRL+  G  +TF  S+S   RMP+ P++ G+    F
Sbjct  1    MGQHHFLIISHPLQGHINPALQLAKRLIRTGAHVTFAVSVSAHCRMPKDPTLPGLTLVPF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D G K S++    + + ++  GS+ +  +      QG P++ +++T  + W   LA
Sbjct  61   SDGYDDGLKYSNDHAQHYMSEIKRCGSETLRRITAMSADQGRPVTCLLHTILLTWAAELA  120



>ref|XP_010099953.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB80936.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=493

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEP----------PSIHGVD  235
            LLV YPAQG INPCLQFAKRLV  G  +TF+T+      M +             +  + 
Sbjct  8    LLVTYPAQGHINPCLQFAKRLVGAGADVTFVTTYFAHRHMTKSRGDTTAAANRNGVVSIS  67

Query  236  FATFSDGWDAGFKGSD--EEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMP  409
            +  FSDG D GFK  D  + YL     +R +GS+AI DL+ +  ++G P + ++Y+  +P
Sbjct  68   YVPFSDGHDDGFKPGDSVDHYLN---EIRRRGSQAISDLVISAAKEGHPYTCLVYSLLLP  124

Query  410  WVGILA  427
            W  + A
Sbjct  125  WAALTA  130



>emb|CAN77410.1| hypothetical protein VITISV_038710 [Vitis vinifera]
Length=299

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + L++ +P QG INP LQFAKRL+ +G  +TF+ S+S    MP+ P + G+    F
Sbjct  1    MGQHHFLIISHPLQGHINPALQFAKRLIRIGAHVTFVVSVSAHRHMPKGPILPGLTLVPF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D G    D     + + ++  GS+ +  ++     QG P++ +++T  + WV  LA
Sbjct  61   SDGYDDGINLEDHAQ-HYLSEIKRCGSETLRRIIAISADQGRPVTCLVHTILLAWVAELA  119



>ref|XP_006442002.1| hypothetical protein CICLE_v10019912mg [Citrus clementina]
 gb|ESR55242.1| hypothetical protein CICLE_v10019912mg [Citrus clementina]
Length=484

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 73/126 (58%), Gaps = 3/126 (2%)
 Frame = +2

Query  59   HMEMKDC-NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIH-GV  232
            HME +   + LL+ +P QG INP LQFA+RL  +G ++TF  ++S   R+   P+   G+
Sbjct  16   HMEQQQQPHFLLLTFPIQGHINPSLQFARRLTRIGTRVTFAIAISAYRRIANNPTPEDGL  75

Query  233  DFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQ-GSPISRVIYTTFMP  409
             FA+FSDG+D GF     +   + +  + + S+A+ +L+T    + G P + ++Y   +P
Sbjct  76   SFASFSDGYDDGFNSKQNDRTHYMSEFKRRSSEALAELITTSQNEGGQPFTCLVYPQLLP  135

Query  410  WVGILA  427
            W   +A
Sbjct  136  WAAEVA  141



>ref|XP_006349903.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Solanum tuberosum]
Length=470

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 6/121 (5%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHG-----VDFAT  244
            +V+L  +PAQG INP LQFAK LV+ G+++TF TS+     M E  SI       ++F  
Sbjct  5    HVILTTFPAQGHINPALQFAKNLVKNGIQVTFSTSIYAQRLMDEKKSIDNFPKGLMNFVP  64

Query  245  FSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            FSDG+D GF  S ++ + + + LR  GS+ +++++    + GSPI+ ++Y+ F+PW   +
Sbjct  65   FSDGFDDGFDHS-KDPVCYMSQLRKCGSETVKNIIINCSENGSPITCLLYSIFLPWAAEV  123

Query  425  A  427
            A
Sbjct  124  A  124



>ref|XP_004297003.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=516

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRMPEPPSI-HGVDFATFSDGW  259
            LLV YPAQG INP LQF K L+   G ++T++T+LS   R+    S   G+ FA FSDG+
Sbjct  52   LLVTYPAQGHINPSLQFVKCLIRTTGAEVTYVTALSAHRRIGNSSSKPRGLTFAPFSDGY  111

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G K  D+    + + LR +GS A+ D++ +   +G P + ++YT  +PWV  +A
Sbjct  112  DDGLKPGDD-IPHYLSELRRRGSHALADIVVSSANEGRPYTCIVYTILLPWVAQVA  166



>emb|CDP15111.1| unnamed protein product [Coffea canephora]
Length=471

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 75/120 (63%), Gaps = 4/120 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPP-SI-HGVDFATFSD  253
            ++LLV YP QG INP LQFAKRL+ +G+++TF TS+  + RM +   SI  G+ FATFSD
Sbjct  6    HILLVSYPVQGHINPSLQFAKRLLRMGIQVTFATSVFALGRMTKSSGSIPKGLSFATFSD  65

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFM--PWVGILA  427
            G+D GF+     + +  + +   GS A+++++     QG P++ ++ T  +  PW   +A
Sbjct  66   GYDNGFQPKGVGHSEHMSGMEKHGSNALKNVINTSANQGCPVTCLVCTFLLPCPWATTVA  125



>emb|CBI39398.3| unnamed protein product [Vitis vinifera]
Length=409

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV YPAQG INP L+ AKRL++ G ++TF+T++    RM +P S+ G+ FA FSDG+
Sbjct  5    HFLLVSYPAQGHINPTLRLAKRLIQTGAQVTFVTTVYAQRRMVKPLSVCGLSFAPFSDGY  64

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G +  D  +    + ++ +G+  + +L+     QG P++ ++YT    W   +A
Sbjct  65   DDGCENKDNLH-HVLSEIKRQGTLKLTELVLECADQGRPVACIVYTMIFDWAQEVA  119



>ref|XP_010103920.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB97437.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=475

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 74/129 (57%), Gaps = 16/129 (12%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE--------------PPSI  223
            LLV+ PA G +NP LQ A+RLV +G ++TF+T++    RM                PP  
Sbjct  7    LLVVLPAHGHVNPALQLARRLVLIGCEVTFVTTVRAHRRMITKGGGTDDNNDNNFTPP--  64

Query  224  HGVDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTF  403
            +G+ F  FSDG+D GF     ++  ++  LR++GS+A+ DL+ +   +G P + +IYT  
Sbjct  65   NGMSFTQFSDGYDDGFGPKAIDFTVYSLELRSRGSQALIDLVDSSKNEGRPYTCMIYTFI  124

Query  404  MPWVGILAG  430
            MPWV  +A 
Sbjct  125  MPWVADVAA  133



>ref|XP_002266628.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=498

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 0/120 (0%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + L++  P QG INP LQFAKRL+  G  +TF  S+S   RMP+ P++ G+    F
Sbjct  33   MGQHHFLIISLPLQGHINPALQFAKRLIRTGAHVTFAVSVSAHRRMPKDPTLPGLTLVLF  92

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D G K SD+      + ++  G + +  +      QG P++ +++T  + W   LA
Sbjct  93   SDGYDDGIKYSDDHVQHSMSEIKRCGPETLRRITAMSADQGRPVTCLLHTILLTWAAELA  152



>ref|XP_002266919.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=463

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV YPAQG INP L+ AKRL++ G ++TF+T++    RM +P S+ G+ FA FSDG+
Sbjct  5    HFLLVSYPAQGHINPTLRLAKRLIQTGAQVTFVTTVYAQRRMVKPLSVCGLSFAPFSDGY  64

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G +  D  +    + ++ +G+  + +L+     QG P++ ++YT    W   +A
Sbjct  65   DDGCENKDNLH-HVLSEIKRQGTLKLTELVLECADQGRPVACIVYTMIFDWAQEVA  119



>ref|XP_008355875.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Malus domestica]
Length=260

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 67/115 (58%), Gaps = 2/115 (2%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            LLV YP QG INP LQ+AKRL+   G  +TF+TSL   + +       G+ +A FSDG+D
Sbjct  7    LLVTYPTQGHINPSLQYAKRLINTTGAHVTFVTSLLAHHHIGNGSIPDGLTYAPFSDGYD  66

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
              FK  D     + + LR  G++AI DL+ A   +G P + ++Y+  +PW   +A
Sbjct  67   DRFKPGD-NIDHYMSELRHHGAQAITDLVVASANEGHPYTCLVYSLLLPWSAGMA  120



>ref|XP_002263498.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=463

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV YPAQG INP L+ AKRL++ G ++TF+T++     M +P S+ G+ FA FSDG+
Sbjct  5    HFLLVSYPAQGHINPTLRLAKRLIQTGAQVTFVTTVYAQRHMVKPLSVCGLSFAPFSDGY  64

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G +  D  +    + ++ +G++ + +L+     QG P++ ++YT    W   +A
Sbjct  65   DDGCENKDNLH-HVLSEIKRQGTRKLTELVLECADQGRPVACIVYTMIFDWAQEVA  119



>ref|XP_004252978.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=470

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 74/121 (61%), Gaps = 6/121 (5%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHG-----VDFAT  244
            +V++  +PAQG INP LQFAK LV+ G+++TF TS+     M E  SI       ++F  
Sbjct  5    HVIVTTFPAQGHINPALQFAKNLVKNGIQVTFSTSIYAQRLMDEKKSIDNFPKGLMNFVP  64

Query  245  FSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            FSDG+D GF  S +    + + LR  GS+ +++++    + GSPI+ ++Y+ F+PW   +
Sbjct  65   FSDGFDDGFDHSKDPVF-YMSQLRKCGSQTVKNIIINCSENGSPITCLLYSIFLPWAAEV  123

Query  425  A  427
            A
Sbjct  124  A  124



>ref|XP_009366234.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Pyrus x bretschneideri]
Length=469

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 72/125 (58%), Gaps = 8/125 (6%)
 Frame = +2

Query  77   CNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDG  256
             +VL+V YPAQG INP LQF+KR+   G+K+T   ++ + N + +P S   V F T SDG
Sbjct  9    AHVLVVPYPAQGHINPFLQFSKRVASKGIKVTLANTIFIANSL-QPKSSGSVHFDTISDG  67

