BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J04

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623519.1|  PREDICTED: uncharacterized protein LOC104114...  98.6    3e-21   Nicotiana tomentosiformis
ref|XP_009796928.1|  PREDICTED: uncharacterized protein LOC104243...  97.8    5e-21   Nicotiana sylvestris
gb|KJB32711.1|  hypothetical protein B456_005G258900                  97.1    1e-20   Gossypium raimondii
gb|KJB32715.1|  hypothetical protein B456_005G258900                  96.7    1e-20   Gossypium raimondii
ref|XP_009623518.1|  PREDICTED: uncharacterized protein LOC104114...  96.7    2e-20   Nicotiana tomentosiformis
ref|XP_009623520.1|  PREDICTED: uncharacterized protein LOC104114...  94.4    9e-20   Nicotiana tomentosiformis
ref|XP_006364359.1|  PREDICTED: uncharacterized protein LOC102599...  86.7    4e-17   Solanum tuberosum [potatoes]
ref|XP_010111709.1|  hypothetical protein L484_006580                 84.3    2e-16   
ref|XP_008235955.1|  PREDICTED: uncharacterized protein LOC103334767  81.6    2e-15   Prunus mume [ume]
ref|XP_007041617.1|  Integral membrane protein hemolysin-III, put...  80.5    6e-15   
ref|XP_010315419.1|  PREDICTED: uncharacterized protein LOC101256...  79.7    1e-14   
ref|XP_004231095.1|  PREDICTED: uncharacterized protein LOC101256...  79.3    1e-14   Solanum lycopersicum
gb|KHF97710.1|  Translation initiation factor IF-2                    79.0    2e-14   Gossypium arboreum [tree cotton]
gb|KJB15972.1|  hypothetical protein B456_002G206500                  75.5    3e-13   Gossypium raimondii
ref|XP_009796930.1|  PREDICTED: uncharacterized protein LOC104243...  74.7    4e-13   Nicotiana sylvestris
ref|XP_007200445.1|  hypothetical protein PRUPE_ppa008919mg           74.7    6e-13   Prunus persica
ref|XP_003526762.1|  PREDICTED: uncharacterized protein LOC100803...  73.2    3e-12   Glycine max [soybeans]
gb|ACU21193.1|  unknown                                               72.4    3e-12   Glycine max [soybeans]
gb|EYU38031.1|  hypothetical protein MIMGU_mgv1a010394mg              72.8    3e-12   Erythranthe guttata [common monkey flower]
ref|XP_003523998.1|  PREDICTED: uncharacterized protein LOC100802...  72.0    6e-12   Glycine max [soybeans]
ref|XP_010266173.1|  PREDICTED: uncharacterized protein LOC104603754  71.6    7e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009623521.1|  PREDICTED: uncharacterized protein LOC104114...  71.2    7e-12   Nicotiana tomentosiformis
gb|ACU16971.1|  unknown                                               70.5    8e-12   Glycine max [soybeans]
gb|KDP42029.1|  hypothetical protein JCGZ_03092                       71.6    9e-12   Jatropha curcas
gb|KEH36400.1|  hypothetical protein MTR_3g118500                     69.3    4e-11   Medicago truncatula
gb|KEH36401.1|  hypothetical protein MTR_3g118500                     68.9    5e-11   Medicago truncatula
gb|ACJ85037.1|  unknown                                               69.3    5e-11   Medicago truncatula
ref|XP_006422437.1|  hypothetical protein CICLE_v10028873mg           69.7    5e-11   
ref|XP_006422438.1|  hypothetical protein CICLE_v10028873mg           68.9    6e-11   Citrus clementina [clementine]
ref|XP_006422436.1|  hypothetical protein CICLE_v10028873mg           68.9    6e-11   
gb|KDO68318.1|  hypothetical protein CISIN_1g021287mg                 68.6    7e-11   Citrus sinensis [apfelsine]
gb|KDO68315.1|  hypothetical protein CISIN_1g021287mg                 68.9    8e-11   Citrus sinensis [apfelsine]
ref|XP_011088703.1|  PREDICTED: uncharacterized protein LOC105169855  68.6    9e-11   Sesamum indicum [beniseed]
ref|XP_007146462.1|  hypothetical protein PHAVU_006G042500g           68.6    9e-11   Phaseolus vulgaris [French bean]
ref|XP_002527148.1|  conserved hypothetical protein                   68.2    1e-10   Ricinus communis
ref|XP_006486607.1|  PREDICTED: uncharacterized protein LOC102617605  66.6    4e-10   Citrus sinensis [apfelsine]
gb|KHN33646.1|  hypothetical protein glysoja_013652                   63.5    6e-09   Glycine soja [wild soybean]
gb|KGN46660.1|  hypothetical protein Csa_6G118870                     63.5    8e-09   Cucumis sativus [cucumbers]
ref|XP_004139970.1|  PREDICTED: uncharacterized protein LOC101211824  62.8    1e-08   Cucumis sativus [cucumbers]
ref|XP_002313586.1|  hypothetical protein POPTR_0009s16760g           62.0    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006379370.1|  hypothetical protein POPTR_0009s16760g           61.2    2e-08   
ref|XP_003604099.1|  hypothetical protein MTR_3g118500                61.2    4e-08   
ref|XP_010649454.1|  PREDICTED: uncharacterized protein LOC100264584  60.1    9e-08   Vitis vinifera
emb|CAN75365.1|  hypothetical protein VITISV_030645                   59.7    2e-07   Vitis vinifera
ref|XP_010690232.1|  PREDICTED: uncharacterized protein LOC104903811  56.6    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010935274.1|  PREDICTED: uncharacterized protein LOC105055...  53.9    2e-05   Elaeis guineensis
ref|XP_010242892.1|  PREDICTED: uncharacterized protein LOC104587...  52.0    7e-05   Nelumbo nucifera [Indian lotus]
ref|XP_009373399.1|  PREDICTED: uncharacterized protein LOC103962427  51.2    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_010935275.1|  PREDICTED: uncharacterized protein LOC105055...  50.4    2e-04   Elaeis guineensis
ref|XP_008781311.1|  PREDICTED: uncharacterized protein LOC103701114  49.7    4e-04   Phoenix dactylifera
ref|XP_010028834.1|  PREDICTED: uncharacterized protein LOC104419028  49.3    5e-04   Eucalyptus grandis [rose gum]
ref|XP_006384839.1|  hypothetical protein POPTR_0004s21510g           48.9    6e-04   
ref|XP_008812238.1|  PREDICTED: uncharacterized protein LOC103723...  49.3    6e-04   Phoenix dactylifera
ref|XP_008812245.1|  PREDICTED: uncharacterized protein LOC103723...  48.5    0.001   



>ref|XP_009623519.1| PREDICTED: uncharacterized protein LOC104114712 isoform X2 [Nicotiana 
tomentosiformis]
Length=315

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 89/149 (60%), Gaps = 9/149 (6%)
 Frame = +3

Query  78   KVPFFLLALSPTSLLSVLRYSQMGQQTADSKVGDYG-ANTESSVPNSDKQPS--DLVAAK  248
            ++  FLL +S  S++S     +MGQQT DSK  D+G ANT+S VP  DK  S  + V   
Sbjct  5    RMEHFLLIMS-CSIISTQCAYEMGQQTVDSKTSDHGKANTKSGVPKHDKPLSVPEAVMGT  63

Query  249  SI--PQCENLAP--KSIISTASQKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSG  416
            ++   Q EN+A   KSI S    + N      S I GSKR  P+C VN L ++  T+NSG
Sbjct  64   AVQDSQSENVAAASKSIESPLFPEANNMVNNVSNITGSKRPTPECLVNPL-NRYSTNNSG  122

