BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J03

Length=556
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365366.1|  PREDICTED: salicylic acid-binding protein 2-...    240   5e-76   Solanum tuberosum [potatoes]
ref|NP_001275411.1|  methyl jasmonate esterase                          237   8e-75   Solanum tuberosum [potatoes]
gb|ABY59789.1|  methyl jasmonate esterase                               234   2e-73   Nicotiana attenuata
ref|XP_009773739.1|  PREDICTED: salicylic acid-binding protein 2-...    233   2e-73   Nicotiana sylvestris
ref|NP_001233813.1|  methylesterase                                     232   8e-73   Solanum lycopersicum
ref|XP_009592821.1|  PREDICTED: salicylic acid-binding protein 2-...    230   6e-72   Nicotiana tomentosiformis
ref|XP_004234676.1|  PREDICTED: salicylic acid-binding protein 2-...    229   9e-72   Solanum lycopersicum
ref|XP_010070491.1|  PREDICTED: probable esterase PIR7A                 227   6e-71   Eucalyptus grandis [rose gum]
ref|XP_006365378.1|  PREDICTED: salicylic acid-binding protein 2-...    224   1e-70   Solanum tuberosum [potatoes]
ref|XP_010070490.1|  PREDICTED: probable esterase PIR7A                 225   5e-70   Eucalyptus grandis [rose gum]
ref|XP_010070492.1|  PREDICTED: salicylic acid-binding protein 2-...    223   3e-69   Eucalyptus grandis [rose gum]
ref|XP_010026413.1|  PREDICTED: salicylic acid-binding protein 2-...    223   4e-69   Eucalyptus grandis [rose gum]
ref|XP_002522352.1|  Polyneuridine-aldehyde esterase precursor, p...    220   4e-68   Ricinus communis
ref|XP_010088992.1|  hypothetical protein L484_020275                   219   1e-67   Morus notabilis
gb|KDP31864.1|  hypothetical protein JCGZ_12325                         219   1e-67   Jatropha curcas
emb|CBI18571.3|  unnamed protein product                                214   6e-66   Vitis vinifera
ref|XP_009773740.1|  PREDICTED: methylesterase 3-like isoform X2        214   6e-66   Nicotiana sylvestris
ref|XP_006380732.1|  hypothetical protein POPTR_0007s11750g             213   1e-65   Populus trichocarpa [western balsam poplar]
ref|XP_007047136.1|  Methyl esterase 10, putative                       212   6e-65   
gb|KCW59297.1|  hypothetical protein EUGRSUZ_H01977                     208   2e-64   Eucalyptus grandis [rose gum]
ref|XP_010646596.1|  PREDICTED: salicylic acid-binding protein 2        211   2e-64   
ref|XP_010646594.1|  PREDICTED: salicylic acid-binding protein 2-...    210   4e-64   Vitis vinifera
ref|XP_011039242.1|  PREDICTED: polyneuridine-aldehyde esterase-like    208   1e-63   Populus euphratica
ref|XP_003611830.1|  Esterase PIR7B                                     208   1e-63   Medicago truncatula
ref|XP_010026414.1|  PREDICTED: salicylic acid-binding protein 2-...    207   4e-63   Eucalyptus grandis [rose gum]
gb|AFK39434.1|  unknown                                                 206   2e-62   Medicago truncatula
ref|XP_006590666.1|  PREDICTED: methylesterase 3-like isoform X2        206   2e-62   Glycine max [soybeans]
ref|XP_004511978.1|  PREDICTED: methylesterase 3-like                   204   4e-62   Cicer arietinum [garbanzo]
gb|KDP31865.1|  hypothetical protein JCGZ_12326                         204   4e-62   Jatropha curcas
ref|XP_003611828.1|  Esterase PIR7B                                     204   4e-62   Medicago truncatula
ref|XP_006590665.1|  PREDICTED: methylesterase 3-like isoform X1        202   4e-61   Glycine max [soybeans]
gb|EYU39395.1|  hypothetical protein MIMGU_mgv1a010351mg                202   2e-60   Erythranthe guttata [common monkey flower]
ref|XP_010026417.1|  PREDICTED: probable esterase PIR7A                 199   5e-60   Eucalyptus grandis [rose gum]
ref|XP_007047135.1|  Methyl esterase 10, putative isoform 2             198   1e-59   
ref|XP_010026416.1|  PREDICTED: probable esterase PIR7A                 198   1e-59   Eucalyptus grandis [rose gum]
ref|XP_010026411.1|  PREDICTED: salicylic acid-binding protein 2-...    197   2e-59   Eucalyptus grandis [rose gum]
gb|KDP31866.1|  hypothetical protein JCGZ_12327                         197   4e-59   Jatropha curcas
gb|KDP31871.1|  hypothetical protein JCGZ_12332                         197   5e-59   Jatropha curcas
ref|XP_007047134.1|  Methyl esterase 10, putative isoform 1             197   5e-59   
ref|XP_004288840.1|  PREDICTED: methylesterase 3-like                   196   1e-58   Fragaria vesca subsp. vesca
ref|XP_004300554.1|  PREDICTED: probable esterase PIR7A isoform X1      197   1e-58   Fragaria vesca subsp. vesca
ref|XP_006365368.1|  PREDICTED: salicylic acid-binding protein 2 ...    194   2e-58   
ref|XP_011039240.1|  PREDICTED: salicylic acid-binding protein 2-...    196   5e-58   Populus euphratica
ref|XP_002310759.2|  hypothetical protein POPTR_0007s11740g             195   1e-57   
ref|XP_003611826.1|  Methyl jasmonate esterase                          193   1e-57   Medicago truncatula
ref|XP_007203427.1|  hypothetical protein PRUPE_ppa021591mg             192   2e-57   
ref|XP_004301853.2|  PREDICTED: probable esterase PIR7A                 193   3e-57   Fragaria vesca subsp. vesca
ref|XP_009341927.1|  PREDICTED: probable esterase PIR7A                 193   3e-57   Pyrus x bretschneideri [bai li]
ref|XP_009376503.1|  PREDICTED: probable esterase PIR7A                 193   3e-57   Pyrus x bretschneideri [bai li]
ref|XP_008241566.1|  PREDICTED: methylesterase 3-like                   192   4e-57   Prunus mume [ume]
ref|XP_007203473.1|  hypothetical protein PRUPE_ppa024619mg             191   6e-57   
ref|XP_004234677.1|  PREDICTED: methylesterase 3-like isoform X2        189   1e-56   Solanum lycopersicum
ref|XP_010921786.1|  PREDICTED: probable esterase PIR7A                 192   1e-56   
ref|XP_010026419.1|  PREDICTED: probable esterase PIR7A                 190   2e-56   Eucalyptus grandis [rose gum]
ref|XP_009366272.1|  PREDICTED: salicylic acid-binding protein 2-...    191   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_002310760.1|  hypothetical protein POPTR_0007s11750g             190   2e-56   
ref|XP_008241854.1|  PREDICTED: salicylic acid-binding protein 2-...    190   2e-56   Prunus mume [ume]
ref|XP_007047133.1|  Methyl esterase 3, putative                        190   3e-56   
ref|XP_007204507.1|  hypothetical protein PRUPE_ppa019104mg             189   3e-56   
ref|XP_002522349.1|  Polyneuridine-aldehyde esterase precursor, p...    189   5e-56   Ricinus communis
ref|XP_009366336.1|  PREDICTED: salicylic acid-binding protein 2-...    189   8e-56   
ref|XP_008241567.1|  PREDICTED: salicylic acid-binding protein 2-...    188   2e-55   Prunus mume [ume]
emb|CBI32481.3|  unnamed protein product                                187   2e-55   Vitis vinifera
ref|XP_002284944.1|  PREDICTED: methylesterase 10                       187   2e-55   Vitis vinifera
emb|CBI18572.3|  unnamed protein product                                186   2e-55   Vitis vinifera
ref|XP_008388737.1|  PREDICTED: salicylic acid-binding protein 2-...    188   3e-55   
ref|XP_009391582.1|  PREDICTED: probable esterase PIR7A                 187   3e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010070493.1|  PREDICTED: probable esterase PIR7A                 187   4e-55   Eucalyptus grandis [rose gum]
gb|EYU44348.1|  hypothetical protein MIMGU_mgv1a012023mg                187   4e-55   Erythranthe guttata [common monkey flower]
ref|XP_009791930.1|  PREDICTED: salicylic acid-binding protein 2-...    187   5e-55   Nicotiana sylvestris
ref|XP_002284928.2|  PREDICTED: salicylic acid-binding protein 2        188   5e-55   Vitis vinifera
gb|KJB47436.1|  hypothetical protein B456_008G026500                    187   6e-55   Gossypium raimondii
ref|XP_008236705.1|  PREDICTED: esterase PIR7B-like                     187   9e-55   Prunus mume [ume]
gb|KEH17955.1|  alpha/beta fold hydrolase                               186   1e-54   Medicago truncatula
ref|XP_007202197.1|  hypothetical protein PRUPE_ppa018866mg             185   1e-54   
ref|XP_008241568.1|  PREDICTED: methylesterase 10-like                  186   1e-54   Prunus mume [ume]
ref|XP_007156845.1|  hypothetical protein PHAVU_002G0222000g            182   1e-54   Phaseolus vulgaris [French bean]
emb|CBI32488.3|  unnamed protein product                                185   1e-54   Vitis vinifera
ref|XP_008241857.1|  PREDICTED: LOW QUALITY PROTEIN: methylestera...    185   2e-54   
ref|XP_003626738.1|  Methyl jasmonate esterase                          186   2e-54   
ref|XP_004170642.1|  PREDICTED: LOW QUALITY PROTEIN: methylestera...    185   3e-54   
ref|XP_004137122.1|  PREDICTED: methylesterase 3-like                   185   3e-54   Cucumis sativus [cucumbers]
ref|XP_002284907.3|  PREDICTED: salicylic acid-binding protein 2        185   3e-54   Vitis vinifera
ref|XP_009383535.1|  PREDICTED: probable esterase PIR7A                 185   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004514191.1|  PREDICTED: methylesterase 10-like isoform X1       184   5e-54   Cicer arietinum [garbanzo]
ref|XP_008444767.1|  PREDICTED: salicylic acid-binding protein 2-...    185   5e-54   Cucumis melo [Oriental melon]
ref|XP_008800037.1|  PREDICTED: probable esterase PIR7A                 184   5e-54   
ref|XP_009366348.1|  PREDICTED: salicylic acid-binding protein 2-...    184   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_009366356.1|  PREDICTED: salicylic acid-binding protein 2-...    184   1e-53   Pyrus x bretschneideri [bai li]
gb|KHN01611.1|  Polyneuridine-aldehyde esterase                         182   2e-53   Glycine soja [wild soybean]
ref|XP_007156843.1|  hypothetical protein PHAVU_002G022100g             182   2e-53   Phaseolus vulgaris [French bean]
ref|XP_002284950.3|  PREDICTED: salicylic acid-binding protein 2-...    184   2e-53   
emb|CDO97130.1|  unnamed protein product                                183   2e-53   Coffea canephora [robusta coffee]
ref|XP_004172528.1|  PREDICTED: salicylic acid-binding protein 2-...    183   3e-53   
ref|XP_007199380.1|  hypothetical protein PRUPE_ppa025654mg             182   4e-53   
emb|CBI32472.3|  unnamed protein product                                183   4e-53   Vitis vinifera
ref|XP_008454904.1|  PREDICTED: methylesterase 3-like                   182   4e-53   Cucumis melo [Oriental melon]
ref|XP_003529022.2|  PREDICTED: polyneuridine-aldehyde esterase-like    183   5e-53   Glycine max [soybeans]
ref|XP_008339151.1|  PREDICTED: salicylic acid-binding protein 2-...    182   5e-53   
ref|XP_004514196.1|  PREDICTED: methylesterase 10-like isoform X1       181   6e-53   Cicer arietinum [garbanzo]
ref|XP_004300557.1|  PREDICTED: salicylic acid-binding protein 2-...    182   6e-53   Fragaria vesca subsp. vesca
ref|XP_006346475.1|  PREDICTED: salicylic acid-binding protein 2-...    182   7e-53   Solanum tuberosum [potatoes]
ref|XP_004137124.1|  PREDICTED: salicylic acid-binding protein 2-...    182   1e-52   Cucumis sativus [cucumbers]
ref|XP_008368952.1|  PREDICTED: salicylic acid-binding protein 2-...    181   1e-52   
ref|XP_007200274.1|  hypothetical protein PRUPE_ppa014939mg             181   1e-52   
gb|KDO48824.1|  hypothetical protein CISIN_1g024134mg                   181   1e-52   Citrus sinensis [apfelsine]
pdb|3STY|A  Chain A, Crystal Structure Of Tomato Methylketone Syn...    180   1e-52   Lycopersicon hirsutum f. glabratum
pdb|3STX|A  Chain A, Crystal Structure Of Tomato Methylketone Syn...    180   1e-52   Lycopersicon hirsutum f. glabratum
ref|XP_006346486.1|  PREDICTED: polyneuridine-aldehyde esterase-like    180   2e-52   
ref|XP_009616768.1|  PREDICTED: salicylic acid-binding protein 2-...    181   2e-52   Nicotiana tomentosiformis
gb|ADK38535.1|  methylketone synthase I                                 180   2e-52   Lycopersicon hirsutum f. glabratum
pdb|3STT|A  Chain A, Crystal Structure Of Tomato Methylketone Syn...    180   2e-52   Lycopersicon hirsutum f. glabratum
gb|AAV87156.1|  MKS1                                                    179   2e-52   Lycopersicon hirsutum f. glabratum
gb|KEH17958.1|  alpha/beta fold hydrolase                               180   3e-52   Medicago truncatula
ref|XP_010921788.1|  PREDICTED: probable esterase PIR7A isoform X1      179   3e-52   Elaeis guineensis
ref|XP_004230826.1|  PREDICTED: polyneuridine-aldehyde esterase         179   3e-52   
ref|XP_007042333.1|  Methyl esterase 10, putative isoform 1             180   4e-52   
emb|CAN67986.1|  hypothetical protein VITISV_010770                     187   4e-52   Vitis vinifera
ref|XP_006485625.1|  PREDICTED: methylesterase 1-like                   179   6e-52   Citrus sinensis [apfelsine]
ref|XP_002313085.2|  hypothetical protein POPTR_0009s11070g             179   6e-52   Populus trichocarpa [western balsam poplar]
ref|XP_006346488.1|  PREDICTED: polyneuridine-aldehyde esterase-like    179   6e-52   
ref|XP_008810785.1|  PREDICTED: salicylic acid-binding protein 2-...    179   6e-52   Phoenix dactylifera
ref|XP_007047146.1|  Methyl esterase 10, putative                       178   7e-52   
ref|XP_010918137.1|  PREDICTED: probable esterase PIR7A isoform X1      179   1e-51   
gb|KEH17957.1|  alpha/beta fold hydrolase                               178   1e-51   Medicago truncatula
ref|XP_006425813.1|  hypothetical protein CICLE_v10026284mg             177   2e-51   Citrus clementina [clementine]
ref|XP_006423079.1|  hypothetical protein CICLE_v10028977mg             178   2e-51   Citrus clementina [clementine]
ref|XP_006466663.1|  PREDICTED: salicylic acid-binding protein 2-...    177   2e-51   Citrus sinensis [apfelsine]
ref|XP_006480147.1|  PREDICTED: methylesterase 10-like                  177   2e-51   Citrus sinensis [apfelsine]
ref|XP_002522344.1|  Polyneuridine-aldehyde esterase precursor, p...    177   3e-51   Ricinus communis
ref|XP_006379213.1|  hypothetical protein POPTR_0009s11050g             177   4e-51   
gb|KDP38249.1|  hypothetical protein JCGZ_04892                         177   4e-51   Jatropha curcas
ref|XP_006366937.1|  PREDICTED: polyneuridine-aldehyde esterase-like    176   4e-51   Solanum tuberosum [potatoes]
ref|XP_009616764.1|  PREDICTED: salicylic acid-binding protein 2-...    177   6e-51   
ref|XP_006361568.1|  PREDICTED: polyneuridine-aldehyde esterase-like    176   7e-51   Solanum tuberosum [potatoes]
ref|XP_006425816.1|  hypothetical protein CICLE_v10026277mg             176   7e-51   
ref|XP_006366936.1|  PREDICTED: polyneuridine-aldehyde esterase-like    176   8e-51   Solanum tuberosum [potatoes]
ref|XP_006425815.1|  hypothetical protein CICLE_v10026277mg             176   1e-50   
ref|XP_006466659.1|  PREDICTED: salicylic acid-binding protein 2-...    176   1e-50   Citrus sinensis [apfelsine]
ref|XP_003626737.1|  Methyl jasmonate esterase                          176   1e-50   Medicago truncatula
ref|XP_004231413.1|  PREDICTED: polyneuridine-aldehyde esterase         176   1e-50   
ref|XP_010683183.1|  PREDICTED: salicylic acid-binding protein 2-...    176   1e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002313084.2|  hypothetical protein POPTR_0009s11040g             176   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_008241565.1|  PREDICTED: salicylic acid-binding protein 2-...    176   1e-50   Prunus mume [ume]
ref|XP_009366305.1|  PREDICTED: salicylic acid-binding protein 2-...    175   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_007047147.1|  Methyl esterase 10, putative                       174   2e-50   
ref|XP_009366394.1|  PREDICTED: methylesterase 10                       175   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_004231412.1|  PREDICTED: salicylic acid-binding protein 2-...    175   2e-50   Solanum lycopersicum
ref|XP_007202442.1|  hypothetical protein PRUPE_ppa009951mg             175   2e-50   Prunus persica
gb|KJB40233.1|  hypothetical protein B456_007G052800                    174   2e-50   Gossypium raimondii
ref|XP_010263778.1|  PREDICTED: methylesterase 10-like                  174   3e-50   Nelumbo nucifera [Indian lotus]
ref|XP_007047137.1|  Methyl esterase 1, putative                        174   3e-50   
ref|XP_004288072.2|  PREDICTED: salicylic acid-binding protein 2-...    176   4e-50   Fragaria vesca subsp. vesca
ref|XP_004243297.2|  PREDICTED: methylesterase 10-like                  174   4e-50   
gb|KDO79352.1|  hypothetical protein CISIN_1g024065mg                   174   5e-50   Citrus sinensis [apfelsine]
gb|KDO79350.1|  hypothetical protein CISIN_1g024065mg                   174   5e-50   Citrus sinensis [apfelsine]
gb|KDP38248.1|  hypothetical protein JCGZ_04891                         174   5e-50   Jatropha curcas
gb|EYU44349.1|  hypothetical protein MIMGU_mgv1a012023mg                172   6e-50   Erythranthe guttata [common monkey flower]
ref|XP_004300553.1|  PREDICTED: salicylic acid-binding protein 2-...    174   6e-50   Fragaria vesca subsp. vesca
gb|KHG11847.1|  Polyneuridine-aldehyde esterase                         173   6e-50   Gossypium arboreum [tree cotton]
ref|XP_007042334.1|  Methyl esterase 10, putative isoform 2             172   7e-50   
gb|KDO79351.1|  hypothetical protein CISIN_1g024065mg                   173   7e-50   Citrus sinensis [apfelsine]
ref|NP_001275858.1|  ethylene-induced esterase                          173   7e-50   Citrus sinensis [apfelsine]
ref|XP_009362000.1|  PREDICTED: methylesterase 7-like                   173   8e-50   Pyrus x bretschneideri [bai li]
ref|XP_010030653.1|  PREDICTED: salicylic acid-binding protein 2-...    174   8e-50   Eucalyptus grandis [rose gum]
ref|XP_006436459.1|  hypothetical protein CICLE_v10032394mg             173   9e-50   Citrus clementina [clementine]
ref|XP_004972330.1|  PREDICTED: uncharacterized protein LOC101759641    180   1e-49   
ref|XP_008354686.1|  PREDICTED: salicylic acid-binding protein 2-...    174   1e-49   
ref|XP_008339612.1|  PREDICTED: methylesterase 10                       173   1e-49   
ref|XP_008789941.1|  PREDICTED: probable esterase PIR7A                 173   1e-49   Phoenix dactylifera
ref|XP_002880516.1|  hypothetical protein ARALYDRAFT_320178             172   1e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_004300552.1|  PREDICTED: methylesterase 1-like                   173   2e-49   Fragaria vesca subsp. vesca
ref|XP_009411687.1|  PREDICTED: probable esterase PIR7A                 172   2e-49   
tpg|DAA55951.1|  TPA: esterase PIR7A                                    172   2e-49   
gb|KCW55258.1|  hypothetical protein EUGRSUZ_I01184                     172   3e-49   Eucalyptus grandis [rose gum]
gb|KJB40231.1|  hypothetical protein B456_007G052600                    171   3e-49   Gossypium raimondii
gb|ABR17565.1|  unknown                                                 172   3e-49   Picea sitchensis
gb|ACG44547.1|  esterase PIR7A                                          172   3e-49   Zea mays [maize]
ref|XP_010028516.1|  PREDICTED: salicylic acid-binding protein 2-...    172   3e-49   Eucalyptus grandis [rose gum]
ref|XP_006404849.1|  hypothetical protein EUTSA_v10000533mg             172   4e-49   
ref|XP_010472355.1|  PREDICTED: methylesterase 2-like                   171   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_003518092.1|  PREDICTED: methylesterase 1-like isoform 1         172   4e-49   Glycine max [soybeans]
ref|XP_004514201.1|  PREDICTED: salicylic acid-binding protein 2-...    171   4e-49   
ref|XP_009376487.1|  PREDICTED: salicylic acid-binding protein 2-...    171   5e-49   Pyrus x bretschneideri [bai li]
ref|XP_009366235.1|  PREDICTED: salicylic acid-binding protein 2-...    171   5e-49   Pyrus x bretschneideri [bai li]
ref|XP_006346534.1|  PREDICTED: salicylic acid-binding protein 2-...    171   7e-49   Solanum tuberosum [potatoes]
ref|XP_006346477.1|  PREDICTED: polyneuridine-aldehyde esterase-l...    171   7e-49   Solanum tuberosum [potatoes]
ref|XP_006346489.1|  PREDICTED: polyneuridine-aldehyde esterase-like    171   7e-49   
ref|XP_008241572.1|  PREDICTED: salicylic acid-binding protein 2-...    170   8e-49   Prunus mume [ume]
ref|XP_003626748.1|  Methyl jasmonate esterase                          171   9e-49   Medicago truncatula
ref|XP_010938436.1|  PREDICTED: salicylic acid-binding protein 2-...    171   1e-48   Elaeis guineensis
gb|KJB48505.1|  hypothetical protein B456_008G072700                    170   1e-48   Gossypium raimondii
gb|KHG14261.1|  Polyneuridine-aldehyde esterase                         170   1e-48   Gossypium arboreum [tree cotton]
dbj|BAK00779.1|  predicted protein                                      170   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010908450.1|  PREDICTED: salicylic acid-binding protein 2-...    170   1e-48   Elaeis guineensis
ref|XP_010417104.1|  PREDICTED: methylesterase 2                        170   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009395210.1|  PREDICTED: salicylic acid-binding protein 2-...    170   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011099229.1|  PREDICTED: putative inactive methylesterase 20     168   1e-48   
gb|ABK26277.1|  unknown                                                 170   2e-48   Picea sitchensis
ref|XP_007202390.1|  hypothetical protein PRUPE_ppa009400mg             171   2e-48   Prunus persica
gb|EMT21621.1|  hypothetical protein F775_21482                         169   2e-48   
gb|KJB43606.1|  hypothetical protein B456_007G209500                    169   2e-48   Gossypium raimondii
ref|XP_010315273.1|  PREDICTED: salicylic acid-binding protein 2-...    170   2e-48   Solanum lycopersicum
ref|XP_011099225.1|  PREDICTED: LOW QUALITY PROTEIN: methylestera...    169   2e-48   
ref|XP_010429311.1|  PREDICTED: methylesterase 2-like                   169   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008241563.1|  PREDICTED: salicylic acid-binding protein 2-...    170   2e-48   Prunus mume [ume]
ref|XP_007047144.1|  Salicylic acid-binding protein 2                   169   2e-48   
ref|XP_010255101.1|  PREDICTED: salicylic acid-binding protein 2-...    169   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010030657.1|  PREDICTED: probable esterase PIR7A                 170   3e-48   Eucalyptus grandis [rose gum]
ref|XP_010921787.1|  PREDICTED: probable esterase PIR7A                 170   3e-48   Elaeis guineensis
ref|XP_004300556.1|  PREDICTED: salicylic acid-binding protein 2        166   3e-48   Fragaria vesca subsp. vesca
ref|XP_007204773.1|  hypothetical protein PRUPE_ppa015635mg             169   3e-48   
ref|XP_006346536.1|  PREDICTED: polyneuridine-aldehyde esterase-like    169   3e-48   
ref|XP_004230823.1|  PREDICTED: polyneuridine-aldehyde esterase         171   4e-48   Solanum lycopersicum
gb|EMS52791.1|  hypothetical protein TRIUR3_30970                       169   4e-48   Triticum urartu
ref|NP_179942.1|  methyl esterase 3                                     169   4e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KJB43607.1|  hypothetical protein B456_007G209600                    168   5e-48   Gossypium raimondii
ref|XP_006346473.1|  PREDICTED: polyneuridine-aldehyde esterase-like    170   5e-48   Solanum tuberosum [potatoes]
gb|KDP31868.1|  hypothetical protein JCGZ_12329                         168   6e-48   Jatropha curcas
ref|XP_008454899.1|  PREDICTED: methylesterase 2-like                   170   6e-48   Cucumis melo [Oriental melon]
ref|XP_006436460.1|  hypothetical protein CICLE_v10032396mg             168   6e-48   Citrus clementina [clementine]
ref|XP_009387633.1|  PREDICTED: salicylic acid-binding protein 2-...    169   6e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002263026.3|  PREDICTED: methylesterase 10-like                  169   6e-48   
ref|XP_006294809.1|  hypothetical protein CARUB_v10023861mg             168   6e-48   Capsella rubella
ref|XP_008338217.1|  PREDICTED: salicylic acid-binding protein 2-...    168   7e-48   
ref|XP_008241856.1|  PREDICTED: salicylic acid-binding protein 2-...    169   9e-48   
ref|XP_010908451.1|  PREDICTED: salicylic acid-binding protein 2-...    167   1e-47   Elaeis guineensis
gb|ACU23966.1|  unknown                                                 167   1e-47   Glycine max [soybeans]
ref|XP_006346482.1|  PREDICTED: polyneuridine-aldehyde esterase-like    168   1e-47   Solanum tuberosum [potatoes]
ref|NP_001240864.1|  uncharacterized protein LOC100796281               167   1e-47   Glycine max [soybeans]
emb|CDM82837.1|  unnamed protein product                                167   1e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006590667.1|  PREDICTED: methylesterase 3-like isoform X3        166   1e-47   
ref|XP_004300558.2|  PREDICTED: salicylic acid-binding protein 2-...    167   1e-47   Fragaria vesca subsp. vesca
ref|XP_006359801.1|  PREDICTED: polyneuridine-aldehyde esterase-l...    168   2e-47   Solanum tuberosum [potatoes]
ref|XP_010323708.1|  PREDICTED: salicylic acid-binding protein 2        167   2e-47   
ref|XP_010255102.1|  PREDICTED: methylesterase 10                       167   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_008459227.1|  PREDICTED: salicylic acid-binding protein 2-...    167   2e-47   Cucumis melo [Oriental melon]
emb|CDM82839.1|  unnamed protein product                                167   2e-47   Triticum aestivum [Canadian hard winter wheat]
emb|CAN76442.1|  hypothetical protein VITISV_032921                     173   2e-47   Vitis vinifera
ref|XP_003519919.1|  PREDICTED: salicylic acid-binding protein 2-...    166   3e-47   
ref|XP_004300551.1|  PREDICTED: salicylic acid-binding protein 2-...    166   3e-47   Fragaria vesca subsp. vesca
ref|XP_008241564.1|  PREDICTED: salicylic acid-binding protein 2-...    167   3e-47   
ref|XP_009366326.1|  PREDICTED: salicylic acid-binding protein 2-...    167   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_006346535.1|  PREDICTED: methylesterase 10-like                  167   3e-47   Solanum tuberosum [potatoes]
ref|XP_009791932.1|  PREDICTED: uncharacterized protein LOC104239099    174   3e-47   Nicotiana sylvestris
ref|XP_008459228.1|  PREDICTED: salicylic acid-binding protein 2-...    167   4e-47   
ref|XP_002459047.1|  hypothetical protein SORBIDRAFT_03g045070          166   4e-47   
ref|XP_004142018.1|  PREDICTED: methylesterase 1-like                   166   4e-47   Cucumis sativus [cucumbers]
ref|XP_006346533.1|  PREDICTED: methylesterase 10-like                  166   6e-47   
ref|XP_007155974.1|  hypothetical protein PHAVU_003G248200g             166   6e-47   Phaseolus vulgaris [French bean]
ref|XP_010041541.1|  PREDICTED: salicylic acid-binding protein 2-...    166   7e-47   
ref|XP_010691000.1|  PREDICTED: salicylic acid-binding protein 2-...    166   7e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006360241.1|  PREDICTED: salicylic acid-binding protein 2-...    165   7e-47   Solanum tuberosum [potatoes]
emb|CDM82835.1|  unnamed protein product                                165   8e-47   Triticum aestivum [Canadian hard winter wheat]
ref|NP_179941.1|  methylesterase 2                                      165   8e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AFK45669.1|  unknown                                                 165   8e-47   Lotus japonicus
gb|AAZ32842.1|  methylesterase                                          165   8e-47   Medicago sativa [alfalfa]
ref|XP_006346487.1|  PREDICTED: polyneuridine-aldehyde esterase-like    166   8e-47   Solanum tuberosum [potatoes]
gb|AAM63650.1|  putative acetone-cyanohydrin lyase                      165   9e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KCW59301.1|  hypothetical protein EUGRSUZ_H01982                     164   1e-46   Eucalyptus grandis [rose gum]
ref|XP_006346481.1|  PREDICTED: salicylic acid-binding protein 2-...    166   1e-46   
emb|CDP19577.1|  unnamed protein product                                165   1e-46   Coffea canephora [robusta coffee]
ref|XP_010026418.1|  PREDICTED: probable esterase PIR7A                 164   1e-46   Eucalyptus grandis [rose gum]
ref|XP_006574732.1|  PREDICTED: salicylic acid-binding protein 2-...    165   1e-46   Glycine max [soybeans]
ref|XP_004171121.1|  PREDICTED: salicylic acid-binding protein 2-...    165   1e-46   
ref|XP_006436461.1|  hypothetical protein CICLE_v10033393mg             166   1e-46   
ref|XP_004301856.2|  PREDICTED: probable esterase PIR7A                 165   1e-46   Fragaria vesca subsp. vesca
ref|XP_004971186.1|  PREDICTED: probable esterase PIR7A-like            165   1e-46   Setaria italica
ref|XP_008241562.1|  PREDICTED: methylesterase 10-like                  165   1e-46   Prunus mume [ume]
ref|XP_003635143.2|  PREDICTED: salicylic acid-binding protein 2-...    166   1e-46   
ref|XP_003518102.2|  PREDICTED: salicylic acid-binding protein 2-...    165   1e-46   Glycine max [soybeans]
ref|XP_002270043.1|  PREDICTED: salicylic acid-binding protein 2        165   1e-46   Vitis vinifera
gb|KCW55271.1|  hypothetical protein EUGRSUZ_I01198                     165   2e-46   Eucalyptus grandis [rose gum]
ref|XP_011088755.1|  PREDICTED: probable esterase PIR7A                 165   2e-46   Sesamum indicum [beniseed]
ref|XP_003635144.1|  PREDICTED: methylesterase 10-like                  164   2e-46   Vitis vinifera
ref|XP_008440233.1|  PREDICTED: LOW QUALITY PROTEIN: salicylic ac...    164   2e-46   Cucumis melo [Oriental melon]
ref|NP_179943.1|  methyl esterase 1                                     164   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KGN48493.1|  hypothetical protein Csa_6G490080                       164   2e-46   Cucumis sativus [cucumbers]
gb|AAO22676.1|  putative acetone-cyanohydrin lyase                      164   3e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KCW44286.1|  hypothetical protein EUGRSUZ_L02277                     165   3e-46   
ref|XP_008354234.1|  PREDICTED: salicylic acid-binding protein 2-...    164   3e-46   
ref|XP_008344281.1|  PREDICTED: salicylic acid-binding protein 2-...    164   3e-46   
ref|XP_006365365.1|  PREDICTED: methylesterase 10-like                  164   3e-46   
ref|XP_002880517.1|  hypothetical protein ARALYDRAFT_481229             164   3e-46   
ref|XP_009627967.1|  PREDICTED: methylesterase 10-like isoform X1       164   3e-46   
ref|XP_009117275.1|  PREDICTED: methylesterase 2-like                   164   3e-46   
gb|KHN00599.1|  Polyneuridine-aldehyde esterase                         163   4e-46   
ref|XP_006436236.1|  hypothetical protein CICLE_v10032328mg             164   4e-46   
ref|XP_004141935.1|  PREDICTED: salicylic acid-binding protein 2-...    163   4e-46   
ref|XP_007202467.1|  hypothetical protein PRUPE_ppa010154mg             163   5e-46   
ref|XP_008241571.1|  PREDICTED: LOW QUALITY PROTEIN: salicylic ac...    163   5e-46   
gb|KDO79353.1|  hypothetical protein CISIN_1g024065mg                   163   5e-46   
ref|XP_004171120.1|  PREDICTED: salicylic acid-binding protein 2-...    163   5e-46   
ref|XP_007202449.1|  hypothetical protein PRUPE_ppa010011mg             163   5e-46   
ref|XP_006346480.1|  PREDICTED: methylesterase 10-like                  164   5e-46   
emb|CBI18568.3|  unnamed protein product                                164   5e-46   
emb|CDP10786.1|  unnamed protein product                                163   6e-46   
ref|XP_010417105.1|  PREDICTED: methylesterase 1                        163   6e-46   
ref|XP_002459051.1|  hypothetical protein SORBIDRAFT_03g045110          163   8e-46   
ref|XP_004952293.1|  PREDICTED: probable esterase PIR7A-like            163   8e-46   
gb|KGN48491.1|  hypothetical protein Csa_6G490060                       162   8e-46   
ref|XP_004167289.1|  PREDICTED: salicylic acid-binding protein 2-...    162   8e-46   
ref|XP_002522346.1|  Polyneuridine-aldehyde esterase precursor, p...    162   8e-46   
ref|XP_004142017.1|  PREDICTED: salicylic acid-binding protein 2-...    162   9e-46   
ref|XP_007203120.1|  hypothetical protein PRUPE_ppa023987mg             162   9e-46   
gb|KHN13365.1|  Polyneuridine-aldehyde esterase                         162   1e-45   
ref|XP_003568595.1|  PREDICTED: probable esterase PIR7A                 162   1e-45   
ref|XP_008440234.1|  PREDICTED: salicylic acid-binding protein 2-...    162   1e-45   
ref|XP_009616767.1|  PREDICTED: salicylic acid-binding protein 2-...    163   1e-45   
gb|EYU44351.1|  hypothetical protein MIMGU_mgv1a012379mg                162   1e-45   
ref|XP_009140475.1|  PREDICTED: methylesterase 1                        162   1e-45   
ref|XP_004153671.1|  PREDICTED: salicylic acid-binding protein 2-...    162   2e-45   
ref|XP_004161629.1|  PREDICTED: salicylic acid-binding protein 2-...    162   2e-45   
ref|NP_001168858.1|  uncharacterized protein LOC100382663               162   2e-45   
dbj|BAJ99976.1|  predicted protein                                      162   2e-45   
emb|CDY38958.1|  BnaA04g13790D                                          162   2e-45   
ref|XP_002522351.1|  conserved hypothetical protein                     160   3e-45   
ref|XP_003626749.1|  Methyl jasmonate esterase                          159   3e-45   
gb|KEH17956.1|  alpha/beta fold hydrolase                               160   3e-45   
gb|KEH34282.1|  alpha/beta fold hydrolase                               161   4e-45   
gb|EPS73771.1|  acetone-cyanohydrin lyase                               160   4e-45   
gb|EYU44355.1|  hypothetical protein MIMGU_mgv1a011959mg                161   4e-45   
ref|XP_007155975.1|  hypothetical protein PHAVU_003G248300g             161   5e-45   
emb|CDX76856.1|  BnaC08g34420D                                          160   5e-45   
ref|XP_009387635.1|  PREDICTED: methylesterase 3-like                   160   6e-45   
ref|XP_010547512.1|  PREDICTED: methylesterase 10                       160   7e-45   
ref|XP_002880515.1|  hypothetical protein ARALYDRAFT_481226             160   7e-45   
gb|KJB40232.1|  hypothetical protein B456_007G052700                    160   8e-45   
ref|XP_003566319.1|  PREDICTED: probable esterase PIR7A                 160   8e-45   
ref|XP_009619949.1|  PREDICTED: probable esterase PIR7A                 160   1e-44   
ref|NP_001237816.1|  uncharacterized protein LOC100527557               159   1e-44   
ref|XP_009388334.1|  PREDICTED: methylesterase 3-like                   160   1e-44   
ref|XP_004142015.1|  PREDICTED: salicylic acid-binding protein 2-...    160   1e-44   
ref|XP_004234674.1|  PREDICTED: methylesterase 10 isoform X1            160   1e-44   
ref|XP_008394304.1|  PREDICTED: salicylic acid-binding protein 2-...    159   1e-44   
ref|XP_006425817.1|  hypothetical protein CICLE_v10026307mg             159   1e-44   
ref|XP_009388333.1|  PREDICTED: salicylic acid-binding protein 2-...    159   1e-44   
gb|KFK32714.1|  hypothetical protein AALP_AA6G279000                    159   2e-44   
ref|XP_002459048.1|  hypothetical protein SORBIDRAFT_03g045080          160   2e-44   
gb|KDO48825.1|  hypothetical protein CISIN_1g030815mg                   156   2e-44   
ref|XP_006295962.1|  hypothetical protein CARUB_v10025104mg             159   2e-44   
ref|XP_010429312.1|  PREDICTED: methylesterase 1-like                   159   2e-44   
ref|XP_008440235.1|  PREDICTED: methylesterase 10                       159   2e-44   
ref|XP_004141931.1|  PREDICTED: methylesterase 10-like                  159   2e-44   
ref|XP_004246309.1|  PREDICTED: polyneuridine-aldehyde esterase-like    159   2e-44   
gb|KJB43605.1|  hypothetical protein B456_007G209500                    157   3e-44   
gb|EMS60437.1|  hypothetical protein TRIUR3_33313                       161   3e-44   
ref|XP_011099230.1|  PREDICTED: salicylic acid-binding protein 2-...    159   3e-44   
ref|XP_002310756.2|  hypothetical protein POPTR_0007s11680g             159   4e-44   
ref|XP_006360243.1|  PREDICTED: salicylic acid-binding protein 2-...    158   4e-44   
ref|XP_008361380.1|  PREDICTED: salicylic acid-binding protein 2-...    158   4e-44   
gb|AGT17094.1|  esterase PIR7A-like protein                             159   4e-44   
ref|XP_010437282.1|  PREDICTED: methylesterase 9-like                   158   4e-44   
emb|CDX75612.1|  BnaA01g00900D                                          158   4e-44   
ref|XP_009616765.1|  PREDICTED: salicylic acid-binding protein 2-...    159   4e-44   
ref|XP_011039232.1|  PREDICTED: salicylic acid-binding protein 2-...    159   4e-44   
gb|AFP53828.1|  salicylic acid-binding protein 2                        158   4e-44   
gb|KHG11848.1|  Polyneuridine-aldehyde esterase                         158   5e-44   
ref|NP_001045314.1|  Os01g0934700                                       158   5e-44   
ref|XP_002310754.2|  Chain A family protein                             158   6e-44   
ref|XP_003518109.1|  PREDICTED: salicylic acid-binding protein 2-...    157   7e-44   
emb|CDX69262.1|  BnaC01g01910D                                          157   8e-44   
gb|AFP53829.1|  salicylic acid-binding protein 2                        157   8e-44   
ref|XP_004301859.1|  PREDICTED: salicylic acid-binding protein 2-...    157   8e-44   
ref|XP_007151829.1|  hypothetical protein PHAVU_004G078700g             157   8e-44   
gb|AGV54684.1|  polyneuridine-aldehyde esterase                         157   8e-44   
ref|XP_011039235.1|  PREDICTED: salicylic acid-binding protein 2-...    157   1e-43   
sp|A2WYS8.2|PIR7A_ORYSI  RecName: Full=Probable esterase PIR7A          157   1e-43   
ref|XP_008674949.1|  PREDICTED: salicylic acid-binding protein 2-...    157   1e-43   
ref|XP_009140147.1|  PREDICTED: methylesterase 9-like                   157   1e-43   
ref|XP_009376486.1|  PREDICTED: salicylic acid-binding protein 2-...    157   1e-43   
ref|XP_010028313.1|  PREDICTED: salicylic acid-binding protein 2-...    157   2e-43   
gb|ACJ84705.1|  unknown                                                 156   2e-43   
ref|XP_010432108.1|  PREDICTED: methylesterase 9-like                   156   2e-43   
ref|XP_004509183.1|  PREDICTED: methylesterase 1-like                   156   2e-43   
emb|CDP19578.1|  unnamed protein product                                156   2e-43   
ref|XP_008655980.1|  PREDICTED: methylesterase 7-like                   156   3e-43   
gb|EEC72109.1|  hypothetical protein OsI_05084                          156   3e-43   
gb|KEH20488.1|  methylesterase                                          156   3e-43   
gb|KFK30342.1|  hypothetical protein AALP_AA7G249100                    155   3e-43   
tpg|DAA55949.1|  TPA: esterase PIR7B                                    162   3e-43   
ref|XP_007047142.1|  Methyl esterase 6, putative                        156   3e-43   
pdb|3GZJ|A  Chain A, Crystal Structure Of Polyneuridine Aldehyde ...    155   4e-43   
emb|CDP11927.1|  unnamed protein product                                155   4e-43   
ref|XP_004233421.1|  PREDICTED: salicylic acid-binding protein 2        155   4e-43   
gb|ACU18956.1|  unknown                                                 155   5e-43   
gb|KFK32713.1|  hypothetical protein AALP_AA6G278900                    155   5e-43   
pdb|2WFM|A  Chain A, Crystal Structure Of Polyneuridine Aldehyde ...    155   5e-43   
ref|XP_011099228.1|  PREDICTED: salicylic acid-binding protein 2-...    155   6e-43   
pdb|2WFL|A  Chain A, Crystal Structure Of Polyneuridine Aldehyde ...    155   6e-43   
pdb|2WFL|B  Chain B, Crystal Structure Of Polyneuridine Aldehyde ...    155   6e-43   
sp|Q9SE93.1|PNAE_RAUSE  RecName: Full=Polyneuridine-aldehyde este...    155   6e-43   
ref|XP_010028309.1|  PREDICTED: salicylic acid-binding protein 2-...    155   8e-43   
gb|AGV54148.1|  polyneuridine-aldehyde esterase                         155   8e-43   
ref|XP_002869010.1|  hypothetical protein ARALYDRAFT_912657             155   8e-43   
ref|XP_010921789.1|  PREDICTED: esterase PIR7B-like isoform X2          154   9e-43   
ref|XP_004968917.1|  PREDICTED: methylesterase 3-like                   155   1e-42   
ref|XP_002877747.1|  hypothetical protein ARALYDRAFT_348153             154   1e-42   
ref|XP_009618934.1|  PREDICTED: salicylic acid-binding protein 2        154   1e-42   
ref|XP_002519157.1|  alpha/beta hydrolase, putative                     155   1e-42   
ref|XP_010028312.1|  PREDICTED: salicylic acid-binding protein 2-...    154   2e-42   
ref|XP_002310168.2|  Chain A family protein                             153   2e-42   
ref|XP_004233422.1|  PREDICTED: salicylic acid-binding protein 2-...    154   2e-42   
ref|XP_006851246.1|  hypothetical protein AMTR_s00180p00034130          154   2e-42   
gb|AGV54480.1|  polyneuridine-aldehyde esterase-like protein            154   2e-42   
emb|CAA84025.1|  Pir7a                                                  154   2e-42   
ref|XP_004234906.1|  PREDICTED: salicylic acid-binding protein 2        154   2e-42   
ref|XP_006380730.1|  hypothetical protein POPTR_0007s11690g             154   2e-42   
ref|XP_002310757.2|  Chain A family protein                             154   2e-42   
ref|XP_010680459.1|  PREDICTED: salicylic acid-binding protein 2-...    154   2e-42   
ref|XP_006346532.1|  PREDICTED: LOW QUALITY PROTEIN: probable est...    154   3e-42   
ref|XP_008810786.1|  PREDICTED: polyneuridine-aldehyde esterase-l...    152   3e-42   
ref|XP_007151830.1|  hypothetical protein PHAVU_004G078800g             153   3e-42   
ref|XP_011099841.1|  PREDICTED: salicylic acid-binding protein 2-...    153   3e-42   
ref|XP_006363634.1|  PREDICTED: salicylic acid-binding protein 2-...    153   4e-42   
ref|XP_002316717.1|  Chain A family protein                             152   4e-42   
ref|XP_009366292.1|  PREDICTED: polyneuridine-aldehyde esterase-like    149   4e-42   
ref|XP_006425814.1|  hypothetical protein CICLE_v10027442mg             152   6e-42   
ref|XP_003565021.1|  PREDICTED: probable esterase PIR7A                 153   6e-42   
ref|XP_006346476.1|  PREDICTED: polyneuridine-aldehyde esterase-like    149   8e-42   
ref|XP_004514192.1|  PREDICTED: methylesterase 10-like isoform X2       151   8e-42   
ref|XP_010026410.1|  PREDICTED: methylesterase 10-like                  152   8e-42   
ref|XP_010028311.1|  PREDICTED: salicylic acid-binding protein 2-...    152   8e-42   
ref|XP_006404029.1|  hypothetical protein EUTSA_v10010606mg             153   9e-42   
ref|XP_003567442.1|  PREDICTED: probable esterase PIR7A                 152   1e-41   
ref|XP_006294757.1|  hypothetical protein CARUB_v10023802mg             152   1e-41   
ref|XP_010028307.1|  PREDICTED: salicylic acid-binding protein 2-...    152   1e-41   
ref|XP_002459046.1|  hypothetical protein SORBIDRAFT_03g045060          151   1e-41   
ref|XP_002522350.1|  Polyneuridine-aldehyde esterase precursor, p...    149   1e-41   
ref|XP_006360242.1|  PREDICTED: salicylic acid-binding protein 2-...    152   1e-41   
ref|XP_002981647.1|  hypothetical protein SELMODRAFT_114920             151   1e-41   
ref|XP_009765140.1|  PREDICTED: salicylic acid-binding protein 2        151   1e-41   
ref|XP_002967870.1|  hypothetical protein SELMODRAFT_88885              151   1e-41   
tpg|DAA57313.1|  TPA: hypothetical protein ZEAMMB73_863808              157   1e-41   
emb|CDY23008.1|  BnaC07g31790D                                          152   2e-41   
ref|XP_010911539.1|  PREDICTED: LOW QUALITY PROTEIN: esterase PIR...    147   2e-41   
gb|KDP31869.1|  hypothetical protein JCGZ_12330                         151   2e-41   
ref|XP_011039236.1|  PREDICTED: salicylic acid-binding protein 2-...    151   2e-41   
ref|XP_011039239.1|  PREDICTED: salicylic acid-binding protein 2-...    151   2e-41   
ref|NP_179940.1|  methyl esterase 8                                     151   2e-41   
ref|NP_001055352.1|  Os05g0370700                                       152   2e-41   
gb|ACH63241.1|  ethylene esterase-like protein                          151   2e-41   
gb|EMT17765.1|  hypothetical protein F775_21190                         151   3e-41   
ref|XP_011099232.1|  PREDICTED: salicylic acid-binding protein 2-...    151   3e-41   
ref|XP_007200132.1|  hypothetical protein PRUPE_ppa017362mg             151   3e-41   
ref|XP_006380731.1|  hypothetical protein POPTR_0007s11700g             150   3e-41   
ref|XP_009785809.1|  PREDICTED: methylesterase 10-like                  148   3e-41   
sp|Q6RYA0.1|SABP2_TOBAC  RecName: Full=Salicylic acid-binding pro...    150   3e-41   
ref|XP_002440986.1|  hypothetical protein SORBIDRAFT_09g018440          151   4e-41   
ref|XP_011039237.1|  PREDICTED: salicylic acid-binding protein 2-...    150   4e-41   
ref|XP_003567195.2|  PREDICTED: salicylic acid-binding protein 2-...    151   4e-41   
emb|CDY02084.1|  BnaA03g40830D                                          150   4e-41   
ref|XP_004514197.1|  PREDICTED: methylesterase 10-like isoform X2       149   4e-41   
ref|XP_002307245.1|  Chain A family protein                             150   4e-41   
gb|EYU44350.1|  hypothetical protein MIMGU_mgv1a019096mg                149   6e-41   
ref|XP_006404841.1|  hypothetical protein EUTSA_v10000611mg             150   6e-41   
ref|XP_006285859.1|  hypothetical protein CARUB_v10007354mg             150   7e-41   
ref|XP_002455771.1|  hypothetical protein SORBIDRAFT_03g024830          150   7e-41   
emb|CDP02455.1|  unnamed protein product                                150   7e-41   
ref|XP_002459049.1|  hypothetical protein SORBIDRAFT_03g045090          150   7e-41   
ref|XP_008676140.1|  PREDICTED: probable esterase PIR7A                 150   8e-41   
ref|XP_010028310.1|  PREDICTED: salicylic acid-binding protein 2-...    149   8e-41   
gb|KCW55024.1|  hypothetical protein EUGRSUZ_I00998                     149   8e-41   
ref|XP_011039238.1|  PREDICTED: salicylic acid-binding protein 2-...    149   9e-41   
ref|XP_006411942.1|  hypothetical protein EUTSA_v10026033mg             149   9e-41   
gb|EAY80986.1|  hypothetical protein OsI_36167                          150   1e-40   
ref|XP_007047141.1|  Methyl esterase 3, putative                        149   1e-40   
ref|XP_004167288.1|  PREDICTED: methylesterase 1-like                   149   1e-40   
emb|CAB62473.1|  putative protein                                       149   1e-40   
gb|AFS35576.1|  salicylic acid-binding protein 2                        149   1e-40   
ref|XP_010472352.1|  PREDICTED: methylesterase 4-like                   149   1e-40   
ref|XP_010028306.1|  PREDICTED: salicylic acid-binding protein 2-...    149   1e-40   
gb|KFK34293.1|  hypothetical protein AALP_AA5G126400                    149   1e-40   
ref|XP_011009267.1|  PREDICTED: methylesterase 8-like                   148   2e-40   
ref|XP_010028304.1|  PREDICTED: salicylic acid-binding protein 2-...    150   2e-40   
gb|EMT18213.1|  hypothetical protein F775_13834                         149   2e-40   
ref|XP_006291682.1|  hypothetical protein CARUB_v10017842mg             149   2e-40   
gb|EEC79085.1|  hypothetical protein OsI_19694                          149   2e-40   
emb|CDM82846.1|  unnamed protein product                                149   2e-40   
ref|XP_008779522.1|  PREDICTED: polyneuridine-aldehyde esterase-like    145   2e-40   
ref|XP_004962289.1|  PREDICTED: esterase PIR7B-like                     149   2e-40   
emb|CDP19580.1|  unnamed protein product                                148   3e-40   
ref|XP_006843726.1|  hypothetical protein AMTR_s00007p00221390          148   3e-40   
pir||T02428  probable (S)-acetone-cyanohydrin lyase - Arabidopsis...    144   3e-40
ref|XP_010472356.1|  PREDICTED: methylesterase 1-like                   148   4e-40   
ref|XP_010088988.1|  hypothetical protein L484_020271                   149   4e-40   
ref|XP_010515405.1|  PREDICTED: methylesterase 10                       148   4e-40   
ref|NP_179937.1|  methyl esterase 7                                     147   5e-40   
gb|AFK45222.1|  unknown                                                 147   5e-40   
ref|XP_010918139.1|  PREDICTED: esterase PIR7B-like isoform X2          147   7e-40   
ref|XP_010548386.1|  PREDICTED: methylesterase 1-like                   147   7e-40   
gb|ABK21272.1|  unknown                                                 147   7e-40   
gb|KCW55017.1|  hypothetical protein EUGRSUZ_I00991                     147   7e-40   
gb|EMT05820.1|  hypothetical protein F775_20033                         147   7e-40   
ref|XP_010426589.1|  PREDICTED: methylesterase 10-like                  147   8e-40   
ref|XP_004142016.1|  PREDICTED: methylesterase 2-like                   143   8e-40   
ref|XP_010028305.1|  PREDICTED: salicylic acid-binding protein 2-...    147   9e-40   
ref|XP_006842541.1|  hypothetical protein AMTR_s00077p00129560          147   1e-39   
ref|XP_003611833.1|  Polyneuridine-aldehyde esterase                    147   1e-39   
ref|XP_009137080.1|  PREDICTED: LOW QUALITY PROTEIN: methylestera...    147   1e-39   