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV-------  415
            +D G     E   ++ + + A GSK++ +L+T       PI+ ++Y  F+PW        
Sbjct  68   YDEGGFARAESIDEYLSRMEAVGSKSLAELITKHQNSPHPINCIVYDPFLPWALEVAKQF  127

Query  416  GILAG  430
            G+LAG
Sbjct  128  GVLAG  132



>ref|XP_010039945.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45604.1| hypothetical protein EUGRSUZ_L00636 [Eucalyptus grandis]
Length=460

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 70/121 (58%), Gaps = 3/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   N L+V +P+QG INP LQFAKRL+  G  +TF T+ S   RM +     G+ FA+F
Sbjct  1    MAPVNYLVVAFPSQGLINPALQFAKRLLHTGAHVTFATAGSAYRRMAKSNPPEGLFFASF  60

Query  248  SDGWDAGF-KGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            SDG D G   G D E  ++ A +   GS+ + DL+   L +G   + + YTT +PWV  +
Sbjct  61   SDGSDEGLMPGIDIE--KYMADVERLGSETLRDLVITSLNRGRTFACIFYTTIVPWVAQV  118

Query  425  A  427
            A
Sbjct  119  A  119



>emb|CAN62624.1| hypothetical protein VITISV_001657 [Vitis vinifera]
Length=456

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 67/120 (56%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M+  + L++ +P QG INP L FAKRL+  G  +TF  S+S   RMP  P++ G+    F
Sbjct  1    MEQHHFLIISHPMQGHINPALLFAKRLIRTGAHVTFAVSVSAHRRMPRGPALPGLTLVPF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D GFK  D     + + ++  GS+ +  +      QG P++ +++T  + W   LA
Sbjct  61   SDGYDDGFKLEDHPQ-HYLSEIKRCGSETLRRITAISADQGRPVTCLVHTILLAWAAELA  119



>ref|XP_002263422.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=456

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 67/120 (56%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M+  + L++ +P QG INP L FAKRL+  G  +TF  S+S   RMP  P++ G+    F
Sbjct  1    MEQHHFLIISHPMQGHINPALLFAKRLIRTGAHVTFAVSVSAHRRMPRGPALPGLTLVPF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D GFK  D     + + ++  GS+ +  +      QG P++ +++T  + W   LA
Sbjct  61   SDGYDDGFKLEDHPQ-HYLSEIKRCGSETLRRITAISADQGRPVTCLVHTILLAWAAELA  119



>ref|XP_008384038.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Malus domestica]
Length=456

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 76/134 (57%), Gaps = 9/134 (7%)
 Frame = +2

Query  50   LEDHMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHG  229
            +ED+   +  +VL+V YPAQG INP LQF+KR+   G+K+T   ++ + N + +P S   
Sbjct  1    MEDNKGYR-AHVLVVPYPAQGHINPFLQFSKRVASKGIKVTLANTIFIANSL-QPKSSGS  58

Query  230  VDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMP  409
            V F T SDG+D G     E   ++ + + A GSK + +L+T       PI+ ++Y  F+P
Sbjct  59   VHFDTISDGYDEGGFARAESIDEYLSRMEAVGSKTLAELITKHQNSPHPINCIVYDPFLP  118

Query  410  WV-------GILAG  430
            W        G+LAG
Sbjct  119  WALEVAKQFGVLAG  132



>ref|XP_003517852.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Glycine max]
Length=465

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 5/120 (4%)
 Frame = +2

Query  59   HMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDF  238
            H    + +VL++ YPAQG INP +QFAKRL   GVK T  T+    N +  P     +  
Sbjct  3    HQRQNNIHVLVLPYPAQGHINPLVQFAKRLASKGVKATVATTHYTANSINAP----NITV  58

Query  239  ATFSDGWD-AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
               SDG+D AGF  ++     F AS R  GS+ + +L+    Q  SP++ ++Y +F PWV
Sbjct  59   EAISDGFDQAGFAQTNNNVQLFLASFRTNGSRTLSELIRKHQQTPSPVTCIVYDSFFPWV  118



>ref|XP_003629627.1| Indole-3-acetate beta-glucosyltransferase [Medicago truncatula]
 gb|AET04103.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=472

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 68/124 (55%), Gaps = 7/124 (6%)
 Frame = +2

Query  62   MEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRM----PEPPSIHG  229
            M      +LLV YPAQG INP LQFAKRL+ +G  +T   +L +  R+    P   +I  
Sbjct  1    MSHHHHRILLVTYPAQGHINPALQFAKRLISMGAHVTLPITLHLYRRLILLNPSITTISN  60

Query  230  VDFATFSDGWDAGF---KGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTT  400
            +    FSDG++ GF     +D ++ Q+ +    +GS  I +L+ +  Q+  P + ++YT 
Sbjct  61   LSITPFSDGYNDGFIAITNTDADFHQYTSQFNTRGSDFITNLILSAKQESKPFTCLLYTI  120

Query  401  FMPW  412
             +PW
Sbjct  121  IIPW  124



>ref|XP_009778639.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=465

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            MK  + L++  PAQG INP LQ AK L   G + TF+T++  + RM   P+   + +++F
Sbjct  1    MKQHHFLVISLPAQGHINPTLQMAKNLARAGARATFVTTVYGLKRMNNLPTQERLFYSSF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D  +  S+ ++  +  +L+ +GSK +++LL     +G P++ ++YT  +PWV ++A
Sbjct  61   SDGYDDDWI-SNTDHNDYMNNLKYEGSKNLKNLLRKFSDEGHPVTFLVYTILLPWVAVVA  119



>gb|KDP32590.1| hypothetical protein JCGZ_13140 [Jatropha curcas]
Length=455

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 0/120 (0%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            MK+ +VL+  +PAQG INP LQFA+RL  +G+K+TF T++    RM +      + FA  
Sbjct  1    MKNPHVLVASFPAQGHINPSLQFAQRLATMGLKVTFATTIGADRRMAKTGIPDNLSFAAL  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG D GFK            LR  GS+ +  L+      G P + V+Y+  +PWV  +A
Sbjct  61   SDGNDDGFKPIVNIGNYMTHDLRLHGSQTLRRLIQQASNDGHPFTFVVYSILIPWVAKVA  120



>ref|NP_001063685.1| Os09g0518200 [Oryza sativa Japonica Group]
 dbj|BAD34401.1| putative UDP-glucose:salicylic acid glucosyltransferase [Oryza 
sativa Japonica Group]
 dbj|BAD34358.1| putative UDP-glucose:salicylic acid glucosyltransferase [Oryza 
sativa Japonica Group]
 dbj|BAF25599.1| Os09g0518200 [Oryza sativa Japonica Group]
Length=469

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 66/115 (57%), Gaps = 6/115 (5%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            +V+L+ YP+QG INP LQF KRL   G     L     + R  EPPS   V  A +SDG+
Sbjct  13   HVVLLPYPSQGHINPILQFGKRLAGHGGVRCTLAVTRFILRQGEPPSTGAVHVAAYSDGY  72

Query  260  DAG---FKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
            DAG     GS  EYL   + L ++GS  ++ LL A+ +QG P+  V+Y +F+ W 
Sbjct  73   DAGGFHEAGSAGEYL---SRLESRGSDTMDALLRAEAEQGRPVDAVVYDSFLSWA  124



>gb|EAZ09772.1| hypothetical protein OsI_32059 [Oryza sativa Indica Group]
Length=471

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 66/115 (57%), Gaps = 6/115 (5%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            +V+L+ YP+QG INP LQF KRL   G     L     + R  EPPS   V  A +SDG+
Sbjct  15   HVVLLPYPSQGHINPILQFGKRLAGHGGVRCTLAVTRFILRQGEPPSTGAVHVAAYSDGY  74

Query  260  DAG---FKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
            DAG     GS  EYL   + L ++GS  ++ LL A+ +QG P+  V+Y +F+ W 
Sbjct  75   DAGGFHEAGSAGEYL---SRLESRGSDTMDALLRAEAEQGRPVDAVVYDSFLSWA  126



>ref|XP_004502258.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cicer arietinum]
 gb|AGU14117.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 68/117 (58%), Gaps = 1/117 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            N L+V YP QG INP LQFAKRLV +G  +TF T++ +  R+   P+I  + FA FSDG+
Sbjct  6    NFLIVTYPLQGHINPALQFAKRLVTMGAHVTFTTTIYLHRRLINKPTIPNLSFAAFSDGY  65

Query  260  DAGFKGSDEEYLQ-FNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G+  +    L  +   L ++GS+ + +++ +      P + + YT  +PW   +A
Sbjct  66   DDGYNSNAIVDLSTYMLELSSRGSEFLRNIILSAKHGNHPFTCLAYTLLLPWAANVA  122



>ref|XP_009604418.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=465

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            MK  + L++  PAQG INP LQ AK L   G + TF+T++  + RM   P+   + +++F
Sbjct  1    MKKHHFLVISLPAQGHINPTLQMAKNLARAGARATFITTVYGLKRMNNLPTQERLFYSSF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D  +  S+ ++  +  +L+ +GSK ++++L     +G P++ ++YT  +PWV ++A
Sbjct  61   SDGYDDDWI-SNTDHNDYMNNLKHEGSKNLKNILRKFSDEGHPVTFLVYTILLPWVAVVA  119



>ref|XP_010023610.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010023611.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59920.1| hypothetical protein EUGRSUZ_H02644 [Eucalyptus grandis]
Length=462

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 72/119 (61%), Gaps = 7/119 (6%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE---PPSIHGVDFATFS  250
            + LLV +P QG INP LQFAKRL+ +G  +TF T++  ++RM E   PP   G+ FA+FS
Sbjct  5    HFLLVTFPGQGHINPSLQFAKRLMRVGAHVTFATAIHALHRMAESKSPP--EGLSFASFS  62