Query  417  NGHLVYVRRRPDAELGKSTTSEDQHCVSD  503
            +GHLVYVRRRPD EL K+  S +Q  V+D
Sbjct  123  SGHLVYVRRRPDGELSKTAASNNQSGVTD  151



>ref|XP_009796928.1| PREDICTED: uncharacterized protein LOC104243442 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009796929.1| PREDICTED: uncharacterized protein LOC104243442 isoform X1 [Nicotiana 
sylvestris]
Length=290

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 78/127 (61%), Gaps = 8/127 (6%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPS--DLVAAKSI--PQCENL--APKSIISTAS  302
            MGQQT DSK  D+G ANT+S VP  DK  S  + V   ++   Q EN+  A KSI S   
Sbjct  1    MGQQTVDSKTSDHGKANTKSGVPKHDKPLSVPEAVMGTAVQDSQSENVVAASKSIESPLF  60

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             + N      S I GSKR  P+C VN L ++C T+NSG+GHLVYVRRRPD EL K+  S 
Sbjct  61   PEANNMVNNVSNITGSKRPTPECLVNPL-NRCSTNNSGSGHLVYVRRRPDGELSKTAASN  119

Query  483  DQHCVSD  503
            +Q  V+D
Sbjct  120  NQSGVTD  126



>gb|KJB32711.1| hypothetical protein B456_005G258900 [Gossypium raimondii]
 gb|KJB32712.1| hypothetical protein B456_005G258900 [Gossypium raimondii]
 gb|KJB32713.1| hypothetical protein B456_005G258900 [Gossypium raimondii]
 gb|KJB32714.1| hypothetical protein B456_005G258900 [Gossypium raimondii]
 gb|KJB32716.1| hypothetical protein B456_005G258900 [Gossypium raimondii]
 gb|KJB32717.1| hypothetical protein B456_005G258900 [Gossypium raimondii]
 gb|KJB32718.1| hypothetical protein B456_005G258900 [Gossypium raimondii]
 gb|KJB32719.1| hypothetical protein B456_005G258900 [Gossypium raimondii]
 gb|KJB32720.1| hypothetical protein B456_005G258900 [Gossypium raimondii]
Length=296

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (66%), Gaps = 8/114 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYGA-NTESSVPNSDKQPSDLVAAKSIP----QCEN-LAPKSIISTASQ  305
            MGQQT DSKV +YG  N ES++P  DKQP  LV  K  P    Q EN   P S  S++  
Sbjct  1    MGQQTIDSKVSEYGLRNPESNLPTCDKQP--LVGTKKTPLRDLQNENRTVPYSTGSSSFS  58

Query  306  KNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGK  467
            K+ GP  + +K+ G+KR  P+CPV+  + Q P+S++ NGHLVYVRR+P+AEL K
Sbjct  59   KDRGPVIDPAKVSGNKRPAPECPVSPSRCQSPSSSAINGHLVYVRRKPEAELAK  112



>gb|KJB32715.1| hypothetical protein B456_005G258900 [Gossypium raimondii]
Length=283

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (66%), Gaps = 8/114 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYGA-NTESSVPNSDKQPSDLVAAKSIP----QCEN-LAPKSIISTASQ  305
            MGQQT DSKV +YG  N ES++P  DKQP  LV  K  P    Q EN   P S  S++  
Sbjct  1    MGQQTIDSKVSEYGLRNPESNLPTCDKQP--LVGTKKTPLRDLQNENRTVPYSTGSSSFS  58

Query  306  KNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGK  467
            K+ GP  + +K+ G+KR  P+CPV+  + Q P+S++ NGHLVYVRR+P+AEL K
Sbjct  59   KDRGPVIDPAKVSGNKRPAPECPVSPSRCQSPSSSAINGHLVYVRRKPEAELAK  112



>ref|XP_009623518.1| PREDICTED: uncharacterized protein LOC104114712 isoform X1 [Nicotiana 
tomentosiformis]
Length=330

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 80/130 (62%), Gaps = 8/130 (6%)
 Frame = +3

Query  135  YSQMGQQTADSKVGDYG-ANTESSVPNSDKQPS--DLVAAKSI--PQCENLAP--KSIIS  293
            +S+MGQQT DSK  D+G ANT+S VP  DK  S  + V   ++   Q EN+A   KSI S
Sbjct  38   FSKMGQQTVDSKTSDHGKANTKSGVPKHDKPLSVPEAVMGTAVQDSQSENVAAASKSIES  97

Query  294  TASQKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKST  473
                + N      S I GSKR  P+C VN L ++  T+NSG+GHLVYVRRRPD EL K+ 
Sbjct  98   PLFPEANNMVNNVSNITGSKRPTPECLVNPL-NRYSTNNSGSGHLVYVRRRPDGELSKTA  156

Query  474  TSEDQHCVSD  503
             S +Q  V+D
Sbjct  157  ASNNQSGVTD  166



>ref|XP_009623520.1| PREDICTED: uncharacterized protein LOC104114712 isoform X3 [Nicotiana 
tomentosiformis]
Length=290

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 77/127 (61%), Gaps = 8/127 (6%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPS--DLVAAKSI--PQCENLAP--KSIISTAS  302
            MGQQT DSK  D+G ANT+S VP  DK  S  + V   ++   Q EN+A   KSI S   
Sbjct  1    MGQQTVDSKTSDHGKANTKSGVPKHDKPLSVPEAVMGTAVQDSQSENVAAASKSIESPLF  60

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             + N      S I GSKR  P+C VN L ++  T+NSG+GHLVYVRRRPD EL K+  S 
Sbjct  61   PEANNMVNNVSNITGSKRPTPECLVNPL-NRYSTNNSGSGHLVYVRRRPDGELSKTAASN  119

Query  483  DQHCVSD  503
            +Q  V+D
Sbjct  120  NQSGVTD  126



>ref|XP_006364359.1| PREDICTED: uncharacterized protein LOC102599247 isoform X1 [Solanum 
tuberosum]
 ref|XP_006364360.1| PREDICTED: uncharacterized protein LOC102599247 isoform X2 [Solanum 
tuberosum]
Length=287

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 75/126 (60%), Gaps = 8/126 (6%)
 Frame = +3

Query  144  MGQQTADSKVGDYGANTESSVPNSDKQ---PSDLVA-AKSIPQCENL--APKSIISTASQ  305
            MGQQT DSK  D   N +S +P  DKQ   P  +V  A    Q E++  A KS  S    
Sbjct  1    MGQQTVDSKSSD-QTNAKSGLPKHDKQLLVPVAIVGPALQDSQSESMVVASKSAESPLFP  59

Query  306  KNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSED  485
            + N  A + S I GSKR  P+C VN L +QC T+NSG+GHLVYVRRRP+ EL K+  + +
Sbjct  60   EANTMANKVSNITGSKRPTPECLVNPL-NQCSTNNSGSGHLVYVRRRPEGELNKTAANNN  118

Query  486  QHCVSD  503
            Q  V+D
Sbjct  119  QSGVTD  124



>ref|XP_010111709.1| hypothetical protein L484_006580 [Morus notabilis]
 gb|EXC31548.1| hypothetical protein L484_006580 [Morus notabilis]
Length=295

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 5/116 (4%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSIPQCEN----LAPKSIISTASQK  308
            M QQT DSK  +YG  N+E+ +P  DKQ    +    +   +N      P S  ++   K
Sbjct  1    MVQQTIDSKFSEYGMGNSETDLPTGDKQLPVAIKKTVLRDLQNNNIITVPNSNGNSPLLK  60

Query  309  NNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTT  476
            + GP  + +K+ G+KR++P+CP +  Q   P +NS NGHLVYVRR+ +AELGKS+T
Sbjct  61   DRGPITDTTKLSGTKRASPECPESPSQHYSPNNNSPNGHLVYVRRKSEAELGKSST  116