>ref|XP_006365366.1| PREDICTED: salicylic acid-binding protein 2-like [Solanum tuberosum]
Length=262

 Score =   240 bits (613),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 139/173 (80%), Gaps = 3/173 (2%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             K HFVLVHGACHGAWCWYKV  +LR+EGHKVS LDMAASGI+PK  E ++SMA+YNEPL
Sbjct  5    NKNHFVLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGINPKHVEDLNSMADYNEPL  64

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             EFM +LP  E+VVLVGHS+GG+N+SLAME FPHKI VAVFVTA M GPDL+F+A+ Q++
Sbjct  65   MEFMNSLPQQERVVLVGHSMGGINISLAMEKFPHKIVVAVFVTAFMPGPDLNFVALSQQY  124

Query  406  HRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++Q+ES+MD +  Y    E  P S++FG ++L    YQLSPPEDLTLA  LVR
Sbjct  125  NQQVESHMDTEFVYNNGLEKCPTSLVFGPKVLATNFYQLSPPEDLTLATYLVR  177



>ref|NP_001275411.1| methyl jasmonate esterase [Solanum tuberosum]
 gb|AAV87151.1| methyl jasmonate esterase [Solanum tuberosum]
Length=262

 Score =   237 bits (605),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 137/173 (79%), Gaps = 3/173 (2%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             K HFVLVHGACHGAWCWYKV  +LR+EGHKVS LDMAASGI+PK  E ++SMA+YNEPL
Sbjct  5    NKNHFVLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGINPKHVEDLNSMADYNEPL  64

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             EFM +LP  E+VVLVGHS+GG+N+SLAME FPHKI+VAVFV+ASM GPDL+ +AV Q++
Sbjct  65   MEFMNSLPQQERVVLVGHSMGGINISLAMEKFPHKIAVAVFVSASMPGPDLNLVAVTQQY  124

Query  406  HRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +Q+E+ MD +  Y    +  P SV+ G ++L  + YQ SPPEDLTLA  LVR
Sbjct  125  SQQVETPMDTEFVYNNGLDKGPTSVVLGPKVLATIYYQFSPPEDLTLATYLVR  177



>gb|ABY59789.1| methyl jasmonate esterase [Nicotiana attenuata]
Length=262

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 136/173 (79%), Gaps = 3/173 (2%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            +  HFVLVHGACHGAWCWYKV  +LRAEGHKVS LDMAASGIHPK  E+++SMAEYNEPL
Sbjct  5    KNHHFVLVHGACHGAWCWYKVVTILRAEGHKVSVLDMAASGIHPKRTEELNSMAEYNEPL  64

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             EF+A LP  E+VVLVGHS+GG+N+SLAME FP KI VAVFVTA M GP+L  +A+ Q++
Sbjct  65   IEFLANLPQEERVVLVGHSMGGINISLAMEMFPQKICVAVFVTAFMPGPNLDIVAISQQY  124

Query  406  HRQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++Q+ES+MD +  Y   +E  P S+L G ++L    YQLSP EDLTLA  LVR
Sbjct  125  NQQVESHMDTEFVYSNGQEKGPTSLLLGPKVLATNFYQLSPAEDLTLATYLVR  177



>ref|XP_009773739.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Nicotiana 
sylvestris]
Length=262

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 136/173 (79%), Gaps = 3/173 (2%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            +  HFVLVHGACHGAWCWYKV  +LRAEGHKVS  DMAASGIHPK  E+++SMAEYNEPL
Sbjct  5    KNHHFVLVHGACHGAWCWYKVVTILRAEGHKVSVPDMAASGIHPKHTEELNSMAEYNEPL  64

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             EFMA +   E+VVLVGHS+GG+N+SLAME FP KI VAVFVTA M GPDL+ +A+ Q++
Sbjct  65   MEFMANVSQEERVVLVGHSMGGINISLAMEMFPQKICVAVFVTAFMPGPDLNIVAISQQY  124

Query  406  HRQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++Q+ES+MD +  Y   +E  P S+LFG E+L    YQLSP EDLTLA  LVR
Sbjct  125  NQQVESHMDTEFVYNNGQEKGPTSLLFGPEVLATNFYQLSPSEDLTLATYLVR  177



>ref|NP_001233813.1| methylesterase [Solanum lycopersicum]
 gb|AAS10488.1| methylesterase [Solanum lycopersicum]
Length=262

 Score =   232 bits (592),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 137/172 (80%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            K HFVLVHGACHGAWCWYKV  +LR+EGHKVS LDMAASGI+PK  + ++SMA+YNEPL 
Sbjct  6    KNHFVLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGINPKHVDDLNSMADYNEPLM  65

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFM +LP  E+VVLVGHS+GG+N+SLAME FP KI VAVFVTA M GPDL+ +A+ Q+++
Sbjct  66   EFMNSLPQLERVVLVGHSMGGINISLAMEKFPQKIVVAVFVTAFMPGPDLNLVALGQQYN  125

Query  409  RQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +Q+ES+MD +  Y   ++  P S++ G E+L    YQLSPPEDLTLA  LVR
Sbjct  126  QQVESHMDTEFVYNNGQDKAPTSLVLGPEVLATNFYQLSPPEDLTLATYLVR  177



>ref|XP_009592821.1| PREDICTED: salicylic acid-binding protein 2-like [Nicotiana tomentosiformis]
Length=262

 Score =   230 bits (586),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 134/173 (77%), Gaps = 3/173 (2%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            +  HFVLVHGACHGAWCWYKV  +LRAEGH+VS  DMAASGIHPK  E+++SMAEYNEPL
Sbjct  5    KSHHFVLVHGACHGAWCWYKVVTILRAEGHRVSVFDMAASGIHPKHTEELNSMAEYNEPL  64

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             EFMA LP  E+VVLVGHS+GG+N+SLAME FP KI VAVFVTA M GP+L  +A+  ++
Sbjct  65   IEFMANLPQEERVVLVGHSMGGINISLAMEMFPQKICVAVFVTAFMPGPNLDIVAISLQY  124

Query  406  HRQLESNMDQKTEYKEDR---PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++Q+ES+MD +  Y   +   P S+LFG ++L    YQLSP EDLTLA  LVR
Sbjct  125  NQQVESHMDTEFVYNNGQKKGPTSLLFGPKVLATNFYQLSPAEDLTLASYLVR  177



>ref|XP_004234676.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Solanum 
lycopersicum]
Length=262

 Score =   229 bits (585),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 133/172 (77%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            K HF+LVHGACHGAWCWYKV  +LR+EGHKVS LDMAASGI+PK    ++SMA+YNEPL 
Sbjct  6    KNHFLLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGINPKHVNDLNSMADYNEPLM  65

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFM +LP  E+VVLVGHS+GG+N+SLAME FP KI+VAVFVTASM GPDL+ +AV Q++ 
Sbjct  66   EFMNSLPQQERVVLVGHSLGGINISLAMEKFPQKIAVAVFVTASMPGPDLNIVAVTQQYS  125

Query  409  RQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             Q+E+ MD +  Y    +  P S++ G + L  + YQ SPPEDLTLA  LVR
Sbjct  126  EQVEAPMDTEFVYNNGLDKTPTSLVLGPKDLATIFYQYSPPEDLTLATYLVR  177



>ref|XP_010070491.1| PREDICTED: probable esterase PIR7A [Eucalyptus grandis]
 gb|KCW59295.1| hypothetical protein EUGRSUZ_H01976 [Eucalyptus grandis]
Length=265

 Score =   227 bits (579),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 133/174 (76%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ER+KHFVLVHGACHGAWCWYKVA LL++ GHK +ALDMAA+G+HPK A +++S+ EY EP
Sbjct  7    EREKHFVLVHGACHGAWCWYKVATLLKSSGHKATALDMAAAGVHPKQARELNSIVEYVEP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF   LP GEKV+LVGHS+GGV +SLAME FP KI+VAVFV A M+GP+LS   V +E
Sbjct  67   LFEFFEGLPRGEKVILVGHSMGGVVISLAMERFPEKIAVAVFVAAIMYGPELSVETVYEE  126

Query  403  FHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + R+L+S+MD K  +    E  P S LFG+  +   +YQLSPPEDLTLA  L R
Sbjct  127  YGRRLDSSMDTKYAFDDGPEKPPTSFLFGYNFMASKLYQLSPPEDLTLASYLAR  180



>ref|XP_006365378.1| PREDICTED: salicylic acid-binding protein 2-like [Solanum tuberosum]
Length=176

 Score =   224 bits (570),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 128/158 (81%), Gaps = 3/158 (2%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             K HFVLVHGACHGAWCWYKV  +LR+EGHKVS LDMAASGIHPK  E ++SMA+YNEPL
Sbjct  5    NKNHFVLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGIHPKHVEDLNSMADYNEPL  64

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             EFM +LP  E+VVLVGHS+GG+N+SLAME FPHKI+VAVFVTASM GPDL+ +AV Q++
Sbjct  65   MEFMNSLPQQERVVLVGHSLGGINISLAMEKFPHKIAVAVFVTASMPGPDLNLVAVTQQY  124

Query  406  HRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQ  510
             +Q+ES+MD +  Y    E  P SV+ G ++LE ++YQ
Sbjct  125  SQQVESHMDTEFVYNNGLEKGPTSVVLGPKVLETIIYQ  162



>ref|XP_010070490.1| PREDICTED: probable esterase PIR7A [Eucalyptus grandis]
 gb|KCW59292.1| hypothetical protein EUGRSUZ_H01973 [Eucalyptus grandis]
Length=265

 Score =   225 bits (573),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 132/174 (76%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ER+KHFVLVHGACHGAWCWYKVA LL++ GHK +ALDMAA+G+HPK  ++++S+ EY EP
Sbjct  7    EREKHFVLVHGACHGAWCWYKVATLLKSSGHKATALDMAAAGVHPKQPQELNSIVEYVEP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF   LP GEKV+LVGHS+GGV +SLAME FP KI+VAVFV A M+GP+LSF  V +E
Sbjct  67   LFEFFEGLPRGEKVILVGHSMGGVVISLAMERFPEKIAVAVFVAAFMYGPELSFETVYEE  126

Query  403  FHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              R+L+S MD K  +    E  P S LFG+  +   +YQLSPPEDLTLA  L R
Sbjct  127  HVRRLDSFMDTKYAFDDGPEKPPTSFLFGYNFMASKLYQLSPPEDLTLASYLAR  180



>ref|XP_010070492.1| PREDICTED: salicylic acid-binding protein 2-like [Eucalyptus 
grandis]
 gb|KCW59296.1| hypothetical protein EUGRSUZ_H01977 [Eucalyptus grandis]
Length=265

 Score =   223 bits (568),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 131/174 (75%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ER+KHFVLVHGACHGAWCWYKVA LL++ GHKV+ALDMA +G+HPK    ++S+ EY EP
Sbjct  7    EREKHFVLVHGACHGAWCWYKVATLLKSSGHKVTALDMATAGVHPKQPRDLNSIVEYVEP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF   LP GEKV+LVGHS GGV +SLA+E FP KI+VAVF+ A M+GP+LS  +V +E
Sbjct  67   LFEFFEGLPRGEKVILVGHSFGGVVISLAIERFPEKIAVAVFLAAFMYGPELSVTSVVEE  126

Query  403  FHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + R+L S+MD K  +    E  P S LFG+  +   +YQLSPPEDLTLA  LVR
Sbjct  127  YGRRLGSSMDTKYAFDDGPEKPPTSFLFGYNFMASKLYQLSPPEDLTLASYLVR  180



>ref|XP_010026413.1| PREDICTED: salicylic acid-binding protein 2-like [Eucalyptus 
grandis]
 gb|KCW59299.1| hypothetical protein EUGRSUZ_H01980 [Eucalyptus grandis]
Length=265

 Score =   223 bits (567),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 134/176 (76%), Gaps = 7/176 (4%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ER+KHFVLVHGACHGAWCWYKVA LL + GHKV+ALDMAASG+HPK   +++S+ EY +P
Sbjct  7    EREKHFVLVHGACHGAWCWYKVATLLESSGHKVTALDMAASGVHPKQPRELNSIVEYVDP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF   LP GEKV+LVGHS+GG+ +S+AME FP KI+VAVFV A M+GP LS  +V +E
Sbjct  67   LFEFFEGLPQGEKVILVGHSMGGIVISMAMEKFPEKIAVAVFVAAFMYGPKLSVTSVIEE  126

Query  403  FHRQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + R+L+S MD  TEY  D      P ++LFG+  +   +YQLSPPEDLTLA  L+R
Sbjct  127  YARRLDSYMD--TEYAFDDGPEKPPTTLLFGYNFVASKLYQLSPPEDLTLASYLMR  180



>ref|XP_002522352.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus 
communis]
 gb|EEF40036.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus 
communis]
Length=260

 Score =   220 bits (560),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 133/176 (76%), Gaps = 3/176 (2%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M+ER++HFVL+HGACHGAWCWYKVA LL+  GHKV+AL++AASG+HPK    + S ++Y 
Sbjct  1    MEERQRHFVLIHGACHGAWCWYKVATLLKCAGHKVTALELAASGVHPKQVNDLYSFSDYY  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL EFM +LP  E+V+LVGHS+GG+++S+AME FP K+S  VF TA M GP+LS+  +K
Sbjct  61   EPLMEFMMSLPPEERVILVGHSLGGLSLSVAMERFPEKVSAGVFATAFMPGPELSYFTLK  120

Query  397  QEFHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +EF RQ  S MD +  +    ++ P SVLFG  +L   +YQLSP EDLTLA LL+R
Sbjct  121  EEFDRQFNSYMDMQYMFDNGPDNPPTSVLFGPNVLADKLYQLSPTEDLTLATLLIR  176



>ref|XP_010088992.1| hypothetical protein L484_020275 [Morus notabilis]
 gb|EXB37219.1| hypothetical protein L484_020275 [Morus notabilis]
Length=259

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 134/178 (75%), Gaps = 7/178 (4%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M++R  HFVLVHG+CHGAWCWYKVAA L++ GHKV+ALDMAASG+HPK   +VSS+++Y 
Sbjct  1    MEKRGSHFVLVHGSCHGAWCWYKVAAQLKSTGHKVTALDMAASGVHPKKVHEVSSVSDYA  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL++FMA+LP  EKV+LVGHS GGV  SLAME FP KISV VFV A M GPDLSF  + 
Sbjct  61   EPLSDFMASLPPEEKVILVGHSAGGVCTSLAMEMFPQKISVGVFVAAFMPGPDLSFSTIN  120

Query  397  QEFHRQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             E+ R ++S MD  T++  D+     P + +FG + LE  +YQLSP EDL LA+ LVR
Sbjct  121  GEYGRSIDSFMD--TQFTSDQGPGHPPTAAIFGPKFLESKLYQLSPLEDLVLARSLVR  176



>gb|KDP31864.1| hypothetical protein JCGZ_12325 [Jatropha curcas]
Length=259

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 131/176 (74%), Gaps = 3/176 (2%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M+E+K+HFVL+HGACHGAWCWYKVAALL++ GHKV+ALD+AASG+H K A  + S  EY 
Sbjct  1    MEEKKRHFVLIHGACHGAWCWYKVAALLKSAGHKVTALDLAASGVHTKQANDIYSFLEYF  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EP  EFM +LP  ++V+LV HS GG+ +S+AME FP KIS  VF  A M GPDL+ +AVK
Sbjct  61   EPFNEFMTSLPPEDRVILVAHSFGGLVISVAMERFPEKISAGVFAAALMPGPDLNCMAVK  120

Query  397  QEFHRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +E +RQL S MD +  + +     P S+LFG  + E  +YQLSPPEDL LAKLL+R
Sbjct  121  EELNRQLGSFMDSQYTFDDGPSSLPTSILFGPNITETKLYQLSPPEDLVLAKLLMR  176



>emb|CBI18571.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   214 bits (546),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 137/179 (77%), Gaps = 8/179 (4%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M++R++HFVLVHGACHGAWCWYKVA LLR+ GH+V+ALD+AA+G + K  ++++S+++Y 
Sbjct  1    MEKRERHFVLVHGACHGAWCWYKVATLLRSAGHRVTALDLAAAGANGKRLDELNSISDYY  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL EFM +L  GEKV+LV HS+GGV+VS+AME FP KISVAVFV A M GPDL+   V 
Sbjct  61   EPLIEFMTSLVTGEKVILVAHSLGGVSVSVAMERFPQKISVAVFVAALMPGPDLNLPTVI  120

Query  397  QEFH-RQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QE H R   ++MD  T+Y  DR     P SV+FG E L  ++YQLSPPEDL LA +L+R
Sbjct  121  QELHQRSPGASMD--TQYTFDRGPNNPPTSVIFGPEYLAAMLYQLSPPEDLMLATMLMR  177



>ref|XP_009773740.1| PREDICTED: methylesterase 3-like isoform X2 [Nicotiana sylvestris]
Length=243

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 123/170 (72%), Gaps = 16/170 (9%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            +  HFVLVHGACHGAWCWYKV  +LRAEGHKVS  DMAASGIHPK  E+++SMAEYNEPL
Sbjct  5    KNHHFVLVHGACHGAWCWYKVVTILRAEGHKVSVPDMAASGIHPKHTEELNSMAEYNEPL  64

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             EFMA +   E+VVLVGHS+GG+N+SLAME FP KI VAVFVTA M GPDL+ +A+ Q+ 
Sbjct  65   MEFMANVSQEERVVLVGHSMGGINISLAMEMFPQKICVAVFVTAFMPGPDLNIVAISQQ-  123

Query  406  HRQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                           E  P S+LFG E+L    YQLSP EDLTLA  LVR
Sbjct  124  ---------------EKGPTSLLFGPEVLATNFYQLSPSEDLTLATYLVR  158



>ref|XP_006380732.1| hypothetical protein POPTR_0007s11750g [Populus trichocarpa]
 gb|ERP58529.1| hypothetical protein POPTR_0007s11750g [Populus trichocarpa]
Length=259

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 130/174 (75%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ER+KHFVLVHGACHGAWCWYKVA LL + GHKV+ALDMAASG+HPK  E++ ++++Y EP
Sbjct  2    ERQKHFVLVHGACHGAWCWYKVATLLTSAGHKVTALDMAASGVHPKRVEELHAISDYFEP  61

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EFM +LP  E+V+LVGHS+GG++ S+AME FP KIS AVF    M GPDLSF A K+E
Sbjct  62   LMEFMTSLPPEERVILVGHSMGGLSNSVAMERFPEKISCAVFAACIMPGPDLSFTAAKEE  121

Query  403  FHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              RQ  S MD +  +     + P S+L G + L   +YQLSP +DLTLAKLL+R
Sbjct  122  NARQAGSFMDSQYMFDNGPNNPPTSILLGPDCLSIQLYQLSPAKDLTLAKLLLR  175



>ref|XP_007047136.1| Methyl esterase 10, putative [Theobroma cacao]
 gb|EOX91293.1| Methyl esterase 10, putative [Theobroma cacao]
Length=258

 Score =   212 bits (539),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 135/177 (76%), Gaps = 4/177 (2%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M+++++HFVLVHGA HGAWCWYKVA LL++ GHKV+ALD+AASG+HPK   ++ S+++Y 
Sbjct  1    MEKKQRHFVLVHGAFHGAWCWYKVATLLKSTGHKVTALDLAASGVHPKQVHELHSISDYY  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL EFMA+LP   KV+LVGHS+GGV++S AME FP K+SVA+F TA M GPD SF +++
Sbjct  61   EPLMEFMASLPVEGKVILVGHSLGGVSLSAAMERFPEKVSVAIFATAVMPGPDFSFASIE  120

Query  397  QEFHRQ-LESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +EF R+ + S MD K  +    +  P SVL GH  +   VYQLSPPEDL LA +L+R
Sbjct  121  EEFTRKGIFSQMDGKYIFDNGPDHPPTSVLAGHNYISSNVYQLSPPEDLMLATVLIR  177



>gb|KCW59297.1| hypothetical protein EUGRSUZ_H01977 [Eucalyptus grandis]
Length=200

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 123/164 (75%), Gaps = 3/164 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ER+KHFVLVHGACHGAWCWYKVA LL++ GHKV+ALDMA +G+HPK    ++S+ EY EP
Sbjct  7    EREKHFVLVHGACHGAWCWYKVATLLKSSGHKVTALDMATAGVHPKQPRDLNSIVEYVEP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF   LP GEKV+LVGHS GGV +SLA+E FP KI+VAVF+ A M+GP+LS  +V +E
Sbjct  67   LFEFFEGLPRGEKVILVGHSFGGVVISLAIERFPEKIAVAVFLAAFMYGPELSVTSVVEE  126

Query  403  FHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPE  525
            + R+L S+MD K  +    E  P S LFG+  +   +YQLSPPE
Sbjct  127  YGRRLGSSMDTKYAFDDGPEKPPTSFLFGYNFMASKLYQLSPPE  170



>ref|XP_010646596.1| PREDICTED: salicylic acid-binding protein 2 [Vitis vinifera]
Length=261

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 137/182 (75%), Gaps = 11/182 (6%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M++R++HFVLVHGACHGAWCWYKVA LLR+ GH+V+ALD+AA+G + K  ++++S+++Y 
Sbjct  1    MEKRERHFVLVHGACHGAWCWYKVATLLRSAGHRVTALDLAAAGANGKRLDELNSISDYY  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL EFM +L  GEKV+LV HS+GGV+VS+AME FP KISVAVFV A M GPDL+   V 
Sbjct  61   EPLIEFMTSLVTGEKVILVAHSLGGVSVSVAMERFPQKISVAVFVAALMPGPDLNLPTVI  120

Query  397  QEFH----RQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAKLL  549
            QE +    R   ++MD  T+Y  DR     P SV+FG E L  ++YQLSPPEDL LA +L
Sbjct  121  QEVYSLHQRSPGASMD--TQYTFDRGPNNPPTSVIFGPEYLAAMLYQLSPPEDLMLATML  178

Query  550  VR  555
            +R
Sbjct  179  MR  180



>ref|XP_010646594.1| PREDICTED: salicylic acid-binding protein 2-like [Vitis vinifera]
 emb|CBI18570.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 132/178 (74%), Gaps = 6/178 (3%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M++R++HFVLVHGACHGAWCWYKV   LR+ GHKV+ALD+AA+G + K  ++++S+++Y+
Sbjct  1    MEKRERHFVLVHGACHGAWCWYKVTTFLRSAGHKVTALDLAAAGANGKRLDELNSISDYH  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL +FM +L AGEKV+LV HS+GGV+VS+AME FP KISVAVFV+A M GPD +   V 
Sbjct  61   EPLMKFMTSLVAGEKVILVAHSLGGVSVSVAMERFPQKISVAVFVSAYMPGPDFNLSTVY  120

Query  397  QEFHRQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QE H Q      + T+Y  DR     P S++F  E L   +YQLSPPEDLTLA  L+R
Sbjct  121  QELH-QRRQGASKDTQYTFDRGSNNPPTSIIFSPEDLAAKLYQLSPPEDLTLATTLMR  177



>ref|XP_011039242.1| PREDICTED: polyneuridine-aldehyde esterase-like [Populus euphratica]
Length=259