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D       ++  ++    + +GS+ + DL+ + L+ G     V YTT +PWV  +A
Sbjct  63   DGYDD--GFDWDDLDKYADEFKRRGSETLSDLIASNLENGRRFLGVFYTTLLPWVADVA  119



>emb|CDP03995.1| unnamed protein product [Coffea canephora]
Length=459

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 63/111 (57%), Gaps = 1/111 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            +VL++ YP QG INP LQF KRLV  GVK TF+ S+ +   +P  P    ++F T SDG 
Sbjct  9    HVLVLPYPGQGHINPMLQFCKRLVAKGVKTTFVNSVFISKSIPADPK-SAINFETISDGH  67

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            D G   + E    +   L   GSKA+ DL+     +G P+  VIY +F+ W
Sbjct  68   DEGGYAAAESPEAYLEKLATFGSKALADLIRKLEDKGEPVQAVIYDSFLTW  118



>emb|CAN62622.1| hypothetical protein VITISV_001655 [Vitis vinifera]
Length=463

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 70/116 (60%), Gaps = 1/116 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LLV YPAQG INP L+ AK L++ G ++TF+T++     M +P S+ G+ FA FSDG+
Sbjct  5    HFLLVSYPAQGHINPTLRLAKXLIQTGAQVTFVTTVYAQRHMVKPLSVCGLSFAPFSDGY  64

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G +  D  +    + ++ +G++ + +L+     QG P++ ++YT    W   +A
Sbjct  65   DDGCENKDNLH-HVLSEIKRQGTRKLTELVLECADQGRPVACIVYTMIFDWAQEVA  119



>emb|CDP06918.1| unnamed protein product [Coffea canephora]
Length=458

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 63/117 (54%), Gaps = 1/117 (1%)
 Frame = +2

Query  62   MEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFA  241
            M     +VL++ YPAQG INP LQF KRLV  GVK TF+ S+ V N +P  P    ++F 
Sbjct  2    MNSTKVHVLVLPYPAQGHINPLLQFCKRLVAKGVKTTFVNSVFVSNSIPADPK-SAINFE  60

Query  242  TFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
              SDG D G   + E    +   L   GSK + DL+     +G P+  VIY + + W
Sbjct  61   AISDGHDEGGYAAAESTGAYLEKLATFGSKKLADLIRKLEDKGEPVQAVIYDSLLTW  117



>ref|XP_010042881.1| PREDICTED: UDP-glycosyltransferase 74F2-like, partial [Eucalyptus 
grandis]
Length=216

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 66/117 (56%), Gaps = 5/117 (4%)
 Frame = +2

Query  71   KDC--NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPS-IHGVDFA  241
            K C  +VLLV YP+QG INP LQF+KRL   G+K TF T++ + N M    S + G+D  
Sbjct  5    KGCRGHVLLVPYPSQGHINPMLQFSKRLASKGLKATFATTVFIFNSMKADTSPLVGLD--  62

Query  242  TFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            T SDG+D+G     E    +   L A GSK + DL+        P+  ++Y + +PW
Sbjct  63   TISDGYDSGGFAEAESIHTYITRLEAAGSKTLSDLIVKYQSTDHPVDCIVYDSILPW  119



>ref|XP_004253165.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=465

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + L++  PAQG INP LQ AK L   G + TF+T++  ++RM   P+  G+ +++F
Sbjct  1    MNKQHFLVISLPAQGHINPTLQLAKNLARAGARATFITTVYGLSRMNNLPTQDGLFYSSF  60

Query  248  SDGW-DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            SDG  D  +  S+     F   L+  GSK + DL+     +G P++ ++YT  +PWV ++
Sbjct  61   SDGCDDDSWMNSNSTVDYFMNDLKINGSKNLRDLVRKYSDEGHPVTFLVYTILLPWVAVV  120

Query  425  A  427
            A
Sbjct  121  A  121



>ref|XP_002266967.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=465

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M   + L++  P QG INP LQFAKRL+  G  +TF  S+S   RMP+ P++ G+    F
Sbjct  1    MGQHHFLIISLPLQGHINPALQFAKRLIRTGAHVTFAVSVSAHRRMPKGPTLPGLTLVPF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D G K  D     + + ++  GS+ +  +      QG P++ +++T  + W   LA
Sbjct  61   SDGYDDGIKLEDHAQ-HYLSEIKRCGSETLRRITAISSDQGRPVTCLVHTMLLAWAAELA  119



>ref|XP_010246963.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=459

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 69/118 (58%), Gaps = 5/118 (4%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNR-MPEPPSIHGVDFATFSDG  256
            + LLV  P QG INP LQFAKRL+  G ++TF  S S   R M     IHG+ FA FSDG
Sbjct  7    HFLLVTLPMQGHINPTLQFAKRLLRTGAQVTFAISFSAYRRLMKSSTPIHGLTFAPFSDG  66

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILAG  430
            +D G++   +E  +F    + + S+A+ DL+ A  ++  P++ +IYT  + W   +A 
Sbjct  67   FDDGYRVFFDEPSEF----KLRASQALADLILAASKEHRPVTCLIYTLLLSWAADVAN  120



>ref|XP_010527436.1| PREDICTED: UDP-glycosyltransferase 75C1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527437.1| PREDICTED: UDP-glycosyltransferase 75C1 isoform X2 [Tarenaya 
hassleriana]
Length=466

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 69/115 (60%), Gaps = 5/115 (4%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPS-IHGVDFATFSDGWD  262
            LLV +PAQG INP L+ A RL+  G  +TF T+++ + RM  PPS + G+ FA  SDG+D
Sbjct  17   LLVTFPAQGHINPALELANRLISHGATVTFSTTVNALRRMGTPPSAVDGLSFAWLSDGFD  76

Query  263  AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             G K S E+   + +  + +GS A+ D++        PI+ VIY+  +PW   +A
Sbjct  77   DGVK-SPEDGKIYMSEFKRRGSAALSDVIDT---SDPPITAVIYSILVPWAAAVA  127



>ref|XP_006307449.1| hypothetical protein CARUB_v10009073mg [Capsella rubella]
 gb|EOA40347.1| hypothetical protein CARUB_v10009073mg [Capsella rubella]
Length=462

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 70/119 (59%), Gaps = 3/119 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNR--MPEPPSIHGVDFATFS  250
            + LLV +PAQG +NP L FA+RL++  G ++TF+T LS   R  M    ++  + F TFS
Sbjct  5    HFLLVTFPAQGHVNPSLHFARRLIKKTGARVTFVTCLSFFQRSMMSNHNNVENLSFLTFS  64

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG+D G   + E+  + + +L+  G KA+ D + A     SP++ +IYT  + W   +A
Sbjct  65   DGFDDGGISTSEDSQKRSVNLKVNGDKALSDFIKASRNGDSPVTCLIYTILLNWAPKVA  123



>emb|CDP20001.1| unnamed protein product [Coffea canephora]
Length=464

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 69/122 (57%), Gaps = 0/122 (0%)
 Frame = +2

Query  62   MEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFA  241
            M +K  + L+   PAQG INP LQ AK L   G ++TF T++  +  +  PP+  G+ FA
Sbjct  1    MNIKHQHFLITALPAQGHINPTLQLAKNLARAGAQVTFATTVYGLRCIKNPPASIGLSFA  60

Query  242  TFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            +FSDG+D      +    ++ + ++  GSK +  L+     +G P++ +IYT  +PWV  
Sbjct  61   SFSDGYDDEEPMKNRNPGRYLSDVKCYGSKDLTKLIQCSSNEGRPVTFLIYTVLLPWVAE  120

Query  422  LA  427
            +A
Sbjct  121  VA  122



>ref|XP_010068983.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW57189.1| hypothetical protein EUGRSUZ_H00004 [Eucalyptus grandis]
Length=465

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 3/109 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + LL+ +P++G INP LQ A+RL   G ++TF T++S   RM EP  + GV FATFSDG+
Sbjct  5    HFLLIAFPSRGAINPALQLAERLTHAGSRVTFFTTVSAHRRMIEPVCLDGVTFATFSDGY  64

Query  260  DAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTF  403
            D G++ G D ++  F A L+ +GS+A+  L+     +G   +  ++T F
Sbjct  65   DNGYELGDDVDH--FMAELKRRGSEALRGLIEYSSGRGLRFTCALHTMF  111



>ref|NP_172044.1| UDP-glucosyl transferase 75B2 [Arabidopsis thaliana]
 sp|Q9ZVY5.1|U75B2_ARATH RecName: Full=UDP-glycosyltransferase 75B2; AltName: Full=(Uridine 
5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl 
transferase 2; AltName: Full=IAA-Glu synthase 2; AltName: 
Full=Indole-3-acetate beta-glucosyltransferase 2 [Arabidopsis 
thaliana]
 gb|AAF79732.1|AC005106_13 T25N20.18 [Arabidopsis thaliana]
 gb|AEE27849.1| UDP-glucosyl transferase 75B2 [Arabidopsis thaliana]
 gb|AHL38969.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=455

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 70/123 (57%), Gaps = 3/123 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNR--MPEPPSIHGVDF  238
            M   + LLV +PAQG +NP L+FA+RL++  G ++TF T LSV++R  +P   ++  + F
Sbjct  1    MAQPHFLLVTFPAQGHVNPSLRFARRLIKTTGARVTFATCLSVIHRSMIPNHNNVENLSF  60

Query  239  ATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
             TFSDG+D G   + ++           G KA+ D + A     SP+S +IYT    WV 
Sbjct  61   LTFSDGFDDGVISNTDDVQNRLVHFERNGDKALSDFIEANQNGDSPVSCLIYTILPNWVP  120

Query  419  ILA  427
             +A
Sbjct  121  KVA  123



>gb|KCW76863.1| hypothetical protein EUGRSUZ_D01218 [Eucalyptus grandis]
Length=430