>ref|XP_008235955.1| PREDICTED: uncharacterized protein LOC103334767 [Prunus mume]
 ref|XP_008235956.1| PREDICTED: uncharacterized protein LOC103334767 [Prunus mume]
Length=314

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 73/121 (60%), Gaps = 7/121 (6%)
 Frame = +3

Query  144  MGQQTADSKVGDYGAN-TESSVPNSDKQPSDLVAAKSIPQCEN----LAPKSIISTASQK  308
            M QQT DSK  +YG   TES +P  DKQ S  V   ++   +N      P SI ++   K
Sbjct  1    MVQQTIDSKFSEYGMGATESELPVHDKQLSVPVKKTALRDLQNDIRVAMPNSIGNSPLLK  60

Query  309  NNGPAGEASKICGSKRS--NPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
            N GP   A ++ G+KR    P+CP++  Q Q P+S++ NGHLVYVRR+ +A++ +S+T +
Sbjct  61   NGGPISNAPRVSGTKRPLPEPECPMSLPQHQLPSSSAANGHLVYVRRKSEADVVRSSTCD  120

Query  483  D  485
            +
Sbjct  121  N  121



>ref|XP_007041617.1| Integral membrane protein hemolysin-III, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007041618.1| Integral membrane protein hemolysin-III, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007041619.1| Integral membrane protein hemolysin-III, putative isoform 1 [Theobroma 
cacao]
 gb|EOX97448.1| Integral membrane protein hemolysin-III, putative isoform 1 [Theobroma 
cacao]
 gb|EOX97449.1| Integral membrane protein hemolysin-III, putative isoform 1 [Theobroma 
cacao]
 gb|EOX97450.1| Integral membrane protein hemolysin-III, putative isoform 1 [Theobroma 
cacao]
Length=294

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 70/117 (60%), Gaps = 8/117 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYGA-NTESSVPNSDKQPSDLVAAKSIP----QCEN-LAPKSIISTASQ  305
            M QQ  DSK  +YG  N E++ P  DKQP   V AK  P    Q EN + P S  S+   
Sbjct  1    MVQQRIDSKFSEYGLRNPENNSPTCDKQPP--VGAKKTPLRDLQNENRIVPNSTGSSPFS  58

Query  306  KNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTT  476
            K+ GP  +  K  G+KR +P+CPV+    Q  ++++ +GHLVYVRR+ +AELGKS+ 
Sbjct  59   KDRGPVIDPIKFSGTKRPSPECPVSPSHCQSRSNSAASGHLVYVRRKSEAELGKSSA  115



>ref|XP_010315419.1| PREDICTED: uncharacterized protein LOC101256042 isoform X1 [Solanum 
lycopersicum]
Length=290

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 73/127 (57%), Gaps = 8/127 (6%)
 Frame = +3

Query  144  MGQQTADSKVGD-YGANTESSVPNSDKQPSDLVA----AKSIPQCENL--APKSIISTAS  302
            MG+QT DSK  D   A +   +P  DKQ S  VA    A    Q E++  A KS  S   
Sbjct  2    MGEQTVDSKSSDQTNAKSGFGLPKHDKQLSVPVAIVGPALQDSQSESVVAASKSTESPLF  61

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             + N  A + S I GSKR  P+C VN L ++C T+NSG+GHLVYVRRRP+ EL K+  + 
Sbjct  62   PEANTMANKVSNITGSKRPTPECLVNPL-NRCSTNNSGSGHLVYVRRRPEGELSKTAANT  120

Query  483  DQHCVSD  503
             Q  V+D
Sbjct  121  SQSGVTD  127



>ref|XP_004231095.1| PREDICTED: uncharacterized protein LOC101256042 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010315420.1| PREDICTED: uncharacterized protein LOC101256042 isoform X2 [Solanum 
lycopersicum]
Length=289

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 73/127 (57%), Gaps = 8/127 (6%)
 Frame = +3

Query  144  MGQQTADSKVGD-YGANTESSVPNSDKQPSDLVA----AKSIPQCENL--APKSIISTAS  302
            MG+QT DSK  D   A +   +P  DKQ S  VA    A    Q E++  A KS  S   
Sbjct  1    MGEQTVDSKSSDQTNAKSGFGLPKHDKQLSVPVAIVGPALQDSQSESVVAASKSTESPLF  60

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             + N  A + S I GSKR  P+C VN L ++C T+NSG+GHLVYVRRRP+ EL K+  + 
Sbjct  61   PEANTMANKVSNITGSKRPTPECLVNPL-NRCSTNNSGSGHLVYVRRRPEGELSKTAANT  119

Query  483  DQHCVSD  503
             Q  V+D
Sbjct  120  SQSGVTD  126



>gb|KHF97710.1| Translation initiation factor IF-2 [Gossypium arboreum]
Length=294

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 71/117 (61%), Gaps = 8/117 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYGA-NTESSVPNSDKQPSDLVAAKSIP----QCEN-LAPKSIISTASQ  305
            M QQT D K  +YG  N E++ P  DKQP     AK  P    Q EN + P S  S+   
Sbjct  1    MVQQTVDPKFSEYGMLNPENNSPICDKQPP--AGAKKTPLRDLQNENRIVPNSAGSSPFP  58

Query  306  KNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTT  476
            K+ GP  +  K+ G+KR +P+CPV+  Q Q P+S + NGHLVYVRR+ +AELGKS+ 
Sbjct  59   KDRGPGIDPIKVSGTKRPSPECPVSPSQCQSPSSCAANGHLVYVRRKCEAELGKSSV  115



>gb|KJB15972.1| hypothetical protein B456_002G206500 [Gossypium raimondii]
 gb|KJB15973.1| hypothetical protein B456_002G206500 [Gossypium raimondii]
Length=294

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 70/117 (60%), Gaps = 8/117 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYGA-NTESSVPNSDKQPSDLVAAKSIP----QCEN-LAPKSIISTASQ  305
            M QQT D K  +YG    E++ P  D+QP   V  K  P    Q EN + P S  S+   
Sbjct  1    MVQQTLDPKFSEYGMLKPENNSPICDEQPP--VGVKKTPLRDLQNENRIVPNSTGSSPFP  58

Query  306  KNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTT  476
            K+ GP  +  K+ G+KR +P+CPV+  Q Q P+S + NGHLVYVRR+ +AELGKS+ 
Sbjct  59   KDRGPGIDPIKVSGTKRPSPECPVSPSQCQSPSSCAANGHLVYVRRKCEAELGKSSV  115



>ref|XP_009796930.1| PREDICTED: uncharacterized protein LOC104243442 isoform X2 [Nicotiana 
sylvestris]
Length=255

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 53/84 (63%), Gaps = 3/84 (4%)
 Frame = +3

Query  258  QCENL--APKSIISTASQKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLV  431
            Q EN+  A KSI S    + N      S I GSKR  P+C VN L ++C T+NSG+GHLV
Sbjct  9    QSENVVAASKSIESPLFPEANNMVNNVSNITGSKRPTPECLVNPL-NRCSTNNSGSGHLV  67

Query  432  YVRRRPDAELGKSTTSEDQHCVSD  503
            YVRRRPD EL K+  S +Q  V+D
Sbjct  68   YVRRRPDGELSKTAASNNQSGVTD  91



>ref|XP_007200445.1| hypothetical protein PRUPE_ppa008919mg [Prunus persica]
 gb|EMJ01644.1| hypothetical protein PRUPE_ppa008919mg [Prunus persica]
Length=314

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 71/121 (59%), Gaps = 7/121 (6%)
 Frame = +3