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 128/174 (74%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ER+KHFVLVHGACHGAWCWYKVA LL + GHKV+ALDMAASG+HPK  E++ ++++Y EP
Sbjct  2    ERQKHFVLVHGACHGAWCWYKVATLLTSAGHKVTALDMAASGVHPKRVEELHAISDYFEP  61

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EFM +LP  E+V+LVGHS+GG+  S+AME FP KIS AVF    M GP LSF A K+E
Sbjct  62   LMEFMTSLPPEERVILVGHSMGGLCNSVAMERFPEKISCAVFAACIMPGPALSFTAAKEE  121

Query  403  FHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              RQ  S MD +  +     + P S+L G + L   +YQLSP EDL+LAKLL+R
Sbjct  122  NARQAGSFMDSQYMFDNGPNNPPTSMLLGPDCLSIQLYQLSPAEDLSLAKLLLR  175



>ref|XP_003611830.1| Esterase PIR7B [Medicago truncatula]
 gb|AES94788.1| methyl jasmonate esterase [Medicago truncatula]
Length=260

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 132/171 (77%), Gaps = 4/171 (2%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            HFVLVHGACHGAWCWYK+  LL++ GH+V++LDMAASGIHPK   ++ S+ +Y EPL EF
Sbjct  5    HFVLVHGACHGAWCWYKIITLLKSAGHEVTSLDMAASGIHPKQVHELDSVTDYYEPLIEF  64

Query  235  MAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHRQ  414
            + +LP  ++V+LVGHS+GG+ +S+AME FP KI+ AVFVTA M  PDLSFL + QE+ ++
Sbjct  65   LRSLPQDQRVILVGHSLGGMCISVAMELFPKKIAAAVFVTAFMPSPDLSFLTLLQEYQQR  124

Query  415  LESNMDQKTEYKE---DRPV-SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            L+S++D K  + +   D+P  S+LFG + L   +YQLSPPEDL+LA  L+R
Sbjct  125  LDSSLDTKIMFDDSPNDKPNGSMLFGPQFLATKLYQLSPPEDLSLAMSLIR  175



>ref|XP_010026414.1| PREDICTED: salicylic acid-binding protein 2-like [Eucalyptus 
grandis]
 gb|KCW59300.1| hypothetical protein EUGRSUZ_H01981 [Eucalyptus grandis]
Length=270

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 129/174 (74%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ER++HFVLVHGACHGAWCWY+VA LL + GHKV+ALDMAASG++PK A  ++S+ EY EP
Sbjct  9    ERERHFVLVHGACHGAWCWYRVATLLESSGHKVTALDMAASGVNPKQARDLNSIVEYVEP  68

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF+  L   EKV+LVGHS+GG+ +S+AME FP K+ VA+F  A M GP+LS  ++++E
Sbjct  69   LFEFLEGLHQEEKVILVGHSMGGLVLSMAMERFPEKVDVAIFAAAFMPGPELSIRSIREE  128

Query  403  FHRQLESNMDQKTEYKED---RPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              R+ E+ MD    + +     P S+LFG ++L   +YQLSPPEDLTLA  LVR
Sbjct  129  NERRFENRMDMAYAFDDGPSRPPTSMLFGFDVLSSKLYQLSPPEDLTLASYLVR  182



>gb|AFK39434.1| unknown [Medicago truncatula]
Length=263

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 133/175 (76%), Gaps = 4/175 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E K+HFVL+HG+CHGAWCWYK+ ALL++ GH+V+ALDMAASGIHPK   ++ S+ +Y EP
Sbjct  4    EIKRHFVLIHGSCHGAWCWYKIIALLKSAGHEVTALDMAASGIHPKQVHELDSVTDYYEP  63

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF+ +LP  ++V+LVGHS+GG+ +S+AME FP KI+ AVFVTA M  PDLS+L++ QE
Sbjct  64   LIEFLRSLPQDQRVILVGHSLGGMRISVAMELFPKKIAAAVFVTAFMPSPDLSYLSLLQE  123

Query  403  FHRQLESNMDQK----TEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              ++++S++D K        + R  S+LFG + L   +YQLSPPEDL+LA  L+R
Sbjct  124  NTQRIDSSLDTKIMLDDSPNDKRNGSMLFGPQFLATKLYQLSPPEDLSLALSLLR  178



>ref|XP_006590666.1| PREDICTED: methylesterase 3-like isoform X2 [Glycine max]
Length=263

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 128/175 (73%), Gaps = 4/175 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E+K+  VLVHGACHGAWCWYKVAALL++ GH+V+ALDMAASGIHPK    ++S++EY EP
Sbjct  4    EKKRRLVLVHGACHGAWCWYKVAALLKSNGHQVTALDMAASGIHPKQVHDLNSISEYFEP  63

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L  F+ +LP  E+V+LVGHS GG  +S+AME FP KI+ AVFV A M  PDLSF  + QE
Sbjct  64   LMYFLGSLPTEERVILVGHSFGGACISVAMEMFPTKIAAAVFVAAWMPSPDLSFSTLLQE  123

Query  403  FHRQLESNMDQKTEYKED----RPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + R +ES++  K  + E+    R  S +FG + L   +YQLSPPEDLTLA  L+R
Sbjct  124  YSRIMESDLHSKIMFDENTSNHRNGSRMFGPQFLASKLYQLSPPEDLTLAMSLLR  178



>ref|XP_004511978.1| PREDICTED: methylesterase 3-like [Cicer arietinum]
Length=263

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 131/175 (75%), Gaps = 4/175 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
             RK+HFVLVHGACHGAWCWYK+ ALL+++G +V+ LDMAASGIHPK   +++S+ +Y EP
Sbjct  4    RRKRHFVLVHGACHGAWCWYKIVALLKSDGQQVTTLDMAASGIHPKQVHELNSITDYYEP  63

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF+ +LP  E+V+LVGHS+GG+ +S+AME FP+KI+ AVFVTA M  P LSF+ + QE
Sbjct  64   LMEFLRSLPQEERVILVGHSLGGICISMAMEFFPNKIAAAVFVTAFMPSPQLSFVTLFQE  123

Query  403  FHRQLESNMDQKTEYKE---DRPVSV-LFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +++  +S+MD K  + +   ++P    + G ++L    YQLSP EDL LA LLVR
Sbjct  124  YNQTTDSSMDSKDTFDDSPNNKPNGTKVLGPQLLASKFYQLSPHEDLCLAMLLVR  178



>gb|KDP31865.1| hypothetical protein JCGZ_12326 [Jatropha curcas]
Length=260

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            D+ ++HFVLVHGACHGAWCWYKVA+LL+  GHKV+ALDMA+SG +PK  + V S +EY E
Sbjct  3    DKEQRHFVLVHGACHGAWCWYKVASLLKLAGHKVTALDMASSGRNPKQVKDVHSFSEYFE  62

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQ  399
            PL EFM +LPA EKV+LVGHS+GG  +S AME FP KIS  VF  A M GPDLS+L +K 
Sbjct  63   PLMEFMTSLPAEEKVILVGHSMGGPCISAAMERFPEKISAGVFAAAFMPGPDLSYLTIKA  122

Query  400  EFHRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            E+ +Q+   +D +  + +   + P   LFG + L   +YQLSP EDL LA L +R
Sbjct  123  EYDKQVNDYLDPELTFDDGLNNPPTGFLFGPKGLSTFLYQLSPNEDLVLATLCMR  177



>ref|XP_003611828.1| Esterase PIR7B [Medicago truncatula]
 gb|AES94786.1| methylesterase [Medicago truncatula]
 gb|AFK42075.1| unknown [Medicago truncatula]
Length=263

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 133/175 (76%), Gaps = 4/175 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E K+HFVL+HG+CHGAWCWYK+ ALL++ GH+V+ALDMAASGIHPK   ++ S+ +Y EP
Sbjct  4    EIKRHFVLIHGSCHGAWCWYKIIALLKSAGHEVTALDMAASGIHPKQVHELDSVTDYYEP  63

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF+ +LP  ++V+LVGHS+GG+ +S+AME FP KI+ AVFVTA M  PDLS+L++ QE
Sbjct  64   LIEFLRSLPQDQRVILVGHSLGGMCISVAMELFPKKIAAAVFVTAFMPSPDLSYLSLLQE  123

Query  403  FHRQLESNMDQKT----EYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              ++++S++D K        + R  S+LFG + L   +YQLSPPEDL+LA  L+R
Sbjct  124  NTQRIDSSLDTKIMLDDSPNDKRNGSMLFGPQFLATKLYQLSPPEDLSLALSLLR  178



>ref|XP_006590665.1| PREDICTED: methylesterase 3-like isoform X1 [Glycine max]
 gb|KHN42052.1| Putative esterase PIR7A [Glycine soja]
Length=265

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 128/177 (72%), Gaps = 6/177 (3%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E+K+  VLVHGACHGAWCWYKVAALL++ GH+V+ALDMAASGIHPK    ++S++EY EP
Sbjct  4    EKKRRLVLVHGACHGAWCWYKVAALLKSNGHQVTALDMAASGIHPKQVHDLNSISEYFEP  63

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L  F+ +LP  E+V+LVGHS GG  +S+AME FP KI+ AVFV A M  PDLSF  + QE
Sbjct  64   LMYFLGSLPTEERVILVGHSFGGACISVAMEMFPTKIAAAVFVAAWMPSPDLSFSTLLQE  123

Query  403  FH--RQLESNMDQKTEYKED----RPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            F   R +ES++  K  + E+    R  S +FG + L   +YQLSPPEDLTLA  L+R
Sbjct  124  FQYSRIMESDLHSKIMFDENTSNHRNGSRMFGPQFLASKLYQLSPPEDLTLAMSLLR  180



>gb|EYU39395.1| hypothetical protein MIMGU_mgv1a010351mg [Erythranthe guttata]
Length=314

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 125/173 (72%), Gaps = 3/173 (2%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            ++ HFVL+HG CHGAWCWYKVA +LR+   KV+ALDMAA GI+P   +++ S+ +Y +PL
Sbjct  56   KEHHFVLIHGDCHGAWCWYKVATILRSSFRKVTALDMAACGINPDQIDEIGSITDYLKPL  115

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
              FM  L   E+V+LVGHS GG+++S+AME FP +I+ AVFVTA+M GPDL    + +EF
Sbjct  116  LVFMEGLSEEERVILVGHSRGGIDISIAMEKFPGRIAAAVFVTAAMPGPDLDLPTLTKEF  175

Query  406  HRQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             R+L+S MD K  Y   K++ P S L G + L   +YQLSPPEDLTLAK L+R
Sbjct  176  ERRLDSPMDNKYTYGEAKDEPPTSYLLGPDFLASKLYQLSPPEDLTLAKFLIR  228



>ref|XP_010026417.1| PREDICTED: probable esterase PIR7A [Eucalyptus grandis]
Length=266

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ERKKHFVLVHGACHGAWCW++VA LL + GHKV+ALD+AASG+HPK  + + S+AEY EP
Sbjct  7    ERKKHFVLVHGACHGAWCWFRVATLLESSGHKVTALDLAASGVHPKQPQDLESIAEYVEP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF+  L  GE+VVLVGHS+GG+ +S+AME FP  I+VAVF  A M GPDL++ ++ +E
Sbjct  67   LLEFLGGLGEGERVVLVGHSMGGLVLSMAMERFPENIAVAVFAAAVMPGPDLTYHSILEE  126

Query  403  FHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              R++E NMD    +    E  P  + FG+  L   VYQLSPPEDLTLA  L R
Sbjct  127  HSRRVEYNMDPMYRFDDGPEQAPTYISFGYNFLASKVYQLSPPEDLTLASYLGR  180



>ref|XP_007047135.1| Methyl esterase 10, putative isoform 2 [Theobroma cacao]
 gb|EOX91292.1| Methyl esterase 10, putative isoform 2 [Theobroma cacao]
Length=262

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 127/178 (71%), Gaps = 5/178 (3%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M++ K HFVLVHGACHGAWCWYKVA  L++ GH+V+A+DMAASG+HPK   +V S ++Y 
Sbjct  1    MEKGKSHFVLVHGACHGAWCWYKVATRLKSMGHRVTAMDMAASGVHPKQVHEVHSFSDYF  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL EFMA+LP  E+V+LVGHS GG  +S AME FP KISVAVF TA M GP L+   + 
Sbjct  61   EPLMEFMASLPPEERVILVGHSKGGFCISAAMERFPEKISVAVFATAFMPGPKLTSQTLS  120

Query  397  QEFHRQLESN--MDQKTEYKE--DRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QE + +L+S+  MD +  +    D P  S+LFG   +   +YQLSPPEDLTLA  L R
Sbjct  121  QEVNERLDSDKFMDAQFGFHNGLDEPATSLLFGPNFMASKLYQLSPPEDLTLALTLAR  178



>ref|XP_010026416.1| PREDICTED: probable esterase PIR7A [Eucalyptus grandis]
Length=266

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            R+KHFVLVHGACHGAWCWY+V  LL++  +KV+ALDMA SG+HPK A++++S+ EY EPL
Sbjct  8    REKHFVLVHGACHGAWCWYRVVTLLKSSDYKVTALDMATSGVHPKQAQELNSIVEYVEPL  67

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             EF+  LP  +KV+LVGHS+GG+ +S+AME FP K+ VAVF  A M GP+LSF +++++ 
Sbjct  68   FEFLEGLPQEKKVILVGHSMGGLCLSMAMERFPEKVDVAVFAAAIMPGPELSFHSIREQR  127

Query  406  HRQLESNMDQKTEYKED--RPVSVLF-GHEMLEKLVYQLSPPEDLTLAKLLV  552
             R L+ +M     + +   RP + LF GH++L   +YQLSPPEDLTLA  L+
Sbjct  128  ARALKFSMGSAYAFDDGPARPPTALFLGHDLLSSKLYQLSPPEDLTLASYLM  179



>ref|XP_010026411.1| PREDICTED: salicylic acid-binding protein 2-like, partial [Eucalyptus 
grandis]
Length=232

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 123/173 (71%), Gaps = 3/173 (2%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            R +H VLVHGACHGAWCWYKVA +L++ GHKV+ALDMAA+G+H K   Q++S+ EY E  
Sbjct  1    RVRHLVLVHGACHGAWCWYKVATILKSSGHKVTALDMAAAGVHSKQPRQLNSIVEYVELP  60

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             +F   L  GEKV+LVGHS GGV +SLA+E FP   +VAVFV A M+GP+L+  +V +E+
Sbjct  61   FKFFKVLLRGEKVILVGHSFGGVVISLAIERFPENTAVAVFVAAFMYGPELNVTSVVEEY  120

Query  406  HRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             R+L S+MD +  +    E  P S LFG+  +   +YQLSPPEDL LA  LVR
Sbjct  121  GRRLGSSMDTRYAFDDGPEKPPTSFLFGYNFMASKLYQLSPPEDLPLASYLVR  173



>gb|KDP31866.1| hypothetical protein JCGZ_12327 [Jatropha curcas]
Length=260

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 129/179 (72%), Gaps = 9/179 (5%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            D +++HFVLVHGACHGAWCWYKV +LL+  GHKV+ALD++ASG++PK  + + S+++Y +
Sbjct  3    DMKQRHFVLVHGACHGAWCWYKVVSLLQLAGHKVTALDLSASGVNPKQMKDLHSISDYFD  62

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQ  399
            PL EFM +LP  EKV++VGHS+GG+++S AME FP KIS  VF  A M GPDLS+LA+K+
Sbjct  63   PLIEFMRSLPEEEKVIIVGHSMGGLSISAAMERFPEKISAGVFAAAFMPGPDLSYLAIKE  122

Query  400  EFHRQLESNM-------DQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            EF ++++          D+K + K   P+   FG + L  ++YQLSP EDL LA   +R
Sbjct  123  EFDKEIDDKQVGVEFIYDKKIDDKS--PIGFQFGPKCLSNMLYQLSPNEDLVLATFCLR  179



>gb|KDP31871.1| hypothetical protein JCGZ_12332 [Jatropha curcas]
Length=260

 Score =   197 bits (500),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 127/173 (73%), Gaps = 4/173 (2%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            +++HFVLVHGA  GAWCWYKVA LL++ GHKV+ALDMAASG+HPK   ++ S+++Y EPL
Sbjct  5    KQRHFVLVHGAGLGAWCWYKVATLLKSAGHKVTALDMAASGVHPKQVSEIQSISDYFEPL  64

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             EFM + P  EKV+LVGHS GG+++S+AME FP KIS A+F +A M GPDLS+ + +++F
Sbjct  65   MEFMMSSPQEEKVILVGHSFGGLSISIAMERFPEKISAAIFASAIMPGPDLSYTSAREKF  124

Query  406  HRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +  +  MD K ++    +  P S+L G   L   +YQLSPPEDL LA +L+R
Sbjct  125  SKTFDP-MDTKFKFDNGPDHPPTSLLSGPNCLSTQLYQLSPPEDLMLAMMLIR  176



>ref|XP_007047134.1| Methyl esterase 10, putative isoform 1 [Theobroma cacao]
 gb|EOX91291.1| Methyl esterase 10, putative isoform 1 [Theobroma cacao]
Length=262

 Score =   197 bits (500),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 127/178 (71%), Gaps = 5/178 (3%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M + ++HFVLVHGACHGAWCWYKVA  L++ GH+V+A+DMAASG+HPK   +V S ++Y 
Sbjct  1    MVKTERHFVLVHGACHGAWCWYKVATRLKSMGHRVTAMDMAASGVHPKQVHEVHSFSDYF  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL EFMA+LP  E+V+LVGHS GG  +S AME FP KISVAVF TA M GP L+   + 
Sbjct  61   EPLMEFMASLPPEERVILVGHSKGGFCISAAMERFPEKISVAVFATAFMPGPKLTSQTLS  120

Query  397  QEFHRQLESN--MDQKTEYKE--DRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QE + +L+S+  MD +  +    D P  S+LFG   +   +YQLSPPEDLTLA  L R
Sbjct  121  QEVNERLDSDKFMDAQFGFHNGLDEPATSLLFGPNFMASKLYQLSPPEDLTLALTLAR  178



>ref|XP_004288840.1| PREDICTED: methylesterase 3-like [Fragaria vesca subsp. vesca]
Length=280

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            + K  FVLVHGA HGAWCWYKV+ LL+  GH V+ LD+AASGI     +QV+S+A Y +P
Sbjct  29   DHKYSFVLVHGANHGAWCWYKVSTLLKQSGHNVTTLDLAASGIDQTQIQQVTSVAVYVDP  88

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L +FM +LP  +KVVLVGHS+GGV ++LAME FPHKISVAVF TASM GPDL+++A++QE
Sbjct  89   LMKFMESLPPKQKVVLVGHSMGGVPIALAMERFPHKISVAVFATASMPGPDLTYVAIRQE  148

Query  403  FHRQLESNMDQKTEYKE--DRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              R L+  +D    + +   +P  SVL   E+L    YQLSPPEDLTLA  LVR
Sbjct  149  LGRHLDF-VDSHFRFDDGASKPATSVLRSQEILAPFFYQLSPPEDLTLALTLVR  201



>ref|XP_004300554.1| PREDICTED: probable esterase PIR7A isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_004300555.2| PREDICTED: probable esterase PIR7A isoform X2 [Fragaria vesca 
subsp. vesca]
Length=296

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 125/172 (73%), Gaps = 4/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVHGA HGAWCWYKVA LL++ GH V+ALDMAASGI+P   +QV S ++Y EPL 
Sbjct  47   KKHFVLVHGAGHGAWCWYKVATLLKSAGHNVTALDMAASGINPTQVQQVHSFSDYAEPLI  106

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LP   +V+LVGHS+GG  +SLAME FP +ISVAVF TA+M GP+L++ A+     
Sbjct  107  EFMASLPPLHRVILVGHSMGGAIISLAMEMFPQRISVAVFATAAMPGPNLTYSAIFAAIS  166

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              + S MD +  Y +   + P S++FG + +    YQLSPPEDLTLA  LVR
Sbjct  167  SGV-SFMDSQFIYDDGQNNPPTSLVFGPKFMSSSFYQLSPPEDLTLAFSLVR  217



>ref|XP_006365368.1| PREDICTED: salicylic acid-binding protein 2 isoform X2 [Solanum 
tuberosum]
Length=218

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             K HFVLVHGACHGAWCWYKV  +LR+EGHKVS LDMAASGI+PK  E ++SMA+YNEPL
Sbjct  5    NKNHFVLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGINPKHVEDLNSMADYNEPL  64

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
             EFM +LP  E+VVLVGHS+GG+N+SLAME FPHKI+VAVFV+ASM GPDL+ +AV Q+
Sbjct  65   MEFMNSLPQQERVVLVGHSMGGINISLAMEKFPHKIAVAVFVSASMPGPDLNLVAVTQQ  123



>ref|XP_011039240.1| PREDICTED: salicylic acid-binding protein 2-like [Populus euphratica]
Length=333

 Score =   196 bits (499),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 123/174 (71%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            + ++HFVLVHGACHGAWCWYKV+A L++ GH V+ALDMAASG+HPK   ++ S  +Y EP
Sbjct  79   KTQRHFVLVHGACHGAWCWYKVSAQLKSAGHNVTALDMAASGVHPKQVHELHSFEDYFEP  138

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EFM +LP  E+VVLVGHS+ G+ +S+AME FP KIS AVF  A M GPDLSF A+ ++
Sbjct  139  LMEFMESLPPEERVVLVGHSMSGICISVAMERFPEKISAAVFAAAVMPGPDLSFKAIAEK  198

Query  403  FHRQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   S MD +  +    ++ P +V+ G   +    Y LSPPEDLTLA LLVR
Sbjct  199  SSQTSVSYMDTQYVFGNGPDNPPTAVVLGPNYMASRFYHLSPPEDLTLATLLVR  252



>ref|XP_002310759.2| hypothetical protein POPTR_0007s11740g [Populus trichocarpa]
 gb|EEE91209.2| hypothetical protein POPTR_0007s11740g [Populus trichocarpa]
Length=333

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 122/174 (70%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            + ++HFVLVHGACHGAWCWYKV+A L++ GH V+ALDMAASG+HPK   ++ S  +Y EP
Sbjct  79   KTQRHFVLVHGACHGAWCWYKVSAQLKSAGHNVTALDMAASGVHPKQVHELHSFEDYFEP  138

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EFM +LP  E+VVLVGHS+ G+ +S+AME FP KIS AVF  A M GPDLSF A+ ++
Sbjct  139  LMEFMESLPPEERVVLVGHSMSGICISVAMERFPEKISAAVFAAAVMPGPDLSFKAIAEK  198

Query  403  FHRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   S MD +  +     + P +V+ G   +    Y LSPPEDLTLA LLVR
Sbjct  199  SSQTSVSYMDTQYVFGNGPGNPPTAVVLGPNYMASRFYHLSPPEDLTLATLLVR  252



>ref|XP_003611826.1| Methyl jasmonate esterase [Medicago truncatula]
 gb|KEH27542.1| methylesterase [Medicago truncatula]
Length=262

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 131/175 (75%), Gaps = 5/175 (3%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E K+HFVL+HG+CHGAWCWYK+ ALL++ GH+V+ALDMAASGIHPK   ++ S+  Y EP
Sbjct  4    EIKRHFVLIHGSCHGAWCWYKIIALLKSAGHEVTALDMAASGIHPKQVHELDSVTYYYEP  63

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF+ +L   ++V+LVGHS+GG+ +S+AME FP KI+ AVFVTA M  PDLS+L++ QE
Sbjct  64   LIEFLRSLRQDQRVILVGHSLGGMCISVAMELFPKKIAAAVFVTAFMPSPDLSYLSLLQE  123

Query  403  FHRQLESNMDQKTEYKE---DRPV-SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +  + +M  K  + +   D+P  S+LFG +++ +  YQLSPPEDL+LA  L+R
Sbjct  124  SRQSRDPSMVPKIMFDDSPNDKPNGSMLFGQQIIFE-AYQLSPPEDLSLAMSLIR  177



>ref|XP_007203427.1| hypothetical protein PRUPE_ppa021591mg, partial [Prunus persica]
 gb|EMJ04626.1| hypothetical protein PRUPE_ppa021591mg, partial [Prunus persica]
Length=259

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 126/184 (68%), Gaps = 8/184 (4%)
 Frame = +1

Query  19   CSG*SIMDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVS  198
            C+     D  +KHFVLVHGA HGAWCWYKV+ LL + GH V+ALD+AASG++PK  +Q+ 
Sbjct  2    CTPSPNTDANQKHFVLVHGAGHGAWCWYKVSTLLSSIGHNVTALDLAASGVNPKQVQQLH  61

Query  199  SMAEYNEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL  378
            S+++Y EPL  FM +LP  E+V+LVGHS+GG  +S+AME FP KI  AVF TA M GP L
Sbjct  62   SLSDYVEPLMRFMKSLPTKERVILVGHSMGGAAISIAMEKFPEKIYTAVFATAVMPGPAL  121

Query  379  SFLAVKQEFHRQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAK  543
             +L +  +    L+  MD  T+++ DR     P + L G ++L   +YQLSPPEDLTLA 
Sbjct  122  DYLNLSSQILNSLDL-MD--TQFRYDRGPNNPPTAALLGPKLLSSSMYQLSPPEDLTLAL  178

Query  544  LLVR  555
             LVR
Sbjct  179  SLVR  182



>ref|XP_004301853.2| PREDICTED: probable esterase PIR7A [Fragaria vesca subsp. vesca]
Length=298

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 125/173 (72%), Gaps = 4/173 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVHGA HGAWCW+KVA LL + GH V+ALDMAASGI+P   ++V S ++Y EPL 
Sbjct  47   KKHFVLVHGAGHGAWCWFKVATLLESAGHNVTALDMAASGINPTQVQKVHSFSDYAEPLI  106

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LP   +V+LVGHS+GG  +SLAME FP +IS AVF TA+M GPDL++ A+    +
Sbjct  107  EFMASLPPLHRVILVGHSMGGAIISLAMEMFPLRISAAVFATAAMPGPDLTYSAIVAAIN  166

Query  409  RQLESN-MDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                S+ MD +  Y +   + P S++FG + +   +YQLSPPEDLTLA  LVR
Sbjct  167  SGATSSLMDSQFIYDDGQNNPPTSLVFGPKFMSSSLYQLSPPEDLTLAFSLVR  219



>ref|XP_009341927.1| PREDICTED: probable esterase PIR7A [Pyrus x bretschneideri]
 ref|XP_009341930.1| PREDICTED: probable esterase PIR7A [Pyrus x bretschneideri]
Length=288

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 122/172 (71%), Gaps = 4/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            K+HFVLVHGA  GAWCWYK+A LL + GH V+ LDMAASGI+PK  +QV+S ++Y EPL 
Sbjct  41   KRHFVLVHGAGVGAWCWYKLATLLNSTGHNVTTLDMAASGINPKQVQQVNSFSDYVEPLI  100

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFM +LP  E+V+LVGHS GG ++S+AME FP KI VAVFVTA M GPDL++  V  E  
Sbjct  101  EFMESLPPKERVILVGHSFGGASISIAMERFPQKIYVAVFVTALMPGPDLNYSTVLNEVA  160

Query  409  RQ---LESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +   L+S   Q  E    +  SVLFG + +  + YQLSPPED+TLA  LVR
Sbjct  161  GKLNFLDSIFRQDNETGHPQ-TSVLFGPKFVSSMFYQLSPPEDVTLAISLVR  211



>ref|XP_009376503.1| PREDICTED: probable esterase PIR7A [Pyrus x bretschneideri]
Length=288

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 122/172 (71%), Gaps = 4/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            K+HFVLVHGA  GAWCWYK+A LL + GH V+ LDMAASGI+PK  +QV+S ++Y EPL 
Sbjct  41   KRHFVLVHGAGVGAWCWYKLATLLNSTGHNVTTLDMAASGINPKQVQQVNSFSDYVEPLI  100

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFM +LP  E+V+LVGHS GG ++S+AME FP KI VAVFVTA M GPDL++  V  E  
Sbjct  101  EFMESLPPKERVILVGHSFGGASISIAMERFPQKIYVAVFVTALMPGPDLNYSTVLNEVA  160

Query  409  RQ---LESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +   L+S   Q  E    +  SVLFG + +  + YQLSPPED+TLA  LVR
Sbjct  161  GKLNFLDSIFRQDNETGHPQ-TSVLFGPKFVSSMFYQLSPPEDVTLAISLVR  211



>ref|XP_008241566.1| PREDICTED: methylesterase 3-like [Prunus mume]
Length=282

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 127/179 (71%), Gaps = 8/179 (4%)
 Frame = +1

Query  19   CSG*SIMDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVS  198
            CSG    + +KKHFVLVHGA HGAWCWYK++ALL + GH V+ALD+AASG +PK   QV 
Sbjct  27   CSGSPNPEAQKKHFVLVHGAGHGAWCWYKLSALLISAGHHVTALDLAASGDNPKQINQVH  86

Query  199  SMAEYNEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL  378
              A+Y EPL EFM +LP  ++V+LVGHS+GG ++S+AME FP KISVAVF TA M G  L
Sbjct  87   CFADYVEPLIEFMESLPPEDRVILVGHSMGGTSISIAMERFPEKISVAVFATAVMPGLTL  146

Query  379  SFLAVKQEFHRQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLA  540
            S+L + +E   +LE    + +EY+ D+     P S +FG E +  ++YQLSPPEDL LA
Sbjct  147  SYLTIVKEVGSRLEI---KDSEYRYDKGPNNPPTSAIFGPERITSVLYQLSPPEDLALA  202



>ref|XP_007203473.1| hypothetical protein PRUPE_ppa024619mg, partial [Prunus persica]
 gb|EMJ04672.1| hypothetical protein PRUPE_ppa024619mg, partial [Prunus persica]
Length=252

 Score =   191 bits (485),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 123/170 (72%), Gaps = 8/170 (5%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            +KKHFVLVHGA HGAWCWYK++ALL + GH V+ALD+AASG +PK   QV   A+Y EPL
Sbjct  2    QKKHFVLVHGAGHGAWCWYKLSALLTSAGHNVTALDLAASGDNPKQINQVHCFADYVEPL  61

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             EFM +LP  E+V+LVGHS+GG  +S+AME FP KIS AVF TA M GP +S+L + +E 
Sbjct  62   IEFMESLPPDERVILVGHSMGGAGISIAMERFPEKISAAVFATALMPGPTISYLTIFEEV  121

Query  406  HRQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLA  540
              +LE  MD  ++Y+ D+     P S +FG + +  ++YQLSPPEDL LA
Sbjct  122  SSRLEF-MD--SQYRFDKGLNNPPTSAIFGPQRMTSVLYQLSPPEDLALA  168



>ref|XP_004234677.1| PREDICTED: methylesterase 3-like isoform X2 [Solanum lycopersicum]
Length=218

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            K HF+LVHGACHGAWCWYKV  +LR+EGHKVS LDMAASGI+PK    ++SMA+YNEPL 
Sbjct  6    KNHFLLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGINPKHVNDLNSMADYNEPLM  65

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            EFM +LP  E+VVLVGHS+GG+N+SLAME FP KI+VAVFVTASM GPDL+ +AV Q+
Sbjct  66   EFMNSLPQQERVVLVGHSLGGINISLAMEKFPQKIAVAVFVTASMPGPDLNIVAVTQQ  123



>ref|XP_010921786.1| PREDICTED: probable esterase PIR7A [Elaeis guineensis]
Length=308

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 126/177 (71%), Gaps = 5/177 (3%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            +E KKHF+LVHG CHGAWCWYK+A LLR+ G +V+ALD+AASG+HPK  +++ S ++Y  
Sbjct  3    EESKKHFILVHGMCHGAWCWYKLATLLRSAGQRVTALDLAASGVHPKRLDELRSFSDYFA  62

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQ  399
            PL E MA++P+GE+VVLVGHS GG  ++LA E FP K+SVAVFV+A+M G      A++Q
Sbjct  63   PLMEAMASIPSGERVVLVGHSYGGYGIALAAEKFPEKVSVAVFVSATMPGFSAPLSAIEQ  122

Query  400  EFHRQ--LESNMDQKTEYKEDRPV---SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            EF      E  MD K    +D  +   S++ G   +++ VYQL PPEDLTLA +LVR
Sbjct  123  EFFNSHPPEFFMDSKFMISQDPQICSTSIVLGPNYMKEKVYQLCPPEDLTLATMLVR  179



>ref|XP_010026419.1| PREDICTED: probable esterase PIR7A [Eucalyptus grandis]
Length=262

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 125/174 (72%), Gaps = 7/174 (4%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +R+KHFVLVHGACHGAWCWY+V  LL++ GHKV+ALDMAAS +HPK A++++S+ +Y EP
Sbjct  7    QREKHFVLVHGACHGAWCWYRVVTLLKSSGHKVTALDMAASRVHPKQAQELNSIVKYVEP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF+  LP  EKV+LV    GG+ +S+AME FP K+ VA+F  A M GP+LSF ++++E
Sbjct  67   LFEFLEGLPQEEKVILV----GGLCLSMAMERFPEKVDVAIFAAALMPGPELSFHSIREE  122

Query  403  FHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              R+L+ +      +       P ++  GH++L   +YQLSPPEDLTLA  L+R
Sbjct  123  RDRRLKFSTGSANAFDGGPAQPPTALFLGHDLLSSKLYQLSPPEDLTLASYLIR  176



>ref|XP_009366272.1| PREDICTED: salicylic acid-binding protein 2-like [Pyrus x bretschneideri]
Length=295

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +  KHFVL+HGACHGAW WYKVA LL+  GH V+ALD+ ASGI+P   +Q+ S++E+ EP
Sbjct  43   QSPKHFVLIHGACHGAWSWYKVATLLKDSGHNVTALDLGASGINPIQVQQLPSLSEFVEP  102

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            LT+FM +LP  EKV+LVGHS+GG  +S+ ME FPHKI  AV+VTA M+GP L+F  +  E
Sbjct  103  LTKFMVSLPPNEKVILVGHSMGGAVISIIMERFPHKIVAAVYVTAFMYGPTLNFSTIYAE  162

Query  403  FHRQLESNMDQKTEYKE--DRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +  ++ MD +  Y    + P  S L G + L   VYQLSPP+DLTLA  LVR
Sbjct  163  VTKGYDA-MDSQFRYDNGTNNPATSFLVGPKALAISVYQLSPPQDLTLALSLVR  215



>ref|XP_002310760.1| hypothetical protein POPTR_0007s11750g [Populus trichocarpa]
 gb|EEE91210.1| hypothetical protein POPTR_0007s11750g [Populus trichocarpa]
Length=264

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 125/181 (69%), Gaps = 12/181 (7%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ER+KHFVLVHGACHGAWCWYKVA LL + GHKV+ALDMAASG+HPK  E++ ++++Y EP
Sbjct  2    ERQKHFVLVHGACHGAWCWYKVATLLTSAGHKVTALDMAASGVHPKRVEELHAISDYFEP  61

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSF------  384
            L EFM +LP  E+V+LVGHS+GG++ S+AME FP KIS AVF    M  P  S       
Sbjct  62   LMEFMTSLPPEERVILVGHSMGGLSNSVAMERFPEKISCAVFAACIM--PAFSLCKTVIF  119

Query  385  -LAVKQEFHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLV  552
             L +  +  RQ  S MD +  +     + P S+L G + L   +YQLSP +DLTLAKLL+
Sbjct  120  TLEIYYQNARQAGSFMDSQYMFDNGPNNPPTSILLGPDCLSIQLYQLSPAKDLTLAKLLL  179

Query  553  R  555
            R
Sbjct  180  R  180



>ref|XP_008241854.1| PREDICTED: salicylic acid-binding protein 2-like [Prunus mume]
Length=277

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 121/174 (70%), Gaps = 2/174 (1%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            D  +KHFVLVHGA HGAWCWYKV+ LL + GH V+ALD+AASG++PK  +Q+ S+++Y E
Sbjct  29   DANQKHFVLVHGAGHGAWCWYKVSTLLTSIGHNVTALDLAASGVNPKQVQQLHSLSDYVE  88

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQ  399
            PL  FM +LP  E+V+LVGHS+GG  +S+AME FP KI +AVF TA M GP L++L +  
Sbjct  89   PLMRFMKSLPPKERVILVGHSMGGAALSIAMEKFPKKIYIAVFATAVMTGPALNYLNLSS  148

Query  400  EF--HRQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    R L  N  +      + P + L G +++   +YQLSPPEDLTLA  LVR
Sbjct  149  QILNSRDLMDNQFRYDRGPNNPPTAALLGPKLMSSSMYQLSPPEDLTLALSLVR  202



>ref|XP_007047133.1| Methyl esterase 3, putative [Theobroma cacao]
 gb|EOX91290.1| Methyl esterase 3, putative [Theobroma cacao]
Length=280

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 129/196 (66%), Gaps = 23/196 (12%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M++ K HFVLVHGACHGAWCWYKV  LL++ GH+V+ALD+AA G+HPK   ++ SM++Y+
Sbjct  1    MEKGKSHFVLVHGACHGAWCWYKVVTLLKSAGHQVTALDLAAFGVHPKQVHELHSMSDYS  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL EFM +LP  E+V+LVGHS+GGV +S+AME FP K+SVAVF  ASM GP+LS+++++
Sbjct  61   EPLMEFMESLPPKERVILVGHSMGGVTISIAMERFPEKVSVAVFAPASMPGPELSYISLR  120

Query  397  QEF--------------HRQLESNMDQKTEYKED---------RPVSVLFGHEMLEKLVY  507
            Q                 + L S  D    +  +           + +LFG   +   +Y
Sbjct  121  QAVLAVVMPAAACCSRRCKDLSSIRDWDPLWTHNLRLMMVLISLQLHLLFGPSFMSTKLY  180

Query  508  QLSPPEDLTLAKLLVR  555
            QLSPPEDLTLA +L R
Sbjct  181  QLSPPEDLTLATMLAR  196



>ref|XP_007204507.1| hypothetical protein PRUPE_ppa019104mg [Prunus persica]
 gb|EMJ05706.1| hypothetical protein PRUPE_ppa019104mg [Prunus persica]
Length=253