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 73/123 (59%), Gaps = 7/123 (6%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE---PPSIHGVDF  238
            M   + LLV +P+QG INP LQFAKRLV +G  +TF T++   +RM E   PP   G+ F
Sbjct  11   MAPPHFLLVTFPSQGHINPSLQFAKRLVRVGAHVTFATAIHAHHRMAESKSPPV--GLSF  68

Query  239  ATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
            A+FSDG+D       ++   +   L+ +GS+ + +L+ + L+ G     V YTT +PWV 
Sbjct  69   ASFSDGYDD--GIDKDDLDGYMDELKRQGSETLSNLIASNLENGRRFLGVFYTTLLPWVA  126

Query  419  ILA  427
             +A
Sbjct  127  DVA  129



>ref|XP_010069229.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74F2-like 
[Eucalyptus grandis]
Length=469

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 65/112 (58%), Gaps = 3/112 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRM-PEPPSIHGVDFATFSDG  256
            +VLLV YP+QG INP LQF+KRL   G+K T  T++ + N M P+   + G+D  T SDG
Sbjct  10   HVLLVPYPSQGHINPMLQFSKRLASKGLKATLATTVFIFNSMKPDTSPLVGLD--TISDG  67

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
             D+G     E    + A L A GSK + DL+        P+  ++Y +F+PW
Sbjct  68   HDSGGFTEAESIHTYIARLEAAGSKTLSDLIIKYQSTDHPVDCIVYDSFLPW  119



>ref|XP_002516389.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF46006.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=460

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 1/121 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHG-VDFAT  244
            M   ++L+V +P+QG INP LQ AKRLV LG+K+TF T++S   RM      +G + FAT
Sbjct  1    MGHPHILVVTFPSQGHINPGLQLAKRLVTLGLKVTFATTISTHRRMSRTDDSNGLLSFAT  60

Query  245  FSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            FSDG D G+     ++    + L   G +    ++    + G P++ +IY+  + WV  +
Sbjct  61   FSDGHDDGYNLLGGDFAHCLSELTHYGQQTFPKIILRSAKDGHPVTCIIYSLLVSWVAKV  120

Query  425  A  427
            A
Sbjct  121  A  121



>ref|XP_010052789.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=472

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 73/123 (59%), Gaps = 7/123 (6%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE---PPSIHGVDF  238
            M   + LLV +P+QG INP LQFAKRLV +G  +TF T++   +RM E   PP   G+ F
Sbjct  11   MAPPHFLLVTFPSQGHINPSLQFAKRLVRVGAHVTFATAIHAHHRMAESKSPPV--GLSF  68

Query  239  ATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
            A+FSDG+D       ++   +   L+ +GS+ + +L+ + L+ G     V YTT +PWV 
Sbjct  69   ASFSDGYDD--GIDKDDLDGYMDELKRQGSETLSNLIASNLENGRRFLGVFYTTLLPWVA  126

Query  419  ILA  427
             +A
Sbjct  127  DVA  129



>ref|XP_007033645.1| UDP-glucosyltransferase 74F2, putative [Theobroma cacao]
 gb|EOY04571.1| UDP-glucosyltransferase 74F2, putative [Theobroma cacao]
Length=455

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 62/111 (56%), Gaps = 1/111 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            +VL + YP+QG +NP LQF+KRL   G+K TF T+L + + M +P S+  V+F T S G 
Sbjct  9    HVLALPYPSQGHVNPMLQFSKRLASKGIKATFATTLFISHTM-KPESLGSVEFDTISHGC  67

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            D G     E    +   L A GSK + DL+        P   VIY +F+PW
Sbjct  68   DQGGFSEAESIHDYLKRLEAAGSKTLADLIIKYKNSPHPFDCVIYDSFLPW  118



>ref|XP_002892298.1| UDP-glucosyl transferase 75B1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68557.1| UDP-glucosyl transferase 75B1 [Arabidopsis lyrata subsp. lyrata]
Length=474

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 69/112 (62%), Gaps = 3/112 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNR--MPEPPSIHGVDFATFSDG  256
            LLV +PAQG +NP L+FA+RL++  G ++TF+  +SV +   +P   ++  + F TFSDG
Sbjct  7    LLVTFPAQGHVNPSLRFARRLIKTTGTRVTFVACVSVFHNSMIPNHNNVDNLSFLTFSDG  66

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            +D G   + E+  +  A+L+  G KA+ + + A     SP++ VIYT  + W
Sbjct  67   FDDGGISTYEDRQKRTANLKVNGDKALSEFIEASRNGDSPVTCVIYTILLNW  118



>gb|KJB18350.1| hypothetical protein B456_003G047900 [Gossypium raimondii]
Length=453

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 70/117 (60%), Gaps = 8/117 (7%)
 Frame = +2

Query  83   VLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGWD  262
            VLLV + +QG INP LQFA  L+  GV +T +++ S+++R  +   +HG+ +A +SDG+D
Sbjct  11   VLLVTFASQGHINPSLQFANNLINNGVHVTLMSASSMIHRFNKASPVHGLSYAYYSDGYD  70

Query  263  AGFK--GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
              F+  G    YL   +  +  G++++ + L     QG+  + ++Y T +PWV  +A
Sbjct  71   HAFQLSGDTNHYL---SETKRHGTQSLREFLA---DQGTRFTSIVYCTLLPWVATVA  121



>ref|XP_010485047.1| PREDICTED: UDP-glycosyltransferase 75B1 isoform X1 [Camelina 
sativa]
Length=465

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 70/117 (60%), Gaps = 3/117 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNR--MPEPPSIHGVDFATFSDG  256
            LLV +PAQG +NP L+FA+RL++  G  +TF+T LS  +R  +P    +  + F TFSDG
Sbjct  7    LLVTFPAQGHVNPSLRFARRLIKTTGAHVTFVTCLSFFHRSMIPNHNKVDNLSFLTFSDG  66

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            +D G   + ++  + + +L   G KA+ + + A    GSP++ +IYT  + W   +A
Sbjct  67   FDDGGISTSDDRQKRSVNLMVNGDKALSEFIEANRNGGSPVTCLIYTILLNWAPKVA  123



>ref|XP_007157504.1| hypothetical protein PHAVU_002G075200g [Phaseolus vulgaris]
 gb|ESW29498.1| hypothetical protein PHAVU_002G075200g [Phaseolus vulgaris]
Length=465

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 64/114 (56%), Gaps = 5/114 (4%)
 Frame = +2

Query  74   DCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSD  253
            + +VLL+ YPAQG INP LQFAKRL   GVK T  T+    N +  P     +     SD
Sbjct  8    NVHVLLLPYPAQGHINPILQFAKRLASKGVKATVATTHYTANSIAAP----NITVEPISD  63

Query  254  GWD-AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            G+D AGF  + ++   F +S R  GS+ +  L+    Q  SP++ ++Y +F PW
Sbjct  64   GFDRAGFAEAKDDVQLFLSSFRTNGSRTLSQLIHKHHQTPSPVTCIVYDSFFPW  117



>dbj|BAF49300.1| putative glycosyltransferase [Clitoria ternatea]
Length=472

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRL-VELGVKLTFLTSLSVVNRMPEPPSIHGVDFAT  244
            M   + +LV++PAQG INP  Q AKRL +  G ++T  T+L +  R+   PS+  + F  
Sbjct  1    MSGHHFILVLFPAQGHINPAFQLAKRLIISFGARVTISTTLRMHRRLTNKPSLPSLSFLP  60

Query  245  FSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGIL  424
            FSDG+D     +++  L + + L+ +GS+ + +L+ +  Q+G P + ++YT  +PW   +
Sbjct  61   FSDGFDDTAATANQSSL-YASELKRRGSQFLTNLILSHAQEGHPFTCLLYTPLLPWAAEV  119

Query  425  A  427
            A
Sbjct  120  A  120



>gb|KFK42892.1| hypothetical protein AALP_AA1G052200 [Arabis alpina]
Length=464

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVN--RMPEPPSIHGVDFATFSDG  256
            LLV +PAQG +NP L+FA+RL+   G ++TF+T  SV N   +P   ++  + F TFSDG
Sbjct  7    LLVTFPAQGHVNPSLRFARRLIRTTGARVTFVTCQSVFNCSMIPNQSNLKNLSFLTFSDG  66

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            +D G   + E+  + + +L+  G K + D + A     SP++ V+YT  + W   +A
Sbjct  67   FDDGGMSNVEDRQKRSLNLKTNGDKTLTDFIEANRYSDSPVTCVVYTILLNWAPKVA  123



>ref|XP_010485054.1| PREDICTED: UDP-glycosyltransferase 75B1 isoform X2 [Camelina 
sativa]
Length=465

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNR--MPEPPSIHGVDFATFSDG  256
            LLV +PAQG +NP L+FA+RL++  G  +TF+T LS  +R  +P    +  + F TFSDG
Sbjct  7    LLVTFPAQGHVNPSLRFARRLIKTTGAHVTFVTCLSFFHRSMIPNHNKVDNLSFLTFSDG  66

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            +D G   + ++  + + +L   G KA+ D + A     SP++ +IYT  + W   +A
Sbjct  67   FDDGGISTSDDSQKRSVNLTVNGDKALSDFIEANRNGDSPVTCLIYTILLNWAPKVA  123



>ref|XP_010457643.1| PREDICTED: UDP-glycosyltransferase 75B1-like [Camelina sativa]
Length=465

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNR--MPEPPSIHGVDFATFSDG  256
            LLV +PAQG +NP L+FA+RL++  G ++TF+T  S  +R  +P    +  + F TFSDG
Sbjct  7    LLVTFPAQGHVNPSLRFARRLIKTTGARVTFVTCFSFFHRSMIPNHKKVDNLSFLTFSDG  66

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            +D G   + ++  + + +L   G KA+ D + A     SP++ +IYT  + W   +A
Sbjct  67   FDDGGISTSDDSQKRSVNLTVNGDKALSDFIEANRNGDSPVTCLIYTILLNWAPKVA  123



>ref|XP_010069228.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
 gb|KCW57506.1| hypothetical protein EUGRSUZ_H00279 [Eucalyptus grandis]
Length=469