Query  144  MGQQTADSKVGDYGAN-TESSVPNSDKQPSDLVAAKSIPQCEN----LAPKSIISTASQK  308
            M QQT DSK  +YG   TES +P  DKQ S  V   ++   +N      P S  ++   K
Sbjct  1    MVQQTIDSKFSEYGMGATESELPVHDKQLSVPVKKTALRDLQNDIRVAMPNSFGNSPLLK  60

Query  309  NNGPAGEASKICGSKRS--NPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
            + G    A ++ G+KR    P+CP++  Q Q P+S++ NGHLVYVRR+ +A++ +S+T +
Sbjct  61   DGGHISNAPRVSGTKRPLPEPECPMSLPQHQLPSSSAANGHLVYVRRKSEADVVRSSTCD  120

Query  483  D  485
            +
Sbjct  121  N  121



>ref|XP_003526762.1| PREDICTED: uncharacterized protein LOC100803861 isoform X1 [Glycine 
max]
 ref|XP_006581077.1| PREDICTED: uncharacterized protein LOC100803861 isoform X2 [Glycine 
max]
 ref|XP_006581078.1| PREDICTED: uncharacterized protein LOC100803861 isoform X3 [Glycine 
max]
 ref|XP_006581079.1| PREDICTED: uncharacterized protein LOC100803861 isoform X4 [Glycine 
max]
 gb|KHN19964.1| hypothetical protein glysoja_014542 [Glycine soja]
Length=307

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 71/130 (55%), Gaps = 9/130 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSIPQCEN----LAPKSIISTASQK  308
            M QQ+  SK  +Y   N +  +PN DKQ +  V   ++   +N    + P S+ S++  K
Sbjct  1    MIQQSIASKFCEYSLGNCKMDLPNRDKQLTVAVKKTALRDLQNDNKIMVPTSVGSSSFFK  60

Query  309  NNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE--  482
            +     ++S++ G+KR   D P+N    Q P++N+ NGHLVYVRR+ +AEL K T  E  
Sbjct  61   DKDLGTDSSRVSGTKRPLSDYPLNHHLQQSPSNNAANGHLVYVRRKSEAELSKGTAFENP  120

Query  483  --DQHCVSDR  506
              D +C   R
Sbjct  121  SIDAYCPHSR  130



>gb|ACU21193.1| unknown [Glycine max]
Length=246

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 71/130 (55%), Gaps = 9/130 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSIPQCEN----LAPKSIISTASQK  308
            M QQ+  SK  +Y   N +  +PN DKQ +  V   ++   +N    + P S+ S++  K
Sbjct  1    MIQQSIASKFCEYSLGNCKMDLPNRDKQLTVAVKKTALRDLQNDNKIMVPTSVGSSSFFK  60

Query  309  NNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE--  482
            +     ++S++ G+KR   D P+N    Q P++N+ NGHLVYVRR+ +AEL K T  E  
Sbjct  61   DKDLGTDSSRVSGTKRPLSDYPLNHHLQQSPSNNAANGHLVYVRRKSEAELSKGTAFENP  120

Query  483  --DQHCVSDR  506
              D +C   R
Sbjct  121  SIDAYCPHSR  130



>gb|EYU38031.1| hypothetical protein MIMGU_mgv1a010394mg [Erythranthe guttata]
Length=313

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 69/120 (58%), Gaps = 12/120 (10%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSIP---QC-EN--LAPKSIISTAS  302
            M QQT DS   +YG A+ +S + NSDKQ S+ V AK+      C EN     KSI S   
Sbjct  1    MVQQTKDSTFTEYGLAHVQSGLSNSDKQLSEFVPAKTSELQSSCNENPMTVSKSIGSPLL  60

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             +++  AGE  K+ G+KR     P++  Q   P SN G+GH+VYVRR+P+ +L KS  S 
Sbjct  61   MEDSECAGEVVKMSGTKR-----PISECQHSPPRSNVGSGHIVYVRRKPETDLAKSNVSH  115



>ref|XP_003523998.1| PREDICTED: uncharacterized protein LOC100802245 isoform X1 [Glycine 
max]
 ref|XP_006577880.1| PREDICTED: uncharacterized protein LOC100802245 isoform X2 [Glycine 
max]
 ref|XP_006577881.1| PREDICTED: uncharacterized protein LOC100802245 isoform X3 [Glycine 
max]
 ref|XP_006577882.1| PREDICTED: uncharacterized protein LOC100802245 isoform X4 [Glycine 
max]
Length=306

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 70/120 (58%), Gaps = 8/120 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKS-IPQCEN----LAPKSIISTASQ  305
            M QQ  DSK  +Y   N +  +PN DKQ +  VA K+ +   +N    + P S+ S++  
Sbjct  1    MIQQGIDSKFCEYSLGNCKMDLPNRDKQLT--VAVKTALRDLQNDNKIMVPTSVGSSSFL  58

Query  306  KNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSED  485
            K+  P  +++++ G+KR   D P+N    Q P++N+ NGHLVYVRR+ +AEL K    E+
Sbjct  59   KDKDPGTDSNRVSGTKRPLSDYPLNHQLQQSPSNNAANGHLVYVRRKSEAELSKGIAYEN  118



>ref|XP_010266173.1| PREDICTED: uncharacterized protein LOC104603754 [Nelumbo nucifera]
 ref|XP_010266174.1| PREDICTED: uncharacterized protein LOC104603754 [Nelumbo nucifera]
Length=296

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 68/121 (56%), Gaps = 8/121 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYGA-NTESSVPNSDKQPSDLVAAKSIPQCEN----LAPKSIISTASQK  308
            M QQ  DSKV  YG  NT + +P SDKQ + LV   ++   +N      PK   ++   K
Sbjct  1    MVQQMVDSKVNQYGLPNTGAGLPTSDKQHAILVKKTALRDLQNDNRISLPKPQGNSTFLK  60

Query  309  NNGPAGEASKICGSKRSNPDCPVNSLQ--SQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
              GP  +A K+ G+KR++P+CP  +     Q  +SN  N HLVYVRR+ ++ELGKS    
Sbjct  61   EKGPLKDA-KVSGNKRASPECPAPASPPGHQSLSSNGENSHLVYVRRKSESELGKSNMDN  119

Query  483  D  485
            D
Sbjct  120  D  120



>ref|XP_009623521.1| PREDICTED: uncharacterized protein LOC104114712 isoform X4 [Nicotiana 
tomentosiformis]
Length=255

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = +3

Query  258  QCENLAP--KSIISTASQKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLV  431
            Q EN+A   KSI S    + N      S I GSKR  P+C VN L ++  T+NSG+GHLV
Sbjct  9    QSENVAAASKSIESPLFPEANNMVNNVSNITGSKRPTPECLVNPL-NRYSTNNSGSGHLV  67

Query  432  YVRRRPDAELGKSTTSEDQHCVSD  503
            YVRRRPD EL K+  S +Q  V+D
Sbjct  68   YVRRRPDGELSKTAASNNQSGVTD  91



>gb|ACU16971.1| unknown [Glycine max]
Length=212

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 69/119 (58%), Gaps = 6/119 (5%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSIPQCEN----LAPKSIISTASQK  308
            M QQ  DSK  +Y   N +  +PN DKQ + +V   ++   +N    + P S+ S++  K
Sbjct  1    MVQQGIDSKFCEYSLGNCKMDLPNRDKQLT-VVVKTALRDLQNDNKIMVPTSVGSSSFLK  59

Query  309  NNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSED  485
            +  P  +++++ G+KR   D P+N    Q P++N+ NGHLVYVRR+ +AEL K    E+
Sbjct  60   DKDPGTDSNRVSGTKRPLSDYPLNHQLQQSPSNNAANGHLVYVRRKSEAELSKGIAYEN  118