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 122/170 (72%), Gaps = 8/170 (5%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            +KKHFVLVHGA HGAWCWYK++ALL + GH V+ALD+AASG +PK   QV   A+Y EPL
Sbjct  3    QKKHFVLVHGAGHGAWCWYKLSALLISAGHHVTALDLAASGDNPKQINQVHCFADYVEPL  62

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
             EFM +LP  ++ +LVGHS+GG ++S+AME FP KISVAVF TA M GP LS+L   +E 
Sbjct  63   IEFMESLPPEDRFILVGHSMGGASISIAMERFPEKISVAVFATAVMPGPTLSYLTTVKEV  122

Query  406  HRQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLA  540
              +LE    + +EY+ D+     P S +FG + +  ++YQLSPPEDL LA
Sbjct  123  GSRLEI---KDSEYRYDKGPNNPPTSAIFGPQRMTSVLYQLSPPEDLALA  169



>ref|XP_002522349.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus 
communis]
 gb|EEF40033.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus 
communis]
Length=250

 Score =   189 bits (479),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 124/171 (73%), Gaps = 6/171 (4%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E+++H V+VHGA HGAWCWYKVAALL++ GHKV+ALD+AA G++P+   Q+ S+++Y+EP
Sbjct  2    EKQRHIVMVHGASHGAWCWYKVAALLKSSGHKVTALDLAACGVNPEQVHQLKSISDYSEP  61

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L +FM +LP+ E+V+LV HS GG+ VS AME FP K+S  VF TA M GPDLS+  + +E
Sbjct  62   LMDFMMSLPSEERVILVAHSFGGLVVSFAMERFPDKVSAGVFATAMMPGPDLSYKTLIEE  121

Query  403  FHRQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++R++      + +  ++   S LFG + L   +YQLSPPEDL L  +L R
Sbjct  122  YNRRI------RIDEPDNPSTSQLFGPKSLSTYLYQLSPPEDLMLGMMLRR  166



>ref|XP_009366336.1| PREDICTED: salicylic acid-binding protein 2-like [Pyrus x bretschneideri]
Length=289

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +  KHFVL+HGACHGAW WYKVA LL+  GH V+ALD+ ASGI+P   +Q+ S++EY EP
Sbjct  37   QSPKHFVLIHGACHGAWSWYKVATLLKNSGHNVTALDLGASGINPIQVQQLPSLSEYVEP  96

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            LT+ M +LP  EKV+LV HS GG  +S+ ME FP KI+ AV+VT  M GP L+F  + QE
Sbjct  97   LTKLMVSLPPNEKVILVAHSFGGAVISIFMERFPRKIAAAVYVTGVMSGPTLNFSTINQE  156

Query  403  FHRQLESNMDQKTEYKE--DRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              ++L+  +D +  Y    + P  S LFG +++   +YQLSPP+DLTLA  LVR
Sbjct  157  IRKRLDY-LDSQFRYDNGTNNPATSFLFGPKVMATSLYQLSPPQDLTLALSLVR  209



>ref|XP_008241567.1| PREDICTED: salicylic acid-binding protein 2-like [Prunus mume]
Length=279

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 122/175 (70%), Gaps = 4/175 (2%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            D  +KHFVLVHGA HGAWCWYKV+ LL + GH V+ALD+AASG++PK  +Q+ S+++Y E
Sbjct  29   DAAQKHFVLVHGAGHGAWCWYKVSTLLTSIGHNVTALDLAASGVNPKQVQQLHSLSDYVE  88

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQ  399
            PL  FM ++P  E+V+LVGHS+GG  +S+AME FP KI VAVF TA M GP L +L +  
Sbjct  89   PLMRFMKSIPPKERVILVGHSMGGAALSIAMEKFPKKIYVAVFATAVMPGPALDYLNLSS  148

Query  400  EFHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    L+  MD +  Y     + P + L G +++   +YQLSPPEDLTLA  LVR
Sbjct  149  QILNSLDL-MDSQFRYDRGPNNPPTAALLGPKLMSSSMYQLSPPEDLTLALSLVR  202



>emb|CBI32481.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KH+VLVHG+CHGAW WYK+ ALL++ GHKV+ALD+AASGI+PK    + S++EY +PL +
Sbjct  12   KHYVLVHGSCHGAWSWYKIVALLKSSGHKVTALDLAASGINPKQVGDLRSISEYFQPLRD  71

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM +LPA E+VVLVGHS+GG+ +S AME FP K+SVAVFVTASM GP L+   + QE  R
Sbjct  72   FMESLPADERVVLVGHSLGGLAISQAMEKFPEKVSVAVFVTASMPGPTLNISTLNQESLR  131

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    +D +  Y     + P +  FG       VYQLSP EDL L  +L+R
Sbjct  132  RQGPLLDSQFTYDNGPNNPPTTFTFGPLFSSLNVYQLSPTEDLALGTMLMR  182



>ref|XP_002284944.1| PREDICTED: methylesterase 10 [Vitis vinifera]
 emb|CBI32475.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KH+VLVHG+CHGAW WYK+ ALL++ GHKV+ALD+AASGI+PK    + S++EY +PL +
Sbjct  12   KHYVLVHGSCHGAWSWYKIVALLKSSGHKVTALDLAASGINPKQVGDLRSISEYFQPLRD  71

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM +LPA E+VVLVGHS+GG+ +S AME FP K+SVAVFVTASM GP L+   + QE  R
Sbjct  72   FMESLPADERVVLVGHSLGGLAISQAMEKFPEKVSVAVFVTASMPGPTLNISTLNQESLR  131

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    +D +  Y     + P +  FG       VYQLSP EDL L  +L+R
Sbjct  132  RQGPLLDSQFTYDNGPNNPPTTFTFGPLFSSLNVYQLSPTEDLALGTMLMR  182



>emb|CBI18572.3| unnamed protein product [Vitis vinifera]
Length=229

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 118/173 (68%), Gaps = 28/173 (16%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M++R++HFVLVHGACHGAWCWYKVA LLR+ GH+V+ALD+AA+G + K  ++++S+++Y 
Sbjct  1    MEKRERHFVLVHGACHGAWCWYKVATLLRSAGHRVTALDLAAAGANGKRLDELNSISDYY  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL EFM +L  GEKV+LV HS+GGV+VS+AME FP KISVAVFV A M GPDL+   V 
Sbjct  61   EPLIEFMTSLVTGEKVILVAHSLGGVSVSVAMERFPQKISVAVFVAALMPGPDLNLPTVI  120

Query  397  QEFHRQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QE H                            +  +YQLSPPEDL LA  L+R
Sbjct  121  QELH----------------------------QSRLYQLSPPEDLMLATTLMR  145



>ref|XP_008388737.1| PREDICTED: salicylic acid-binding protein 2-like [Malus domestica]
Length=295

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +  KHFVL+HGACHGAW WYKVA LL+  GH V+ALD+ ASGI+P   +Q+ S++E+ EP
Sbjct  43   QSPKHFVLIHGACHGAWSWYKVATLLKDSGHNVTALDLGASGINPIXVQQLPSLSEFVEP  102

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            LT+ M +LP  EKVVLVGHS+GG  +S+ ME FP KI+ AVFVTA M+GP L+F A   E
Sbjct  103  LTKVMVSLPPNEKVVLVGHSLGGAVISIFMERFPQKIAAAVFVTAVMYGPTLNFSAAYAE  162

Query  403  FHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +  +  MD +  Y     +   S LFG +++   +YQLSPP+DL LA  LVR
Sbjct  163  VTKGFDX-MDSQYIYDNGTNNXATSFLFGPKVMATSLYQLSPPQDLNLALSLVR  215



>ref|XP_009391582.1| PREDICTED: probable esterase PIR7A [Musa acuminata subsp. malaccensis]
Length=261

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 120/172 (70%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            +KHFVLVHG  HGAWCWYK+  LLR  GH+V+ LD+AASG+HP+  +++ S A+Y+ PL 
Sbjct  7    RKHFVLVHGIGHGAWCWYKLVVLLRLAGHRVTTLDLAASGVHPQRLDELESFADYSRPLM  66

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            E MAA+P  E+VVLVGHS GGV++ LAME FP KI VAVF TA M  P  S  ++ +EF 
Sbjct  67   ELMAAVPPHERVVLVGHSYGGVSLGLAMEKFPEKILVAVFATALMPSPGNSVASITEEFS  126

Query  409  R--QLESNMDQKTEYKED-RPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +   LE+ MD   E  +D R  S+ FG   L   +YQL+PPED+ LA +L+R
Sbjct  127  KGHPLEAYMDSTVEISDDQRGFSLAFGRNYLSTRLYQLTPPEDIELATVLLR  178



>ref|XP_010070493.1| PREDICTED: probable esterase PIR7A [Eucalyptus grandis]
 gb|KCW59305.1| hypothetical protein EUGRSUZ_H01986 [Eucalyptus grandis]
Length=266

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 124/174 (71%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +R+KHFVLVHG CHGAWCWY+VA LL + GHKV+ALDMAASG+H K  + + S+ EY EP
Sbjct  7    QREKHFVLVHGVCHGAWCWYRVATLLESSGHKVTALDMAASGVHSKRPQDLKSIVEYVEP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF+ +L   E+VVLVGHS GG  +S+AME FP KI+VAVF  A M GP+L++ ++ +E
Sbjct  67   LMEFLGSLGERERVVLVGHSQGGAVLSMAMERFPEKIAVAVFAAALMPGPELTYHSIFEE  126

Query  403  FHRQLESNMDQKTEYKE--DRPVSVL-FGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              R+LE +M  +  + +  D+P + +    + L   +YQLSPPED+TLA  L R
Sbjct  127  HSRRLEYDMVPQYRFDDGPDKPPTYISLEDDFLASKLYQLSPPEDVTLASYLKR  180



>gb|EYU44348.1| hypothetical protein MIMGU_mgv1a012023mg [Erythranthe guttata]
Length=264

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 114/174 (66%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
              +KHFVLVHGACHGAWCWYKV   LR+ GH+V+ALDMA +G      E++S  ++Y  P
Sbjct  7    NNQKHFVLVHGACHGAWCWYKVVTRLRSAGHRVTALDMAGAGADTGCVEELSLFSDYCRP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L E M  LP+ E+VVLVGHS+GG+ +SL ME FP KI +AVFV A M GPD + L    +
Sbjct  67   LVELMEGLPSDERVVLVGHSLGGICISLVMEKFPDKIGLAVFVAAIMPGPDFTVLTALGK  126

Query  403  FHRQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              R+    MD +  +    E  P S +FG   + K +YQLS PEDL+LA LLVR
Sbjct  127  LEREAGYYMDSRFSFANGDEKPPTSFIFGPNFMAKHLYQLSSPEDLSLATLLVR  180



>ref|XP_009791930.1| PREDICTED: salicylic acid-binding protein 2-like [Nicotiana sylvestris]
Length=300

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHG CHGAW WYK+ AL+R+ GH V+ALD+ ASGI+PK   ++  +++Y  PL E
Sbjct  48   KHFVLVHGVCHGAWSWYKLVALMRSSGHNVTALDLGASGINPKQVLEIPRLSDYFSPLME  107

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FMA+LPA EKVVLVGHS GG  VS AMESFP KISVAVFVTA M GP L+   V  E   
Sbjct  108  FMASLPAHEKVVLVGHSFGGFAVSKAMESFPEKISVAVFVTAGMPGPTLNATTVFVEASS  167

Query  412  QLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++ S +D +  Y     + P + +FG + L   +YQLSP +D  LA  LVR
Sbjct  168  EIISQLDNRLTYYNGPNNPPTTFIFGPKYLASNLYQLSPIQDWALATTLVR  218



>ref|XP_002284928.2| PREDICTED: salicylic acid-binding protein 2 [Vitis vinifera]
Length=317

 Score =   188 bits (477),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KH+VLVHG+CHGAW WYK+ ALL++ GHKV+ALD+AASGI+PK    + S++EY +PL +
Sbjct  64   KHYVLVHGSCHGAWSWYKIVALLKSSGHKVTALDLAASGINPKQVGDLRSISEYFQPLRD  123

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM +LPA E+VVLVGHS+GG+ +S AME FP K+SVAVFVTASM GP L+   + QE  R
Sbjct  124  FMESLPADERVVLVGHSLGGLAISQAMEKFPEKVSVAVFVTASMPGPTLNISTLNQESLR  183

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    +D +  Y     + P +  FG       VYQLSP EDL L  +L+R
Sbjct  184  RQGPLLDSQFTYDNGPNNPPTTFTFGPLFSSLNVYQLSPTEDLALGTMLMR  234



>gb|KJB47436.1| hypothetical protein B456_008G026500 [Gossypium raimondii]
Length=287

 Score =   187 bits (474),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E  KHFVLVHG+CHGAW WYKV  LL++ GH V+ALD+  SG+ P+    + S+++Y +P
Sbjct  28   EPPKHFVLVHGSCHGAWSWYKVVPLLKSGGHNVTALDLGGSGVDPQQVNTLRSISDYIKP  87

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EFMA+LP  EKVVLVGHS+GG+ +S AME FP K++VAVFVTASM GP L+   + Q+
Sbjct  88   LREFMASLPDEEKVVLVGHSLGGLAISQAMEMFPEKVAVAVFVTASMPGPTLNVSILIQK  147

Query  403  FHRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              R  +S MD    Y +     P +  FG   L   VYQLSPPED  LA +L+R
Sbjct  148  ALRDQDSQMDNHYTYDDGPSSPPTTFTFGPMFLSSKVYQLSPPEDSALASMLMR  201



>ref|XP_008236705.1| PREDICTED: esterase PIR7B-like [Prunus mume]
Length=291

 Score =   187 bits (474),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVHG+C GAW WYK+  L+++ GH V+ALD+AASG+ P+ A+ + S+++Y +PLT
Sbjct  35   KKHFVLVHGSCFGAWSWYKLVTLMKSSGHNVTALDLAASGVDPQQAKYLQSISDYFKPLT  94

Query  229  EFMAAL-PAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
            +FMAAL P  +KV+LVGHS+GG+ +S AME FP KIS+AVFVTA   GP+L+   + QE 
Sbjct  95   DFMAALDPPHDKVILVGHSLGGLAISYAMERFPDKISLAVFVTALTPGPNLNISTLNQES  154

Query  406  HRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             R+  S +D K  Y +   + P++++FG   LE  VYQLSP ED+ L  +L+R
Sbjct  155  FRRQGSLLDSKYTYDQGPNNPPITLIFGPLFLETNVYQLSPTEDVALGTMLLR  207



>gb|KEH17955.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=262

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M +++KHFVL+HG  HGAWCWYKVA  L++ GHKV+ALDMAA G +PK  ++V S++EY+
Sbjct  1    MFKQEKHFVLIHGGIHGAWCWYKVATDLKSAGHKVTALDMAACGTNPKQMQEVHSISEYH  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            +PL  FM +LP  EKVVLVGHS+GG++VS+AME++PHKI VAVF+TA++   +L++ A  
Sbjct  61   QPLMTFMESLPLEEKVVLVGHSLGGLSVSIAMENYPHKIFVAVFITATVVTQNLTYPAFL  120

Query  397  QEFHRQLESNMDQKT---EYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QE  R++ S +D++       +  P+    G ++L   +YQLSP +DLTLA  LVR
Sbjct  121  QERRRRVGSILDKQNFIVNGPDKAPILSSNGLDLLASRMYQLSPSQDLTLALSLVR  176



>ref|XP_007202197.1| hypothetical protein PRUPE_ppa018866mg, partial [Prunus persica]
 gb|EMJ03396.1| hypothetical protein PRUPE_ppa018866mg, partial [Prunus persica]
Length=250

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             +KHFVLVHGA HGAWCWYKV+ LL + GH V+ALD+AASG++PK  +Q+ S+++Y EPL
Sbjct  2    NQKHFVLVHGAGHGAWCWYKVSTLLTSIGHNVTALDLAASGVNPKQVQQLHSLSDYVEPL  61

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
              FM +LP  E+V+LVGHS+GG  +S+AME FP KI +AVF TA M GP L++  +  + 
Sbjct  62   MRFMKSLPPKERVILVGHSMGGAAISIAMEKFPEKIYIAVFATALMPGPALNYSNLSSQI  121

Query  406  HRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
               ++  MD +  Y     + P + L G ++L   +YQLSPPEDLTLA  LVR
Sbjct  122  LNSVDF-MDSQFRYDRGPNNPPTATLIGPKLLSSSMYQLSPPEDLTLALSLVR  173



>ref|XP_008241568.1| PREDICTED: methylesterase 10-like [Prunus mume]
Length=261

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 125/179 (70%), Gaps = 8/179 (4%)
 Frame = +1

Query  19   CSG*SIMDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVS  198
            CS     + +KKHFVLVHGA HGAWCWYK++ALL + GH+V+ALD+AASG +PK   QV 
Sbjct  2    CSRSPNPEAQKKHFVLVHGAGHGAWCWYKLSALLTSAGHQVTALDLAASGDNPKQINQVH  61

Query  199  SMAEYNEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL  378
              A+Y EPL EFM +LP+ E+V LVGHS+GG ++S+AME FP KIS AVF TA M GP +
Sbjct  62   CFADYVEPLIEFMESLPSDERVFLVGHSMGGASISIAMERFPEKISAAVFATALMPGPTI  121

Query  379  SFLAVKQEFHRQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLA  540
            S+L + +E   + E  MD  ++Y+ D+     P S + G + L  + YQLSPPEDL LA
Sbjct  122  SYLTIFKEASSRSEF-MD--SQYRFDKGINNPPTSAISGPQRLTSVAYQLSPPEDLALA  177



>ref|XP_007156845.1| hypothetical protein PHAVU_002G0222000g, partial [Phaseolus vulgaris]
 gb|ESW28839.1| hypothetical protein PHAVU_002G0222000g, partial [Phaseolus vulgaris]
Length=172

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 120/169 (71%), Gaps = 8/169 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E+++H VLVHG  HGAWCWYKVAALL++ GH+V+ALDMAAS IHPK AE+++S++EY EP
Sbjct  4    EKERHLVLVHGGGHGAWCWYKVAALLKSSGHQVTALDMAASEIHPKQAEELNSISEYFEP  63

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF+ +L A E+V+LVGHS+GG+ + LAME FP KI+ AVFV   M GPDLS L + QE
Sbjct  64   LMEFVESLAAEERVILVGHSLGGIGMCLAMEKFPKKIAAAVFVNTWMPGPDLSLLTLSQE  123

Query  403  FH----RQLESNMDQK---TEYKEDRPVSVL-FGHEMLEKLVYQLSPPE  525
                  R +ES+ D K    E    +P S + F  E L   +YQLSPPE
Sbjct  124  SRARRPRVVESDSDSKIMTDESNSTQPKSSMKFSPEFLASKLYQLSPPE  172



>emb|CBI32488.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHG+CHGAW WYK+ ALL++ GHKV+ALD+AASGI+PK    + S++ Y +PL +
Sbjct  12   KHFVLVHGSCHGAWSWYKIVALLKSSGHKVTALDLAASGINPKQVGDLRSISWYFQPLRD  71

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            F+ +LPA E+VVLVGHS+GG+ +S AME FP K+SVAVFVTASM GP L+   + QE  R
Sbjct  72   FVESLPADERVVLVGHSLGGLAISQAMEKFPEKVSVAVFVTASMPGPTLNISTLNQESLR  131

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    +D +  Y     + P +  FG   L   VYQLSP EDL L  +L+R
Sbjct  132  RQGPLLDSQFTYDNGPNNPPTTFSFGPLFLSLNVYQLSPTEDLALGTVLMR  182



>ref|XP_008241857.1| PREDICTED: LOW QUALITY PROTEIN: methylesterase 10 [Prunus mume]
Length=261

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 124/179 (69%), Gaps = 8/179 (4%)
 Frame = +1

Query  19   CSG*SIMDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVS  198
            CS     + +KKHFVLVHGA HGAWCWYK++ALL + G+ V+ALD+AASG +PK   QV 
Sbjct  2    CSPSPNPEAQKKHFVLVHGAGHGAWCWYKLSALLTSAGYNVTALDLAASGDNPKQINQVH  61

Query  199  SMAEYNEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL  378
              A+Y EPL EF+ +LP  E+V+LVGHS+GG  +S+AME FP KIS AVF TA M GP +
Sbjct  62   CFADYVEPLIEFIESLPPNERVILVGHSMGGACISIAMERFPEKISAAVFATALMPGPTI  121

Query  379  SFLAVKQEFHRQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLA  540
            S+L + +E   + E  MD  ++Y+ D+     P S +FG + +  + YQLSPPEDL LA
Sbjct  122  SYLTIFEEVSSRSEF-MD--SQYRFDKGLNNPPTSAIFGPQRMTSVFYQLSPPEDLALA  177



>ref|XP_003626738.1| Methyl jasmonate esterase [Medicago truncatula]
Length=285

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            M +++KHFVL+HG  HGAWCWYKVA  L++ GHKV+ALDMAA G +PK  ++V S++EY+
Sbjct  24   MFKQEKHFVLIHGGIHGAWCWYKVATDLKSAGHKVTALDMAACGTNPKQMQEVHSISEYH  83

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            +PL  FM +LP  EKVVLVGHS+GG++VS+AME++PHKI VAVF+TA++   +L++ A  
Sbjct  84   QPLMTFMESLPLEEKVVLVGHSLGGLSVSIAMENYPHKIFVAVFITATVVTQNLTYPAFL  143

Query  397  QEFHRQLESNMDQKT---EYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QE  R++ S +D++       +  P+    G ++L   +YQLSP +DLTLA  LVR
Sbjct  144  QERRRRVGSILDKQNFIVNGPDKAPILSSNGLDLLASRMYQLSPSQDLTLALSLVR  199



>ref|XP_004170642.1| PREDICTED: LOW QUALITY PROTEIN: methylesterase 3-like [Cucumis 
sativus]
Length=285

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFV +HG+CHGAW W+K+  LL++ GH+V+ALD+AASGI  +  + V S+++Y +PLT+
Sbjct  32   KHFVFIHGSCHGAWSWFKLLPLLQSSGHRVTALDLAASGIDHRNPDSVRSISQYFQPLTD  91

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM+ALP  +KV+LVGHS+GG+ VS AME FP KIS AVFVTA+M GP L+   +  +   
Sbjct  92   FMSALPQHQKVILVGHSLGGLVVSKAMEDFPTKISAAVFVTATMPGPALNISTIYSKVFE  151

Query  412  QLESNMDQKTEYKEDR---PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + ES MD    Y + R   P + LFG   L   VYQ SP EDLTLA LL+R
Sbjct  152  RNESMMDSVYSYGDGRNRPPTAFLFGSRFLASKVYQRSPAEDLTLATLLMR  202



>ref|XP_004137122.1| PREDICTED: methylesterase 3-like [Cucumis sativus]
 gb|KGN43959.1| hypothetical protein Csa_7G074920 [Cucumis sativus]
Length=286

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFV +HG+CHGAW W+K+  LL++ GH+V+ALD+AASGI  +  + V S+++Y +PLT+
Sbjct  32   KHFVFIHGSCHGAWSWFKLLPLLQSSGHRVTALDLAASGIDHRNPDSVRSISQYFQPLTD  91

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM+ALP  +KV+LVGHS+GG+ VS AME FP KIS AVFVTA+M GP L+   +  +   
Sbjct  92   FMSALPQHQKVILVGHSLGGLVVSKAMEDFPTKISAAVFVTATMPGPALNISTIYSKVFE  151

Query  412  QLESNMDQKTEYKEDR---PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + ES MD    Y + R   P + LFG   L   VYQ SP EDLTLA LL+R
Sbjct  152  RNESMMDSVYSYGDGRNRPPTAFLFGSRFLASKVYQRSPAEDLTLATLLMR  202



>ref|XP_002284907.3| PREDICTED: salicylic acid-binding protein 2 [Vitis vinifera]
Length=288

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHG+CHGAW WYK+ ALL++ GHKV+ALD+AASGI+PK    + S++ Y +PL +
Sbjct  35   KHFVLVHGSCHGAWSWYKIVALLKSSGHKVTALDLAASGINPKQVGDLRSISWYFQPLRD  94

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            F+ +LPA E+VVLVGHS+GG+ +S AME FP K+SVAVFVTASM GP L+   + QE  R
Sbjct  95   FVESLPADERVVLVGHSLGGLAISQAMEKFPEKVSVAVFVTASMPGPTLNISTLNQESLR  154

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    +D +  Y     + P +  FG   L   VYQLSP EDL L  +L+R
Sbjct  155  RQGPLLDSQFTYDNGPNNPPTTFSFGPLFLSLNVYQLSPTEDLALGTVLMR  205



>ref|XP_009383535.1| PREDICTED: probable esterase PIR7A [Musa acuminata subsp. malaccensis]
Length=300

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            K+HFVLVHG  HGAWCWYK+ ALLR+ GH V+ALD+A SG+HP+  ++V S  +Y  PL 
Sbjct  27   KQHFVLVHGIGHGAWCWYKLTALLRSAGHTVTALDLAGSGVHPQRLDEVRSFGDYARPLM  86

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            E MA++P  EKVVLVGHS GG  V+LAME FP K+ VAVFV   M  P  S   + +EF 
Sbjct  87   EVMASIPPREKVVLVGHSYGGACVALAMERFPEKVLVAVFVAGIMPSPACSVARIAEEFF  146

Query  409  R--QLESNMDQKTEYKEDRPVSVL---FGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +   LE+ MD     ++D P+S+    FG+  L   +YQLSPPEDLTLA +LVR
Sbjct  147  KGHPLEAYMDSTLVVRKD-PLSICSVSFGYNYLSTRLYQLSPPEDLTLATMLVR  199



>ref|XP_004514191.1| PREDICTED: methylesterase 10-like isoform X1 [Cicer arietinum]
Length=262

 Score =   184 bits (467),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 120/175 (69%), Gaps = 6/175 (3%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            K HFVL+HGA +GAWCWYKVA +L++ GH V+ +DM A G++ K  + + S+ +YNEPL 
Sbjct  3    KSHFVLIHGASYGAWCWYKVATMLKSIGHNVTTIDMGACGLNTKQVQDICSILDYNEPLM  62

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
             FM +LP+ EKV+LVGHS GG+++S+AME FP+KIS+A+FV A +   +L++  + QE  
Sbjct  63   TFMESLPSHEKVILVGHSFGGISISMAMEKFPNKISIAIFVAAFVISENLTYPTITQELI  122

Query  409  RQLESNMDQKT------EYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            R+ + N D             + P ++LFG + +E  +YQLSP EDLTLA  LVR
Sbjct  123  RKKDENKDSMDIQHFFFNGPNNPPTALLFGPKFMESKMYQLSPSEDLTLALSLVR  177



>ref|XP_008444767.1| PREDICTED: salicylic acid-binding protein 2-like [Cucumis melo]
Length=293

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 121/174 (70%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ++K  FVLVHG+ HGAW WYK++ +L++ GH V+ALDMAASGI P   + VSS  +Y  P
Sbjct  32   KKKTQFVLVHGSFHGAWSWYKLSTILQSWGHNVTALDMAASGIDPIQPKTVSSAFQYFHP  91

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            LTEF+A LP+ E+VVLVGHS GG+ V+ AME FP KISV VFVTA+M GP+L+   +  E
Sbjct  92   LTEFLAGLPSDERVVLVGHSFGGIGVAAAMEDFPEKISVGVFVTATMPGPNLTLSDILVE  151

Query  403  FHRQLESNMDQKTEYK--EDR-PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +Q    +D    Y   ED+ P S++ G   L K +Y LSPPEDLTLA +LVR
Sbjct  152  NGKQAPPPLDSHYVYDDGEDKPPTSIIVGSLTLAKHLYSLSPPEDLTLATMLVR  205



>ref|XP_008800037.1| PREDICTED: probable esterase PIR7A [Phoenix dactylifera]
Length=255

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 119/171 (70%), Gaps = 4/171 (2%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            HF+LVHG CHGAWCWY++A LLR+ GH+V+ALD+AASGI+PK  +++   A+Y EPL E 
Sbjct  3    HFILVHGMCHGAWCWYQLATLLRSAGHRVTALDLAASGINPKRLDELRRFADYTEPLMEV  62

Query  235  MAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHRQ  414
            MA++P  EKV LVGHS+GG N++LAME FP KI+VAVF +A M           QE+ R+
Sbjct  63   MASIPLDEKVALVGHSLGGFNLALAMEKFPEKIAVAVFASAWMPSISTPMSVFMQEYSRR  122

Query  415  LESN-MDQK---TEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                 MD K   +E  E+   S LFG + +   +YQLSPP+DLTLA +LVR
Sbjct  123  NPPGPMDSKIIVSEDPENPFTSFLFGPKYMATTMYQLSPPKDLTLATMLVR  173



>ref|XP_009366348.1| PREDICTED: salicylic acid-binding protein 2-like [Pyrus x bretschneideri]
Length=295

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +  KHFVL+HGACHGAW WYKVA LLR  GH V+ALD+ ASGI+P   +Q+ S++E+ EP
Sbjct  43   QSPKHFVLIHGACHGAWSWYKVATLLRNSGHNVTALDLGASGINPIQVQQLPSLSEFVEP  102

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            LT+ M +LP  EKV+LVGHS+GG  +S+ ME FP K++ A+FVTA M+GP L+F     E
Sbjct  103  LTKVMVSLPPNEKVILVGHSLGGAVISIFMERFPEKVAAAIFVTAVMYGPTLNFSTASAE  162

Query  403  FHRQLESNMDQKTEYKE--DRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +  +  MD +  Y    + P  S+L G + +  ++YQLSPP+DL LA  LVR
Sbjct  163  VTKGRQF-MDTQYRYDNGTNNPATSLLLGPKDMATILYQLSPPQDLNLALSLVR  215



>ref|XP_009366356.1| PREDICTED: salicylic acid-binding protein 2-like [Pyrus x bretschneideri]
Length=296

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 119/171 (70%), Gaps = 4/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVL+HGACHGAW WYKVA LL+  GH V+ALD+ ASGI+P   +Q+ S++EY EPLTE
Sbjct  47   KHFVLIHGACHGAWSWYKVATLLKDSGHNVTALDLGASGINPIQVQQLPSLSEYVEPLTE  106

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             M +LP  EKV+LV HS+GG  +S+ ME FP KI+ AV+VTA M GP L++  +  E  +
Sbjct  107  LMVSLPPKEKVILVAHSLGGAVISIFMERFPQKIAAAVYVTAFMSGPTLNYSTIFAEVTK  166

Query  412  QLESNMDQKTEYKE--DRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + +  MD +  Y    + P  S LFG ++L   +YQLSPP+DLTL   LVR
Sbjct  167  RFDF-MDSQFRYDNGTNNPATSFLFGPKVLATELYQLSPPQDLTLGLSLVR  216



>gb|KHN01611.1| Polyneuridine-aldehyde esterase [Glycine soja]
Length=257

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 122/170 (72%), Gaps = 3/170 (2%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            HFVLVHG  HGAWCWYKVA  L++EGH V+ LDMAA G++PK  ++V S++EYNEPL  F
Sbjct  2    HFVLVHGGLHGAWCWYKVANKLKSEGHNVTTLDMAACGVNPKQRQEVHSVSEYNEPLMTF  61

Query  235  MAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHRQ  414
            MA+LP  EKV+LVGHS+GG++ S+AME++P KISVAVF+TA++   +L++ A  QE  R+
Sbjct  62   MASLPPEEKVILVGHSLGGLSASIAMENYPEKISVAVFITATVVSQNLTYPAFLQERRRR  121

Query  415  LES-NMDQ--KTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            L S N+D+    +     P+    G E+L    YQL+  EDLTLA  LVR
Sbjct  122  LISLNLDEFFILDGVNKAPILSSLGVELLASRFYQLTSNEDLTLAFCLVR  171



>ref|XP_007156843.1| hypothetical protein PHAVU_002G022100g [Phaseolus vulgaris]
 gb|ESW28837.1| hypothetical protein PHAVU_002G022100g [Phaseolus vulgaris]
Length=264

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 129/177 (73%), Gaps = 6/177 (3%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E+K+  VLVHGA HGAWCWYK++A L++ G + ++LDMAASGIHPK  + ++S++++ EP
Sbjct  4    EKKRRLVLVHGAYHGAWCWYKLSAFLKSTGLQFTSLDMAASGIHPKQVQDLTSVSQFVEP  63

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L +F+ +LP  E+V+LVGHS GG+ +SLAME FPH+I+ AVFVT  M GP LS+L++ QE
Sbjct  64   LIQFLRSLPPEERVILVGHSFGGLCISLAMEMFPHQIAAAVFVTGWMPGPHLSYLSLLQE  123

Query  403  F-HR-QLESNMDQKT---EYKED-RPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            F HR  L+S++  K    +Y  D +   + F  + L   VYQLSPPEDLTLA  L+R
Sbjct  124  FKHRLSLKSDLGSKNVSDDYTSDHQKQHMTFDPQNLASNVYQLSPPEDLTLALSLLR  180



>ref|XP_002284950.3| PREDICTED: salicylic acid-binding protein 2-like [Vitis vinifera]
Length=317

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHG+CHGAW WYK+ ALL++ GHKV+ALD+AASGI+ K    +  ++EY +PL +
Sbjct  64   KHFVLVHGSCHGAWSWYKIVALLKSSGHKVTALDLAASGINTKQVGDLRLISEYFQPLRD  123

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM +LPA E+VVLVGHS GG+ +S AME FP K+SVAVFVTASM GP L+   + QE  R
Sbjct  124  FMESLPADERVVLVGHSSGGLAISQAMEKFPEKVSVAVFVTASMPGPTLNISTLNQETSR  183

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    +D +  Y     + P +  FG   L   +YQLSP EDL L  +L+R
Sbjct  184  RQGPLLDSQFTYDNGPNNPPTTFTFGPLFLSLNLYQLSPTEDLALGTMLMR  234



>emb|CDO97130.1| unnamed protein product [Coffea canephora]
Length=292

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHF+LVHGACHGAW WYK+ ALLR+ GH V+ALD+AASGI+PK    V  +++Y +PL +
Sbjct  38   KHFILVHGACHGAWSWYKLVALLRSAGHNVTALDLAASGINPKQVYDVKYISDYFQPLRD  97

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FMA+L + E+V+LVGHS GG+ +S AME FP KI+VAVF+TA M GP+L    + QE  R
Sbjct  98   FMASLSSNERVILVGHSFGGLAISQAMEIFPKKITVAVFITALMPGPELKISILNQESFR  157

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  S +D    Y     + P + +FG + L   VYQ SP EDL LA +L+R
Sbjct  158  RQNSLLDSHFLYDNGPNNPPTAFVFGPKHLSAKVYQRSPIEDLALATMLLR  208



>ref|XP_004172528.1| PREDICTED: salicylic acid-binding protein 2-like [Cucumis sativus]
Length=315

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 119/175 (68%), Gaps = 5/175 (3%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             K HFVLVHGAC GAW WY+V   L+  GHKV+ALDMAA+GI P   E ++S+ +Y +PL
Sbjct  41   NKSHFVLVHGACLGAWSWYQVTTFLQTAGHKVTALDMAAAGIDPTQPESLTSLTDYFQPL  100

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE-  402
              F  AL A +K+VLVGHS+GG+ +S+AME FP KISVA+FVTA+M GP + F +++++ 
Sbjct  101  LNFTEALQADDKIVLVGHSLGGLGISMAMERFPEKISVAIFVTAAMPGPIIGFQSIEEQK  160

Query  403  ----FHRQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                 ++      D K+E  +  P   +F  E LE  ++ LSPP+DLTLA+ LVR
Sbjct  161  TTLGMYKAFHKGDDTKSEVSKKPPRLFMFSEEELETKLFPLSPPQDLTLARTLVR  215



>ref|XP_007199380.1| hypothetical protein PRUPE_ppa025654mg [Prunus persica]
 gb|EMJ00579.1| hypothetical protein PRUPE_ppa025654mg [Prunus persica]
Length=268

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVHG+C GAW WYK+  L+++ GH V+A+D+AASG+ P+ A+ + S+++Y +PLT
Sbjct  12   KKHFVLVHGSCFGAWSWYKLVTLMKSSGHNVTAIDLAASGVDPQQAKDLQSISDYFKPLT  71

Query  229  EFMAAL-PAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF  405
            +FMAAL P  +KV+LVGHS+GG+ +S AME FP KIS+AVFVTA M GP L+   + QE 
Sbjct  72   DFMAALDPPHDKVILVGHSLGGLAISHAMERFPDKISLAVFVTALMPGPTLNISTLNQES  131

Query  406  HRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             R+  S +D K  Y +   + P+++ FG   L   +YQLSP ED+ L  +L+R
Sbjct  132  FRRQGSLLDSKYTYDQGPNNPPITLTFGPLFLATNMYQLSPTEDVALGTILMR  184



>emb|CBI32472.3| unnamed protein product [Vitis vinifera]
Length=314

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHG+CHGAW WYK+ ALL++ GHKV+ALD+AASGI+ K    +  ++EY +PL +
Sbjct  61   KHFVLVHGSCHGAWSWYKIVALLKSSGHKVTALDLAASGINTKQVGDLRLISEYFQPLRD  120

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM +LPA E+VVLVGHS GG+ +S AME FP K+SVAVFVTASM GP L+   + QE  R
Sbjct  121  FMESLPADERVVLVGHSSGGLAISQAMEKFPEKVSVAVFVTASMPGPTLNISTLNQETSR  180

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    +D +  Y     + P +  FG   L   +YQLSP EDL L  +L+R
Sbjct  181  RQGPLLDSQFTYDNGPNNPPTTFTFGPLFLSLNLYQLSPTEDLALGTMLMR  231



>ref|XP_008454904.1| PREDICTED: methylesterase 3-like [Cucumis melo]
Length=291

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFV +HG+CHGAW W+K+  LL++ GH+V+ALD+AASGI  +  + + S+++Y +PLT+
Sbjct  37   KHFVFIHGSCHGAWSWFKLLPLLQSSGHRVTALDLAASGIDHRNPDSIRSISQYFQPLTD  96

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM+ALP  +KV+LVGHS+GG+ V+ AME FP +IS AVFVTA+M GP L+   +  +   
Sbjct  97   FMSALPQHQKVILVGHSLGGLAVAKAMEEFPTRISAAVFVTATMPGPALNISTIYGKVFE  156