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 64/112 (57%), Gaps = 3/112 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPS-IHGVDFATFSDG  256
            +VLLV YP+QG INP LQF+KRL   G+K TF T++ + N M    S + G+D  T SDG
Sbjct  10   HVLLVPYPSQGHINPMLQFSKRLASKGLKATFATTVFIFNSMKADTSPLVGLD--TISDG  67

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            +D+G     E    +   L A GSK + DL+        P+  ++Y + +PW
Sbjct  68   YDSGGFAEAESIHTYITRLEAAGSKTLSDLIVKYQSTDHPVDCIVYDSILPW  119



>ref|XP_004298222.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=473

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 68/116 (59%), Gaps = 3/116 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRMPEPPSI-HGVDFATFSDGW  259
            +++ YPAQG INP LQ AKRL+   G  +TF+ ++    RM    +I   + FA FSDG+
Sbjct  7    IVIAYPAQGHINPSLQLAKRLIRTTGAHVTFVNTVYAHRRMANSLTIPCRLTFAPFSDGY  66

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D G K  D+      + LR++ SKAI DL+     +G P + ++YT  + WVG +A
Sbjct  67   DDGTKPEDDSE-HVLSELRSRSSKAIVDLVKTGANEGHPYTCIVYTLLLSWVGGVA  121



>dbj|BAJ97695.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 64/111 (58%), Gaps = 1/111 (1%)
 Frame = +2

Query  83   VLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRM-PEPPSIHGVDFATFSDGW  259
            VLL+ YP+QG+++P LQFAKRL   GV+ T   S  ++    P+  ++  V  A  SDG 
Sbjct  1    VLLLPYPSQGRVHPMLQFAKRLAHHGVRPTLAVSRYILATCKPDAAAVGAVRLAAVSDGC  60

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            DAG  G   +   +   L A GS+ + +LL A+  +G P+  V+Y  F+PW
Sbjct  61   DAGGFGQCNDVTAYLGLLEAAGSETLAELLRAEAAEGRPVRAVVYDAFLPW  111



>ref|XP_007041388.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOX97219.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=468

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 74/125 (59%), Gaps = 1/125 (1%)
 Frame = +2

Query  53   EDHMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGV  232
            E+ M   D + LLV  P QG +NP LQ AKRL++ G ++TF T+ S   ++   PS+ G+
Sbjct  6    EEAMSSDDPHFLLVTLPGQGHLNPTLQLAKRLIQAGARVTFATTTSGQRKIKSFPSLEGL  65

Query  233  DFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
             +A FSDG+D G   SD++     + L   GS+ + +LL +   +G P+S +IY+  + W
Sbjct  66   AYAFFSDGFDDGTSPSDKQE-DIMSKLEHIGSQTLTNLLLSLSGEGHPVSFLIYSLLLSW  124

Query  413  VGILA  427
            V  +A
Sbjct  125  VADVA  129



>gb|KDP45201.1| hypothetical protein JCGZ_15066 [Jatropha curcas]
Length=457

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 63/111 (57%), Gaps = 1/111 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            +VL+V YP QG +NP LQF+KRLV  GVK T   ++++   M   P+   VD  T SDG+
Sbjct  11   HVLVVPYPLQGHLNPMLQFSKRLVSKGVKATLPNTIAINKSMHADPN-SPVDIETISDGF  69

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            D G     E    + + L+  GSK + DL+      G P++ VIY  FMPW
Sbjct  70   DEGGFAQAESTEIYLSRLQEVGSKTLADLINRLKDLGRPVTAVIYDGFMPW  120



>gb|KHN28671.1| UDP-glycosyltransferase 74B1 [Glycine soja]
Length=457

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 5/114 (4%)
 Frame = +2

Query  74   DCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSD  253
            + +VL++ YPAQG INP LQFAKRL   GVK T  T+    N +  P     +     SD
Sbjct  8    NVHVLVLPYPAQGHINPLLQFAKRLASKGVKATVATTHYTANSINAP----NITIEAISD  63

Query  254  GWD-AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            G+D AGF  ++     F AS R  GS+ +  L+    Q  SP++ ++Y +F PW
Sbjct  64   GFDQAGFAQTNNNMQLFLASFRTNGSRTLSLLIKKHQQTPSPVTCIVYDSFFPW  117



>ref|XP_003519432.1| PREDICTED: UDP-glycosyltransferase 74B1-like [Glycine max]
Length=457

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 5/114 (4%)
 Frame = +2

Query  74   DCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSD  253
            + +VL++ YPAQG INP LQFAKRL   GVK T  T+    N +  P     +     SD
Sbjct  8    NVHVLVLPYPAQGHINPLLQFAKRLASKGVKATVATTHYTANSINAP----NITIEAISD  63

Query  254  GWD-AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            G+D AGF  ++     F AS R  GS+ +  L+    Q  SP++ ++Y +F PW
Sbjct  64   GFDQAGFAQTNNNMQLFLASFRTNGSRTLSLLIKKHQQTPSPVTCIVYDSFFPW  117



>gb|AHL68667.1| UDP-glucose: anthocyanin 5-O-glucosyltransferase [Vitis amurensis]
Length=464

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 69/116 (59%), Gaps = 4/116 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + L++ +PAQG INP L+ AKRL+ +G  +TF T++   +R+ + P++ G+ F+TFSDG 
Sbjct  7    HFLIITFPAQGHINPALELAKRLIGVGADVTFATTIHAKSRLVKNPTVDGLRFSTFSDGQ  66

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            + G K    E   F    +   S+ + +L+ A   +G PIS +IY+  +P    LA
Sbjct  67   EEGVKRGPNELPVF----QRLASENLSELIMASANEGRPISCLIYSILIPGAAELA  118



>gb|KDP35132.1| hypothetical protein JCGZ_10666 [Jatropha curcas]
Length=457

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            +VLL+ YP QG INP L F++RL+  G+K T +TS+ +   M  P SI  V  A  SDG+
Sbjct  8    HVLLLPYPGQGHINPMLHFSRRLISRGIKATLVTSIFISKSMNLPSSIDSVHLAAISDGF  67

Query  260  DAG--FKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            D G   K S  +Y  +   L+ +GS+ + +L+        P   VIY  F+PW
Sbjct  68   DDGGYEKSSGVDY--YLTRLKTEGSRTLSELIEKHKTSSDPFDCVIYEPFLPW  118



>emb|CDY44260.1| BnaC03g24520D [Brassica napus]
Length=443

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 66/116 (57%), Gaps = 6/116 (5%)
 Frame = +2

Query  71   KDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFS  250
            K  +VL V YPAQG I P  QF KRL+  G++ T   +  + N +   PS   V  AT S
Sbjct  3    KRGHVLAVSYPAQGHITPIHQFCKRLISKGLQTTLALTTFIFNSIKHDPS-GPVSIATIS  61

Query  251  DGWDAGF--KGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            DG+D GF   GS ++Y+Q   S +  GSK I D++       +PI+ ++Y +F+PW
Sbjct  62   DGYDQGFDSSGSIQDYVQ---SFKIFGSKTITDIIRKHETSDNPITCIVYDSFLPW  114



>emb|CBI36304.3| unnamed protein product [Vitis vinifera]
Length=333

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 69/116 (59%), Gaps = 4/116 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            + L++ +PAQG INP L+ AKRL+ +G  +TF T++   +R+ + P++ G+ F+TFSDG 
Sbjct  7    HFLIITFPAQGHINPALELAKRLIGVGADVTFATTIHAKSRLVKNPTVDGLRFSTFSDGQ  66

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            + G K    +   F    +   S+ + +L+ A   +G PIS +IY+  +P    LA
Sbjct  67   EEGVKRGPNDLPVF----QRLASENLSELIMASANEGRPISCLIYSIVIPGAAELA  118



>sp|Q9ZR25.1|5GT_VERHY RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase; 
AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
HGT8; Flags: Precursor [Glandularia x hybrida]
 dbj|BAA36423.1| UDP-glucose:anthocyanin 5-O-glucosyltransferase [Glandularia 
x hybrida]
Length=461

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 70/124 (56%), Gaps = 5/124 (4%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHG--VDFA  241
            M   +VLL  +PAQG INP LQFAKRL    +++TF TS+    RM    +     ++F 
Sbjct  1    MSRAHVLLATFPAQGHINPALQFAKRLANADIQVTFFTSVYAWRRMSRTAAGSNGLINFV  60

Query  242  TFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKL--QQGSPISRVIYTTFMPWV  415
            +FSDG+D G +  D+    + + ++++G KA+ D L A    Q+ S I+ V+Y+    W 
Sbjct  61   SFSDGYDDGLQPGDDGK-NYMSEMKSRGIKALSDTLAANNVDQKSSKITFVVYSHLFAWA  119

Query  416  GILA  427
              +A
Sbjct  120  AKVA  123



>ref|XP_004309287.1| PREDICTED: UDP-glycosyltransferase 74F2-like, partial [Fragaria 
vesca subsp. vesca]
Length=330

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDG  256
            +VL + YPAQG INP LQF+KRL    G+K+T   ++ + N +  P S   V   T SDG
Sbjct  9    HVLAIPYPAQGHINPLLQFSKRLASSKGLKVTLANTVFIANSLNLPKSAGSVQLETISDG  68

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            +D G     E    + + L+A GSK++ +++T      +PI  +IY  F+PW
Sbjct  69   YDDGGFALAESIAAYLSRLQAVGSKSVAEIITRHKATPNPIDCIIYDPFLPW  120



>emb|CDP20003.1| unnamed protein product [Coffea canephora]
Length=461

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 68/120 (57%), Gaps = 0/120 (0%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M+  + L+   P+QG INP LQ AK L   G ++TF T++   +R+   P+   + FA+F
Sbjct  1    MEHQHFLITALPSQGHINPTLQLAKNLARTGAQVTFATTVYGFSRIRNLPASGCLSFASF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D      + ++  F++  +  G K +  L+    ++G P++ +IYT  +PWV  +A
Sbjct  61   SDGYDDEKSQKNRDFTSFSSDTKRFGYKDLTKLIQTTSKEGRPVTFLIYTVMLPWVAEVA  120