>gb|KDP42029.1| hypothetical protein JCGZ_03092 [Jatropha curcas]
Length=296

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 73/130 (56%), Gaps = 5/130 (4%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSI---PQCENLAPKSIISTASQKN  311
            M QQT DSK+ +YG  N+E+++   +K P  +   K+     Q EN  P SI  +   K+
Sbjct  1    MVQQTVDSKLNEYGLGNSEANLSTCEK-PFAIAVKKTALRDVQNENRIPHSIGISPLPKD  59

Query  312  NGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSEDQH  491
             G   ++ ++ G+KR +   PV++   Q PTSN+ N  LVYVRR+ +AE GKS   E + 
Sbjct  60   RGQTMDSLQVSGTKRPSSKGPVSTPHHQSPTSNAANAQLVYVRRKAEAETGKSNICEGRS  119

Query  492  CVSDRLGGRR  521
              +D L  R+
Sbjct  120  LNADCLNSRQ  129



>gb|KEH36400.1| hypothetical protein MTR_3g118500 [Medicago truncatula]
Length=284

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 10/121 (8%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAK--SIPQCEN----LAPKSIISTAS  302
            M QQ  DS+  +Y   N++  +PN DKQ   LV  K  S+   +N    + P S+ +++ 
Sbjct  1    MVQQGIDSRFCEYNLGNSKMDLPNGDKQ---LVILKKTSLKDLQNDNKNMVPTSVGNSSF  57

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             K+  P  ++++  G+KR + D PV     Q P +N+ NGHLVYVRR+ + E+ KST  E
Sbjct  58   LKDKDPGTDSNRATGTKRPSSDYPVIHHLQQSPGNNAANGHLVYVRRKSEGEMSKSTAFE  117

Query  483  D  485
            +
Sbjct  118  N  118



>gb|KEH36401.1| hypothetical protein MTR_3g118500 [Medicago truncatula]
Length=258

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 10/121 (8%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAK--SIPQCEN----LAPKSIISTAS  302
            M QQ  DS+  +Y   N++  +PN DKQ   LV  K  S+   +N    + P S+ +++ 
Sbjct  1    MVQQGIDSRFCEYNLGNSKMDLPNGDKQ---LVILKKTSLKDLQNDNKNMVPTSVGNSSF  57

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             K+  P  ++++  G+KR + D PV     Q P +N+ NGHLVYVRR+ + E+ KST  E
Sbjct  58   LKDKDPGTDSNRATGTKRPSSDYPVIHHLQQSPGNNAANGHLVYVRRKSEGEMSKSTAFE  117

Query  483  D  485
            +
Sbjct  118  N  118



>gb|ACJ85037.1| unknown [Medicago truncatula]
 gb|AES74350.2| hypothetical protein MTR_3g118500 [Medicago truncatula]
Length=299

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 10/121 (8%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAK--SIPQCEN----LAPKSIISTAS  302
            M QQ  DS+  +Y   N++  +PN DKQ   LV  K  S+   +N    + P S+ +++ 
Sbjct  1    MVQQGIDSRFCEYNLGNSKMDLPNGDKQ---LVILKKTSLKDLQNDNKNMVPTSVGNSSF  57

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             K+  P  ++++  G+KR + D PV     Q P +N+ NGHLVYVRR+ + E+ KST  E
Sbjct  58   LKDKDPGTDSNRATGTKRPSSDYPVIHHLQQSPGNNAANGHLVYVRRKSEGEMSKSTAFE  117

Query  483  D  485
            +
Sbjct  118  N  118



>ref|XP_006422437.1| hypothetical protein CICLE_v10028873mg [Citrus clementina]
 gb|ESR35677.1| hypothetical protein CICLE_v10028873mg [Citrus clementina]
 gb|KDO68314.1| hypothetical protein CISIN_1g021287mg [Citrus sinensis]
Length=314

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 72/128 (56%), Gaps = 13/128 (10%)
 Frame = +3

Query  141  QMGQQTADSKVGDYGANT-ESSVPNSDKQPSDLVAAKSIP----QCEN--LAPKSIISTA  299
             M QQTADSK   YG  + E+++ + DKQ   LVA K       Q EN  + PK   ++ 
Sbjct  33   MMVQQTADSKFNQYGFGSPETNLLSRDKQ--QLVAMKKTALRELQNENRIVVPKPNGNSP  90

Query  300  SQKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTS  479
              K+ G   +A K+ GSKR   +CPV    S    SN  NGHLVYVRR+ +A++GK++TS
Sbjct  91   YSKDGGSIIDAIKVSGSKRPLHECPV----SPPKDSNVANGHLVYVRRKFEADVGKASTS  146

Query  480  EDQHCVSD  503
            +  +   D
Sbjct  147  DSTNTAVD  154



>ref|XP_006422438.1| hypothetical protein CICLE_v10028873mg [Citrus clementina]
 gb|ESR35678.1| hypothetical protein CICLE_v10028873mg [Citrus clementina]
 gb|KDO68316.1| hypothetical protein CISIN_1g021287mg [Citrus sinensis]
Length=282

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 72/128 (56%), Gaps = 13/128 (10%)
 Frame = +3

Query  141  QMGQQTADSKVGDYGANT-ESSVPNSDKQPSDLVAAKSIP----QCEN--LAPKSIISTA  299
             M QQTADSK   YG  + E+++ + DKQ   LVA K       Q EN  + PK   ++ 
Sbjct  1    MMVQQTADSKFNQYGFGSPETNLLSRDKQ--QLVAMKKTALRELQNENRIVVPKPNGNSP  58

Query  300  SQKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTS  479
              K+ G   +A K+ GSKR   +CPV    S    SN  NGHLVYVRR+ +A++GK++TS
Sbjct  59   YSKDGGSIIDAIKVSGSKRPLHECPV----SPPKDSNVANGHLVYVRRKFEADVGKASTS  114

Query  480  EDQHCVSD  503
            +  +   D
Sbjct  115  DSTNTAVD  122



>ref|XP_006422436.1| hypothetical protein CICLE_v10028873mg [Citrus clementina]
 gb|ESR35676.1| hypothetical protein CICLE_v10028873mg [Citrus clementina]
 gb|KDO68317.1| hypothetical protein CISIN_1g021287mg [Citrus sinensis]
Length=281

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 72/127 (57%), Gaps = 13/127 (10%)
 Frame = +3

Query  144  MGQQTADSKVGDYGANT-ESSVPNSDKQPSDLVAAKSIP----QCEN--LAPKSIISTAS  302
            M QQTADSK   YG  + E+++ + DKQ   LVA K       Q EN  + PK   ++  
Sbjct  1    MVQQTADSKFNQYGFGSPETNLLSRDKQ--QLVAMKKTALRELQNENRIVVPKPNGNSPY  58

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             K+ G   +A K+ GSKR   +CPV    S    SN  NGHLVYVRR+ +A++GK++TS+
Sbjct  59   SKDGGSIIDAIKVSGSKRPLHECPV----SPPKDSNVANGHLVYVRRKFEADVGKASTSD  114

Query  483  DQHCVSD  503
              +   D
Sbjct  115  STNTAVD  121



>gb|KDO68318.1| hypothetical protein CISIN_1g021287mg [Citrus sinensis]
Length=272

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 72/127 (57%), Gaps = 13/127 (10%)
 Frame = +3

Query  144  MGQQTADSKVGDYGANT-ESSVPNSDKQPSDLVAAKSIP----QCEN--LAPKSIISTAS  302
            M QQTADSK   YG  + E+++ + DKQ   LVA K       Q EN  + PK   ++  
Sbjct  1    MVQQTADSKFNQYGFGSPETNLLSRDKQ--QLVAMKKTALRELQNENRIVVPKPNGNSPY  58