Query  412  QLESNMDQKTEYKEDR---PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + ES MD    Y +     P + LFG   L   VYQ SPPEDLTLA LL+R
Sbjct  157  RNESMMDSVYSYGDGTNRPPTAFLFGPRFLASKVYQRSPPEDLTLATLLMR  207



>ref|XP_003529022.2| PREDICTED: polyneuridine-aldehyde esterase-like [Glycine max]
Length=328

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 122/170 (72%), Gaps = 3/170 (2%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            HFVLVHG  HGAWCWYKVA  L++EGH V+ LDMAA G++PK  ++V S++EYNEPL  F
Sbjct  73   HFVLVHGGLHGAWCWYKVANKLKSEGHNVTTLDMAACGVNPKQRQEVHSVSEYNEPLMTF  132

Query  235  MAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHRQ  414
            MA+LP  EKV+LVGHS+GG++ S+AME++P KISVAVF+TA++   +L++ A  QE  R+
Sbjct  133  MASLPPEEKVILVGHSLGGLSASIAMENYPEKISVAVFITATVVSQNLTYPAFLQERRRR  192

Query  415  LES-NMDQ--KTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            L S N+D+    +     P+    G E+L    YQL+  EDLTLA  LVR
Sbjct  193  LISLNLDEFFILDGVNKAPILSSLGVELLASRFYQLTSNEDLTLAFCLVR  242



>ref|XP_008339151.1| PREDICTED: salicylic acid-binding protein 2-like [Malus domestica]
Length=286

 Score =   182 bits (461),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 4/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVL HGACHGAW WYKVA LLR  GH V+ALD+ ASGI+P   +Q+ S++E+ EPLT+
Sbjct  37   KHFVLXHGACHGAWSWYKVATLLRNSGHNVTALDLGASGINPIQVQQLPSLSEFVEPLTK  96

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             M +L   EKV+LVGHS+GG  +S+ ME FPHK++ AVFVTA M+GP L+F  V  E  +
Sbjct  97   VMVSLLPNEKVILVGHSLGGAVISIFMERFPHKVAAAVFVTAIMYGPTLNFSTVHAEVTK  156

Query  412  QLESNMDQKTEYKE--DRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +  MD +  Y    + P  S +FG + +   +YQLSPP+DL LA  LVR
Sbjct  157  GRDL-MDTQYRYDNGTNNPATSQVFGPKFMATSLYQLSPPQDLNLALSLVR  206



>ref|XP_004514196.1| PREDICTED: methylesterase 10-like isoform X1 [Cicer arietinum]
Length=262

 Score =   181 bits (459),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 119/175 (68%), Gaps = 6/175 (3%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            K HFVL+HGA +GAWCWYKVA +L++ GH V+ +DM A G++ K  + + S+ +YNEPL 
Sbjct  3    KSHFVLIHGASYGAWCWYKVATMLKSIGHNVTTIDMGACGLNTKQVQDICSILDYNEPLM  62

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
             FM +LP+ EKV+LVGHS GG+++S+AME FP+KIS+A+F  A +   +L++  + QE  
Sbjct  63   TFMESLPSHEKVILVGHSFGGISISMAMEKFPNKISIAIFAAAFVISENLTYPTITQELI  122

Query  409  RQLESNMDQKT------EYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            R+ + N D             + P ++LFG + +E  +YQLSP EDLTLA  LVR
Sbjct  123  RKRDENKDSMDIQHFFFNGPNNPPTALLFGPKFMESKMYQLSPFEDLTLALSLVR  177



>ref|XP_004300557.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=282

 Score =   182 bits (461),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 121/176 (69%), Gaps = 8/176 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E  KHFVLVHG+ HGAWCWYK+A LL + GH V+ LD+ ASGI+    +Q+ S ++Y EP
Sbjct  15   ENSKHFVLVHGSGHGAWCWYKLATLLSSTGHNVTTLDLPASGINQTQQQQLHSFSDYAEP  74

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF+ +LP  EKV+LVGHS+GG  +S+AME FP KI+ AVF TA M GPD S+L + Q+
Sbjct  75   LFEFLGSLPPEEKVILVGHSMGGPVISIAMEMFPEKIAAAVFATAFMPGPDFSYLTIYQK  134

Query  403  FHRQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                +E  +   +++  D+     P +++FG + L   +YQLSPPEDLTLA  LVR
Sbjct  135  L---VERTVVSDSQFINDQGVDNPPSAMIFGPKRLATKLYQLSPPEDLTLALSLVR  187



>ref|XP_006346475.1| PREDICTED: salicylic acid-binding protein 2-like [Solanum tuberosum]
Length=297

 Score =   182 bits (462),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 119/174 (68%), Gaps = 7/174 (4%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGACHGAW WYK+ AL+R+ GH V++LD+ ASGI+ K   ++  + +Y  PL E
Sbjct  43   KHFVLVHGACHGAWSWYKIVALIRSSGHNVTSLDLGASGINNKQVLEIPHLFDYFSPLME  102

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL---SFLAVKQE  402
            FMA+LPA EKV+LVGHS GG+ +S AME FP KISVAVFVTA M GP L   + L   Q 
Sbjct  103  FMASLPAHEKVILVGHSFGGLAISNAMERFPEKISVAVFVTALMPGPTLNVTTLLTKLQS  162

Query  403  FHRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            F+  + S +D +  Y     + P + +FG + L + VYQLSP +DL LA  LVR
Sbjct  163  FNGNV-SQLDNRVTYDNGPTNPPTTFIFGPKYLARNVYQLSPIQDLALATTLVR  215



>ref|XP_004137124.1| PREDICTED: salicylic acid-binding protein 2-like [Cucumis sativus]
 gb|KGN43964.1| hypothetical protein Csa_7G074970 [Cucumis sativus]
Length=315

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 119/175 (68%), Gaps = 5/175 (3%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             K HFVLVHGAC GAW WY+V   L+  GHKV+A+DMAA+GI P   E ++S+ +Y +PL
Sbjct  41   NKSHFVLVHGACLGAWSWYQVTTFLQTAGHKVTAVDMAAAGIDPTQPESLTSLTDYFQPL  100

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE-  402
              F  AL A +K+VLVGHS+GG+ +S+AME FP KISVA+FVTA+M GP + F +++++ 
Sbjct  101  LNFTEALQADDKIVLVGHSLGGLGISMAMERFPEKISVAIFVTAAMPGPIIGFQSIEEQK  160

Query  403  ----FHRQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                 ++      D K+E  +  P   +F  E LE  ++ LSPP+DLTLA+ LVR
Sbjct  161  TTLGMYKAFHKGDDTKSEVSKKPPRLFMFSEEELETKLFPLSPPQDLTLARTLVR  215



>ref|XP_008368952.1| PREDICTED: salicylic acid-binding protein 2-like [Malus domestica]
Length=292

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 116/172 (67%), Gaps = 4/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
             KHFVL+HGACHGAW WYKVA LL+  GH V+ALD+ ASGI+P   +Q+ S++EY EPLT
Sbjct  42   NKHFVLIHGACHGAWSWYKVATLLKDSGHNVTALDLGASGINPIRVQQLPSLSEYVEPLT  101

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            E M +LP  EKV+LV HS+GG  +S+ ME FP KI+ AV+VTA M GP L++  +  E  
Sbjct  102  ELMVSLPPKEKVILVAHSLGGAVISIFMERFPQKIAAAVYVTAFMSGPTLNYSTIFAEVT  161

Query  409  RQLESNMDQKTEYKE--DRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++ +  MD +  Y    + P  S LFG  +L    YQLSPP+D TL   LVR
Sbjct  162  KRFDF-MDSQFRYDNGTNNPATSFLFGPNVLATSFYQLSPPQDSTLGLSLVR  212



>ref|XP_007200274.1| hypothetical protein PRUPE_ppa014939mg [Prunus persica]
 gb|EMJ01473.1| hypothetical protein PRUPE_ppa014939mg [Prunus persica]
Length=269

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 122/176 (69%), Gaps = 4/176 (2%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            +E KKHFVLVHG+C GAW WYK+  L+++ GH V+ALD+AASG+ P+ A+ + S+++Y +
Sbjct  10   EESKKHFVLVHGSCFGAWSWYKLVTLMKSSGHNVTALDLAASGVDPQQAKDLQSISDYFK  69

Query  220  PLTEFMAAL-PAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            PLT FMAAL P  +KV+LVGHS+GG+ +S AME F  KIS+ VF+TA M GP L+   + 
Sbjct  70   PLTNFMAALDPPHDKVILVGHSLGGLAISYAMERFLDKISLVVFITALMPGPTLNISTLN  129

Query  397  QEFHRQLESNMDQKTEYKED---RPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QE  R+  S +D K  Y +     P+++ FG   L   VYQLSP EDL L  +L+R
Sbjct  130  QESFRRQRSLLDSKYTYDQGPNYPPITLTFGPLFLATNVYQLSPTEDLALGTMLMR  185



>gb|KDO48824.1| hypothetical protein CISIN_1g024134mg [Citrus sinensis]
Length=272

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 123/178 (69%), Gaps = 9/178 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +++KHFVLVHG+ HGAWCWYKV   L A GH+V+A+D+AASGI+ K  + V S  EYNEP
Sbjct  14   KKQKHFVLVHGSNHGAWCWYKVKPRLEAAGHRVTAMDLAASGINMKKIQDVRSFYEYNEP  73

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA--VK  396
            L E +A+L A EKV+LVGHS GG++V+LA + FPHKISVA+F+TA  F PD       V 
Sbjct  74   LLEILASLSADEKVILVGHSFGGLSVALAADKFPHKISVAIFLTA--FMPDTKHQPSYVV  131

Query  397  QEFHRQLESNMDQKTEY---KEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + F   +       T+Y    E  P  +S+LFGH+ L   +YQLSPPEDL LAK+LV+
Sbjct  132  ERFSESIPREERLDTQYSIIDESNPSRMSILFGHKFLTLKLYQLSPPEDLELAKMLVK  189



>pdb|3STY|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
T18a Mutant
 pdb|3STY|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
T18a Mutant
Length=267

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 118/172 (69%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH A HGAWCWYK+ AL+R+ GH V+ALD+ ASGI+PK A Q+ + ++Y  PL 
Sbjct  12   KKHFVLVHAAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLM  71

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA EK++LVGH++GG+ +S AME+FP KISVAVF++  M GP++    V  +  
Sbjct  72   EFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAG  131

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D    Y+    + P +++ G + L   VY LSP EDL LA  LVR
Sbjct  132  SAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVR  183



>pdb|3STX|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
H243a Variant Complexed With Beta-ketoheptanoate
 pdb|3STX|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
H243a Variant Complexed With Beta-ketoheptanoate
Length=267

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 118/172 (69%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH A HGAWCWYK+ AL+R+ GH V+ALD+ ASGI+PK A Q+ + ++Y  PL 
Sbjct  12   KKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLM  71

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA EK++LVGH++GG+ +S AME+FP KISVAVF++  M GP++    V  +  
Sbjct  72   EFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAG  131

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D    Y+    + P +++ G + L   VY LSP EDL LA  LVR
Sbjct  132  SAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVR  183



>ref|XP_006346486.1| PREDICTED: polyneuridine-aldehyde esterase-like [Solanum tuberosum]
Length=260

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH ACHGAW WYK+ ALLR+ GH V+ALD+AASGI+PK   +V   ++Y  PL 
Sbjct  11   KKHFVLVHAACHGAWSWYKIVALLRSSGHNVTALDLAASGINPKQTLEVPLFSDYLIPLM  70

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA EKVVLVGHS GG+ +S AME+FP KISVAVFV+A M GP+++   +  E  
Sbjct  71   EFMASLPAHEKVVLVGHSYGGLAISKAMETFPEKISVAVFVSAHMPGPNINVTTIYSEVL  130

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +  S  D +  Y     + P + + G + +E  VYQ S  +DL LA  LVR
Sbjct  131  FKSISQPDNRIIYDNGPTNPPTTYILGPKYMETDVYQRSSIQDLALATTLVR  182



>ref|XP_009616768.1| PREDICTED: salicylic acid-binding protein 2-like [Nicotiana tomentosiformis]
Length=300

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
             KHFVLVHG CHGAW WYK+ AL+R+ G+ V+ALD+ ASGI+PK   ++  +++Y  PL 
Sbjct  47   NKHFVLVHGVCHGAWSWYKLVALMRSSGYNVTALDLGASGINPKQVLEIPRLSDYFSPLM  106

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            +FMA+LPA EKVVLVGHS GG  VS AME FP KISV+VFVTA M GP L+   V  E  
Sbjct  107  KFMASLPAHEKVVLVGHSFGGFAVSKAMEIFPEKISVSVFVTAGMPGPTLNATTVFIEAS  166

Query  409  RQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             ++ S +D +  Y+    + P + +FG + L   +YQLSP +D  LA  LVR
Sbjct  167  SEIISQLDNRLTYENGPNNPPTTFIFGPKYLASNLYQLSPIQDWALATTLVR  218



>gb|ADK38535.1| methylketone synthase I [Lycopersicon hirsutum f. glabratum]
Length=265

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 118/172 (69%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH A HGAWCWYK+ AL+R+ GH V+ALD+ ASGI+PK A Q+ + ++Y  PL 
Sbjct  10   KKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLM  69

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA EK++LVGH++GG+ +S AME+FP KISVAVF++  M GP++    V  +  
Sbjct  70   EFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAG  129

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D    Y+    + P +++ G + L   VY LSP EDL LA  LVR
Sbjct  130  SAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVR  181



>pdb|3STT|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
Apo Form
 pdb|3STT|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
Apo Form
 pdb|3STU|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With Methyl-3-hydroxydodecanoate
 pdb|3STU|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With Methyl-3-hydroxydodecanoate
 pdb|3STV|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With 3- Hydroxyoctanoate
 pdb|3STV|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With 3- Hydroxyoctanoate
 pdb|3STW|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With 2- Tridecanone
 pdb|3STW|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With 2- Tridecanone
Length=267

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 118/172 (69%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH A HGAWCWYK+ AL+R+ GH V+ALD+ ASGI+PK A Q+ + ++Y  PL 
Sbjct  12   KKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLM  71

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA EK++LVGH++GG+ +S AME+FP KISVAVF++  M GP++    V  +  
Sbjct  72   EFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAG  131

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D    Y+    + P +++ G + L   VY LSP EDL LA  LVR
Sbjct  132  SAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVR  183



>gb|AAV87156.1| MKS1 [Lycopersicon hirsutum f. glabratum]
Length=265

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 118/172 (69%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH A HGAWCWYK+ AL+R+ GH V+ALD+ ASGI+PK A Q+ + ++Y  PL 
Sbjct  10   KKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLXASGINPKQALQIPNFSDYLSPLM  69

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA EK++LVGH++GG+ +S AME+FP KISVAVF++  M GP++    V  +  
Sbjct  70   EFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAG  129

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D    Y+    + P +++ G + L   VY LSP EDL LA  LVR
Sbjct  130  SAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVR  181



>gb|KEH17958.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=281

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 119/175 (68%), Gaps = 2/175 (1%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            +D   KHFVLVHGA HG WCWYKVA +L++ GH V+ +DMAASGI+P   +++ S+++Y 
Sbjct  22   VDVNGKHFVLVHGAGHGEWCWYKVATMLKSAGHNVTTIDMAASGINPIQVQEIHSISKYY  81

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL  FM +LP  EKV+LVGHS GG+ +S+AME F  K+SVAVFVTA +    L+F +V 
Sbjct  82   EPLMTFMESLPPKEKVILVGHSYGGIPLSVAMEKFSKKVSVAVFVTALVMSETLNFTSVI  141

Query  397  QEFHRQLESNMDQKTEYK--EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QE  R+ + N  Q   +      P ++L G ++L   +YQLSP EDLTL   LVR
Sbjct  142  QENERRTQQNPPQLLFFNGPNSPPTALLLGSKLLASHLYQLSPNEDLTLGSSLVR  196



>ref|XP_010921788.1| PREDICTED: probable esterase PIR7A isoform X1 [Elaeis guineensis]
Length=262

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 120/177 (68%), Gaps = 5/177 (3%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            +E KKHF+LVHG CHGAWCWYK+A LLR+ G +V+ALD+AASG+HPK   ++ S ++Y  
Sbjct  3    EESKKHFILVHGMCHGAWCWYKLATLLRSAGQRVTALDLAASGVHPKCLNELRSFSDYYA  62

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQ  399
            PL E MA++P+GE+VVLVGHS GG  ++LA E FP K+SVAVFV+A+M         + Q
Sbjct  63   PLMEAMASIPSGERVVLVGHSYGGYGIALAAEKFPEKVSVAVFVSAAMPSISAPLSTMDQ  122

Query  400  EFHRQL--ESNMDQKTEYKEDRPV---SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            EF ++   E  MD K    +D  +   S+  G   ++  +YQL P EDL LA +LVR
Sbjct  123  EFFKRYPPEFFMDSKFFISQDPQICSTSIALGPNYMKAKLYQLCPLEDLMLATMLVR  179



>ref|XP_004230826.1| PREDICTED: polyneuridine-aldehyde esterase [Solanum lycopersicum]
 gb|ADK38537.1| methylketone synthase Ia [Solanum lycopersicum]
Length=265

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH A HGAWCWYK+ AL+R+ GH V+ALD+ ASGI+PK A ++ + ++Y+ PL 
Sbjct  10   KKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALEIPNFSDYSSPLM  69

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA EK++LVGH++GG+ +S AME+FP KISVAVF++  M GP++    V  +  
Sbjct  70   EFMASLPANEKLILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVYTKAA  129

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D    Y+    + P +++ G + L   VY LSP EDL LA  LVR
Sbjct  130  SAVIGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVR  181



>ref|XP_007042333.1| Methyl esterase 10, putative isoform 1 [Theobroma cacao]
 gb|EOX98164.1| Methyl esterase 10, putative isoform 1 [Theobroma cacao]
Length=300

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E  KHFVLVHG+CHGAW WYK+  LL++EGH V+ +D+A SG+ P+    + S+++Y +P
Sbjct  43   EPPKHFVLVHGSCHGAWSWYKLVPLLKSEGHNVTGIDLAGSGVDPQQVNTLRSISDYIKP  102

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L +FM +LP  +KVVLVGHS+GG+ +S AME FP KISVAVF+TA M GP L+   + Q 
Sbjct  103  LRDFMESLPDQQKVVLVGHSLGGLAISQAMERFPEKISVAVFLTALMPGPTLNISTLSQR  162

Query  403  FHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              ++ +S MD    Y     + P + +FG   L   VYQLSP ED  LA +L+R
Sbjct  163  AFKEQDSQMDSLYTYDNGPNNAPTTFIFGPLYLSSQVYQLSPREDWALANVLMR  216



>emb|CAN67986.1| hypothetical protein VITISV_010770 [Vitis vinifera]
Length=674

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KH+VLVHG+CHGAW WYK+ ALL++ GHKV+ALD+AASGI+PK    + S++EY +PL +
Sbjct  421  KHYVLVHGSCHGAWSWYKIVALLKSSGHKVTALDLAASGINPKQVGDLRSISEYFQPLRD  480

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM +LPA E+VVLVGHS+GG+ +S AME FP K+SVAVFVTASM GP L+   + QE  R
Sbjct  481  FMESLPADERVVLVGHSLGGLAISQAMEKFPEKVSVAVFVTASMPGPTLNISTLNQESLR  540

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    +D +  Y     + P +  FG       VYQLSP EDL L  +L+R
Sbjct  541  RQGPLLDSQFTYDNGPNNPPTTFTFGPLFSSLNVYQLSPTEDLALGTMLMR  591



>ref|XP_006485625.1| PREDICTED: methylesterase 1-like [Citrus sinensis]
Length=272

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 123/178 (69%), Gaps = 9/178 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +++KHFVLVHG+ HGAWCWYKV   L A GH+V+A+D+AASGI+ K  + V S  EYNEP
Sbjct  14   KKQKHFVLVHGSNHGAWCWYKVKPRLEAAGHRVTAMDLAASGINMKKIQDVRSFYEYNEP  73

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA--VK  396
            L E +A+L A EKV+LVGHS GG++V+LA + FPHKISVA+F+TA  F PD       V 
Sbjct  74   LLEILASLSADEKVILVGHSFGGLSVALAADKFPHKISVAIFLTA--FMPDTKHQPSYVV  131

Query  397  QEFHRQLESNMDQKTEY---KEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + F   +       T+Y    +  P  +S+LFGH+ L   +YQLSPPEDL LAK+LV+
Sbjct  132  ERFSESIPREERLDTQYSIIDKSNPSRMSILFGHKFLTLKLYQLSPPEDLELAKMLVK  189



>ref|XP_002313085.2| hypothetical protein POPTR_0009s11070g [Populus trichocarpa]
 gb|EEE87040.2| hypothetical protein POPTR_0009s11070g [Populus trichocarpa]
Length=289

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 115/171 (67%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGA HGAWCWYK+  LLR+ GH V+ +D+AASGI P+    + S+++Y  PL +
Sbjct  35   KHFVLVHGAGHGAWCWYKLVPLLRSSGHNVTTIDLAASGIDPRQISDLQSISDYIRPLRD  94

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             +A+LP  EKV+LVGHS+GG+ +S  ME  P KISVAVF+TA M GP L+   + QE  R
Sbjct  95   LLASLPPNEKVILVGHSLGGLALSQTMERLPSKISVAVFLTAVMPGPSLNISTLSQELAR  154

Query  412  QLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +L   +D +  +     + P S+ FG + L   +YQLSP ED TLA  L+R
Sbjct  155  RLTDMLDTRYTFGNGPNNPPTSLTFGPKYLLLRLYQLSPIEDWTLATTLMR  205



>ref|XP_006346488.1| PREDICTED: polyneuridine-aldehyde esterase-like [Solanum tuberosum]
Length=283

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 118/172 (69%), Gaps = 4/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH A HGAWCWYK+ ALLR+ GH V+ALD+AASGI+PK   QV   ++Y  PL 
Sbjct  30   KKHFVLVHTAGHGAWCWYKIVALLRSSGHNVTALDLAASGINPKQTFQVPLFSDYLVPLM  89

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA EKVVLVGH+ GG+ ++ AME+FP KISVAVFVTA M GP ++   V  E  
Sbjct  90   EFMASLPAHEKVVLVGHTYGGLAIAKAMETFPAKISVAVFVTALMPGPKINVTTVYTELL  149

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + + S  D +  Y     + P   + G + +E  +YQ SP +DLTLA  LVR
Sbjct  150  KSV-SQPDNRFIYNNGPTNPPTIFIPGPKYMETNMYQRSPFQDLTLAYTLVR  200



>ref|XP_008810785.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Phoenix 
dactylifera]
Length=282

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 117/177 (66%), Gaps = 5/177 (3%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            DE KKHF+LVHG CHGAWCWYK+A LL + GHKV+ LD+ ASG+HPK  + + S  +Y E
Sbjct  23   DESKKHFILVHGLCHGAWCWYKLATLLTSAGHKVTWLDLGASGVHPKNLDDLRSFTDYWE  82

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQ  399
            PL E MA++P  +KV+LVGHS GG++V+LAME FP K+SV VF TA M        ++ +
Sbjct  83   PLMEIMASIPPDDKVILVGHSFGGLSVALAMEKFPEKVSVGVFATALMPSTTTPLSSIME  142

Query  400  EFHR--QLESNMDQKTEYKED--RPVSVL-FGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            E  +   LE+ MD K     D   P S L FG + +   +YQL+ PED  LA +LVR
Sbjct  143  ELFKGHPLEAYMDSKVMISTDPNNPSSFLHFGPKYMSSRMYQLTAPEDFMLATMLVR  199



>ref|XP_007047146.1| Methyl esterase 10, putative [Theobroma cacao]
 gb|EOX91303.1| Methyl esterase 10, putative [Theobroma cacao]
Length=257

 Score =   178 bits (452),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 122/173 (71%), Gaps = 5/173 (3%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHG CHGAWCWYK+ +LL++ GH+V+ALD+ ASGI+P+   +++SM++Y +PL E
Sbjct  2    KHFVLVHGMCHGAWCWYKLVSLLKSAGHRVTALDLGASGINPRKISELTSMSDYAQPLME  61

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FMA+LP  EKV+LVGHS GG+++SLAMES+P+KI  AV++TA M   D       +EF +
Sbjct  62   FMASLPQEEKVILVGHSFGGISMSLAMESYPNKILAAVYLTAFMPNHDSPPGTGVEEFFK  121

Query  412  QL--ESNMDQKTEYKED---RPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +  ES MD +  + E     P   LFG   +   VYQLSP EDL LAK ++R
Sbjct  122  SVMAESIMDFQLSFDEGPNHPPTGALFGPNYMVAKVYQLSPKEDLELAKTVLR  174



>ref|XP_010918137.1| PREDICTED: probable esterase PIR7A isoform X1 [Elaeis guineensis]
 ref|XP_010918138.1| PREDICTED: probable esterase PIR7A isoform X1 [Elaeis guineensis]
Length=296

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 117/171 (68%), Gaps = 4/171 (2%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            H++LVHG CHGAWCWY++A LLR+ GH+V+ LD+AASGI+PK   ++   A+Y+EPL E 
Sbjct  37   HYILVHGMCHGAWCWYQLATLLRSAGHRVTVLDLAASGINPKRLVELRRFADYSEPLMEA  96

Query  235  MAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHRQ  414
            MA++P+ EKVVLVGHS+GG N++LAME FP KI+VAVF +A M            E+ R+
Sbjct  97   MASIPSDEKVVLVGHSLGGFNLALAMEKFPEKITVAVFASAWMPSISTPMSVFMHEYSRR  156

Query  415  LESN-MDQKTEYKED--RP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                 MD K    ED   P  S LFG + +   +YQLSPPEDLTLA LL R
Sbjct  157  NPPGPMDSKIIVNEDPENPFTSFLFGPKYMATTMYQLSPPEDLTLATLLGR  207



>gb|KEH17957.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=286

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 121/170 (71%), Gaps = 3/170 (2%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            +FVL+HG  HGAWCWYKV  +L++ GH V+ +++AASGI+P   +++ S+++Y EPL  F
Sbjct  32   NFVLIHGGSHGAWCWYKVVTMLKSAGHNVTTIELAASGINPIQVQEIHSISKYYEPLMTF  91

Query  235  MAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHRQ  414
            M +LP  EKV+LVGHS+GGV+ S+AME FP KISVAVFVTA +   +LS+  V QE  R+
Sbjct  92   MESLPPNEKVILVGHSLGGVSTSVAMEKFPQKISVAVFVTAYVLSQNLSYPVVLQEQARR  151

Query  415  LESNMDQKTEYKE--DRPVSV-LFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            L S MD K  + +  ++P +  L G + +   +YQLSP EDLTLA  LVR
Sbjct  152  LSSLMDTKFFFFDGPNKPATARLVGPKFMASKMYQLSPSEDLTLALSLVR  201



>ref|XP_006425813.1| hypothetical protein CICLE_v10026284mg [Citrus clementina]
 gb|ESR39053.1| hypothetical protein CICLE_v10026284mg [Citrus clementina]
Length=267

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 128/179 (72%), Gaps = 11/179 (6%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            + KHFVLVHGA HGAWCWYK+ A L A GH+V+A+D+AASGI+ K  E V +   Y+EPL
Sbjct  8    KGKHFVLVHGANHGAWCWYKLKARLVAGGHRVTAVDLAASGINTKRIEDVHTFHAYSEPL  67

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFLAV  393
             E +A+LPA EKV+LVGHS+GGV ++LA + FPHKISVAVFVTA  F PD     SF+  
Sbjct  68   MEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTA--FMPDTTHRPSFVLE  125

Query  394  K--QEFHRQLESNMD-QKTEYKEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  ++  ++ +S +D Q ++  E  P  +S+LFG E L   +YQL PPEDL LAK+LVR
Sbjct  126  QYCEKIGKEDDSWLDTQFSQCDESNPSHISMLFGREFLTIKLYQLCPPEDLELAKMLVR  184



>ref|XP_006423079.1| hypothetical protein CICLE_v10028977mg [Citrus clementina]
 gb|ESR36319.1| hypothetical protein CICLE_v10028977mg [Citrus clementina]
Length=289

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 125/182 (69%), Gaps = 7/182 (4%)
 Frame = +1

Query  31   SIMDERK----KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVS  198
            SI+ +R+    KHFVLVHG+CHGAW WYK+ A++++ GH V+A D+AASG+ P+    + 
Sbjct  24   SILQQRQPLPTKHFVLVHGSCHGAWSWYKLVAMIKSSGHNVTAFDLAASGVEPQQVHNLR  83

Query  199  SMAEYNEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL  378
            S++++ +PL +FMAALP  +KV+LVGHS GG+ V+ +ME FP+KISVAVFV+A M GPDL
Sbjct  84   SISDFFKPLIDFMAALPLDKKVILVGHSYGGLAVAQSMERFPNKISVAVFVSALMPGPDL  143

Query  379  SFLAVKQEFHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLL  549
            +   + QE   +    +D K  Y    +  P + +FG   L+  VYQLSP ED  LA +L
Sbjct  144  NISTLNQESFSRQGPLLDCKYAYDDGPDSPPTTFIFGPLYLKSKVYQLSPVEDWALATML  203

Query  550  VR  555
            +R
Sbjct  204  MR  205



>ref|XP_006466663.1| PREDICTED: salicylic acid-binding protein 2-like [Citrus sinensis]
Length=267

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 126/179 (70%), Gaps = 11/179 (6%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            + KHFVLVHGA HGAWCWYK+ A L A GH+V+A+D+AASGI+ K  E V +   Y+EPL
Sbjct  8    KGKHFVLVHGANHGAWCWYKLKARLVAGGHRVTAVDLAASGINTKRIEDVHTFHAYSEPL  67

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFL--  387
             E +A+LPA EKV+LVGHS+GGV ++LA + FPHKISVAVFVTA  F PD     SF+  
Sbjct  68   MEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTA--FMPDTTHRPSFVLE  125

Query  388  AVKQEFHRQLESNMD-QKTEYKEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
               ++  ++  S +D Q ++  E  P  +S+LFG E L   +YQL PPEDL LAK+LVR
Sbjct  126  QYSEKMGKEDGSWLDTQFSQCDESNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVR  184



>ref|XP_006480147.1| PREDICTED: methylesterase 10-like [Citrus sinensis]
Length=289

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 124/182 (68%), Gaps = 7/182 (4%)
 Frame = +1

Query  31   SIMDERK----KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVS  198
            SI+ +R+    KHFVLVHG+CHGAW WYK+ A++++ GH V+A D+AASG+ P+    + 
Sbjct  24   SILQQRQPLPTKHFVLVHGSCHGAWSWYKLVAMIKSSGHNVTAFDLAASGVEPQQVNNLR  83

Query  199  SMAEYNEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL  378
            S++++ +PL +FMAALP  + V+LVGHS GG+ V+ +ME FP+KISVAVFVTA M GPDL
Sbjct  84   SISDFFKPLIDFMAALPLDKMVILVGHSYGGLAVAQSMERFPNKISVAVFVTALMPGPDL  143

Query  379  SFLAVKQEFHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLL  549
            +   + QE   +    +D K  Y    +  P + +FG   L+  VYQLSP ED  LA +L
Sbjct  144  NISTLNQESFSRQGPLLDCKYAYDDGPDSPPTTFIFGPLYLKSKVYQLSPVEDWALATML  203

Query  550  VR  555
            +R
Sbjct  204  MR  205



>ref|XP_002522344.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus 
communis]
 gb|EEF40028.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus 
communis]
Length=263

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 119/176 (68%), Gaps = 5/176 (3%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            + +KHFVLVHGACHGAWCWYK+  LL + GH+V+ALDMAASGIH K  ++V ++  Y EP
Sbjct  5    KNQKHFVLVHGACHGAWCWYKLKPLLESSGHQVTALDMAASGIHMKAIQEVQTLHAYTEP  64

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L +F+A LP  EKV+LVGHS+GG N+++A + FP KI+VAV++TA M   D     V  E
Sbjct  65   LLDFLAKLPRNEKVILVGHSLGGFNLAVATDQFPEKIAVAVYLTAFMPDTDHRPSFVLDE  124

Query  403  FHRQLESNMDQKTEYKE-----DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++R+  S     T++           ++LFG  ML   +YQLSP ED+ LAK L+R
Sbjct  125  YNRRTPSEAWLDTQFSPYSTSLQHLTTMLFGQFMLSNKLYQLSPTEDIELAKSLLR  180



>ref|XP_006379213.1| hypothetical protein POPTR_0009s11050g [Populus trichocarpa]
 gb|ERP57010.1| hypothetical protein POPTR_0009s11050g [Populus trichocarpa]
Length=289

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 115/171 (67%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGA HGAWCWYK+  LLR+ GH V+ +D+AASGI P+    + S+++Y  PL +
Sbjct  35   KHFVLVHGAGHGAWCWYKLVPLLRSSGHNVTTIDLAASGIDPRQISDLQSISDYIRPLRD  94

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             +A+LP  EKV+LVGHS+GG+ +S  ME  P KISVAVF+TA M GP L+   + QE  R
Sbjct  95   LLASLPPNEKVILVGHSLGGLALSQTMERLPSKISVAVFLTAFMPGPSLNISTLNQERVR  154

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +L   +D +  +     + P S +FG + L   +YQLSP ED TLA  L+R
Sbjct  155  RLTDMLDTRFTFDNGPNNPPTSFIFGPKHLLLRLYQLSPIEDWTLATTLMR  205



>gb|KDP38249.1| hypothetical protein JCGZ_04892 [Jatropha curcas]
Length=271

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 113/169 (67%), Gaps = 1/169 (1%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVL+HGACHGAW W+K+  LLRA G+ V+A+D+AASGI P+      S+++Y  PL +
Sbjct  16   KHFVLIHGACHGAWAWFKLLPLLRAYGYNVTAIDLAASGIDPQQVNTFGSISDYFRPLRD  75

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             MA+LP  EKV+LVGHS GG+ +S AME FP KI  AVF+TA M GP L+   + QE  R
Sbjct  76   LMASLPQDEKVILVGHSFGGIAISQAMELFPEKIYAAVFLTAIMPGPSLNLSTITQESER  135

Query  412  QLESNMDQK-TEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++   +D + T    + P ++  G   L+  +YQLSP ED TLA  L+R
Sbjct  136  RVGDQLDNRYTRGDGNTPATLTLGPMFLKSRMYQLSPTEDWTLATTLMR  184



>ref|XP_006366937.1| PREDICTED: polyneuridine-aldehyde esterase-like [Solanum tuberosum]
Length=266

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 113/172 (66%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH   HGAW WYK+ AL+R  GH V+ALD+  SGI+PK A ++   ++Y  PL 
Sbjct  11   KKHFVLVHTLGHGAWSWYKIVALIRCSGHNVTALDLGGSGINPKQALEIPIFSDYLSPLM  70

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFM +LPA EK+VLVGHS+GG+ +S AME+FP KISVAVF++  M GP++S   V  E  
Sbjct  71   EFMTSLPADEKIVLVGHSVGGLAISKAMETFPEKISVAVFLSGVMPGPNISASIVYTETI  130

Query  409  RQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D +  Y    E+ P + + G + LE   Y LSP EDL LA  LVR
Sbjct  131  NAIIRELDNRVTYHNGPENPPTTFILGPKFLETNAYHLSPIEDLALATTLVR  182



>ref|XP_009616764.1| PREDICTED: salicylic acid-binding protein 2-like [Nicotiana tomentosiformis]
Length=285

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 115/174 (66%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +  KHFVLVHGACHGAW WYK+ A L+  GH V+ALD+ ASG++PK   ++  +++Y  P
Sbjct  30   KTSKHFVLVHGACHGAWSWYKIMASLKTSGHNVTALDLGASGVNPKQVLEIPHLSDYFSP  89

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EFMA+LPA EKV+LVGHS+GG  +S AME+FP KISVAVFVTA M GP L+   +  E
Sbjct  90   LMEFMASLPADEKVILVGHSLGGFAISKAMENFPEKISVAVFVTALMPGPTLNATTIFTE  149

Query  403  FHRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   S +D +  +     + P +  FG + L   +Y LSP +D  LA  +VR
Sbjct  150  SSKAAISALDNRVTFDNGPMNPPTTFSFGPKYLASYLYPLSPIQDWALATTVVR  203



>ref|XP_006361568.1| PREDICTED: polyneuridine-aldehyde esterase-like [Solanum tuberosum]
Length=266

 Score =   176 bits (446),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 113/172 (66%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH   HGAW WYK+ AL+R  GH V+ALD+  SGI+PK A ++   ++Y  PL 
Sbjct  11   KKHFVLVHTLGHGAWSWYKIVALIRCSGHNVTALDLGGSGINPKQALEIPIFSDYLSPLM  70

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFM +LPA EK+VLVGHS+GG+ +S AME+FP KISVAVF++  M GP++S   V  E  
Sbjct  71   EFMTSLPADEKIVLVGHSVGGLAISKAMETFPEKISVAVFLSGVMPGPNISASIVYTETI  130

Query  409  RQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D +  Y    E+ P + + G + LE   Y LSP EDL LA  LVR
Sbjct  131  NAIIREVDNRVTYHNGPENPPTTFILGPKFLETNAYHLSPIEDLALATTLVR  182



>ref|XP_006425816.1| hypothetical protein CICLE_v10026277mg [Citrus clementina]
 gb|ESR39056.1| hypothetical protein CICLE_v10026277mg [Citrus clementina]
Length=267

 Score =   176 bits (446),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 125/179 (70%), Gaps = 11/179 (6%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             +KHFVLVHG  HGAWCWYK+ A+L A GH+V+ +D+AASGI+ K  E V +   Y+EPL
Sbjct  8    EEKHFVLVHGVNHGAWCWYKLKAMLVAGGHRVTTVDLAASGINMKRIEDVHTFQAYSEPL  67

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFL--  387
             E +A+LPA EKV+LVGHS+GGV ++LA + FPHKISVAVFVTA  F PD     SF+  
Sbjct  68   MEILASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTA--FMPDTTHRPSFVLE  125