>emb|CDP21504.1| unnamed protein product [Coffea canephora]
Length=461

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 68/120 (57%), Gaps = 0/120 (0%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M+  + L+   P+QG INP LQ AK L   G ++TF T++   +R+   P+   + FA+F
Sbjct  1    MEHQHFLITALPSQGHINPTLQLAKNLARTGAQVTFATTVYGFSRIRNLPASGCLSFASF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG+D      + ++  F++  +  G K +  L+    ++G P++ +IYT  +PWV  +A
Sbjct  61   SDGYDDEKSQKNRDFTSFSSDTKRFGYKDLTKLIQTTSKEGRPVTFLIYTVMLPWVAEVA  120



>ref|XP_010069575.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
 gb|KCW57961.1| hypothetical protein EUGRSUZ_H00697 [Eucalyptus grandis]
Length=465

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 66/122 (54%), Gaps = 1/122 (1%)
 Frame = +2

Query  50   LEDHMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHG  229
            +E   ++   +VL+V YP QG INP LQF+KRLV  G+K T + ++ +   M   PS   
Sbjct  1    MEPSSKLHRAHVLVVPYPGQGHINPMLQFSKRLVSKGLKATLVLTVHIAKSMHADPS-SS  59

Query  230  VDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMP  409
            ++  T SDG D G + S +    +    +  GS+ + +L+      G P+  +IY  F+P
Sbjct  60   INLETISDGHDLGGRASAKSMQAYLTCFQTVGSRGLAELIHKLDCSGRPVDAIIYDGFLP  119

Query  410  WV  415
            WV
Sbjct  120  WV  121



>ref|XP_006418014.1| hypothetical protein EUTSA_v10007593mg [Eutrema salsugineum]
 dbj|BAJ33712.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36367.1| hypothetical protein EUTSA_v10007593mg [Eutrema salsugineum]
Length=456

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 71/123 (58%), Gaps = 3/123 (2%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNR--MPEPPSIHGVDF  238
            M   + LLV +PAQG +NP L+FA+RL++  G ++TF T LSV +R  +     ++ + F
Sbjct  1    MAPLHFLLVTFPAQGHVNPSLRFARRLIKTTGARVTFATCLSVFHRSMISTQSDLNNLSF  60

Query  239  ATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVG  418
             TFSDG+D G   + E+    + +L+  G K + D + A     SP++ ++YT  + W  
Sbjct  61   LTFSDGFDDGGVSTAEDRENRSVNLKINGDKTLSDFIEANRDGDSPVTCLVYTILLNWAP  120

Query  419  ILA  427
             +A
Sbjct  121  KVA  123



>ref|XP_006415092.1| hypothetical protein EUTSA_v10007589mg [Eutrema salsugineum]
 gb|ESQ33445.1| hypothetical protein EUTSA_v10007589mg [Eutrema salsugineum]
Length=458

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 68/117 (58%), Gaps = 3/117 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSV--VNRMPEPPSIHGVDFATFSDG  256
            LLV  PAQG +NP L+FA+RL+   G ++TF+T +S+   +R+P   +I  + F TFSDG
Sbjct  7    LLVTLPAQGHVNPSLRFARRLIRTTGARVTFVTCISIFHCSRIPNHHNIDNLSFLTFSDG  66

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            +D G   + ++      +L+  G K + + + A     SP++ +IYT    WV  LA
Sbjct  67   FDDGVISTTDDVQNRLLNLKRNGDKTLSEFIEANRNGDSPVTCLIYTILPSWVPKLA  123



>gb|EYU17634.1| hypothetical protein MIMGU_mgv1a006216mg [Erythranthe guttata]
Length=452

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 66/112 (59%), Gaps = 2/112 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            ++L V YP+QG +NP LQF KRLV  G K TF T  + +++   P S   VD A+ SDG+
Sbjct  11   HILGVPYPSQGHVNPMLQFCKRLVSKGAKATF-TITNFISKSINPKS-DSVDIASISDGF  68

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
            DAG     E    +   +  +GS+ +E+L+ + L +  P+  ++Y  F+PWV
Sbjct  69   DAGGFRQAESVSDYLHRMEIEGSRTLENLIKSYLDRNLPVDCIVYDAFLPWV  120



>ref|XP_002892295.1| UDP-glucosyl transferase 75B2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68554.1| UDP-glucosyl transferase 75B2 [Arabidopsis lyrata subsp. lyrata]
Length=459

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 68/113 (60%), Gaps = 4/113 (4%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNR--MPEPPSIHGV-DFATFSD  253
            LLV +PAQG +NP L+FA+RL++  G ++TF T LS +NR  +P+  +++ +  F TFSD
Sbjct  7    LLVTFPAQGHVNPSLRFARRLIKTTGTRVTFATCLSAINRSMIPDHNNVNDLLSFLTFSD  66

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            G+D G   + ++      +    G KA+ D + A L   SP++ +IYT    W
Sbjct  67   GFDDGVISNTDDVQNRLLNFERNGDKALSDFIEANLNGDSPVTCLIYTILPNW  119



>ref|NP_563742.1| UDP-glucosyltransferase 75B1 [Arabidopsis thaliana]
 sp|Q9LR44.1|U75B1_ARATH RecName: Full=UDP-glycosyltransferase 75B1; AltName: Full=(Uridine 
5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl 
transferase 1; AltName: Full=IAA-Glu synthase 1; AltName: 
Full=Indole-3-acetate beta-glucosyltransferase 1 [Arabidopsis 
thaliana]
 gb|AAF79730.1|AC005106_11 T25N20.21 [Arabidopsis thaliana]
 gb|AAK32944.1|AF367358_1 At1g05560/T25N20_20 [Arabidopsis thaliana]
 gb|AAK37839.1|AF196777_1 UDP-glucosyltransferase [Arabidopsis thaliana]
 gb|AAL77752.1| At1g05560/T25N20_20 [Arabidopsis thaliana]
 gb|AEE27854.1| UDP-glucosyltransferase 75B1 [Arabidopsis thaliana]
 gb|AHL38968.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=469

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVE-LGVKLTFLTSLSVVNR--MPEPPSIHGVDFATFSDG  256
            LLV +PAQG +NP L+FA+RL++  G ++TF+T +SV +   +     +  + F TFSDG
Sbjct  7    LLVTFPAQGHVNPSLRFARRLIKRTGARVTFVTCVSVFHNSMIANHNKVENLSFLTFSDG  66

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            +D G   + E+  + + +L+  G KA+ D + A     SP++ +IYT  + W
Sbjct  67   FDDGGISTYEDRQKRSVNLKVNGDKALSDFIEATKNGDSPVTCLIYTILLNW  118



>ref|XP_010101353.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
 gb|EXB88300.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
Length=455

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 64/119 (54%), Gaps = 3/119 (3%)
 Frame = +2

Query  62   MEMKDC--NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVD  235
            ME K C  +VL+V YP+QG +NP L+F KRL   G+K TF  ++ +       PS   V 
Sbjct  1    MENKKCVPHVLVVPYPSQGHVNPMLEFCKRLAFYGLKTTFANTVFISKSFNPTPS-PSVQ  59

Query  236  FATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            F T SDG+D G          + A + A GSK + +L+T      +PI  V+Y  F+PW
Sbjct  60   FDTISDGFDDGGFAQAANAADYLARMVAAGSKTLAELITRHNNSSNPIDFVVYDPFLPW  118



>ref|XP_010650442.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=361

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M + ++L+V  P QG INP LQ AK L+  G  +TF  S S  +RM + P++ G++FATF
Sbjct  1    MSNPHILIVTLPVQGHINPTLQLAKLLIRAGAHVTFFPSASAGSRMSKSPNLDGLEFATF  60

Query  248  SDGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLTAKL  361
            SDG+D G K G D E+  F + L   GS+A+ +L+   L
Sbjct  61   SDGYDHGLKQGDDVEH--FVSQLERLGSQALIELIMHSL  97



>gb|EYU27003.1| hypothetical protein MIMGU_mgv1a024986mg [Erythranthe guttata]
Length=450

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 63/113 (56%), Gaps = 18/113 (16%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPS--IHGVDFATFSD  253
            +VLLV +PAQG I+P  QFAKR   +G+K+TF TSL    RM    +    GV FA FS 
Sbjct  4    HVLLVTFPAQGHISPSFQFAKRPTAMGIKVTFATSLYARRRMSRTAAGLPKGVTFAAFSG  63

Query  254  GWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            G+D G                +KGS+++ D + A   Q  P+++++YT  +PW
Sbjct  64   GYDDG----------------SKGSQSLRDTILAAADQDRPVTQLVYTLLLPW  100



>gb|KDP45202.1| hypothetical protein JCGZ_15067 [Jatropha curcas]
Length=454

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 65/121 (54%), Gaps = 1/121 (1%)
 Frame = +2

Query  50   LEDHMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHG  229
            +E        +VL++ YPAQG INP LQF+KRLV  GVK T   ++++   M   P+   
Sbjct  1    MEKEKRTYKSHVLVLPYPAQGHINPMLQFSKRLVSRGVKATLANTIAINKSMHRDPN-SL  59

Query  230  VDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMP  409
            +D  T+SDG+D G  G  E    + + L+  GSK   DL+        P++ VIY  F+ 
Sbjct  60   IDIQTYSDGFDEGGFGQAESTEIYLSRLQEVGSKTFADLIKKLRDSDFPVTAVIYDGFLT  119

Query  410  W  412
            W
Sbjct  120  W  120



>sp|Q9ZR26.1|5GT2_PERFR RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2; AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
3R6; Short=p3R6; Flags: Precursor [Perilla frutescens]
 dbj|BAA36422.1| UDP-glucose:anthocyanin 5-O-glucosyltransferase homologue [Perilla 
frutescens var. crispa]
Length=443