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             K+ G   +A K+ GSKR   +CPV    S    SN  NGHLVYVRR+ +A++GK++TS+
Sbjct  59   SKDGGSIIDAIKVSGSKRPLHECPV----SPPKDSNVANGHLVYVRRKFEADVGKASTSD  114

Query  483  DQHCVSD  503
              +   D
Sbjct  115  STNTAVD  121



>gb|KDO68315.1| hypothetical protein CISIN_1g021287mg [Citrus sinensis]
Length=305

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 72/128 (56%), Gaps = 13/128 (10%)
 Frame = +3

Query  141  QMGQQTADSKVGDYGANT-ESSVPNSDKQPSDLVAAKSIP----QCEN--LAPKSIISTA  299
             M QQTADSK   YG  + E+++ + DKQ   LVA K       Q EN  + PK   ++ 
Sbjct  33   MMVQQTADSKFNQYGFGSPETNLLSRDKQ--QLVAMKKTALRELQNENRIVVPKPNGNSP  90

Query  300  SQKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTS  479
              K+ G   +A K+ GSKR   +CPV    S    SN  NGHLVYVRR+ +A++GK++TS
Sbjct  91   YSKDGGSIIDAIKVSGSKRPLHECPV----SPPKDSNVANGHLVYVRRKFEADVGKASTS  146

Query  480  EDQHCVSD  503
            +  +   D
Sbjct  147  DSTNTAVD  154



>ref|XP_011088703.1| PREDICTED: uncharacterized protein LOC105169855 [Sesamum indicum]
Length=295

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 12/115 (10%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSIPQ---CENL--APKSIISTASQ  305
            M QQT +S   +YG  + +S + NSDKQ S  VAAK+ P+    ENL    KSI S    
Sbjct  1    MVQQTKESSFTEYGLGHADSGLSNSDKQLSVSVAAKT-PEDSRNENLMTVSKSIFSPLLM  59

Query  306  KNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKS  470
             +   AGE  ++ G+KR  P+C    L+S    SN+G+ H+VYVRR+P+ EL KS
Sbjct  60   DDGACAGEVVRVSGTKRPIPEC----LRSPA-KSNAGSAHIVYVRRKPEPELAKS  109



>ref|XP_007146462.1| hypothetical protein PHAVU_006G042500g [Phaseolus vulgaris]
 ref|XP_007146463.1| hypothetical protein PHAVU_006G042500g [Phaseolus vulgaris]
 gb|ESW18456.1| hypothetical protein PHAVU_006G042500g [Phaseolus vulgaris]
 gb|ESW18457.1| hypothetical protein PHAVU_006G042500g [Phaseolus vulgaris]
Length=283

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 4/98 (4%)
 Frame = +3

Query  204  VPNSDKQPSDLVAAKSIPQCEN----LAPKSIISTASQKNNGPAGEASKICGSKRSNPDC  371
            +PN DKQ +  V   ++   +N    + P S+ S +  K+  PA +++++ G+KR + + 
Sbjct  3    LPNRDKQQTVAVKKTALRDLQNDNKSMVPTSVGSPSFLKDKDPATDSNRVSGTKRPSSEY  62

Query  372  PVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSED  485
            PVN    Q P +N+ NGHLVYVRR+ + ELGK T  E+
Sbjct  63   PVNQNLQQSPGNNAANGHLVYVRRKSETELGKGTAFEN  100



>ref|XP_002527148.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35230.1| conserved hypothetical protein [Ricinus communis]
Length=297

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 77/140 (55%), Gaps = 9/140 (6%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSI--PQCENLAPKSIISTASQKNN  314
            M QQ  D K  +YG +NTES+V   DKQ    V   ++   Q EN    S+ +++  K+ 
Sbjct  1    MVQQAVDLKCSEYGLSNTESNVSACDKQFPVAVKKTALRDVQNENRISNSVANSSFSKDR  60

Query  315  GPAGEASKICGSKRSNPDCPVNSLQS-----QCPTSNSGNGHLVYVRRRPDAELGKSTTS  479
            G A +A K+ G+KR +P  P++ + S     Q P+SN+ N  LVYVRR+ + E GKS+  
Sbjct  61   GQANDAVKVAGTKRPSPS-PMDPVSSPPPHHQSPSSNAANAQLVYVRRKSEGETGKSSIC  119

Query  480  EDQHCVSDRLGGRRPPDAEL  539
            + +    D +  R+   AE+
Sbjct  120  DGRSINVDCVNSRQLDQAEI  139



>ref|XP_006486607.1| PREDICTED: uncharacterized protein LOC102617605 [Citrus sinensis]
Length=281

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 71/125 (57%), Gaps = 9/125 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYGANT-ESSVPNSDKQPSDLVAAKSIPQCEN----LAPKSIISTASQK  308
            M QQTADSK   YG  + E+++ + DKQ   ++   ++ + +N    + PK   ++   K
Sbjct  1    MVQQTADSKFNQYGFGSPETNLLSRDKQQLVVMKKTALRELQNENRIVVPKPNGNSPYSK  60

Query  309  NNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSEDQ  488
            + G   +A K+ GSKR   +CPV    S    SN  NGHLVYVRR+ +A++GK++T +  
Sbjct  61   DGGSIIDAIKVSGSKRPLHECPV----SPPKDSNVANGHLVYVRRKFEADVGKASTLDST  116

Query  489  HCVSD  503
            +   D
Sbjct  117  NTAVD  121



>gb|KHN33646.1| hypothetical protein glysoja_013652 [Glycine soja]
Length=287

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +3

Query  204  VPNSDKQPSDLVAAKS-IPQCEN----LAPKSIISTASQKNNGPAGEASKICGSKRSNPD  368
            +PN DKQ +  VA K+ +   +N    + P S+ S++  K+  P  +++++ G+KR   D
Sbjct  3    LPNRDKQLT--VAVKTALRDLQNDNKIMVPTSVGSSSFLKDKDPGTDSNRVSGTKRPLSD  60

Query  369  CPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSED  485
             P+N    Q P++N+ NGHLVYVRR+ +AEL K    E+
Sbjct  61   YPLNHQLQQSPSNNAANGHLVYVRRKSEAELSKGIAYEN  99



>gb|KGN46660.1| hypothetical protein Csa_6G118870 [Cucumis sativus]
Length=338

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSIP----QCENLAPKSIISTAS--  302
            M Q++ DSK  +YG  N    VP+ +KQ    ++AK       Q +N+A  S  + +S  
Sbjct  1    MVQKSIDSKFSEYGHGNFGKDVPSQEKQLQ--ISAKKTASRDLQNDNMAIASNCTGSSPL  58

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             K  G   +  K+ G+KR+ P  P +       TSNS NGHLVYVRR+ DA++GK+++ +
Sbjct  59   LKEIGTGSDIIKVSGNKRALPVYPASPSHLHSSTSNSANGHLVYVRRKSDADIGKNSSCD  118

Query  483  D  485
            +
Sbjct  119  N  119



>ref|XP_004139970.1| PREDICTED: uncharacterized protein LOC101211824 [Cucumis sativus]
 ref|XP_004154529.1| PREDICTED: uncharacterized LOC101211824 [Cucumis sativus]
Length=296

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSIP----QCENLAPKSIISTAS--  302
            M Q++ DSK  +YG  N    VP+ +KQ    ++AK       Q +N+A  S  + +S  
Sbjct  1    MVQKSIDSKFSEYGHGNFGKDVPSQEKQLQ--ISAKKTASRDLQNDNMAIASNCTGSSPL  58

Query  303  QKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
             K  G   +  K+ G+KR+ P  P +       TSNS NGHLVYVRR+ DA++GK+++ +
Sbjct  59   LKEIGTGSDIIKVSGNKRALPVYPASPSHLHSSTSNSANGHLVYVRRKSDADIGKNSSCD  118