Query  388  AVKQEFHRQLESNMD-QKTEYKEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
               ++  ++  S +D Q ++  E  P  +S+LFG E L   +YQL PPEDL LAK+LVR
Sbjct  126  QYSEKMGKEDGSWLDTQFSQCDESNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVR  184



>ref|XP_006366936.1| PREDICTED: polyneuridine-aldehyde esterase-like [Solanum tuberosum]
Length=264

 Score =   176 bits (445),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 113/172 (66%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH   HGAW WYK+ AL+R  GH V+ALD+  SGI+PK A ++   ++Y  PL 
Sbjct  9    KKHFVLVHTLGHGAWSWYKIVALIRCSGHNVTALDLGGSGINPKQALEIPIFSDYLSPLM  68

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFM +LPA EK+VLVGHS+GG+ +S AME+FP KISVAVF++  M GP++S   V  E  
Sbjct  69   EFMTSLPADEKIVLVGHSVGGLAISKAMETFPEKISVAVFLSGVMPGPNISASIVYTETI  128

Query  409  RQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D +  Y    E+ P + + G + LE   Y +SP EDL LA  LVR
Sbjct  129  NAIIRELDNRVTYHNGPENPPTTFILGPKFLETNAYHMSPIEDLALATTLVR  180



>ref|XP_006425815.1| hypothetical protein CICLE_v10026277mg [Citrus clementina]
 gb|ESR39055.1| hypothetical protein CICLE_v10026277mg [Citrus clementina]
Length=269

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 124/181 (69%), Gaps = 13/181 (7%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             +KHFVLVHG  HGAWCWYK+ A+L A GH+V+ +D+AASGI+ K  E V +   Y+EPL
Sbjct  8    EEKHFVLVHGVNHGAWCWYKLKAMLVAGGHRVTTVDLAASGINMKRIEDVHTFQAYSEPL  67

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPD--------LS  381
             E +A+LPA EKV+LVGHS+GGV ++LA + FPHKISVAVFVTA  F PD        L 
Sbjct  68   MEILASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTA--FMPDTTHRPSFVLE  125

Query  382  FLAVKQEFHRQLESNMD-QKTEYKEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLV  552
             +   ++  ++  S +D Q ++  E  P  +S+LFG E L   +YQL PPEDL LAK+LV
Sbjct  126  QVPYSEKMGKEDGSWLDTQFSQCDESNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLV  185

Query  553  R  555
            R
Sbjct  186  R  186



>ref|XP_006466659.1| PREDICTED: salicylic acid-binding protein 2-like [Citrus sinensis]
 ref|XP_006466661.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466662.1| PREDICTED: salicylic acid-binding protein 2-like isoform X2 [Citrus 
sinensis]
Length=267

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 125/179 (70%), Gaps = 11/179 (6%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             +KHFVLVHG  HGAWCWYK+ A+L A GH+V+ +D+AASGI+ K  E V +   Y+EPL
Sbjct  8    EEKHFVLVHGVNHGAWCWYKLKAMLVAGGHRVTTVDLAASGINMKRIEDVHTFQAYSEPL  67

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFL--  387
             E +A+LPA EKV+LVGHS+GGV ++LA + FPHKISVAVFVTA  F PD     SF+  
Sbjct  68   MEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTA--FMPDTTHRPSFVLE  125

Query  388  AVKQEFHRQLESNMD-QKTEYKEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
               ++  ++  S +D Q ++  E  P  +S+LFG E L   +YQL PPEDL LAK+LVR
Sbjct  126  QYSEKMGKEDGSWLDTQFSQCDESNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVR  184



>ref|XP_003626737.1| Methyl jasmonate esterase [Medicago truncatula]
 gb|AET01213.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=284

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 121/174 (70%), Gaps = 6/174 (3%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQV-SSMAEYNEPLT  228
            KHFVLVHGA HGAWCWYKVA +L++ GH V+ +++AA GI P   +++ SS+++Y+EPL 
Sbjct  26   KHFVLVHGAGHGAWCWYKVATMLKSAGHNVTTIELAACGISPIQVQEIHSSISKYHEPLI  85

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
             F+ +LP  EKV+LVGHS GG+ +S+AME FP KIS+AVFVTA +   +L+F ++ QE  
Sbjct  86   SFIESLPPKEKVILVGHSFGGIPLSVAMEKFPKKISLAVFVTAFVISENLNFTSLLQENQ  145

Query  409  RQLESNMDQK-----TEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            R+L S+         ++     P  +LFG ++L   +YQLSP EDLTL   LVR
Sbjct  146  RRLNSSQQDPPQLVFSDGPNSPPTGLLFGSKLLASNLYQLSPNEDLTLGSSLVR  199



>ref|XP_004231413.1| PREDICTED: polyneuridine-aldehyde esterase [Solanum lycopersicum]
 gb|ADK38538.1| methylketone synthase Ib [Solanum lycopersicum]
Length=269

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 115/172 (67%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH ACHGAWCWYK+ +L+ + GH V+ALD+ ASGI+PK A ++   ++Y  PL 
Sbjct  14   KKHFVLVHSACHGAWCWYKIVSLMTSSGHNVTALDLGASGINPKQALEIPHFSDYLSPLM  73

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFM +LPA EKVV+VGHS+GG+ +S AME+FP KISVAVF++  M GP ++   V  E  
Sbjct  74   EFMTSLPADEKVVVVGHSLGGLAISKAMETFPEKISVAVFLSGLMPGPSINASNVYTEAL  133

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D +  Y     + P +++ G + L   VY LS  +DL LA  LVR
Sbjct  134  NAIIPQLDNRVTYDNGPTNPPTTLILGPKFLAASVYHLSSIKDLALATTLVR  185



>ref|XP_010683183.1| PREDICTED: salicylic acid-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=273

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVHG+CHGAWCWYK+  ++   GH+V+ LDMAASGI+PK  +++ ++ +Y+EPL 
Sbjct  18   KKHFVLVHGSCHGAWCWYKLKPMIETAGHRVTVLDMAASGINPKNIDELQTLRDYSEPLI  77

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFM ++P  +KV+LVGHS GG+N+S+ ME FPHKI VAVF+ A M     +   +  EF 
Sbjct  78   EFMTSVPDDQKVILVGHSYGGLNISVVMEMFPHKIHVAVFLAAFMPDSRHTPSFIFDEFT  137

Query  409  RQLESNMDQKTEYK-----EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +L  +    T++K     ++ P + LFG   L KL Y+LSP EDL LA  LVR
Sbjct  138  TRLPPDYWLDTKFKSSGDPKETPTTFLFGPRFLSKL-YRLSPVEDLELALTLVR  190



>ref|XP_002313084.2| hypothetical protein POPTR_0009s11040g [Populus trichocarpa]
 gb|EEE87039.2| hypothetical protein POPTR_0009s11040g [Populus trichocarpa]
Length=289

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 115/171 (67%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGA HGAWCWYK+  LLR+ GH V+ +D+AASGI P+    + S+++Y  PL +
Sbjct  35   KHFVLVHGAGHGAWCWYKLVPLLRSSGHNVTTIDLAASGIDPRQISDLQSISDYIRPLRD  94

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             +A+LP  +KV+LVGHS+GG+ +S  ME  P KISVAVF+TA M GP L+   + QE  R
Sbjct  95   LLASLPPNDKVILVGHSLGGLALSQTMERLPSKISVAVFLTAVMPGPSLNISTLNQERVR  154

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    +D +  +     + P S++FG + L   +YQLSP ED TLA  L+R
Sbjct  155  RQTDMLDTRFTFDNGPNNPPTSLIFGPKFLLLRLYQLSPIEDWTLATTLMR  205



>ref|XP_008241565.1| PREDICTED: salicylic acid-binding protein 2-like [Prunus mume]
Length=295

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 126/184 (68%), Gaps = 8/184 (4%)
 Frame = +1

Query  19   CSG*SIMDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVS  198
            CS  +  D  +KHFVLVHGA HGAWCWYKV+ LL + GH V+ALD+AASG++PK  +Q+ 
Sbjct  38   CSPSANPDANQKHFVLVHGAGHGAWCWYKVSTLLTSIGHNVTALDLAASGVNPKQVQQLH  97

Query  199  SMAEYNEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL  378
            S+++Y EPL  FM +LP  E+V+LVGHS+GG  +S+AME FP KI +AVF TA M GP L
Sbjct  98   SLSDYVEPLMRFMKSLPPKERVILVGHSLGGAALSIAMEKFPEKIYIAVFATALMPGPAL  157

Query  379  SFLAVKQEFHRQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAK  543
             +L +  +    L S     ++++ DR     P + L G ++L   +YQLSPPEDLTLA 
Sbjct  158  DYLNLISQI---LNSTDWMDSQFRYDRGPNNPPTAALIGPKLLSSSLYQLSPPEDLTLAL  214

Query  544  LLVR  555
             LVR
Sbjct  215  SLVR  218



>ref|XP_009366305.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=280

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 119/174 (68%), Gaps = 8/174 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +  KHFVL+HGA    W WYKVA LL+  GH V+ALD+ ASGI+P   +Q+ S++EY EP
Sbjct  32   QSPKHFVLIHGA----WSWYKVATLLKDSGHHVTALDLGASGINPIQVQQLPSLSEYVEP  87

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            LT+ M +LP  EKV+LV HS GG  +S+ ME FPHKI+ AV+VTA+M GP L+F  ++ E
Sbjct  88   LTKLMVSLPPNEKVILVAHSFGGAVISIFMERFPHKIAAAVYVTAAMSGPTLNFSTIQSE  147

Query  403  FHRQLESNMDQKTEYKE--DRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              ++L+  MD +  Y    + P  S LFG + L   +YQLSPP+DLTLA  LVR
Sbjct  148  IKKRLDY-MDSQFRYDNGTNNPATSFLFGPKDLATSLYQLSPPQDLTLALSLVR  200



>ref|XP_007047147.1| Methyl esterase 10, putative [Theobroma cacao]
 gb|EOX91304.1| Methyl esterase 10, putative [Theobroma cacao]
Length=260

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 120/176 (68%), Gaps = 5/176 (3%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ERK+HFVLVHGACHGAWCWYK+ +LL+  GH+V+ALD+ ASG+ P+  E+ + +++Y +P
Sbjct  2    ERKQHFVLVHGACHGAWCWYKLVSLLKTAGHQVTALDLGASGVDPRRLEESTCISDYLQP  61

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L +F+A+LP   KV+LVGHS  G+ +SLAME FP+KISVAVF+ A M         + QE
Sbjct  62   LMDFLASLPEPGKVILVGHSYAGLCISLAMERFPNKISVAVFIAAYMPCLGSPPGTLIQE  121

Query  403  FHRQ--LESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + +   +ES MD +  +    E  P  VLFG E +E   YQ    EDL LAK+LVR
Sbjct  122  YFKSTPVESLMDCQFTFDKGLEKPPTRVLFGPEFMEAKAYQQCQLEDLELAKMLVR  177



>ref|XP_009366394.1| PREDICTED: methylesterase 10 [Pyrus x bretschneideri]
Length=274

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 122/179 (68%), Gaps = 10/179 (6%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E  KHFVLVHG CHGAWCWYK+ ALLR  GH+V+ALD+  SGIH     +V+S+ +Y +P
Sbjct  15   ENAKHFVLVHGTCHGAWCWYKLVALLRHAGHRVTALDLGGSGIHSNQIHEVTSIWDYAQP  74

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFL--AVK  396
            L EF+ ++P  EKV+LVGHS GG+ +SLAME FP KISVAVFVTA +  P  +F    + 
Sbjct  75   LMEFLGSIPEDEKVILVGHSYGGLPMSLAMEMFPQKISVAVFVTAYL--PHYTFPPGVLI  132

Query  397  QEFHRQL--ESNMDQKTEYKEDRP----VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QEF ++   ES +D +  ++++ P     SVLFG + +   +Y+   PEDL LAK+L R
Sbjct  133  QEFLKRTPAESLLDCQFTFEQNNPENQLTSVLFGSQYMAAKLYKHCNPEDLELAKMLTR  191



>ref|XP_004231412.1| PREDICTED: salicylic acid-binding protein 2-like [Solanum lycopersicum]
Length=288

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 117/174 (67%), Gaps = 7/174 (4%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGACHGAW WYK+ AL+R+ G+ V++LD+ ASGI+     ++  +++Y  PL E
Sbjct  30   KHFVLVHGACHGAWSWYKIVALIRSSGNNVTSLDLGASGINKNQVLEIPHLSDYFSPLME  89

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL---SFLAVKQE  402
            FMA+LP  EKV+LVGHS GG  +S AME FP KISVAVFVTA M GP L   + L   Q 
Sbjct  90   FMASLPTHEKVILVGHSFGGWAISNAMERFPEKISVAVFVTALMPGPTLNATTLLTKLQS  149

Query  403  FHRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            F+  + S +D +  Y     + P + +FG + L + VYQLSP +DL LA  +VR
Sbjct  150  FNGNV-SQLDNRLTYDNGPTNPPTTFIFGPKYLARNVYQLSPIQDLALATTVVR  202



>ref|XP_007202442.1| hypothetical protein PRUPE_ppa009951mg [Prunus persica]
 gb|EMJ03641.1| hypothetical protein PRUPE_ppa009951mg [Prunus persica]
Length=271

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 130/178 (73%), Gaps = 10/178 (6%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            + +KHFVLVHGACHG+WCWYK+   L + GH+V+ALD+AASGI+ K  + V S+AEY+EP
Sbjct  5    KEEKHFVLVHGACHGSWCWYKIKPRLESAGHRVTALDLAASGINTKAIQDVHSLAEYSEP  64

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA--VK  396
            L EF+A+L   EKV+LVGHS+GG++++LAME+FP KISVAVF+TA  F PD +     V 
Sbjct  65   LLEFIASLGPEEKVILVGHSLGGMSLALAMENFPQKISVAVFLTA--FVPDTTHQPSHVL  122

Query  397  QEFHRQL--ESNMD-QKTEY--KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             ++++    E+ +D Q T Y   E+  VS+ FG E L KL YQLSP EDL LAK LVR
Sbjct  123  DQYNQNTPAEAWLDTQFTNYGSAEEPLVSMHFGPEFLAKL-YQLSPIEDLELAKSLVR  179



>gb|KJB40233.1| hypothetical protein B456_007G052800 [Gossypium raimondii]
Length=257

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 119/172 (69%), Gaps = 5/172 (3%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            HFVL+HG CHGAWCWYK+ +LL++ GH+V+ LD+ ASGI+PK    ++S+++Y EPL   
Sbjct  3    HFVLIHGMCHGAWCWYKIVSLLKSGGHRVTPLDLGASGINPKTITDLASLSDYAEPLMAL  62

Query  235  MAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSF-LAVKQEFHR  411
            MA+LP  EKV+LVGHS GGV +SLAMESFP K+  AV++TA M   D     AV + F R
Sbjct  63   MASLPQDEKVILVGHSYGGVIISLAMESFPMKVLAAVYLTAFMPNHDSPIATAVAESFRR  122

Query  412  QL-ESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             + E  MD +  ++   E+ P   LFG + +E +VYQLSP ED+ LA  L+R
Sbjct  123  AMAEPLMDFQLLFEDGSENPPTHALFGPKYMEAMVYQLSPKEDIELANTLLR  174



>ref|XP_010263778.1| PREDICTED: methylesterase 10-like [Nelumbo nucifera]
Length=266

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 120/181 (66%), Gaps = 10/181 (6%)
 Frame = +1

Query  37   MDER-KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEY  213
            MDER  KHFVLVHGA  GAWCWYK+A LL++ GH+V+ALD+AASG+ PK   QVSS+ EY
Sbjct  4    MDERVMKHFVLVHGAGQGAWCWYKLAMLLKSGGHRVTALDLAASGVDPKQLNQVSSVFEY  63

Query  214  NEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSF--L  387
             +PL + MA+LP  E+V+LVGHS+GG+ +SLAMESF  KI+  VFVTA M  PD +    
Sbjct  64   VQPLMDLMASLPPDERVILVGHSLGGIAISLAMESFSEKIAAGVFVTAIM--PDYTSPPA  121

Query  388  AVKQEFHRQLESNMDQKTEYK-----EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLV  552
             V +E  R+         +       E  P S+ FG E L + +Y    PED+TLAK+LV
Sbjct  122  TVLEELFRRTSPESLSGIQLTLGPTPESIPASITFGPEYLAQRMYNRCQPEDITLAKMLV  181

Query  553  R  555
            R
Sbjct  182  R  182



>ref|XP_007047137.1| Methyl esterase 1, putative [Theobroma cacao]
 gb|EOX91294.1| Methyl esterase 1, putative [Theobroma cacao]
Length=263

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 121/179 (68%), Gaps = 9/179 (5%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            D R+KHFVLVHG C GAWCWYK+   L + GH+V+ALD+AASGI+ K  + V +  EY+E
Sbjct  4    DNREKHFVLVHGMCKGAWCWYKLKTRLESAGHRVTALDLAASGINTKSIQDVRTFHEYSE  63

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA--V  393
            PL E +A+LP+ +KV+LVGHS+GG+N++LAM+ FPHK+SV VF+TA M  PD + L   V
Sbjct  64   PLLEMLASLPSDKKVILVGHSLGGINLALAMDKFPHKVSVGVFLTAYM--PDTTHLPSYV  121

Query  394  KQEFHRQLESNMDQKTEY-----KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +F   +   M   T++      E    SV+FG +++   +YQ  P EDL LAK LVR
Sbjct  122  LDKFFGSISPEMWLDTQFLPYGGPEQPLTSVIFGPQIMSSKLYQQCPVEDLELAKTLVR  180



>ref|XP_004288072.2| PREDICTED: salicylic acid-binding protein 2-like [Fragaria vesca 
subsp. vesca]
Length=324

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 119/172 (69%), Gaps = 4/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVL+HGAC GAW WYKVA LL+A GH V+ALD+ ASGI+P  A+Q+ S+++Y EPLT
Sbjct  74   KKHFVLIHGACQGAWTWYKVATLLKASGHNVTALDLGASGINPIQAQQLPSLSDYVEPLT  133

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            + M  LP  E+V+LV HS+GG  +S+ ME FP KI+ AV+V+  M GP L++  V  E +
Sbjct  134  KLMVFLPPKERVILVAHSMGGAVISIFMERFPEKIAAAVYVSGFMSGPALNYSTVFIEIN  193

Query  409  RQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++L+  MD +  Y    ++   S L G  +L    YQLSPPEDLTL+  ++R
Sbjct  194  KRLDY-MDSQYRYDAGPKNPATSFLTGPRLLASKFYQLSPPEDLTLSLSVMR  244



>ref|XP_004243297.2| PREDICTED: methylesterase 10-like [Solanum lycopersicum]
 gb|ADK38539.1| methylketone synthase Id [Solanum lycopersicum]
Length=264

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 111/172 (65%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH   HGAW WYK+ AL+R  GH V+ALD+  SGI+PK A ++   ++Y  PL 
Sbjct  9    KKHFVLVHTLGHGAWSWYKIVALIRCSGHNVTALDLGGSGINPKQALEIPKFSDYLSPLM  68

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFM +LP  EK+VLVGHS+GG+ +S AME+FP KISVAVF++  M GP++S   V  E  
Sbjct  69   EFMTSLPVDEKIVLVGHSVGGLAISKAMETFPEKISVAVFLSGVMPGPNISASIVYTEAI  128

Query  409  RQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D +  Y    E+ P +   G + LE   Y LSP EDL LA  LVR
Sbjct  129  NAIIRELDNRVTYHNGSENPPTTFNLGPKFLETNAYHLSPIEDLALATTLVR  180



>gb|KDO79352.1| hypothetical protein CISIN_1g024065mg [Citrus sinensis]
Length=267

 Score =   174 bits (440),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 125/179 (70%), Gaps = 11/179 (6%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             +KHFVLVHG  HGAWCWYK+ A L A GH+V+A+D+AASGI+ K  E V +   Y+EPL
Sbjct  8    EEKHFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPL  67

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFL--  387
             E +A+LPA EKV+LVGHS+GGV ++LA + FPHKISVAVFVTA  F PD     SF+  
Sbjct  68   MEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTA--FMPDTTHRPSFVLE  125

Query  388  AVKQEFHRQLESNMD-QKTEYKEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
               ++  ++ +S +D Q ++     P  +S+LFG E L   +YQL PPEDL LAK+LVR
Sbjct  126  QYSEKMGKEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVR  184



>gb|KDO79350.1| hypothetical protein CISIN_1g024065mg [Citrus sinensis]
Length=273

 Score =   174 bits (441),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 125/178 (70%), Gaps = 11/178 (6%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            +KHFVLVHG  HGAWCWYK+ A L A GH+V+A+D+AASGI+ K  E V +   Y+EPL 
Sbjct  9    EKHFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPLM  68

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFL--A  390
            E +A+LPA EKV+LVGHS+GGV ++LA + FPHKISVAVFVTA  F PD     SF+   
Sbjct  69   EVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTA--FMPDTTHRPSFVLEQ  126

Query  391  VKQEFHRQLESNMD-QKTEYKEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              ++  ++ +S +D Q ++     P  +S+LFG E L   +YQL PPEDL LAK+LVR
Sbjct  127  YSEKMGKEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVR  184



>gb|KDP38248.1| hypothetical protein JCGZ_04891 [Jatropha curcas]
Length=291

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 119/181 (66%), Gaps = 3/181 (2%)
 Frame = +1

Query  22   SG*SIMDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSS  201
            +G S   +  KHF+L+HGA HGAW WY++  LLR  GH+V+ +D+AASGI P+  E + S
Sbjct  24   NGASCQPKASKHFLLIHGAAHGAWSWYRIVPLLRLSGHEVTTIDLAASGIDPRQPESLRS  83

Query  202  MAEYNEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLS  381
            +++Y  P  +F+A+LP  E+V+LVGHS GG+ +S  ME+FP+KISVAVF+TA M GP  +
Sbjct  84   LSDYIRPAIDFVASLPPQERVILVGHSFGGLAISKVMENFPNKISVAVFLTAFMPGPTFN  143

Query  382  FLAVKQEFHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLV  552
               + +E+ R+    +D    Y    ++ P + L+G   L   +YQLSP ED TLA  LV
Sbjct  144  ISTLFEEYDRKELPELDNSYSYDDGPDNPPTTELWGPIFLRTFLYQLSPIEDWTLATTLV  203

Query  553  R  555
            R
Sbjct  204  R  204



>gb|EYU44349.1| hypothetical protein MIMGU_mgv1a012023mg [Erythranthe guttata]
Length=218

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 107/170 (63%), Gaps = 3/170 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
              +KHFVLVHGACHGAWCWYKV   LR+ GH+V+ALDMA +G      E++S  ++Y  P
Sbjct  7    NNQKHFVLVHGACHGAWCWYKVVTRLRSAGHRVTALDMAGAGADTGCVEELSLFSDYCRP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L E M  LP+ E+VVLVGHS+GG+ +SL ME FP KI +AVFV A M GPD + L    +
Sbjct  67   LVELMEGLPSDERVVLVGHSLGGICISLVMEKFPDKIGLAVFVAAIMPGPDFTVLTALGK  126

Query  403  FHRQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAK  543
              R+    MD +  +    E  P S +FG   + K +YQLS PE  +  +
Sbjct  127  LEREAGYYMDSRFSFANGDEKPPTSFIFGPNFMAKHLYQLSSPETRSTVR  176



>ref|XP_004300553.1| PREDICTED: salicylic acid-binding protein 2-like [Fragaria vesca 
subsp. vesca]
Length=302

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 120/172 (70%), Gaps = 5/172 (3%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVL+HGA HGAW WYKVAALL++ GH V+ALD+ ASGI+P   +Q+ S +++ EPLT
Sbjct  53   KKHFVLIHGAGHGAWSWYKVAALLKSSGHNVTALDLGASGINPIQVQQLPSFSDFVEPLT  112

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            + M +LP  E+V+LV HS+ G  +++ ME FP KI+ AV+V+A M GP L++  +  E +
Sbjct  113  KIMVSLPPKERVILVSHSMAGATIAVFMEKFPEKIAAAVYVSAFMSGPTLNYSTIFTEIN  172

Query  409  RQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++L+  MD +  Y    +D   S  FG ++LE   YQLSPPEDL+L   LVR
Sbjct  173  KRLD-YMDSEFRYDNGTKDSATSFRFGPKVLESF-YQLSPPEDLSLGISLVR  222



>gb|KHG11847.1| Polyneuridine-aldehyde esterase [Gossypium arboreum]
Length=257

 Score =   173 bits (439),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 118/172 (69%), Gaps = 5/172 (3%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            HFVLVHG CHGAWCWYK+ +LL++ GH+V+ LD+ ASGI+PK    ++S+++Y EPL   
Sbjct  3    HFVLVHGMCHGAWCWYKIVSLLKSGGHRVTPLDLGASGINPKTITDLASLSDYAEPLMAL  62

Query  235  MAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHRQ  414
            MA+LP  EKV+LVGHS GGV +SLAMESFP K+  AV++TA M   D        E+ R+
Sbjct  63   MASLPEDEKVILVGHSYGGVIISLAMESFPMKVLAAVYLTAFMPNHDSPIATGVAEYFRR  122

Query  415  L--ESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  E  MD +  ++   E+ P   LFG + +E +VYQLSP ED+ LA  L+R
Sbjct  123  VMAEPLMDFQLLFEDGSENPPTHALFGPKYMEAMVYQLSPKEDIELANTLLR  174



>ref|XP_007042334.1| Methyl esterase 10, putative isoform 2 [Theobroma cacao]
 gb|EOX98165.1| Methyl esterase 10, putative isoform 2 [Theobroma cacao]
Length=215

 Score =   172 bits (435),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 114/171 (67%), Gaps = 4/171 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E  KHFVLVHG+CHGAW WYK+  LL++EGH V+ +D+A SG+ P+    + S+++Y +P
Sbjct  43   EPPKHFVLVHGSCHGAWSWYKLVPLLKSEGHNVTGIDLAGSGVDPQQVNTLRSISDYIKP  102

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L +FM +LP  +KVVLVGHS+GG+ +S AME FP KISVAVF+TA M GP L+   + Q 
Sbjct  103  LRDFMESLPDQQKVVLVGHSLGGLAISQAMERFPEKISVAVFLTALMPGPTLNISTLSQR  162

Query  403  FHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKL  546
              ++ +S MD    Y     + P + +FG   L   VYQLSP E  T+A L
Sbjct  163  AFKEQDSQMDSLYTYDNGPNNAPTTFIFGPLYLSSQVYQLSPRES-TIAGL  212



>gb|KDO79351.1| hypothetical protein CISIN_1g024065mg [Citrus sinensis]
Length=269

 Score =   173 bits (439),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 124/181 (69%), Gaps = 13/181 (7%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             +KHFVLVHG  HGAWCWYK+ A L A GH+V+A+D+AASGI+ K  E V +   Y+EPL
Sbjct  8    EEKHFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPL  67

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPD--------LS  381
             E +A+LPA EKV+LVGHS+GGV ++LA + FPHKISVAVFVTA  F PD        L 
Sbjct  68   MEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTA--FMPDTTHRPSFVLE  125

Query  382  FLAVKQEFHRQLESNMD-QKTEYKEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLV  552
             +   ++  ++ +S +D Q ++     P  +S+LFG E L   +YQL PPEDL LAK+LV
Sbjct  126  QVPYSEKMGKEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLV  185

Query  553  R  555
            R
Sbjct  186  R  186



>ref|NP_001275858.1| ethylene-induced esterase [Citrus sinensis]
 gb|AAK58599.1|AF269158_1 ethylene-induced esterase [Citrus sinensis]
Length=267

 Score =   173 bits (439),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 125/179 (70%), Gaps = 11/179 (6%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             +KHFVLVHG  HGAWCWYK+ A L A GH+V+A+D+AASGI+ K  E V +   Y+EPL
Sbjct  8    EEKHFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPL  67

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFL--  387
             E +A+LPA EKV+LVGHS+GGV ++LA + FPHKISVAVFVTA  F PD     SF+  
Sbjct  68   MEVLASLPAEEKVILVGHSLGGVTLALAGDKFPHKISVAVFVTA--FMPDTTHRPSFVLE  125

Query  388  AVKQEFHRQLESNMD-QKTEYKEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
               ++  ++ +S +D Q ++     P  +S+LFG E L   +YQL PPEDL LAK+LVR
Sbjct  126  QYSEKMGKEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVR  184



>ref|XP_009362000.1| PREDICTED: methylesterase 7-like [Pyrus x bretschneideri]
Length=275

 Score =   173 bits (439),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            D  KKHFVL+HGACHGAWCWYK++A L + G+ V+ALD+AA GIHPK  + V + ++Y E
Sbjct  9    DANKKHFVLIHGACHGAWCWYKLSASLTSAGYDVTALDLAACGIHPKEVKYVQTFSDYAE  68

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQ  399
            PL +FM  LP  ++V LVGHS GG  +S+AME FP KI  AVF TA M  P  S+  + +
Sbjct  69   PLIKFMETLPPEKRVFLVGHSFGGPVISIAMEMFPEKILAAVFATAFMPSPTFSYPHIME  128

Query  400  EFHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    ++  MD    +     + P S +FG +++  L+YQLSPP+D+ LA  LVR
Sbjct  129  KMFAGVDL-MDYYQRFDNGPNNPPTSAIFGPKIMSLLLYQLSPPQDVQLASSLVR  182



>ref|XP_010030653.1| PREDICTED: salicylic acid-binding protein 2-like [Eucalyptus 
grandis]
 gb|KCW55269.1| hypothetical protein EUGRSUZ_I01196 [Eucalyptus grandis]
Length=288

 Score =   174 bits (440),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 113/175 (65%), Gaps = 3/175 (2%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            + R KHFVLVHGACHGAWCWYKVA LLR+ GH V+ +D+AASGI+P  A  + S++ Y +
Sbjct  29   NARGKHFVLVHGACHGAWCWYKVATLLRSSGHDVTTIDLAASGINPIQASSLQSISNYFK  88

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQ  399
            PL + M +L   E+V+LVGHS GG+ +S  ME +P KI+VAVFVTA M GP L+   V +
Sbjct  89   PLRDVMESLSLRERVILVGHSYGGMALSHVMERYPKKIAVAVFVTALMPGPTLNATTVNR  148

Query  400  EFHRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            E  R+  S  D +  Y     + P +   G       VYQLSP +D TLA  LVR
Sbjct  149  ESFRRAGSIGDSRYSYDNGPNNPPTAYTLGPMFSASRVYQLSPIQDWTLANTLVR  203



>ref|XP_006436459.1| hypothetical protein CICLE_v10032394mg [Citrus clementina]
 ref|XP_006485627.1| PREDICTED: methylesterase 1-like [Citrus sinensis]
 gb|ESR49699.1| hypothetical protein CICLE_v10032394mg [Citrus clementina]
Length=272

 Score =   173 bits (439),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 122/178 (69%), Gaps = 9/178 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +++KHFVLVHG+ HGAWCWYKV   L A G++V+ALD+AA+GI+ K  + V S  EYNEP
Sbjct  14   KKRKHFVLVHGSNHGAWCWYKVKPQLEAAGYRVTALDLAATGINMKKIQDVHSFYEYNEP  73

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA--VK  396
            L EF+A+L AGEKVVLVGHS GG++++LA + FPHKISVA+F+TA  F PD       V 
Sbjct  74   LLEFLASLSAGEKVVLVGHSAGGLSLALAADKFPHKISVAIFLTA--FMPDTKHQPSYVV  131

Query  397  QEFHRQLESNMDQKTEY---KEDRPV--SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + F  ++ S     T++       P   ++ FGH  L   +YQLSPPED+ L K+L+R
Sbjct  132  ERFFEKIPSGEWLDTQFSVIDSSNPSRKTIFFGHNFLTLKLYQLSPPEDVELGKMLLR  189



>ref|XP_004972330.1| PREDICTED: uncharacterized protein LOC101759641 [Setaria italica]
Length=605

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 121/177 (68%), Gaps = 6/177 (3%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +++ HFVLVHGACHGAW WYKVA  L + GH+V+ALDMA  G  P+ AE+VSS  EY+ P
Sbjct  338  QQRHHFVLVHGACHGAWSWYKVATALSSAGHRVTALDMAGCGARPERAEEVSSFEEYSRP  397

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L + +AALPAGEK VLVGHS GG +++LAME FP +I+VAVFV+A++         V Q+
Sbjct  398  LLDAVAALPAGEKAVLVGHSFGGRSLALAMERFPDRIAVAVFVSAAIPAAGKPMTLVFQQ  457

Query  403  F---HRQLESNMDQKTEYKED--RPV-SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            F    R  +  MD K E   D   PV ++ +G   LE+ +YQLSPPEDLTLAK   R
Sbjct  458  FSQEQRAADFYMDCKIETSGDPQHPVETIRYGPRYLEQRLYQLSPPEDLTLAKAATR  514


 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 117/174 (67%), Gaps = 9/174 (5%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            HFV+VHG CHGAWCWY+VAALL + GH+V+ALDMAA G  P  AE+V S  EY+ PL + 
Sbjct  14   HFVMVHGVCHGAWCWYRVAALLSSAGHRVTALDMAACGASPGRAEEVPSFEEYSRPLLDA  73

Query  235  MAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASM--FGPDLSFLAVKQEFH  408
            +AALP GE+ VLVGHS GG  ++LAME +P +++VAVF +A+M   G  ++F  V +EF 
Sbjct  74   VAALPPGERAVLVGHSFGGQCLALAMERYPDRVAVAVFASAAMPALGKPMTF--VLEEFS  131

Query  409  RQLESNMDQKTEY----KEDRPV-SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++   +      Y        PV ++L G E L K +YQLS PEDLTLA  +VR
Sbjct  132  QETGPDFYMDCTYGASSNPQYPVETLLLGPEYLAKRLYQLSSPEDLTLAMAMVR  185



>ref|XP_008354686.1| PREDICTED: salicylic acid-binding protein 2-like [Malus domestica]
Length=298

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 115/174 (66%), Gaps = 4/174 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +  KHFVL+HGACHGAW WYKVA LL+  GH+V+ALD+ ASGI+P   EQ+ S++E+ EP
Sbjct  41   QSPKHFVLIHGACHGAWSWYKVATLLKDSGHRVTALDLGASGINPIQVEQLPSLSEFVEP  100

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            LT+ M +LP  EKV+LV HS GG  +S+ ME F  KIS AV+VTA M GP L++  +  E
Sbjct  101  LTKLMVSLPPNEKVILVAHSYGGAVISIFMERFSQKISAAVYVTAIMSGPTLNYSTIFAE  160

Query  403  FHRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            F +  +   D +  Y +   +   S + G + +   +YQLSPPED TL   LVR
Sbjct  161  FVKTFDFK-DSRFRYDKGTSNPATSFILGPKDMATSLYQLSPPEDFTLGLSLVR  213



>ref|XP_008339612.1| PREDICTED: methylesterase 10 [Malus domestica]
Length=274

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 122/179 (68%), Gaps = 10/179 (6%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +  KHFVLVHG+C GAWCWYK+ ALLR  GH+V+ALD+  SGIH     +V+S+ +Y +P
Sbjct  15   QNAKHFVLVHGSCLGAWCWYKLVALLRHAGHRVTALDLGGSGIHSNQIHEVTSIWDYVQP  74

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFL--AVK  396
            L EF+ ++P  EKV+LVGHS GG+ +SLAME FP KISVAVFVTA +  P  +F    + 
Sbjct  75   LMEFLGSIPEDEKVILVGHSYGGLPISLAMEMFPQKISVAVFVTAYL--PHYTFPPGVLI  132

Query  397  QEFHRQL--ESNMDQKTEYKEDRP----VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QEF ++   ES +D +  + ++ P     SVLFG + +   +YQ   PEDL LAK+L+R
Sbjct  133  QEFLKRTSAESLLDCQFTFGQNNPENQLTSVLFGSQYMAAKLYQHCKPEDLELAKMLIR  191



>ref|XP_008789941.1| PREDICTED: probable esterase PIR7A [Phoenix dactylifera]
Length=270

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 117/174 (67%), Gaps = 5/174 (3%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHF+LVHG  HGAWCWYK+A LL + GH+V+ALD+ ASG+HPK  +++ S  +Y EPL 
Sbjct  14   KKHFILVHGIGHGAWCWYKLATLLTSAGHRVTALDLGASGVHPKQLDELRSFTDYCEPLM  73

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            E MA++P  ++V+LV HS GG++++LAME FP KISVAVF T  M         + +EF+
Sbjct  74   ETMASIPPDDRVILVSHSFGGLSIALAMEKFPEKISVAVFATGVMPSTTTPVSDIVKEFY  133

Query  409  RQ--LESNMDQKTEYKED--RPVSVL-FGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            R   LE+ MD K     D     S+L FG + ++  +YQL+ PED  LA +LVR
Sbjct  134  RTHPLEAYMDSKVMISTDPKNSSSLLHFGPKYMQSRMYQLTAPEDFMLATMLVR  187



>ref|XP_002880516.1| hypothetical protein ARALYDRAFT_320178 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56775.1| hypothetical protein ARALYDRAFT_320178 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 125/179 (70%), Gaps = 9/179 (5%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIH-PKLAEQVSSMAEYN  216
            ++RK+HFVLVHGACHGAWCWYKV   L A GH+V+ALD+AASGI+  +    +S+  +Y+
Sbjct  4    EKRKQHFVLVHGACHGAWCWYKVKPQLEASGHRVTALDLAASGINMTRSITDISTCEQYS  63

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SF  384
            EPLT+ M +LP  EKVVLVGHS+GG+++++AM+ FP+KISV+VFVTA M  PD     SF
Sbjct  64   EPLTQLMTSLPNDEKVVLVGHSLGGLSLAVAMDMFPNKISVSVFVTAIM--PDTTHSPSF  121

Query  385  LAVKQEFHRQLESNMDQK-TEYKEDRPVSV-LFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  K       E  +D   T  K D P    LFG + + K +YQLSP +DL LAK+LVR
Sbjct  122  VMDKLRQGISREEWLDTVFTSEKPDCPREFSLFGPKFMAKNLYQLSPVQDLELAKMLVR  180