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 68/122 (56%), Gaps = 14/122 (11%)
 Frame = +2

Query  83   VLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIH-----GVDFATF  247
            VLL  +PAQG INP LQFAKRL++ G  +TF TS+    RM    S       G+DF  F
Sbjct  6    VLLATFPAQGHINPALQFAKRLLKAGTDVTFFTSVYAWRRMANTASAAAGNPPGLDFVAF  65

Query  248  SDGWDAGFK--GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            SDG+D G K  G  + Y+   + ++A+GS+A+ +LL         ++ V+Y+    W   
Sbjct  66   SDGYDDGLKPGGDGKRYM---SEMKARGSEALRNLLL----NNDDVTFVVYSHLFAWAAE  118

Query  422  LA  427
            +A
Sbjct  119  VA  120



>sp|Q9ZR27.1|5GT1_PERFR RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1; AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
3R4; Short=p3R4; Flags: Precursor [Perilla frutescens]
 dbj|BAA36421.1| UDP-glucose:anthocysnin 5-O-glucosyltransferase [Perilla frutescens 
var. crispa]
Length=460

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 68/122 (56%), Gaps = 14/122 (11%)
 Frame = +2

Query  83   VLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIH-----GVDFATF  247
            VLL  +PAQG INP LQFAKRL++ G  +TF TS+    RM    S       G+DF  F
Sbjct  6    VLLATFPAQGHINPALQFAKRLLKAGTDVTFFTSVYAWRRMANTASAAAGNPPGLDFVAF  65

Query  248  SDGWDAGFK--GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGI  421
            SDG+D G K  G  + Y+   + ++A+GS+A+ +LL         ++ V+Y+    W   
Sbjct  66   SDGYDDGLKPCGDGKRYM---SEMKARGSEALRNLLL----NNHDVTFVVYSHLFAWAAE  118

Query  422  LA  427
            +A
Sbjct  119  VA  120



>dbj|BAK00438.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=476

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNR-MPEPPSIHGVDFATFSDG  256
            +VLL+ YP+QG ++P LQFAKRL   GV+ T   S  ++    P+  ++  V  A  SDG
Sbjct  19   HVLLLPYPSQGHVHPMLQFAKRLAHHGVRPTLAVSRYILATCKPDAAAVGAVRLAAVSDG  78

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
             DAG  G   +   +   L A GS+ + +LL A+  +G P+  V+Y  F+PW
Sbjct  79   CDAGGFGQCNDVTAYLGLLEAAGSETLAELLRAEAAEGRPVRAVVYDAFLPW  130



>emb|CDP03926.1| unnamed protein product [Coffea canephora]
Length=461

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 60/117 (51%), Gaps = 1/117 (1%)
 Frame = +2

Query  62   MEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFA  241
            M     +VL + +P QG INP LQF KRL   GVK+TF  ++S+   M   P    ++F 
Sbjct  3    MASSKVHVLALPFPVQGHINPLLQFCKRLEAKGVKVTFANTVSLSKSMHADPK-RSINFE  61

Query  242  TFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            T SDG+D G   + E +  +       GSK + DL+T     G P+  VIY   + W
Sbjct  62   TISDGYDDGGYAAAESFEAYVEKFATVGSKTLADLITKLKDDGEPVQAVIYDPHLTW  118



>gb|KGN45711.1| hypothetical protein Csa_6G007450 [Cucumis sativus]
Length=465

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            +VL V     G  NP L FA  L   G+ +TF TS SV  R+P+ PS   + FA FSDG 
Sbjct  5    HVLFVALATHGHFNPGLHFANILSHGGLHVTFATSSSVFRRVPKLPSSPRLSFAFFSDGQ  64

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D GFK  D + + F +    + S+AI D++      G PI+ V+Y+   PW+  +A
Sbjct  65   DDGFKPGD-DVVPFLSQFELQASRAIHDIILKSKASGKPITFVLYSLLTPWMANVA  119



>gb|EMS63606.1| UDP-glycosyltransferase 74F2 [Triticum urartu]
Length=642

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 5/119 (4%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLV-ELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDG  256
            +VLLV YPAQG INP LQ AKRL    G++ T   + SV+     P     V  A FSDG
Sbjct  9    HVLLVSYPAQGHINPLLQLAKRLAGHRGIRCTLAVTRSVLGNSGGPSQAGAVHIAAFSDG  68

Query  257  WDAGFKGSDE--EYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
             D   +G DE  +   F A L + GS  +++LL ++ +QG P+  V+Y  F+ W   +A
Sbjct  69   CDR--QGYDEVGDVQTFLARLESVGSSTLDELLRSEAEQGRPVHAVVYDAFLLWAPRVA  125



>ref|XP_010069572.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
Length=467

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 1/121 (1%)
 Frame = +2

Query  50   LEDHMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHG  229
            +E   ++   +VL++ YPAQG INP LQF+KRLV  G+K T   ++ +   M   PS   
Sbjct  1    MEPSSKLHRAHVLVLPYPAQGHINPMLQFSKRLVSRGLKATLALTVHLTGSMHADPSSF-  59

Query  230  VDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMP  409
            +D  T SDG D G     E    +   L+  GS+ + +L+    + G P+  VIY  F+P
Sbjct  60   IDLETISDGHDVGGFMEAESNEAYQMDLQVVGSRTLAELIHKLDRSGRPLDAVIYDGFLP  119

Query  410  W  412
            W
Sbjct  120  W  120



>gb|KCW57958.1| hypothetical protein EUGRSUZ_H00692 [Eucalyptus grandis]
Length=452

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 1/121 (1%)
 Frame = +2

Query  50   LEDHMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHG  229
            +E   ++   +VL++ YPAQG INP LQF+KRLV  G+K T   ++ +   M   PS   
Sbjct  1    MEPSSKLHRAHVLVLPYPAQGHINPMLQFSKRLVSRGLKATLALTVHLTGSMHADPSSF-  59

Query  230  VDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMP  409
            +D  T SDG D G     E    +   L+  GS+ + +L+    + G P+  VIY  F+P
Sbjct  60   IDLETISDGHDVGGFMEAESNEAYQMDLQVVGSRTLAELIHKLDRSGRPLDAVIYDGFLP  119

Query  410  W  412
            W
Sbjct  120  W  120



>gb|EYU17631.1| hypothetical protein MIMGU_mgv1a006064mg [Erythranthe guttata]
Length=459

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 64/112 (57%), Gaps = 2/112 (2%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            ++L V YP+QG +NP LQF KRLV  G K TF T  + +++   P S H VD A+ SDG+
Sbjct  11   HILCVPYPSQGHVNPMLQFCKRLVSKGAKATF-TITNFISKSINPKS-HSVDIASISDGF  68

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
            D G     E    +   +  +GS+ +E+L+ +   +   +  ++Y  F+PWV
Sbjct  69   DTGGFRQAESVSDYLNRMEVEGSRTLENLIKSYRDRNLAVDCIVYDAFLPWV  120



>gb|ABL85474.1| glycosyltransferase UGT75L4 [Maclura pomifera]
Length=472

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 71/130 (55%), Gaps = 15/130 (12%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTS----LSVVNRMPEPPSIHG--  229
            M     LLV YPAQG INP LQFAKRL   G  +TF+T+      ++NR    P+I    
Sbjct  1    MTKPRFLLVTYPAQGHINPGLQFAKRLARAGADITFVTANYAHRQMINR--SDPTIQNGT  58

Query  230  -VDFATFS-DGWDAGFK--GSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYT  397
             +  A FS DG++ GFK  G  + YL   +  R  GS+A+ DL+   + +G P + + YT
Sbjct  59   SLSHAPFSVDGYEDGFKPGGDPDHYL---SEFRRCGSQALTDLILTAVNEGRPYTCLAYT  115

Query  398  TFMPWVGILA  427
              +PW  + A
Sbjct  116  ILLPWAALTA  125



>ref|XP_004307485.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=454

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 78/126 (62%), Gaps = 6/126 (5%)
 Frame = +2

Query  62   MEMKDCNVLLVMYPAQGQINPCLQFAKRLVELG-VKLTFLTSLSVVNRMPEPPSIHGVDF  238
            ME ++ + L++   AQG +NP LQ AKRL+++G   +TF+T++  + ++   PS+ G+ F
Sbjct  1    MESRNHHFLVISCAAQGHLNPSLQLAKRLIDIGSSHVTFVTNIHGLTQIKSLPSLEGLSF  60

Query  239  ATFSDGWDAGFK-GSDEEYLQFNASLRAKGSKAIEDLLT--AKLQQGSPISRVIYTTFMP  409
            A+FSDG+D G    +D E++   + L+  GS+++  L+   +   +  PI+ +IYT  +P
Sbjct  61   ASFSDGFDDGVHPANDPEHIM--SELKRAGSESLTALIEKISTSDEHGPITFLIYTVLLP  118

Query  410  WVGILA  427
            W   +A
Sbjct  119  WAAEVA  124



>ref|XP_009119145.1| PREDICTED: UDP-glycosyltransferase 75B1 [Brassica rapa]
Length=472

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNR--MPEPPSIHGVDFATFSDG  256
            LLV +PAQG +NP L+FA+RL+   G ++TF+T  SV +R  + +   +  + F TFSDG
Sbjct  8    LLVTFPAQGHVNPSLRFARRLIRTTGARVTFVTCASVFHRSMISKHSDLDNLSFLTFSDG  67

Query  257  WDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPW  412
            +D G   + E+    +A+L+  G KA+ + +    +  SP++ ++YT  + W
Sbjct  68   FDQGGLTTAEDLKSRSANLKNNGEKALSEFIEGNKKGDSPVTCLVYTILLNW  119



>ref|XP_010100065.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB81236.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=402