Query  483  D  485
            +
Sbjct  119  N  119



>ref|XP_002313586.1| hypothetical protein POPTR_0009s16760g [Populus trichocarpa]
 gb|ABK93717.1| unknown [Populus trichocarpa]
 gb|EEE87541.1| hypothetical protein POPTR_0009s16760g [Populus trichocarpa]
Length=278

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 69/120 (58%), Gaps = 7/120 (6%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSI---PQCENLAPKSIISTASQKN  311
            M QQT DSK  +YG +NT++++   DKQ   LV  K+     Q EN  PKS+ ++   K+
Sbjct  1    MVQQTIDSKFSEYGLSNTDTNLSTHDKQ-FPLVLKKTALRDVQNENRIPKSVGNSPLSKD  59

Query  312  NGPAGEASKICGSKRSNPDCPVN--SLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSED  485
             G    + K+ G+KR + +  +N   L+ +  +S + N HLVYVRR+ +AE GK    E+
Sbjct  60   RGQTMNSFKVSGAKRPSSEGLMNPPVLRYESSSSGAPNSHLVYVRRKSEAETGKLGHHEE  119



>ref|XP_006379370.1| hypothetical protein POPTR_0009s16760g [Populus trichocarpa]
 gb|ERP57167.1| hypothetical protein POPTR_0009s16760g [Populus trichocarpa]
Length=227

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 69/120 (58%), Gaps = 7/120 (6%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSI---PQCENLAPKSIISTASQKN  311
            M QQT DSK  +YG +NT++++   DKQ   LV  K+     Q EN  PKS+ ++   K+
Sbjct  1    MVQQTIDSKFSEYGLSNTDTNLSTHDKQ-FPLVLKKTALRDVQNENRIPKSVGNSPLSKD  59

Query  312  NGPAGEASKICGSKRSNPDCPVN--SLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSED  485
             G    + K+ G+KR + +  +N   L+ +  +S + N HLVYVRR+ +AE GK    E+
Sbjct  60   RGQTMNSFKVSGAKRPSSEGLMNPPVLRYESSSSGAPNSHLVYVRRKSEAETGKLGHHEE  119



>ref|XP_003604099.1| hypothetical protein MTR_3g118500 [Medicago truncatula]
Length=280

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 58/100 (58%), Gaps = 9/100 (9%)
 Frame = +3

Query  204  VPNSDKQPSDLVAAK--SIPQCEN----LAPKSIISTASQKNNGPAGEASKICGSKRSNP  365
            +PN DKQ   LV  K  S+   +N    + P S+ +++  K+  P  ++++  G+KR + 
Sbjct  3    LPNGDKQ---LVILKKTSLKDLQNDNKNMVPTSVGNSSFLKDKDPGTDSNRATGTKRPSS  59

Query  366  DCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSED  485
            D PV     Q P +N+ NGHLVYVRR+ + E+ KST  E+
Sbjct  60   DYPVIHHLQQSPGNNAANGHLVYVRRKSEGEMSKSTAFEN  99



>ref|XP_010649454.1| PREDICTED: uncharacterized protein LOC100264584 [Vitis vinifera]
 ref|XP_010649455.1| PREDICTED: uncharacterized protein LOC100264584 [Vitis vinifera]
 ref|XP_010649456.1| PREDICTED: uncharacterized protein LOC100264584 [Vitis vinifera]
 ref|XP_010649457.1| PREDICTED: uncharacterized protein LOC100264584 [Vitis vinifera]
 ref|XP_010649458.1| PREDICTED: uncharacterized protein LOC100264584 [Vitis vinifera]
 ref|XP_010649459.1| PREDICTED: uncharacterized protein LOC100264584 [Vitis vinifera]
 ref|XP_010649460.1| PREDICTED: uncharacterized protein LOC100264584 [Vitis vinifera]
 ref|XP_010649461.1| PREDICTED: uncharacterized protein LOC100264584 [Vitis vinifera]
Length=284

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 5/115 (4%)
 Frame = +3

Query  162  DSKVGDY-GANTESSVPNSDKQPSDLVAAKSIPQCEN----LAPKSIISTASQKNNGPAG  326
            DSK G+Y   NT   +   DKQ    V   ++   +N    + PK + ++ + K+     
Sbjct  3    DSKFGEYEKGNTGIGLATCDKQALAPVKKTALRDLQNDNRTVLPKPLENSPAPKDAETTK  62

Query  327  EASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSEDQH  491
               K+ G+KR  PD P++  + Q  +SN  NGHLVYVRR+ +AE GK++  ++ H
Sbjct  63   NVIKLLGAKRPTPDRPLSPSRPQSLSSNGANGHLVYVRRKSEAEPGKNSAQDNDH  117



>emb|CAN75365.1| hypothetical protein VITISV_030645 [Vitis vinifera]
Length=511

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 55/104 (53%), Gaps = 13/104 (13%)
 Frame = +3

Query  168  KVGDYGANTESSVPNSDKQPSDLVAAKSIP----QCENLAPKSIISTASQKNNGPAGEAS  335
            K+GD G    S +P   KQP    A K IP    Q +N   +S++   ++   G   +A 
Sbjct  77   KLGDNG----SGLPTYHKQPPX--AIKKIPLRDVQNDN---RSLLHXHTESEGGSIADAI  127

Query  336  KICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGK  467
            K  G+KR  PDCP +    Q  +SN  N HLVY RRR ++ELGK
Sbjct  128  KTSGTKRLTPDCPQSPPCHQFFSSNGANDHLVYARRRFESELGK  171



>ref|XP_010690232.1| PREDICTED: uncharacterized protein LOC104903811 [Beta vulgaris 
subsp. vulgaris]
Length=293

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 68/131 (52%), Gaps = 33/131 (25%)
 Frame = +3

Query  144  MGQQTADSKVGDY-GANTESSVPNSDKQ---------------PSDLVAAK--SIPQCEN  269
            M QQ  D+K G+    N+E+ +   +KQ                +++VA K  SIP    
Sbjct  1    MAQQEVDTKFGELTSGNSEAGLAGLEKQLPVPLKKTPLRDLQSENNIVAQKGSSIP----  56

Query  270  LAPKSIISTASQKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRP  449
            LA K +  T          EA+K+ G KR +PD P+ S   Q  +S+  NGHLVYVRR+ 
Sbjct  57   LALKEVAIT----------EAAKVSGIKRPSPDSPM-SPHQQSSSSSGANGHLVYVRRKS  105

Query  450  DAELGKSTTSE  482
            +AE GKS+T+E
Sbjct  106  EAETGKSSTNE  116



>ref|XP_010935274.1| PREDICTED: uncharacterized protein LOC105055214 isoform X1 [Elaeis 
guineensis]
Length=339

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 70/136 (51%), Gaps = 8/136 (6%)
 Frame = +3

Query  90   FLLALSPT--SLLSVLRYSQMGQQTADSKVGDYGA-NTESSVPNSDKQ-PSDL--VAAKS  251
             L  +SP+  SL+ +  Y  M QQ  D K  +Y    +  ++P  DKQ P  +  VA + 
Sbjct  25   LLSQVSPSQKSLIWLSCYPPMVQQMID-KFSEYRLLGSGRAMPAGDKQHPISVKKVALRE  83

Query  252  IP-QCENLAPKSIISTASQKNNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHL  428
            +P +  N+  K   ++   K+ G A ++ K+ G KR  PD   N    Q P +   NGHL
Sbjct  84   LPNESRNIITKPPGTSPLPKDKGVAPDSLKVVGIKRPQPDDSSNPSSHQAPGNIGPNGHL  143