>ref|XP_004300552.1| PREDICTED: methylesterase 1-like [Fragaria vesca subsp. vesca]
Length=302

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 119/172 (69%), Gaps = 5/172 (3%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVL+HGA HGAW WYKVAALL++ GH V+ALD+ ASGI+P   +Q+ S +++ EPLT
Sbjct  53   KKHFVLIHGAGHGAWSWYKVAALLKSSGHNVTALDLGASGINPIQVQQLPSFSDFVEPLT  112

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            + M +LP  E+V+LV HS+ G  +++ ME FP KI+ AV+V+A M GP L++  +  E +
Sbjct  113  KIMVSLPPKERVILVSHSMAGATIAVFMEKFPEKIAAAVYVSAFMSGPTLNYSTIFTEIN  172

Query  409  RQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++L+  MD +  Y     +   S  FG ++ E L YQLSPPEDLTL   LVR
Sbjct  173  KRLDY-MDSEFRYDNGSNNSATSFRFGPKVSENL-YQLSPPEDLTLGISLVR  222



>ref|XP_009411687.1| PREDICTED: probable esterase PIR7A [Musa acuminata subsp. malaccensis]
 ref|XP_009411688.1| PREDICTED: probable esterase PIR7A [Musa acuminata subsp. malaccensis]
Length=261

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 116/174 (67%), Gaps = 5/174 (3%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHF+LVHG C GAWCWYK+  LLR+ GH V A+D+ A+G+ P+  +++SSM +Y  PL 
Sbjct  6    KKHFILVHGICQGAWCWYKLITLLRSAGHFVIAVDLGATGVDPQRLDELSSMDDYARPLF  65

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
              +A+LP  +K+VLVGHS GG +VSLAME FP KISVAVFVTA M    ++  A+  EF 
Sbjct  66   HAIASLPPHQKLVLVGHSFGGASVSLAMEKFPDKISVAVFVTAVMPSTTVAMAALTDEFF  125

Query  409  R--QLESNMDQKTEYKED--RPVS-VLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    E+ +D K     D   P S + FG E +   +YQLSP EDLTL  LLVR
Sbjct  126  KGHPAEAYLDSKVSISSDPQNPSSRIEFGPEYMSNRLYQLSPAEDLTLGTLLVR  179



>tpg|DAA55951.1| TPA: esterase PIR7A [Zea mays]
Length=269

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 118/176 (67%), Gaps = 6/176 (3%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            R+ HFVLVHG CHGAWCWYKVA LL + GH+V+ALDMAA G  P  AE+V S  EY+ PL
Sbjct  10   RRHHFVLVHGTCHGAWCWYKVATLLSSAGHRVTALDMAACGASPGRAEEVPSFEEYSRPL  69

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASM--FGPDLSFL---A  390
               +A L   EKVVLVGHS GGV+++LAME +P +++VAVFV   M   G  ++F+    
Sbjct  70   LATVAGLAPEEKVVLVGHSFGGVSLALAMEQYPDRVAVAVFVATGMPSAGKPMAFVFEQF  129

Query  391  VKQEFHRQLESNMDQKTEYKEDRPVSVL-FGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +++E+      + + +T     RPV    FG + L++ +YQLSPPEDLTLA  +VR
Sbjct  130  LQEEYPADRYMDCEFETSGDPQRPVETFRFGPQYLKQRLYQLSPPEDLTLAMAMVR  185



>gb|KCW55258.1| hypothetical protein EUGRSUZ_I01184, partial [Eucalyptus grandis]
Length=272

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHG+ HGAWCWYK+A LLR+ GH+V+ALD+AASGI    A+ + S++EY +PL +
Sbjct  18   KHFVLVHGSGHGAWCWYKIATLLRSAGHRVTALDLAASGIDLLQAKSLQSISEYFKPLRD  77

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             M  L + E+V+L+GHS+GG+ +S  ME FP +I++AVFV+A M GP+L+   + QE  R
Sbjct  78   VMEGLASHERVILIGHSLGGLALSQVMEKFPERIALAVFVSALMPGPELNVSTLNQESLR  137

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    +D    Y     + P +  FG   L   VYQLSP EDLTLA +L+R
Sbjct  138  RSPPVLDSHYTYDNGPNNPPTTFSFGPTFLASTVYQLSPIEDLTLANMLLR  188



>gb|KJB40231.1| hypothetical protein B456_007G052600 [Gossypium raimondii]
Length=257

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 117/172 (68%), Gaps = 5/172 (3%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            HF+LVHG CHGAWCWYK+ +LL++ GH+V+ LD+ ASGI+PK    ++S+++Y EPL   
Sbjct  3    HFLLVHGMCHGAWCWYKIVSLLKSGGHRVTPLDLGASGINPKTITDLASLSDYAEPLMAL  62

Query  235  MAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHRQ  414
            MA+LP  EKV+LVGHS GGV +SLAME FP K+  AV++TA M   D        E+ R+
Sbjct  63   MASLPQDEKVILVGHSYGGVIISLAMERFPMKVLAAVYLTAFMPNHDSPIATAVAEYFRR  122

Query  415  L--ESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  E  MD +  ++   E+ P   LFG + +E +VYQLSP ED+ LA  L+R
Sbjct  123  VMAEPLMDFQLLFEDGPENPPTHALFGPKYMEAMVYQLSPKEDIELANTLLR  174



>gb|ABR17565.1| unknown [Picea sitchensis]
Length=271

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 118/179 (66%), Gaps = 12/179 (7%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            HFVLVHGAC GAWCWYK++ LL   GH V+A+D+  +G++PK  E + S+AEYNEPL EF
Sbjct  15   HFVLVHGACLGAWCWYKLSDLLEKAGHVVTAIDLGGAGVNPKDGEAIRSLAEYNEPLAEF  74

Query  235  MAALPAG--------EKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA  390
            M +LP G        EKV+LVGHS+GGVN++  ME FPHKI+ AVFVTA M     + + 
Sbjct  75   MKSLPHGEGNRAEKDEKVILVGHSMGGVNLTCMMEQFPHKIAAAVFVTAFMPVSGTTPIQ  134

Query  391  VKQEFHRQLESNMDQKTEY----KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  E +++ ++  D + +Y    + +RP S  FG     + +YQ SP ED+TL + L+R
Sbjct  135  LLDEVYQRNQTWGDTEFKYGLDGQPNRPTSFRFGRNFAREYLYQNSPSEDITLTECLLR  193



>gb|ACG44547.1| esterase PIR7A [Zea mays]
Length=267

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 120/181 (66%), Gaps = 6/181 (3%)
 Frame = +1

Query  31   SIMDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAE  210
            S  + R+ HFVLVHG CHGAWCWYKVA LL + GH+V+ALDMAA G  P  AE+V S  E
Sbjct  3    SGTERRRHHFVLVHGTCHGAWCWYKVATLLSSAGHRVTALDMAACGASPGRAEEVPSFEE  62

Query  211  YNEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASM--FGPDLSF  384
            Y+ PL   +A L   EKVVLVGHS GGV+++LAME +P +++VAVFV   M   G  ++F
Sbjct  63   YSRPLLATVAGLAPEEKVVLVGHSFGGVSLALAMEQYPDRVAVAVFVATGMPSAGKPMAF  122

Query  385  L---AVKQEFHRQLESNMDQKTEYKEDRPVSVL-FGHEMLEKLVYQLSPPEDLTLAKLLV  552
            +    +++E+      + + +T     RPV    FG + L++ +YQLSPPEDLTLA  ++
Sbjct  123  VFEQFLQEEYPADRYMDCEFETSGDPQRPVETFRFGPQYLKQRLYQLSPPEDLTLAMAML  182

Query  553  R  555
            R
Sbjct  183  R  183



>ref|XP_010028516.1| PREDICTED: salicylic acid-binding protein 2-like [Eucalyptus 
grandis]
Length=284

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHG+ HGAWCWYK+A LLR+ GH+V+ALD+AASGI    A+ + S++EY +PL +
Sbjct  30   KHFVLVHGSGHGAWCWYKIATLLRSAGHRVTALDLAASGIDLLQAKSLQSISEYFKPLRD  89

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             M  L + E+V+L+GHS+GG+ +S  ME FP +I++AVFV+A M GP+L+   + QE  R
Sbjct  90   VMEGLASHERVILIGHSLGGLALSQVMEKFPERIALAVFVSALMPGPELNVSTLNQESLR  149

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +    +D    Y     + P +  FG   L   VYQLSP EDLTLA +L+R
Sbjct  150  RSPPVLDSHYTYDNGPNNPPTTFSFGPTFLASTVYQLSPIEDLTLANMLLR  200



>ref|XP_006404849.1| hypothetical protein EUTSA_v10000533mg, partial [Eutrema salsugineum]
 gb|ESQ46302.1| hypothetical protein EUTSA_v10000533mg, partial [Eutrema salsugineum]
Length=276

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 127/181 (70%), Gaps = 12/181 (7%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIH-PKLAEQVSSMAEYN  216
            + +K+HFVLVHGACHGAWCWYKV  LL A GH V+ALD+AASGI   +   ++SS  +Y+
Sbjct  16   ENKKQHFVLVHGACHGAWCWYKVKPLLEASGHLVTALDLAASGIDTTRSITEISSCEQYS  75

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SF  384
            EPL + MA+LP  EKVVLVGHS GG+N+++AM+ FP KISV+VFVTA  F PD     SF
Sbjct  76   EPLMQLMASLPVDEKVVLVGHSFGGLNLAMAMDKFPDKISVSVFVTA--FMPDTKHSPSF  133

Query  385  LAVKQEF--HRQLESNMDQKTE-YKEDRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLV  552
            + + +EF   + LE  +  + E Y  DR  VS+ F +E +++ +YQLSP EDL L  LL 
Sbjct  134  V-MDKEFGGDKPLEIWLGTEFEPYGSDRSGVSMFFSNEFMKQALYQLSPIEDLELGLLLK  192

Query  553  R  555
            R
Sbjct  193  R  193



>ref|XP_010472355.1| PREDICTED: methylesterase 2-like [Camelina sativa]
Length=263

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 117/177 (66%), Gaps = 5/177 (3%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIH-PKLAEQVSSMAEYN  216
            ++RK+HFVLVHGACHGAWCWYKV  LL A GH+V+ALD+AA GI   +    +S+  +Y+
Sbjct  4    EKRKQHFVLVHGACHGAWCWYKVKPLLEASGHRVTALDLAACGIDTTRSITDISTCEQYS  63

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL + M +LP  EKVVLVGHS GG+N+++AM+ FP KISV+VFVTA M     S   V 
Sbjct  64   EPLIQLMTSLPNDEKVVLVGHSFGGLNLAIAMDKFPEKISVSVFVTAFMPDTKCSPSFVV  123

Query  397  QEFHRQLESNMDQKTEYK----EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +F   + S     TE K    ++  +SV F  E ++  +YQLSP EDL L  LL R
Sbjct  124  DKFASYMTSEGWMGTELKPYGLDNSGLSVFFSTEFMKNRLYQLSPIEDLELGLLLKR  180



>ref|XP_003518092.1| PREDICTED: methylesterase 1-like isoform 1 [Glycine max]
Length=277

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 114/178 (64%), Gaps = 17/178 (10%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
             RKKH+VLVHGACHGAW W K+   L +EGHKV+ LD+AASGI+ K    V + ++Y+EP
Sbjct  27   NRKKHYVLVHGACHGAWSWCKLKPRLESEGHKVTVLDLAASGINMKRIADVDTFSQYSEP  86

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L + M  +P+ EKVVLVGHS GG+N++LAME FP K++V VF+TA  F PD         
Sbjct  87   LLQLMTKIPSNEKVVLVGHSFGGMNIALAMEKFPEKVAVGVFLTA--FAPDTE-------  137

Query  403  FHRQ---LESNMDQKTEYKEDRP----VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             HR    LE N   +    E  P     S+LFG E L K  YQLSP EDL LAK LVR
Sbjct  138  -HRPSYVLEQNTSSEDLDNEFAPSGNKTSMLFGPEYLSKKQYQLSPVEDLELAKTLVR  194



>ref|XP_004514201.1| PREDICTED: salicylic acid-binding protein 2-like [Cicer arietinum]
Length=259

 Score =   171 bits (433),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 125/173 (72%), Gaps = 7/173 (4%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVL+HGA HGAWCWYKVA+ L++ GHKV+ LDMAASGI+PK  ++V S+++Y++PL  
Sbjct  3    KHFVLIHGAIHGAWCWYKVASELKSFGHKVTTLDMAASGINPKQMQEVHSISQYHQPLMT  62

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM ++P  EKV+LVGHS+GG+++S+AME++ HKI VAVF+TA++   +L++ A  +E  R
Sbjct  63   FMESIPHDEKVILVGHSLGGLSLSIAMENYYHKIYVAVFITATVVTQNLTYPAFLEERRR  122

Query  412  QLESNMDQKTEY-----KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++ S +D  T+Y         P+    G +++   +YQLS  +DLTL   LVR
Sbjct  123  RVGSALD--TQYFIFDGPNKVPILSSDGLKLITSRMYQLSENQDLTLGLSLVR  173



>ref|XP_009376487.1| PREDICTED: salicylic acid-binding protein 2-like [Pyrus x bretschneideri]
Length=265

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 125/178 (70%), Gaps = 9/178 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ERK HFVLVHGA HGAWCWYK+   L + GH+V+ L++AASGI+ K  + V S+ EY+EP
Sbjct  7    ERKAHFVLVHGAGHGAWCWYKIKPKLESRGHRVTVLNLAASGINMKAIQDVHSLTEYSEP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA--VK  396
            L E + +L   EKV+LVGHS+GG+N+SLAME FPHKIS AVF+TA  F PD +     V 
Sbjct  67   LLESIESLAPNEKVILVGHSLGGMNLSLAMEKFPHKISAAVFLTA--FLPDTTHQPSYVM  124

Query  397  QEF--HRQLESNMDQKTEY--KEDRPV-SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +F   +  +S +D + E     ++P+ S+ FG + L++++YQLSP EDL LAK LVR
Sbjct  125  DQFLEKKPADSWLDTRFEKFGSPEQPLTSIFFGPKCLQEILYQLSPIEDLELAKSLVR  182



>ref|XP_009366235.1| PREDICTED: salicylic acid-binding protein 2-like [Pyrus x bretschneideri]
Length=265

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 126/178 (71%), Gaps = 9/178 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E+K HFVLVHGA HGAWCWYK+   L + GH+V+ALD+AASGI+ K  + V S+ EY+EP
Sbjct  7    EQKAHFVLVHGAGHGAWCWYKIKPKLESVGHRVTALDLAASGINMKAIQDVHSLTEYSEP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA--VK  396
            L E + +L   EKV+LVGHS+GG+N+SLAME FPHKIS AVFVTAS+  PD +     + 
Sbjct  67   LLELIESLGPEEKVILVGHSLGGMNLSLAMEKFPHKISAAVFVTASL--PDTTHQPSYIM  124

Query  397  QEFHRQLESNMDQKTEYKE----DRPV-SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +   +L ++    T +++    ++P+ S+L G + L++ +YQLSP EDL LAK LVR
Sbjct  125  DQIMEKLPADSWLDTRFEKFGSAEQPLTSILLGPKFLQEKLYQLSPIEDLELAKSLVR  182



>ref|XP_006346534.1| PREDICTED: salicylic acid-binding protein 2-like [Solanum tuberosum]
Length=288

 Score =   171 bits (434),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 112/171 (65%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGACHGAW WYK+ AL+R+ GH V++LD+ ASGI+ K   ++  +++Y  PL E
Sbjct  34   KHFVLVHGACHGAWSWYKIVALIRSSGHNVTSLDLGASGINKKQVLEIPYLSDYFSPLME  93

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FMA+LP+ EKV+LVG S+GG  +S AMESFP KISVA+FV A M GP L    V  E  R
Sbjct  94   FMASLPSYEKVILVGQSLGGFAISKAMESFPEKISVAIFVNALMPGPILDAATVFNESSR  153

Query  412  QLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +   +D +  +     + P + ++G + L    Y LSP +D  LA  LVR
Sbjct  154  GVVFKLDNRVTFDNGLANPPTTFIYGPKYLASYNYPLSPIQDWALATTLVR  204



>ref|XP_006346477.1| PREDICTED: polyneuridine-aldehyde esterase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006346478.1| PREDICTED: polyneuridine-aldehyde esterase-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006346479.1| PREDICTED: polyneuridine-aldehyde esterase-like isoform X3 [Solanum 
tuberosum]
Length=286

 Score =   171 bits (434),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 111/172 (65%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            +KHFVLVHGACHGAW WYK  A ++  GH V+ALD+  +G++P+   Q+  +++Y  PL 
Sbjct  33   RKHFVLVHGACHGAWSWYKTMASIKTTGHNVTALDLGGAGVNPRQVLQIPHLSDYFRPLM  92

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA EKV+LVGHS+GG  +S AMESFP KISVA+FVTA M GP L    +  E  
Sbjct  93   EFMASLPADEKVILVGHSLGGFAISKAMESFPEKISVAIFVTALMPGPMLDAATIFNESS  152

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                  +D +  +     + P + +FG + L   +Y LSP +D  LA  LVR
Sbjct  153  SGAIFKLDNRLTFDNGLANPPTTFIFGPKYLASYLYPLSPIQDWALATTLVR  204



>ref|XP_006346489.1| PREDICTED: polyneuridine-aldehyde esterase-like [Solanum tuberosum]
Length=285

 Score =   171 bits (433),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 115/172 (67%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH A HGAW  YK+ AL+R+ GH V+ALD+ ASGI+PK A ++   ++Y  PL 
Sbjct  31   KKHFVLVHTAGHGAWTSYKIMALMRSSGHNVTALDLGASGINPKQALEIPHFSDYLSPLM  90

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA +KVVLVGHS GG+ +S AME+FP KIS AVF++  M GP+++   V  +  
Sbjct  91   EFMASLPADKKVVLVGHSFGGLGISKAMETFPDKISAAVFLSGLMPGPNINATTVYTKAI  150

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              + + +  +  Y     + P +V+ G + L   +YQLSP EDL LA  LVR
Sbjct  151  NAVITQLGTRVTYDNGPTNPPTTVILGPKYLGTYIYQLSPIEDLALATTLVR  202



>ref|XP_008241572.1| PREDICTED: salicylic acid-binding protein 2-like [Prunus mume]
Length=262

 Score =   170 bits (431),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 126/178 (71%), Gaps = 10/178 (6%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            + +KHFVLVHGACHG+WCWYK+   L + GH+V+ALD+AASGI+ K  + V S+AEY+EP
Sbjct  5    KEEKHFVLVHGACHGSWCWYKIKPRLESAGHRVTALDLAASGINTKAIQDVHSLAEYSEP  64

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFLA  390
            L EF+A+L   EKV+LVGHSIGG++++LAME+FP KISVAVF+TA  F PD     S++ 
Sbjct  65   LLEFIASLGPEEKVILVGHSIGGMSLALAMENFPKKISVAVFLTA--FVPDTTHQPSYVL  122

Query  391  VKQEFHRQLESNMD-QKTEYKEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +       E+ +D Q T Y   +   +S+ FG E L KL YQLSP EDL LAK L R
Sbjct  123  DQFTQFTPAEAWLDTQFTNYGSAKEPLMSMHFGPEFLAKL-YQLSPIEDLELAKSLAR  179



>ref|XP_003626748.1| Methyl jasmonate esterase [Medicago truncatula]
 gb|AET01224.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=278

 Score =   171 bits (432),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 115/169 (68%), Gaps = 2/169 (1%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGA HGAWCWYKVA +L+  GH V+ +D+AA GI P   +++ S+++Y EP   
Sbjct  26   KHFVLVHGAFHGAWCWYKVATMLKLAGHNVTTIDLAACGISPIQVQEIHSISQYYEPFMT  85

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH-  408
            FM +LP  EKV+LVGHS GG+ +S+AME FP KISVAVF+TA +   +L+F +  QE   
Sbjct  86   FMESLPPKEKVILVGHSFGGIPLSVAMEKFPKKISVAVFITALVLSENLNFTSFNQENST  145

Query  409  RQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            RQ ES +        + P + L+G +++   +YQLSP EDLTL   LVR
Sbjct  146  RQGESQLFFSNGI-NNPPTASLWGPKIMSSNLYQLSPHEDLTLGLSLVR  193



>ref|XP_010938436.1| PREDICTED: salicylic acid-binding protein 2-like [Elaeis guineensis]
Length=270

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 116/178 (65%), Gaps = 7/178 (4%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            +E K HF+LVHG  HGAWCWYK+A LL + GH+V+A D+AASG+HPK   ++ S  +Y E
Sbjct  11   EESKMHFILVHGIGHGAWCWYKLATLLTSAGHRVTAFDLAASGVHPKNLHELRSFTDYCE  70

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQ  399
            PL E MA++P  ++V+LVGHS GG+ ++LAME FP K+SVAVF T  M         + +
Sbjct  71   PLMETMASIPPDDRVILVGHSFGGICIALAMEKFPAKVSVAVFATGVMPSTTTPVSDIVK  130

Query  400  EFHRQ--LESNMDQKTEYKEDRPVSVLFGH----EMLEKLVYQLSPPEDLTLAKLLVR  555
            EF+R+  LE+ MD K     D   S  F H     ML K+ YQL+ PED  LA +LVR
Sbjct  131  EFYRRHPLEAYMDSKVMISTDPKNSSSFLHFGPKYMLSKM-YQLTAPEDFMLATMLVR  187



>gb|KJB48505.1| hypothetical protein B456_008G072700 [Gossypium raimondii]
Length=261

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 117/176 (66%), Gaps = 5/176 (3%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E+K HFVL+HGA HGAWCWYKV   L++ GHKV+A+DMA +GIHPK   +V S++ Y EP
Sbjct  2    EKKGHFVLIHGASHGAWCWYKVIPQLKSVGHKVTAMDMAGAGIHPKQVHEVQSISVYFEP  61

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L  FMA+L   EKV+LVGHS+GG  +S AME +P K++VAVF  A M  P L F+ + Q+
Sbjct  62   LMNFMASLQPEEKVILVGHSMGGYCISAAMERYPEKVAVAVFAAAYMASPTLPFVTISQQ  121

Query  403  FHRQLESNMDQKTEY-----KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            F  +++S+    +++      +  P S   G   +    YQLSPPEDLTLA  LVR
Sbjct  122  FKEKMDSDKAMDSQFLFHNGLDKPPTSACLGPNFMASKFYQLSPPEDLTLALTLVR  177



>gb|KHG14261.1| Polyneuridine-aldehyde esterase [Gossypium arboreum]
Length=263

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 125/180 (69%), Gaps = 13/180 (7%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
             ++KHF+LVHGACHGAWCWYK+   L++ GH+V+A+DMAASGI+ K  + V SM +Y++P
Sbjct  5    NKQKHFILVHGACHGAWCWYKLKPRLQSAGHRVTAVDMAASGINMKAIQGVHSMYDYSKP  64

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFLA  390
            L E +A+L +GEK +LVGHS+GG+N++LAM+ +P KIS AVF+ A  F PD     SF  
Sbjct  65   LLEILASLASGEKAILVGHSLGGLNLALAMDKYPEKISAAVFLAA--FMPDTAHHPSF--  120

Query  391  VKQEFHRQLESNMDQKTEYK-----EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            V +++ ++  S     TE+      ED  +S+ FG + L   +YQLSP EDL LAK L+R
Sbjct  121  VLEQYWQRTPSEAWLDTEFAPYGRPEDSSMSMFFGPKFLTSKLYQLSPVEDLELAKALIR  180



>dbj|BAK00779.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=265

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 117/174 (67%), Gaps = 7/174 (4%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHF+LVHG CHGAWCWYK+  +LRA GH+V+ALDMAA G HP   ++V S  +Y+ PL +
Sbjct  8    KHFILVHGFCHGAWCWYKLVPMLRAAGHRVTALDMAACGAHPARMDEVESFEDYSRPLLD  67

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             +AA PAGE++VLVGHS+GG+N++LAME FP K++ AVF+ ASM           +E  R
Sbjct  68   AVAAAPAGERLVLVGHSLGGLNIALAMERFPRKVAAAVFLVASMPCVGRHMGVTTEEIMR  127

Query  412  QLESN--MDQK----TEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            Q++ +  MD K       K  RP +++FG ++L   +Y  S  ED TLA +LVR
Sbjct  128  QIKPDFFMDMKRMLLNTSKGPRP-ALVFGPKLLAAKLYDRSSAEDQTLATMLVR  180



>ref|XP_010908450.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Elaeis 
guineensis]
Length=264

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 116/181 (64%), Gaps = 15/181 (8%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
             R+KH +LVHGACHGAW WYKVA LLR  GH+V+  D+AASGI  +   +VS+ A+Y++P
Sbjct  6    RRQKHIILVHGACHGAWSWYKVATLLRCAGHQVTVPDLAASGIDERRLHEVSTFADYSQP  65

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGP--------DL  378
            L + +AALP GE+V+LVGHS+GG++VSLAME FP +I+ AVF+TA M  P        D 
Sbjct  66   LLDILAALPPGERVILVGHSLGGMSVSLAMERFPERIAAAVFLTAFMPAPASRPSHVLDK  125

Query  379  SFLAVKQEF--HRQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLV  552
             F      F    Q  S+ DQ     E  PVS+LFG   +   +YQL   EDLTL   LV
Sbjct  126  LFQEAPMSFWMDTQFSSSRDQ-----EKSPVSMLFGPLFISLNLYQLCSVEDLTLGTTLV  180

Query  553  R  555
            R
Sbjct  181  R  181



>ref|XP_010417104.1| PREDICTED: methylesterase 2 [Camelina sativa]
Length=263

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 120/181 (66%), Gaps = 13/181 (7%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIH-PKLAEQVSSMAEYN  216
            ++RK+HFVLVHGACHGAWCWYKV  LL A GH+V+ALD+AA GI   +    +S+  +Y+
Sbjct  4    EKRKQHFVLVHGACHGAWCWYKVKPLLEASGHRVTALDLAACGIDTTRSITDISTCEQYS  63

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SF  384
            EPL + M +LP  EKVVLVGHS GG+N+++AM+ FP KISV+VFVTA  F PD     SF
Sbjct  64   EPLIQLMTSLPNDEKVVLVGHSFGGLNLAIAMDKFPEKISVSVFVTA--FMPDTKYSPSF  121

Query  385  LAVKQEFHRQLESNMDQKTEYK----EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLV  552
            +  K   H   E  M   TE K    ++  +SV F  E ++  +YQLSP EDL L  LL 
Sbjct  122  VVDKFASHMTPEGWMG--TELKPYGLDNSGLSVFFSTEFMKNRLYQLSPIEDLELGLLLK  179

Query  553  R  555
            R
Sbjct  180  R  180



>ref|XP_009395210.1| PREDICTED: salicylic acid-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=280

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 121/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKH +LVHGACHGAW WYKV  LLR+ G++V+  D+AASG+  +  E + +  +Y++PL 
Sbjct  25   KKHIILVHGACHGAWSWYKVTTLLRSAGYQVTVPDLAASGVDERRLEDLRTFTDYSQPLL  84

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFLAVK  396
            + +A LP GE+V+LVGHS+GG+N++LAM+ FP KI+ AVFVTA  F PD     S++  K
Sbjct  85   DILACLPPGERVILVGHSLGGLNIALAMDRFPEKIAAAVFVTA--FMPDSVNPPSYVMDK  142

Query  397  QEFHRQLESNMDQKTEY--KEDR-PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +  + + +  D +      ED+ P SVLFG E L KL Y  SPPEDLTLA+ LVR
Sbjct  143  HKEEKPMLNWGDTQFGLVGDEDKGPASVLFGTEFLSKL-YTRSPPEDLTLARTLVR  197



>ref|XP_011099229.1| PREDICTED: putative inactive methylesterase 20 [Sesamum indicum]
Length=202

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            + ++++HFVLVHGACHGAWCWYKV   LR++GH+V+ALDMAA+G +PK  E+++S+++Y 
Sbjct  31   LGDKQQHFVLVHGACHGAWCWYKVMTKLRSDGHRVTALDMAAAGANPKRVEELTSISDYY  90

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            +PL EFM AL   EKVVLVGHS+GG+ +SLAME FP KI++AVF TA M GPD     V 
Sbjct  91   QPLMEFMMALATDEKVVLVGHSMGGICISLAMEKFPEKIALAVFATAFMPGPDFPVSTVV  150

Query  397  QEFHRQLESNMDQKTE  444
             E+ R +     Q + 
Sbjct  151  DEYQRHICQRRRQTSN  166



>gb|ABK26277.1| unknown [Picea sitchensis]
Length=279

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 118/179 (66%), Gaps = 12/179 (7%)
 Frame = +1

Query  55   HFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTEF  234
            HFVLVHGACHGAWCWYK++ LL+  GH V+A+D+  +G++PK  + + S+AEYNEPL  F
Sbjct  15   HFVLVHGACHGAWCWYKLSDLLKNAGHVVTAVDLGGAGLNPKDGDGIRSLAEYNEPLARF  74

Query  235  MAALPAG--------EKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA  390
            M ALP G        EKV+LVGHS+GGV+++  ME FPHKI+ AVFVTA M  P  + L 
Sbjct  75   MEALPHGDEDGAEKDEKVILVGHSMGGVDLTCMMEQFPHKIAAAVFVTAFMPVPGTAPLQ  134

Query  391  VKQEFHRQLESNMDQKTEYKED----RPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  + + + ++  D + +Y  D    RP S  FG     + +Y  SP +D+TLA+ L+R
Sbjct  135  LINQVYERNKTWGDTEFKYGLDGQPSRPTSFKFGSNFAREYLYHKSPSQDITLAERLLR  193



>ref|XP_007202390.1| hypothetical protein PRUPE_ppa009400mg [Prunus persica]
 gb|EMJ03589.1| hypothetical protein PRUPE_ppa009400mg [Prunus persica]
Length=294

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 115/174 (66%), Gaps = 8/174 (5%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVL+HGA HGAW WYKVA LL+  GH V+ALD+ ASGI+P   EQ+ SM++Y EPLT
Sbjct  44   KKHFVLIHGAGHGAWSWYKVATLLKHSGHNVTALDLGASGINPIQVEQLHSMSQYVEPLT  103

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            + M +LP  E+V+LV HSI G  +S+ ME FP KI   V+ TA M G  LS+  +  E +
Sbjct  104  KLMVSLPPTERVILVAHSITGAVISIFMERFPEKIVAGVYATAFMSGLGLSYSTIFAEIN  163

Query  409  RQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++L+  MD  T+Y+ D        S  FG +++    YQLSPPEDLTL   LVR
Sbjct  164  KRLDY-MD--TQYRYDNGPKNPATSFRFGPKVMASNFYQLSPPEDLTLGYSLVR  214



>gb|EMT21621.1| hypothetical protein F775_21482 [Aegilops tauschii]
Length=265

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 117/174 (67%), Gaps = 7/174 (4%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHF+LVHG CHGAWCWYK+A +LRA GH+V+ALDMAASG HP   ++V S  +Y++PL +
Sbjct  8    KHFILVHGLCHGAWCWYKLAPMLRAAGHRVTALDMAASGAHPARMDEVPSFEDYSQPLLD  67

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             +AA P GE++VLVGHS+GG+N++LAME FP K++ AVF+ A M           +EF R
Sbjct  68   ALAAAPPGERLVLVGHSLGGLNLALAMERFPRKVAAAVFLAACMACAGRHMGVTIEEFSR  127

Query  412  QLESN--MDQKT----EYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  S+  MD K+      +  RP +V  G ++L   +Y  S  EDL LA LLVR
Sbjct  128  RTRSDFFMDSKSMVLNADQGARP-AVALGPKLLAAKLYDRSSVEDLMLATLLVR  180



>gb|KJB43606.1| hypothetical protein B456_007G209500 [Gossypium raimondii]
Length=263

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 122/180 (68%), Gaps = 13/180 (7%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
             ++KHF+LVHGACHGAWCWYK+   L + GH+V+A+DMAASGI+ K  + V SM EY++P
Sbjct  5    NKQKHFILVHGACHGAWCWYKLKPRLESAGHRVTAVDMAASGINMKAIQGVHSMYEYSKP  64

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFLA  390
            L E +A+L  GEK +LVGHS+GG+N++LAME +P  IS AVF+ A  F PD     SF  
Sbjct  65   LLEILASLAPGEKAILVGHSLGGLNLALAMEKYPENISAAVFLAA--FMPDTAHHPSF--  120

Query  391  VKQEFHRQLESNMDQKTEYK-----EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            V +++ ++  S     TE+      ED  +S+ FG + L   +YQLSP EDL LAK L+R
Sbjct  121  VLEQYWQRTPSEAWLDTEFAPYGRPEDSSMSMFFGTKFLTSKLYQLSPVEDLELAKALIR  180



>ref|XP_010315273.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Solanum 
lycopersicum]
Length=286

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 111/171 (65%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGACHGAW WYK+ A ++  GH V+ALD+ ASG++PK   ++  +++Y  PL E
Sbjct  34   KHFVLVHGACHGAWSWYKIMASIKTSGHNVTALDLGASGVNPKQVLEIPHLSDYFSPLME  93

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FMA+LP  EKV+LVGHS+GG  +S AMESFP KISVA+FVTA M G  L    V  E   
Sbjct  94   FMASLPVDEKVILVGHSLGGFAISKAMESFPEKISVAIFVTALMPGLILDAATVFNESSS  153

Query  412  QLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
               S +D +  +     + P + +FG + L   +Y LSP +D  LA  LVR
Sbjct  154  GAISKLDNRLTFDNGLANPPTTFIFGPKYLASYLYPLSPIQDWALATTLVR  204



>ref|XP_011099225.1| PREDICTED: LOW QUALITY PROTEIN: methylesterase 10 [Sesamum indicum]
Length=261

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 117/177 (66%), Gaps = 5/177 (3%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNE  219
            +  KKHFVLVHG  HGAWCWYK+  +L+ +GH+V+ALD+   GIHPK   Q+SS+++Y +
Sbjct  4    NSAKKHFVLVHGLSHGAWCWYKIVPMLKLQGHRVTALDLGGWGIHPKRLHQISSISDYIQ  63

Query  220  PLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQ  399
            PL +F+AAL   + V+LVGHS GG+ +SLAME+FP KI VAVFV+A M         + Q
Sbjct  64   PLLDFLAALADDQTVILVGHSYGGIPISLAMENFPGKIXVAVFVSAYMPNCADPPATLIQ  123

Query  400  EFHRQLESN--MDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            EF ++  +N  MD +  +    ++ P+S  FG E +   +Y   P EDL LAK LVR
Sbjct  124  EFLKRCSTNSLMDCEITFDQISQNLPISAAFGPEYMAAKMYANCPSEDLELAKTLVR  180



>ref|XP_010429311.1| PREDICTED: methylesterase 2-like [Camelina sativa]
Length=264

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 120/178 (67%), Gaps = 6/178 (3%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLA-EQVSSMAEYN  216
            ++RK+HFVLVHGACHGAWCWYKV  LL A GH+V+ALD+AASGI    +   +S+  +Y+
Sbjct  4    EKRKQHFVLVHGACHGAWCWYKVKPLLEASGHRVTALDLAASGIDTTRSLTDISTCEQYS  63

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL + M +LP  EKVVLVGHS GG+N+++AM+ FP KISV+VFVTA M     S   V 
Sbjct  64   EPLIQLMTSLPNDEKVVLVGHSFGGMNLAIAMDKFPEKISVSVFVTALMPDTKYSPSFVV  123

Query  397  QEFHRQLESNMDQKTEYK----EDRPVSVLFG-HEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++F   +       TE+K    ++  +SV    HE ++  +YQLSP EDL L +LL R
Sbjct  124  EKFASYMTPEGWMGTEHKPYGLDNSGLSVFLSTHEFMKNRLYQLSPIEDLELGQLLKR  181



>ref|XP_008241563.1| PREDICTED: salicylic acid-binding protein 2-like [Prunus mume]
Length=294

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 115/174 (66%), Gaps = 8/174 (5%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVL+HGA HGAW WYKVA LL+  GH V+ALD+ ASGI+P   EQ+ SM++Y EPLT
Sbjct  44   KKHFVLIHGAGHGAWSWYKVATLLKHSGHNVTALDLGASGINPIQVEQLHSMSQYVEPLT  103

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            + M +LP  E+V+LV HSI G  +S+ ME FP KI   V+ TA M G  LS+  +  E +
Sbjct  104  KLMVSLPPKERVILVAHSITGAVISIFMERFPEKIVAGVYATAFMSGLSLSYSTIFAEIN  163

Query  409  RQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++L+  MD  T+Y+ D        S  FG +++    YQLSPPEDLTL   LVR
Sbjct  164  KRLDY-MD--TQYRYDNGPKSPATSFRFGPKVMASNFYQLSPPEDLTLGYSLVR  214



>ref|XP_007047144.1| Salicylic acid-binding protein 2 [Theobroma cacao]
 gb|EOX91301.1| Salicylic acid-binding protein 2 [Theobroma cacao]
Length=263

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 121/177 (68%), Gaps = 9/177 (5%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
            ++KHF+LVHGACHGAWCWYK+   L + GH+V+A+D+AASGI+    + V +M EY +PL
Sbjct  6    KQKHFILVHGACHGAWCWYKLKPRLESAGHRVTAIDLAASGINMNAIQSVHTMNEYTKPL  65

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA--VKQ  399
             E +A+LP GEKV+LVGHS+GG+N++LAM+ FP KIS  VF+TA  F PD +     V +
Sbjct  66   LEILASLPPGEKVILVGHSLGGLNLALAMDKFPEKISAGVFLTA--FMPDTAHQPSFVLE  123

Query  400  EFHRQLESNMDQKTEY-----KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++ ++  +     TE+      E   +S+ FG + L   +YQLSP EDL LAK L+R
Sbjct  124  QYWKRTPAEAWLDTEFAPYGRPEQSLMSMFFGPKFLTYKLYQLSPVEDLELAKALIR  180



>ref|XP_010255101.1| PREDICTED: salicylic acid-binding protein 2-like [Nelumbo nucifera]
Length=258