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 70/124 (56%), Gaps = 11/124 (9%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPE-------PPSIHG---VD  235
            LLV YPAQG INP LQFAKRLV  G  +TF+T+      M +         + +G   + 
Sbjct  8    LLVTYPAQGHINPVLQFAKRLVGAGADVTFVTTYFAHRCMAKGRGDTTAAANRNGGVSIS  67

Query  236  FATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
            +  FSDG D GFK  D ++  +   +R +GS+AI DL+ +  ++G P + ++Y+  + W 
Sbjct  68   YVPFSDGHDDGFKPGD-DFGHYLNEIRRRGSQAISDLVISAAKEGHPYTCLVYSLLITWA  126

Query  416  GILA  427
             + A
Sbjct  127  VLTA  130



>emb|CDP20005.1| unnamed protein product [Coffea canephora]
Length=463

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 68/119 (57%), Gaps = 5/119 (4%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSL---SVVNRMPEPPSIHGVDFATFS  250
            + L+   PAQG INP LQ AK L   G ++TF T++   S +N+    P  +G+ +ATFS
Sbjct  6    HFLITALPAQGHINPTLQLAKSLARNGARVTFATTVHGFSCINKAL--PRYNGLSYATFS  63

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            DG D        +  +F A L+  G++ + +L+    ++G P++ +IYT  +PWV  +A
Sbjct  64   DGCDDEESSKRRDRGRFFADLKHFGTQTVRELIKTLSEEGRPVTCLIYTILLPWVAEVA  122



>gb|KFK39474.1| hypothetical protein AALP_AA3G248900 [Arabis alpina]
Length=475

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 69/129 (53%), Gaps = 20/129 (16%)
 Frame = +2

Query  86   LLVMYPAQGQINPCLQFAKRLVEL--GVKLTFLTSLSVVNR-------MPEPPSIHGVDF  238
            L V +PAQG INP L+ AKRL     G ++TF  S+S  NR       +PE      + F
Sbjct  17   LFVTFPAQGHINPSLELAKRLAGTIAGARVTFAASISAYNRRMFSTENVPET-----LIF  71

Query  239  ATFSDGWDAGFKGSDEEYL------QFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTT  400
            AT+SDG D GFK S  +        +F + +R +G + + +L+    +Q  PI+ V+YT 
Sbjct  72   ATYSDGHDDGFKKSSSDKTLKDDSGKFMSEMRRRGRETLTELIEDNRRQNRPITCVVYTI  131

Query  401  FMPWVGILA  427
             + WV  LA
Sbjct  132  LLTWVAELA  140



>ref|XP_008793440.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
 ref|XP_008793441.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=474

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 70/130 (54%), Gaps = 8/130 (6%)
 Frame = +2

Query  62   MEMKDCNVLLVMYPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRM------PEPPS  220
            ME +  + LLV YPAQG +NP L  AKRL    G ++TF T++S   RM      P+   
Sbjct  1    MERRQQHFLLVTYPAQGHVNPALHLAKRLARTTGSRVTFSTAISGHRRMFPSLAKPDEEV  60

Query  221  IHG-VDFATFSDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYT  397
              G V +  +SDG+D G+K + ++   F + ++  GS+ +  L+     +  P+S +IYT
Sbjct  61   EDGLVSYIPYSDGYDDGYKATTDDVNTFMSKIKLAGSRTVSTLVQDLAARDRPVSCLIYT  120

Query  398  TFMPWVGILA  427
              M W   +A
Sbjct  121  LLMAWAADVA  130



>gb|KCW57960.1| hypothetical protein EUGRSUZ_H00695 [Eucalyptus grandis]
Length=398

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 70/124 (56%), Gaps = 5/124 (4%)
 Frame = +2

Query  50   LEDHMEMKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRM-PEPPSIH  226
            +E   ++   +VL++ +PAQG +NP LQF+KRLV  G+K T   ++ +   M P+P S  
Sbjct  1    MEPSTKLHRAHVLILPFPAQGHVNPMLQFSKRLVSKGLKATLALTVHLAGSMQPDPSS--  58

Query  227  GVDFATFSDGWD-AGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTF  403
             +D  T SDG D  GF G+ +    +    R  GS+ + +L+    + G P+  VIY  F
Sbjct  59   SIDLETISDGHDLGGFMGA-KSIEAYQTDFRDVGSRTLAELIHKLDRLGRPLDAVIYDGF  117

Query  404  MPWV  415
            +PWV
Sbjct  118  LPWV  121



>gb|EAZ09773.1| hypothetical protein OsI_32060 [Oryza sativa Indica Group]
Length=199

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 70/124 (56%), Gaps = 10/124 (8%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRL-VELGVKLTFLTSLSVVN---RMPEPP--SIHGVDFA  241
            +VLL+ YPAQG +NP LQF KRL     V+ T   + S++N   R P  P     GV  A
Sbjct  9    HVLLLSYPAQGHVNPLLQFGKRLAAHRRVRCTLAVTRSLLNSCCRAPPSPGGGGGGVHVA  68

Query  242  TFSDGWDAGFKGSDE--EYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
            T+SDG DA  +G DE  +   + + L + GS  +++LL  +  +G P+  V+Y  F+PW 
Sbjct  69   TYSDGCDA--RGYDELGDEGAYLSRLESAGSATLDELLRGESGEGRPVRAVVYDAFLPWA  126

Query  416  GILA  427
              +A
Sbjct  127  APVA  130



>ref|XP_007226459.1| hypothetical protein PRUPE_ppa024612mg [Prunus persica]
 gb|EMJ27658.1| hypothetical protein PRUPE_ppa024612mg [Prunus persica]
Length=471

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 76/127 (60%), Gaps = 7/127 (6%)
 Frame = +2

Query  62   MEMKDCNVLLVMYPAQGQINPCLQFAKRLVELG-VKLTFLTSLSVVNRMPEPPSIHGVDF  238
            M+    + LL+  PAQG INP LQ AKRL+ +G   +T+ T++  + ++   PS+ G+ +
Sbjct  3    MKHHHHHFLLISCPAQGHINPTLQLAKRLIGIGGTHVTYATTIRGLTKIKSFPSLEGLSY  62

Query  239  ATFSDGWDAGFKGSDEEYLQFNASLRAKGSKA----IEDLLTAKLQQGSPISRVIYTTFM  406
            A+FSDG+D G K +++  L F +  +  GSK     IE + T++   G P++ +IY+  +
Sbjct  63   ASFSDGFDDGIKPTNDPNL-FMSEFKLVGSKTLKALIEKISTSQDHSG-PVTFLIYSVLL  120

Query  407  PWVGILA  427
            PW   +A
Sbjct  121  PWAAEVA  127



>dbj|BAF96596.1| UDP-glucose:anthocysnin 5-O-glucosyltransferase [Rosa hybrid 
cultivar]
Length=364

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +2

Query  98   YPAQGQINPCLQFAKRLVEL-GVKLTFLTSLSVVNRMPEPPSI-HGVDFATFSDGWDAGF  271
            +PAQG +NP LQ AKRL+   G  +TF+TS+S   R     ++  G+ FA FSDG+D G 
Sbjct  2    FPAQGHMNPSLQLAKRLIRTTGALVTFVTSVSAHRRFGNGSTVPTGLTFAPFSDGYDDGA  61

Query  272  KGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            K  D+    F + L+++ S+AI DL+ +   +G P + ++YT  + WV  +A
Sbjct  62   KPEDDNQHVF-SELKSRSSQAIVDLVESGRNEGQPYTCMVYTLLLSWVAEVA  112



>ref|XP_008458151.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Cucumis melo]
Length=465

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 66/120 (55%), Gaps = 1/120 (1%)
 Frame = +2

Query  68   MKDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATF  247
            M + +VLLV     G  NP L  A  L   G+ +TF TS SV+ R+P+ PS   + FA F
Sbjct  1    MTEPHVLLVALATHGHFNPGLHLANILSHGGLHVTFATSSSVLCRLPKLPSSPRLSFAFF  60

Query  248  SDGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            SDG + GFK  + + + F +    + S+AI D++      G PIS V+Y+   PW+  +A
Sbjct  61   SDGQEDGFKPGN-DVVPFLSQFELQASRAIHDIILKSKASGKPISFVLYSLLTPWMANVA  119



>ref|XP_006853436.1| hypothetical protein AMTR_s00032p00176750 [Amborella trichopoda]
 gb|ERN14903.1| hypothetical protein AMTR_s00032p00176750 [Amborella trichopoda]
Length=450

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = +2

Query  80   NVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFSDGW  259
            +VL+V  PAQG INP L+ AKRLV+  +++TF T+   ++R+ +   I  V FA++SDG+
Sbjct  4    HVLMVCSPAQGHINPALELAKRLVKKDLRVTFATTAHGLSRIHQAIDI--VSFASYSDGF  61

Query  260  DAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWVGILA  427
            D GF  S   +  + +  +  GS+ +  L+     QG P++ +IY + +PW   +A
Sbjct  62   DQGFDNSI-AFADYVSQFKRLGSETLAALIRNLASQGCPVTFIIYNSVVPWSADVA  116



>gb|KJB27755.1| hypothetical protein B456_005G008000 [Gossypium raimondii]
Length=462

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 61/115 (53%), Gaps = 0/115 (0%)
 Frame = +2

Query  71   KDCNVLLVMYPAQGQINPCLQFAKRLVELGVKLTFLTSLSVVNRMPEPPSIHGVDFATFS  250
            K  +VL++ YP+QG INP LQF+KRL   G+K TF T++ +   M        +DF T S
Sbjct  7    KRVHVLVIPYPSQGHINPMLQFSKRLSSKGLKATFATTVFISETMKPELLNSDIDFDTIS  66

Query  251  DGWDAGFKGSDEEYLQFNASLRAKGSKAIEDLLTAKLQQGSPISRVIYTTFMPWV  415
            DG D G     E    +   L+  GSK + +L+        PI  ++Y  F+PWV
Sbjct  67   DGCDKGGFLQVESVDDYLVRLQTVGSKTLTELIIKHKNSPHPIDCILYDAFLPWV  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800