Query  429  VYVRRRPDAELGKSTT  476
            VYVRR+ + E GK +T
Sbjct  144  VYVRRKLETEQGKMST  159



>ref|XP_010242892.1| PREDICTED: uncharacterized protein LOC104587121 isoform X1 [Nelumbo 
nucifera]
Length=388

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 60/119 (50%), Gaps = 5/119 (4%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQ---PSDLVAAKSIPQC-ENLAPKSIISTASQK  308
            M +Q  DSK  + G  N        DKQ   P+   A + +      + PK+  ++   K
Sbjct  97   MVKQAIDSKANENGLGNVGPGFHTCDKQHPVPAKKTALRDLQNSYRTVVPKTQGNSPFLK  156

Query  309  NNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSED  485
              GP  +A K+ G+KR +P+ P N    Q  +SN  NGHLVYVRR+ + ELGKS    D
Sbjct  157  EKGPILDAIKVSGNKRPSPEIPPNPPCHQSLSSNGENGHLVYVRRKSELELGKSNVGSD  215



>ref|XP_009373399.1| PREDICTED: uncharacterized protein LOC103962427 [Pyrus x bretschneideri]
Length=279

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (54%), Gaps = 16/114 (14%)
 Frame = +3

Query  144  MGQQTADSKVGDYGANT---ESSVPNSDKQPSDLVAAKSIPQCENLAPKSIISTASQKNN  314
            M QQT DS V +YG  T   ESS+ +  +QP  +   K++ +     PK          +
Sbjct  1    MVQQTIDSIVSEYGMGTTESESSI-HDKRQP--VPVKKTVLRDLQNVPK----------D  47

Query  315  GPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTT  476
             P   A ++ G+KR  P+ P++  Q Q P+S+  N  LVYVRR+ +A+  +++T
Sbjct  48   RPTSNAPRVSGTKRPLPERPMSPPQHQSPSSSPANTQLVYVRRKSEADAVRNST  101



>ref|XP_010935275.1| PREDICTED: uncharacterized protein LOC105055214 isoform X2 [Elaeis 
guineensis]
Length=295

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 60/116 (52%), Gaps = 6/116 (5%)
 Frame = +3

Query  144  MGQQTADSKVGDYGA-NTESSVPNSDKQ-PSDL--VAAKSIP-QCENLAPKSIISTASQK  308
            M QQ  D K  +Y    +  ++P  DKQ P  +  VA + +P +  N+  K   ++   K
Sbjct  1    MVQQMID-KFSEYRLLGSGRAMPAGDKQHPISVKKVALRELPNESRNIITKPPGTSPLPK  59

Query  309  NNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTT  476
            + G A ++ K+ G KR  PD   N    Q P +   NGHLVYVRR+ + E GK +T
Sbjct  60   DKGVAPDSLKVVGIKRPQPDDSSNPSSHQAPGNIGPNGHLVYVRRKLETEQGKMST  115



>ref|XP_008781311.1| PREDICTED: uncharacterized protein LOC103701114 [Phoenix dactylifera]
Length=299

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = +3

Query  144  MGQQTADSKVGDYGANTESSVPNSDKQ-PSDL--VAAKSIP-QCENLAPKSIISTASQKN  311
            M QQ  D   G    ++  ++P  DKQ P  +  VA + +P +  N+  K   ++   K+
Sbjct  1    MVQQMIDKFSGYRLPSSGRAMPAGDKQHPISVKKVALRELPNESRNIITKQPGTSPLPKD  60

Query  312  NGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTT  476
             G    + K  G+KR  PD P +    Q P +   NGHLVYVRR+ + E GK +T
Sbjct  61   KGITPGSVKEVGTKRPQPDDPSSPSSHQAPGNIGPNGHLVYVRRKLETEQGKMST  115



>ref|XP_010028834.1| PREDICTED: uncharacterized protein LOC104419028 [Eucalyptus grandis]
 gb|KCW55663.1| hypothetical protein EUGRSUZ_I01517 [Eucalyptus grandis]
Length=280

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 58/117 (50%), Gaps = 4/117 (3%)
 Frame = +3

Query  144  MGQQTADSK-VGDYGANTESSVPNSDKQPSDLVAAKSIPQCENLAPKSIISTA---SQKN  311
            MGQQ +D K   ++G         S  +PS  VA K+  +      + ++  +   + KN
Sbjct  1    MGQQASDQKYFTEHGHGRSECDLASGNKPSPFVAKKTALRTLQNVNRILVRNSDGSTLKN  60

Query  312  NGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
              P  +  K+ G+KR + +   +   +Q   S + N HLVYVRR+ DAE+GKS   E
Sbjct  61   KVPTVDTVKVSGAKRPSSELLASLPCNQSSPSTAANNHLVYVRRKSDAEIGKSGICE  117



>ref|XP_006384839.1| hypothetical protein POPTR_0004s21510g [Populus trichocarpa]
 gb|ERP62636.1| hypothetical protein POPTR_0004s21510g [Populus trichocarpa]
Length=276

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 66/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  144  MGQQTADSKVGDYG-ANTESSVPNSDKQPSDLVAAKSI--PQCENLAPKSIISTASQKNN  314
            M QQT DSK G++G  N ++++   DK    +V   ++   Q EN  PKS+ ++ S K+ 
Sbjct  1    MVQQTIDSKSGEHGLGNADNNLSIHDKHFPLVVKKTALRDVQNENRIPKSVGNSPSSKDG  60

Query  315  GPAGEASKICGSKR-SNPDC---PVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTTSE  482
            G      K+ G+KR S+ D    PV   +S   TS + N  LVY R + +AE+GK +  E
Sbjct  61   GKTMNGIKVSGAKRPSSEDLMYRPVPCYESS--TSGAPNFRLVYARGKSEAEVGKLSHPE  118

Query  483  D  485
            +
Sbjct  119  E  119



>ref|XP_008812238.1| PREDICTED: uncharacterized protein LOC103723179 isoform X1 [Phoenix 
dactylifera]
Length=300

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 60/116 (52%), Gaps = 6/116 (5%)
 Frame = +3

Query  144  MGQQTADSKVGDYGA-NTESSVPNSDKQPS---DLVAAKSIP-QCENLAPKSIISTASQK  308
            M QQ  D+    YG  ++ S++   DKQ S     VA + +P +  N+  K   ++   K
Sbjct  1    MIQQMVDN-FSKYGMLSSGSAMAAGDKQHSVSVKKVALRELPNESRNIITKPTGTSPLPK  59

Query  309  NNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTT  476
            +     ++ K+ G+KR  PD P +    Q P +   NGHLVYVRR+ + E GK +T
Sbjct  60   DKRLTPDSVKVVGTKRPQPDDPSSPSSHQTPGNIGPNGHLVYVRRKLETEQGKMST  115



>ref|XP_008812245.1| PREDICTED: uncharacterized protein LOC103723179 isoform X2 [Phoenix 
dactylifera]
Length=267

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 60/116 (52%), Gaps = 6/116 (5%)
 Frame = +3

Query  144  MGQQTADSKVGDYGA-NTESSVPNSDKQPS---DLVAAKSIP-QCENLAPKSIISTASQK  308
            M QQ  D+    YG  ++ S++   DKQ S     VA + +P +  N+  K   ++   K
Sbjct  1    MIQQMVDN-FSKYGMLSSGSAMAAGDKQHSVSVKKVALRELPNESRNIITKPTGTSPLPK  59

Query  309  NNGPAGEASKICGSKRSNPDCPVNSLQSQCPTSNSGNGHLVYVRRRPDAELGKSTT  476
            +     ++ K+ G+KR  PD P +    Q P +   NGHLVYVRR+ + E GK +T
Sbjct  60   DKRLTPDSVKVVGTKRPQPDDPSSPSSHQTPGNIGPNGHLVYVRRKLETEQGKMST  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960