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 123/176 (70%), Gaps = 10/176 (6%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVL+HG CHGAWCWYKV  +L AEGH+V+ALD++ASGI+ K  E++ +MAEY+EPLT
Sbjct  2    KKHFVLIHGLCHGAWCWYKVKPMLEAEGHRVTALDLSASGINTKKIEEIQTMAEYSEPLT  61

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSF---LAVKQ  399
            + M ++P  EKV+LVGHS+GG+++ +AME FPHKIS A+FVTA  F PD S      + Q
Sbjct  62   DLMKSIPPEEKVILVGHSLGGLSLGVAMEEFPHKISTAIFVTA--FMPDSSHPPSYVLDQ  119

Query  400  EFHR-QLESNMDQKTEYKED--RPV-SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             F +   E+ +D +    ++  +P  SVL G + L +  Y L  P+D +L  +L+R
Sbjct  120  LFEKIPAEAWLDTQFSSSDNSGKPAPSVLIGPKDLSRF-YHLCSPQDFSLGMMLMR  174



>ref|XP_010030657.1| PREDICTED: probable esterase PIR7A [Eucalyptus grandis]
 gb|KCW55273.1| hypothetical protein EUGRSUZ_I01201 [Eucalyptus grandis]
 gb|KCW55274.1| hypothetical protein EUGRSUZ_I01201 [Eucalyptus grandis]
Length=288

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 110/171 (64%), Gaps = 3/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGACHGAWCWYKVA LLR+ GH V+ +D+AASGI P  A  + S+++Y +PL +
Sbjct  33   KHFVLVHGACHGAWCWYKVATLLRSSGHNVTTIDLAASGIDPIQASSLQSISDYFKPLRD  92

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             M +L   E+V+LVGHS GG+ +S  ME +P KI VAVFVTA M GP L+   V  E  R
Sbjct  93   VMESLSLHERVILVGHSFGGMALSHVMERYPKKIVVAVFVTALMPGPKLNATTVNTETIR  152

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  S  D +  Y     + P +V  G  +L    YQ SP +D TLA  LVR
Sbjct  153  RAGSLGDSRYIYDNGPNNPPTAVTLGPMLLASRTYQRSPIQDWTLANTLVR  203



>ref|XP_010921787.1| PREDICTED: probable esterase PIR7A [Elaeis guineensis]
Length=284

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 120/174 (69%), Gaps = 5/174 (3%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHF+LVHG  HGAWCWYK+A LLR+ G +V+ALD+AASG +P+   ++ S ++Y+ PL 
Sbjct  30   KKHFILVHGMGHGAWCWYKLAPLLRSAGQRVTALDLAASGRNPEPLNELRSFSDYSAPLM  89

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            E MA++P+GE+VVLVGHS GG +++LA E FP KISVAVFVTA M         + QE++
Sbjct  90   EAMASIPSGERVVLVGHSHGGYSIALAAEKFPEKISVAVFVTAIMPSTTTPLSTITQEYN  149

Query  409  RQ--LESNMDQKTEYKEDRPVS---VLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +   E  +D K    +D  +S   + FG   +++ +Y+LS PEDLTLA  LVR
Sbjct  150  IRHPPEYFLDTKFVIGQDHDISWTTITFGPNYMKERLYRLSAPEDLTLATTLVR  203



>ref|XP_004300556.1| PREDICTED: salicylic acid-binding protein 2 [Fragaria vesca subsp. 
vesca]
Length=165

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 113/163 (69%), Gaps = 8/163 (5%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVL+HGA HGAWCWYK+A LL A GH V+ALD+  SGI+    +Q+ S+A+Y+EPL +
Sbjct  2    KHFVLIHGAGHGAWCWYKLATLLTAAGHNVTALDLPGSGINLTEVQQIRSIADYSEPLIK  61

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             M +LP  ++V+LVGHS+GG+ ++L ME FP KI+ AVF TA M G +LS   + +EF +
Sbjct  62   LMESLPPQDRVILVGHSLGGLPLTLVMERFPSKIAAAVFATADMPGLNLSLATISEEFGK  121

Query  412  QLESNMDQKTEYKED----RPVS-VLFGHEMLEKLVYQLSPPE  525
              +  MD  T+Y+ D    RP + V FG + L   +YQLSPPE
Sbjct  122  DTDF-MD--TQYRFDDGSGRPATAVFFGPKFLASKLYQLSPPE  161



>ref|XP_007204773.1| hypothetical protein PRUPE_ppa015635mg, partial [Prunus persica]
 gb|EMJ05972.1| hypothetical protein PRUPE_ppa015635mg, partial [Prunus persica]
Length=254

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 117/174 (67%), Gaps = 8/174 (5%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVL+HGA  GAW WYKVA LL+  GH V+ALD+ ASGI+P   +Q+ S+++Y EPLT
Sbjct  4    KKHFVLIHGAGLGAWSWYKVATLLKDSGHNVTALDLGASGINPIQIQQLRSISQYVEPLT  63

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            + M +LP  ++++LVGHS+GG  +S  ME FP KI+ AV+VTA M GP L++  +  E +
Sbjct  64   KLMVSLPPKDRIILVGHSMGGAVISTFMERFPEKIAAAVYVTAFMSGPTLNYSTILTEVN  123

Query  409  RQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++L+  +D  T+Y+ D      P S L G + L    YQLSP +D TL   L+R
Sbjct  124  KRLDY-LD--TQYRYDNGTNNPPTSFLIGPKALALKFYQLSPAQDKTLVSSLIR  174



>ref|XP_006346536.1| PREDICTED: polyneuridine-aldehyde esterase-like [Solanum tuberosum]
Length=283

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 113/172 (66%), Gaps = 4/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH  CHGAW WYK+ AL+R+ GH V+ALD+ ASGI+PK   QV   +++  PL 
Sbjct  29   KKHFVLVHKGCHGAWTWYKIVALMRSSGHNVTALDLGASGINPKQTFQVPHFSDFLSPLM  88

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+L A E VVLVGH IGG+ +S AME+FP KISVAVFVT  M GP+++   V  E  
Sbjct  89   EFMASLTAHEIVVLVGHEIGGLAISKAMETFPKKISVAVFVTGLMPGPNINVTTVYNELL  148

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + + S  D    Y     + P + + G + ++  +YQ SP +DL LA  LVR
Sbjct  149  KSV-SQPDNCVIYDNGPTNPPTTFILGPKYIKTNLYQRSPIQDLALAYTLVR  199



>ref|XP_004230823.1| PREDICTED: polyneuridine-aldehyde esterase [Solanum lycopersicum]
Length=361

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 114/172 (66%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVL+H  CHG+WCWYK+  L+++ GH V+ALD+  SG + K A +++S ++Y  PL 
Sbjct  106  KKHFVLLHTGCHGSWCWYKIVELMKSSGHNVTALDLGGSGSNEKQAIEITSFSDYLSPLM  165

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            +FMA+LPA EK+VLVGHS  G+ +S AME+FP KISVAVF+ A M GP  S  AV  +  
Sbjct  166  KFMASLPADEKIVLVGHSFAGLGISKAMENFPEKISVAVFIAALMPGPSFSATAVYTKTC  225

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D +  Y     + P S++ G + +E  +YQLSP  DL LA  LVR
Sbjct  226  DVVIPELDNRVIYDNGPANPPTSLILGPKFMETNLYQLSPITDLKLATELVR  277



>gb|EMS52791.1| hypothetical protein TRIUR3_30970 [Triticum urartu]
Length=265

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 116/174 (67%), Gaps = 7/174 (4%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            +HF+LVHG CHGAWCWYK+  +LRA GH+V+ALDMAASG HP   ++V S  +Y+ PL +
Sbjct  8    RHFILVHGLCHGAWCWYKLVPMLRAAGHRVTALDMAASGAHPARMDEVESFEDYSRPLLD  67

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             +AA PAGE++VLVGHS+GG+N++LAME FP K++ AVF+ A M           +EF R
Sbjct  68   AVAAAPAGERLVLVGHSLGGLNLALAMERFPRKVAAAVFLAACMACAGRHMGVTIEEFSR  127

Query  412  QLESN--MDQK----TEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  ++  MD K       +  RP +V  G ++L   +Y  S  EDLTLA LLVR
Sbjct  128  RTPADFFMDSKIMVLNTDQGPRP-AVALGPKLLAAKLYDRSSVEDLTLATLLVR  180



>ref|NP_179942.1| methyl esterase 3 [Arabidopsis thaliana]
 sp|O80477.1|MES3_ARATH RecName: Full=Methylesterase 3; Short=AtMES3 [Arabidopsis thaliana]
 gb|AAC23774.1| putative acetone-cyanohydrin lyase [Arabidopsis thaliana]
 gb|AAT46030.1| At2g23610 [Arabidopsis thaliana]
 gb|AAT70482.1| At2g23610 [Arabidopsis thaliana]
 gb|AEC07472.1| methyl esterase 3 [Arabidopsis thaliana]
Length=263

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 121/179 (68%), Gaps = 9/179 (5%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIH-PKLAEQVSSMAEYN  216
            +ERK+H VLVHGACHGAWCWYKV   L A GH+V+A+D+AASGI   +    +S+  +Y+
Sbjct  4    EERKQHVVLVHGACHGAWCWYKVKPQLEASGHRVTAVDLAASGIDMTRSITDISTCEQYS  63

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SF  384
            EPL + M +LP  EKVVLVGHS+GG+++++AM+ FP KISV+VFVTA M  PD     SF
Sbjct  64   EPLMQLMTSLPDDEKVVLVGHSLGGLSLAMAMDMFPTKISVSVFVTAMM--PDTKHSPSF  121

Query  385  LAVKQEFHRQLESNMDQK-TEYKEDRPVSV-LFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  K       E  +D   T  K D P    +FG E + K +YQLSP +DL LAK+LVR
Sbjct  122  VWDKLRKETSREEWLDTVFTSEKPDFPSEFWIFGPEFMAKNLYQLSPVQDLELAKMLVR  180



>gb|KJB43607.1| hypothetical protein B456_007G209600 [Gossypium raimondii]
Length=261

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 7/178 (4%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ERK+HFVL+HG+CHGAWCWYKV  LL+  GH+V+ALD+ ASG+ PK  E+V+S ++Y +P
Sbjct  2    ERKQHFVLIHGSCHGAWCWYKVVNLLKTAGHQVTALDLGASGVDPKRLEEVTSFSDYLQP  61

Query  223  LTEFMAALP--AGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            L +F A+LP     KV+LVGHS  G+ +SLAME FP KISVAVF+ A M         + 
Sbjct  62   LMDFFASLPDEQDRKVILVGHSYAGLCISLAMERFPKKISVAVFIAAYMPHHSSPPGTLI  121

Query  397  QEFHRQLESNMDQKTEYK-----EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QE+ ++ +       E+      +  P S LFG   ++ + YQ  P EDL L K+LVR
Sbjct  122  QEYFKRTKVEFLMDCEFTFGNGLDKPPTSALFGPNFMKAIAYQHCPLEDLELGKMLVR  179



>ref|XP_006346473.1| PREDICTED: polyneuridine-aldehyde esterase-like [Solanum tuberosum]
Length=328

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 113/172 (66%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVL+H  CHGAWCWYK+  L+++ GH V+ALD+ ASG + K A ++++ ++Y  PL 
Sbjct  73   KKHFVLLHTGCHGAWCWYKIVELMKSSGHNVTALDLGASGTNSKQALEITTFSDYLSPLM  132

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            +FMA+LPA EK+VLVGHS  G+ +S AME+FP  ISVAVF+ A M GP  +   V  +  
Sbjct  133  KFMASLPAHEKIVLVGHSFAGLGISKAMENFPENISVAVFIAALMPGPTFNVTTVYTKTC  192

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D    Y     + P +++ G + +E  +YQLSP +DL LA  LVR
Sbjct  193  SAIIPELDNHVTYDNGPGNPPTTLILGPKFMETNLYQLSPIKDLKLATKLVR  244



>gb|KDP31868.1| hypothetical protein JCGZ_12329 [Jatropha curcas]
Length=263

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 123/178 (69%), Gaps = 9/178 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +++KHFVLVHGACHGAWCWYK+   L + G++V+ALD+AASGI+ K  +++ +  +Y++P
Sbjct  5    KKQKHFVLVHGACHGAWCWYKLKPRLESAGYRVTALDLAASGINMKAIQEIQTFGDYSKP  64

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFLA  390
            L EF+A+L + E+V+LVGHS+GG+N++LAME FP KISVAVF+TA  F PD     SF+ 
Sbjct  65   LLEFLASLQSDERVILVGHSLGGLNLALAMEKFPEKISVAVFLTA--FLPDSVHQPSFVL  122

Query  391  VKQEFHRQLESNMD-QKTEYKEDRP--VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             K       E+ +D Q   Y    P   ++ FG + L   +YQL+P EDL LAK L R
Sbjct  123  QKYNERTPSEAWLDTQFLPYSTSLPHLSTMFFGPKFLSSKLYQLTPIEDLELAKTLTR  180



>ref|XP_008454899.1| PREDICTED: methylesterase 2-like [Cucumis melo]
Length=318

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 117/174 (67%), Gaps = 6/174 (3%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            K HFVLVHGAC GAW WYKV   L+  GH V+ALDMAA+GI P   + + ++ +Y +PL 
Sbjct  37   KSHFVLVHGACLGAWSWYKVTTFLQTAGHNVTALDMAAAGIDPTQPQSLKTITDYFQPLL  96

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE--  402
             FM AL A EK+VLVGHS+GG+ +S+AME FP KISVA+FVTA+M GP     +++++  
Sbjct  97   NFMEALQADEKIVLVGHSLGGLGISMAMERFPEKISVAIFVTAAMPGPIPWLFSMEEQRK  156

Query  403  ---FHRQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                +    +  D K++  ++  +  +F  E LE  ++ LSPPEDLTLAK LVR
Sbjct  157  VLGMYGGFYTEEDFKSKGSDNSNL-FMFSEEELETKLFPLSPPEDLTLAKTLVR  209



>ref|XP_006436460.1| hypothetical protein CICLE_v10032396mg [Citrus clementina]
 ref|XP_006485626.1| PREDICTED: methylesterase 1-like [Citrus sinensis]
 gb|ESR49700.1| hypothetical protein CICLE_v10032396mg [Citrus clementina]
Length=272

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 120/178 (67%), Gaps = 9/178 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +++KHFVLVHG+ HGAWCWYKV A L A GH+V+ALD+ ASGI  K  + V S  EYNEP
Sbjct  14   KKQKHFVLVHGSNHGAWCWYKVKAQLEAAGHRVTALDLTASGIDMKKIQDVHSFYEYNEP  73

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA--VK  396
            L E +A+L A EKVV+VGHS+GG++++LA + FPHKISVA+FVTA  F PD       V 
Sbjct  74   LLEILASLSADEKVVIVGHSLGGLSLALAADMFPHKISVAIFVTA--FMPDTKHQPSYVV  131

Query  397  QEFHRQLESNMDQKTEY---KEDRPV--SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            + F  ++ S     T++       P   ++ FG+  L   +YQLSPPED+ L K+L+R
Sbjct  132  ERFFERIPSGEWLDTQFSVIDSSNPSRKTLFFGYSFLTLKLYQLSPPEDVELGKMLLR  189



>ref|XP_009387633.1| PREDICTED: salicylic acid-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=276

 Score =   169 bits (427),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 118/178 (66%), Gaps = 11/178 (6%)
 Frame = +1

Query  46   RKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPL  225
             KKH +LVHGACHGAW W+KV  LLR+ G++V+ALD+AASGI  +  + + +  +Y +PL
Sbjct  19   NKKHIILVHGACHGAWSWHKVTTLLRSAGYRVTALDLAASGIDERRFQDLRTFTDYTQPL  78

Query  226  TEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPD--------LS  381
             + +A+LP GE+VVLVGHS+GG+N++LAM+ FP KI+ AVFVTA  F PD        L 
Sbjct  79   LDVVASLPPGERVVLVGHSLGGMNIALAMDRFPEKIAAAVFVTA--FMPDSVNPPSYVLD  136

Query  382  FLAVKQEFHRQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             L  ++     L++        +E  P S+L G + L KL Y+LSPPEDLTLA  L R
Sbjct  137  KLKQEKTMSYWLDTQFGLVVGDRERGPTSMLLGPKFLSKL-YKLSPPEDLTLAMTLAR  193



>ref|XP_002263026.3| PREDICTED: methylesterase 10-like [Vitis vinifera]
Length=305

 Score =   169 bits (429),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGACHGAWCWYK+  LL++ GH+V+ALD+ ASG++PK  ++++S+ +Y +PL E
Sbjct  50   KHFVLVHGACHGAWCWYKLVPLLKSFGHRVTALDLGASGVNPKRLDELASVYDYVQPLME  109

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEF--  405
            F+A+LP  EKVVLVGHS GG+ +SLAMESFP KI V VFV+A M       + + +EF  
Sbjct  110  FVASLPQDEKVVLVGHSYGGLAISLAMESFPEKILVGVFVSAYMPNYISPPVTLAEEFFI  169

Query  406  -HRQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
               + ES +D +  +    E  P ++ FG + L   +YQ   PEDL LAK L+R
Sbjct  170  NRSKPESLLDTQLSFGQGLESPPTALTFGPDHLSVALYQNCQPEDLELAKSLIR  223



>ref|XP_006294809.1| hypothetical protein CARUB_v10023861mg [Capsella rubella]
 gb|EOA27707.1| hypothetical protein CARUB_v10023861mg [Capsella rubella]
Length=263

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 118/177 (67%), Gaps = 5/177 (3%)
 Frame = +1

Query  40   DERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIH-PKLAEQVSSMAEYN  216
            ++RK+HFVLVHGACHGAWCWYKV  LL A GH+V+ALD+A  GI   +    +S+  EY+
Sbjct  4    EKRKQHFVLVHGACHGAWCWYKVKVLLEASGHRVTALDLAGCGIDTTRSITDISTCEEYS  63

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            EPL + M +LP  EKVVLVGHS GG+++++AM+ FP KISV+VFVTA M     S   V 
Sbjct  64   EPLIQLMTSLPNDEKVVLVGHSFGGLSLAIAMDKFPEKISVSVFVTAFMPDTKHSPSFVL  123

Query  397  QEFHRQLESNMDQKTEYK----EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++F   +       TE+K    ++  +S LF  E+++  +YQLSP EDL L  LL R
Sbjct  124  EKFASYMTPEGWMGTEFKPYGSDNIGMSALFSTEIMKNRIYQLSPIEDLELGLLLKR  180



>ref|XP_008338217.1| PREDICTED: salicylic acid-binding protein 2-like [Malus domestica]
 ref|XP_008338218.1| PREDICTED: salicylic acid-binding protein 2-like [Malus domestica]
 ref|XP_008338219.1| PREDICTED: salicylic acid-binding protein 2-like [Malus domestica]
 ref|XP_008338220.1| PREDICTED: salicylic acid-binding protein 2-like [Malus domestica]
Length=265

 Score =   168 bits (425),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 124/178 (70%), Gaps = 9/178 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ERK HFVLVHGA HGAWCWYK+   L + GH+V+ L++AASGI+ K  + V S+ EY+EP
Sbjct  7    ERKAHFVLVHGAGHGAWCWYKIKPKLESGGHRVTVLNLAASGINMKAIQDVHSLTEYSEP  66

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFLA  390
            L E + +L   EKV+LVGHS+GG+N+SLAME FP KIS AVF+TA  F PD     S++ 
Sbjct  67   LLELIESLAPNEKVILVGHSLGGMNLSLAMEKFPXKISAAVFLTA--FLPDTTHQPSYIM  124

Query  391  VKQEFHRQLESNMDQKTEY--KEDRPV-SVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             +    +  +S +D + E     ++P+ S+ FG + L++++YQLSP EDL LAK LVR
Sbjct  125  DQFMEKKPADSWLDTRFEKFGSPEQPLTSIFFGPKYLQEVLYQLSPIEDLELAKSLVR  182



>ref|XP_008241856.1| PREDICTED: salicylic acid-binding protein 2-like [Prunus mume]
Length=291

 Score =   169 bits (427),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVL+HGA  GAW WYKVA LL   GH V+ALD+ ASGI+P   +Q+ S+++Y EPLT
Sbjct  41   KKHFVLIHGAGVGAWSWYKVATLLNDSGHNVTALDLGASGINPIQIQQLRSISQYVEPLT  100

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            + M +LP  E+++LVGHS+GG  +S  ME FP KI+ AV+VTA M GP L++  +  E +
Sbjct  101  KLMVSLPPKERIILVGHSMGGAVISTFMERFPEKIAAAVYVTAFMTGPTLNYSTILTEVN  160

Query  409  RQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++L+  +D +  Y     +RP S L G + L     QLSP +D TL   L+R
Sbjct  161  KRLDY-LDTQYRYDNGTNNRPTSFLIGPKALALKFCQLSPAQDKTLVSSLIR  211



>ref|XP_010908451.1| PREDICTED: salicylic acid-binding protein 2-like isoform X2 [Elaeis 
guineensis]
Length=261

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 116/183 (63%), Gaps = 22/183 (12%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
             R+KH +LVHGACHGAW WYKVA LLR  GH+V+  D+AASGI  +   +VS+ A+Y++P
Sbjct  6    RRQKHIILVHGACHGAWSWYKVATLLRCAGHQVTVPDLAASGIDERRLHEVSTFADYSQP  65

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGP----------  372
            L + +AALP GE+V+LVGHS+GG++VSLAME FP +I+ AVF+TA M  P          
Sbjct  66   LLDILAALPPGERVILVGHSLGGMSVSLAMERFPERIAAAVFLTAFMPAPASRPSHVLDK  125

Query  373  --DLSFLAVKQEFHRQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKL  546
               +SF         Q  S+ DQ     E  PVS+LFG   +   +YQL   EDLTL   
Sbjct  126  EAPMSFW-----MDTQFSSSRDQ-----EKSPVSMLFGPLFISLNLYQLCSVEDLTLGTT  175

Query  547  LVR  555
            LVR
Sbjct  176  LVR  178



>gb|ACU23966.1| unknown [Glycine max]
Length=249

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 9/174 (5%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            +KH+VLVHGACHGAWCWYK+   L + GHKV+ LD+AASG + K  E V + +EY+ PL 
Sbjct  9    RKHYVLVHGACHGAWCWYKLKPRLESAGHKVTVLDLAASGTNMKKIEDVDTFSEYSAPLL  68

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFLAVK  396
            + MA +P+ EK+VLVGHS+GG+N++LAME FP K++V VF+TA  F PD     S++  K
Sbjct  69   QLMATIPSNEKLVLVGHSLGGLNIALAMEKFPEKVAVGVFLTA--FAPDTEHHPSYVLEK  126

Query  397  QEFHRQLESNMDQKTEY-KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                  L + +D  TE+       S+ FG   L   +YQLSP EDL LAK L R
Sbjct  127  YNERTPLAAWLD--TEFAPSGNKTSMFFGPNFLSDKLYQLSPIEDLELAKTLAR  178



>ref|XP_006346482.1| PREDICTED: polyneuridine-aldehyde esterase-like [Solanum tuberosum]
Length=273

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 112/172 (65%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH   HGAW WYK+ AL+ + GH V+A+D+ ASGI+PK A ++   ++Y  PL 
Sbjct  18   KKHFVLVHTLGHGAWSWYKIVALMTSSGHNVTAIDLGASGINPKQALEIPHFSDYLSPLM  77

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA + VVLVGHS+GG  +S AME+FP KISVAVF++A M GP  +   +  +  
Sbjct  78   EFMASLPADKNVVLVGHSLGGFAISKAMETFPEKISVAVFLSALMPGPIHNVTDIYTKAL  137

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                  +D +  Y     + P +++ G   L   VYQLSP EDLTLA  LVR
Sbjct  138  NATIVQLDNRVAYDNGPTNPPATLILGLNYLAASVYQLSPIEDLTLATTLVR  189



>ref|NP_001240864.1| uncharacterized protein LOC100796281 [Glycine max]
 gb|ACU23079.1| unknown [Glycine max]
 gb|KHN13366.1| Polyneuridine-aldehyde esterase [Glycine soja]
Length=261

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 9/174 (5%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            +KH+VLVHGACHGAWCWYK+   L + GHKV+ LD+AASG + K  E V + +EY+ PL 
Sbjct  9    RKHYVLVHGACHGAWCWYKLKPRLESAGHKVTVLDLAASGTNMKKIEDVDTFSEYSAPLL  68

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFLAVK  396
            + MA +P+ EK+VLVGHS+GG+N++LAME FP K++V VF+TA  F PD     S++  K
Sbjct  69   QLMATIPSNEKLVLVGHSLGGLNIALAMEKFPEKVAVGVFLTA--FAPDTEHHPSYVLEK  126

Query  397  QEFHRQLESNMDQKTEYK-EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                  L + +D  TE+       S+ FG   L   +YQLSP EDL LAK L R
Sbjct  127  YNERTPLAAWLD--TEFAPSGNKTSMFFGPNFLSDKLYQLSPIEDLELAKTLAR  178



>emb|CDM82837.1| unnamed protein product [Triticum aestivum]
Length=265

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 117/174 (67%), Gaps = 7/174 (4%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHF+LVHG CHGAWCWYK+  +LRA GH+V+ALDMAASG HP   ++V+S  +Y+ PL +
Sbjct  8    KHFILVHGLCHGAWCWYKLVPMLRAAGHRVTALDMAASGAHPARMDEVASFEDYSRPLLD  67

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             +AA PAGE++VLVGHS+GG+N++LAME FP K++ AVF+ A M           +EF R
Sbjct  68   AVAAAPAGERLVLVGHSLGGLNLALAMEGFPRKVAAAVFLAACMACAGRHMGVTIEEFCR  127

Query  412  QLESN--MDQKT----EYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  ++  MD K+      +  RP +V  G ++L   +Y  S  EDL LA LLVR
Sbjct  128  RTPADFFMDSKSMVLNTDQGPRP-AVALGPKLLAAKLYDRSSVEDLMLATLLVR  180



>ref|XP_006590667.1| PREDICTED: methylesterase 3-like isoform X3 [Glycine max]
Length=218

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E+K+  VLVHGACHGAWCWYKVAALL++ GH+V+ALDMAASGIHPK    ++S++EY EP
Sbjct  4    EKKRRLVLVHGACHGAWCWYKVAALLKSNGHQVTALDMAASGIHPKQVHDLNSISEYFEP  63

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L  F+ +LP  E+V+LVGHS GG  +S+AME FP KI+ AVFV A M  PDLSF  + QE
Sbjct  64   LMYFLGSLPTEERVILVGHSFGGACISVAMEMFPTKIAAAVFVAAWMPSPDLSFSTLLQE  123



>ref|XP_004300558.2| PREDICTED: salicylic acid-binding protein 2-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=279

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 112/172 (65%), Gaps = 3/172 (2%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            E  KHFVLVHG+ HGAWCWYK+A LL + GH V+ LD+ ASGI+    +Q+ S ++Y EP
Sbjct  15   ENSKHFVLVHGSGHGAWCWYKLATLLSSTGHNVTTLDLPASGINQTQQQQLHSFSDYAEP  74

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EF+ +LP  EKV+LVGHS+GG  +S+AME FP KI+ AVF TA  F P        Q 
Sbjct  75   LFEFLGSLPPEEKVILVGHSMGGPVISIAMEMFPEKIAAAVFATA--FMPGYCLFKPIQL  132

Query  403  FHRQLESNMDQKTEYKEDRPVS-VLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              R + S+     +   D P S ++FG + L   +YQLSPPEDLTLA  LVR
Sbjct  133  VERTVVSDSQFINDQGVDNPPSAMIFGPKRLATKLYQLSPPEDLTLALSLVR  184



>ref|XP_006359801.1| PREDICTED: polyneuridine-aldehyde esterase-like isoform X1 [Solanum 
tuberosum]
Length=292

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 112/170 (66%), Gaps = 2/170 (1%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVH ACHGAW WYK+ AL+++ GH V+ALD+ ASGI+ K A +++  +++  PL E
Sbjct  31   KHFVLVHKACHGAWSWYKIIALMKSSGHNVTALDLGASGINSKQAAEITHFSDFLSPLIE  90

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM +LPA + VVLVGHSIGG+ +S AME FP KIS AVFV   M GP+++   V  E   
Sbjct  91   FMTSLPAHKNVVLVGHSIGGLAISKAMELFPEKISGAVFVAGLMPGPNINASTVYIELCN  150

Query  412  QLESNMDQKTEYKE--DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             + S +D +  Y +    P + + G + L   VYQ SP EDL LA  LVR
Sbjct  151  AVVSKLDNRVIYDKGPSNPPTFILGPKYLASNVYQQSPIEDLALATTLVR  200



>ref|XP_010323708.1| PREDICTED: salicylic acid-binding protein 2 [Solanum lycopersicum]
 gb|ADK38540.1| methylketone synthase Ie [Solanum lycopersicum]
Length=265

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 114/177 (64%), Gaps = 3/177 (2%)
 Frame = +1

Query  34   IMDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEY  213
            I  + KKHFVLVH   HGAW WYK+ AL+R  GH V+ALD+  SGI+ K A ++ + ++Y
Sbjct  5    IESKAKKHFVLVHTLGHGAWSWYKIVALMRCSGHNVTALDLGGSGINAKQALEIPNFSDY  64

Query  214  NEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAV  393
              PL EFM +L   EK+VLVGHS+GG+ +S AME++P KISVAVF++  M GP+++   V
Sbjct  65   LSPLMEFMTSLSTDEKIVLVGHSLGGLAISKAMETYPEKISVAVFLSGVMPGPNINASIV  124

Query  394  KQEFHRQLESNMDQKTEY---KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +    +   +D +  Y    E+ P +++ G + LE   Y LSP EDL LA  LVR
Sbjct  125  YTQTINAIIRELDNRVTYHNGPENPPTTLILGPKFLETNAYHLSPIEDLVLATTLVR  181



>ref|XP_010255102.1| PREDICTED: methylesterase 10 [Nelumbo nucifera]
Length=262

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 114/174 (66%), Gaps = 6/174 (3%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGA HGAWCWYK+ ALL++ G++V+ALD+ ASG++PK  +Q++S+ EY  PL  
Sbjct  5    KHFVLVHGAGHGAWCWYKLLALLKSAGYRVTALDLGASGVNPKKLDQIASVFEYVLPLMN  64

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE-FH  408
            FMAALP  E+V+LVGHS+GG+ +SLAMESF  KISVAVF TA M        A+ QE F 
Sbjct  65   FMAALPEEERVILVGHSLGGIAISLAMESFSRKISVAVFATAIMPNTASPPAAILQELFG  124

Query  409  RQLESNMDQKTEYKEDR-----PVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            R    ++         R     P S+ FG E L   +Y    PED+TL  LLVR
Sbjct  125  RTPPESLSGINFTLGPRPESLIPTSITFGPEYLAPRMYNCCQPEDVTLGTLLVR  178



>ref|XP_008459227.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Cucumis 
melo]
Length=288

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 113/171 (66%), Gaps = 4/171 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGAC GAW WYK++ LLR+ GH+V+ALDMA +GI P+ AE + +  EY EPL  
Sbjct  35   KHFVLVHGACLGAWSWYKLSTLLRSAGHRVTALDMAGAGIDPREAESL-TFNEYVEPLRS  93

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FMA +   EKV+LVGHS GG+ +S AME +P KI VAVFV A+M GP L+   +  E  +
Sbjct  94   FMAEVGEDEKVILVGHSQGGLCISKAMEEYPEKICVAVFVVAAMPGPALNASFLIGELRK  153

Query  412  QLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +L+   D +  Y       P ++ FG   L   V+  SPPEDLTL ++LVR
Sbjct  154  RLDFGPDSRYTYGNGPTSPPTTLTFGPLFLAASVFNKSPPEDLTLGRILVR  204



>emb|CDM82839.1| unnamed protein product [Triticum aestivum]
Length=265

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHF+L+HG CHGAWCWYK+  +LRA GH+V+ALDMAASG HP   ++V S  +Y+ PL +
Sbjct  8    KHFILIHGLCHGAWCWYKLVPMLRAAGHRVTALDMAASGAHPARMDEVPSFEDYSWPLLD  67

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
             +AA PAGE++VLVGHS+GG+N++LAME FP K++ AVF+ A M        A  +E  R
Sbjct  68   AVAAAPAGERLVLVGHSLGGLNIALAMERFPRKVAAAVFLAACMPCVGRHMGATTEEIMR  127

Query  412  QLESN--MDQK----TEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +++ +  MD K       +  RP +++FG ++L   +Y  S  ED TLA +LVR
Sbjct  128  RIKPDFFMDMKRMVLNTSQGPRP-ALVFGPKILAAKLYDRSSGEDQTLATMLVR  180



>emb|CAN76442.1| hypothetical protein VITISV_032921 [Vitis vinifera]
Length=568

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 111/161 (69%), Gaps = 3/161 (2%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHG+CHGAW WYK+ ALL++ GHKV+ALD+AASGI+ K    +  ++EY +PL +
Sbjct  401  KHFVLVHGSCHGAWSWYKIVALLKSSGHKVTALDLAASGINTKQVGDLRXISEYFQPLRD  460

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFHR  411
            FM +LPA E+VVLVGHS GG+ +S AME FP K+SVAVFVTASM GP L+   + QE  R
Sbjct  461  FMESLPADERVVLVGHSSGGLAISQAMEKFPEKVSVAVFVTASMPGPTLNISTLNQETSR  520

Query  412  QLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPE  525
            +    +D +  Y     + P +  FG   L   +YQLSP E
Sbjct  521  RQGPLLDSQFTYDNGPNNPPTTFTFGPLFLSLNLYQLSPTE  561



>ref|XP_003519919.1| PREDICTED: salicylic acid-binding protein 2-like [Glycine max]
Length=262

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 117/172 (68%), Gaps = 5/172 (3%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKH+VLVHGACHGAW WYK+   L + GHKV++LD+AASGI+ K  + V + ++Y++PL 
Sbjct  10   KKHYVLVHGACHGAWSWYKLKPRLESAGHKVTSLDLAASGINMKKIDDVHTFSQYSQPLL  69

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA--VKQE  402
              MA +P  EKVVLVGHS+GG+N++LAM+ FP K++V VF+ A  F PD  +    V + 
Sbjct  70   HLMATIPKNEKVVLVGHSLGGLNIALAMDKFPKKVAVGVFLAA--FAPDTEYRPSYVVEN  127

Query  403  FHRQLESNMDQKTEY-KEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            +  ++  +    TE+       S+L G E+L K +YQLSP EDL LAK LVR
Sbjct  128  YIERIPPSEWFDTEFAPSGNKTSILLGPEILAKKLYQLSPIEDLELAKTLVR  179



>ref|XP_004300551.1| PREDICTED: salicylic acid-binding protein 2-like [Fragaria vesca 
subsp. vesca]
Length=263

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 118/179 (66%), Gaps = 6/179 (3%)
 Frame = +1

Query  37   MDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYN  216
            MDE +KHFVLVHG CHGAWCWYK+  LLR  GH+V+ALD+ ASGI  K  ++V S+ +Y 
Sbjct  1    MDENQKHFVLVHGTCHGAWCWYKLIPLLRGAGHRVTALDLGASGIDSKQVDEVPSLWDYV  60

Query  217  EPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVK  396
            + L EFMA +P  EKV+LV HS GG+ +SLAME FPHKI V+VFVTA +         + 
Sbjct  61   KSLMEFMATIPHDEKVILVCHSYGGLPISLAMERFPHKILVSVFVTAYLPHYSSPPGTLI  120

Query  397  QEFHRQL--ESNMDQKTEYKEDRP----VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            QEF ++   ES +D +  + ++       SV+FG + +   +YQ    EDL LAKLL+R
Sbjct  121  QEFLKRTSAESLLDNQFTFDKNTENPAITSVMFGPKYMAAKLYQNCKLEDLELAKLLLR  179



>ref|XP_008241564.1| PREDICTED: salicylic acid-binding protein 2-like [Prunus mume]
Length=291

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 115/172 (67%), Gaps = 4/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVL+HGA  GAW WYKVA LL+  GH V+ALD+ ASGI+P   +Q+ S+++Y EPLT
Sbjct  41   KKHFVLIHGAGLGAWSWYKVATLLKDSGHNVTALDLGASGINPIQIQQLRSISQYVEPLT  100

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            + M +LP  E+++LVGHS+ G  +S+ ME FP KI+ AV+VTA M GP L++  +  E +
Sbjct  101  KLMVSLPPEERIILVGHSMNGAVISIFMERFPEKIAAAVYVTAFMSGPTLNYSTILTEVN  160

Query  409  RQLESNMDQKTEYK---EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++L+  +D +  Y     + P S L G + L    +QLSP +D TL   L+R
Sbjct  161  KRLDY-LDTQYRYDNGTNNSPTSFLLGPKALALKFFQLSPAQDKTLGSSLIR  211



>ref|XP_009366326.1| PREDICTED: salicylic acid-binding protein 2-like [Pyrus x bretschneideri]
Length=298

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 114/173 (66%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +  KHFVL+HG C GAW WYKVA LL+  GH+V+ALD+ ASGI+P   EQ+ S++E+ EP
Sbjct  41   QSPKHFVLIHGGCLGAWSWYKVATLLKYSGHRVTALDLGASGINPIQVEQLPSLSEFVEP  100

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            LT+ M +LP  EKV+LV HS GG  +S+ ME F  KIS AV+VTA M GP L+F  +  E
Sbjct  101  LTKLMVSLPPKEKVILVAHSYGGAVISIFMERFSQKISAAVYVTAIMSGPTLNFSTIFAE  160

Query  403  FHRQLESNMDQ-KTEYKEDRP-VSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              ++ +    Q + +   + P  S +FG + L   +Y+LSPP DLTL   LVR
Sbjct  161  ATKRFDFKDSQFRYDNGTNNPATSFIFGPKDLATSLYELSPPYDLTLGLSLVR  213



>ref|XP_006346535.1| PREDICTED: methylesterase 10-like [Solanum tuberosum]
Length=288

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 112/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH  CHGAW WYK+ AL+R+ GH V+A+D+ ASGI+PK A Q+   ++Y  PL 
Sbjct  30   KKHFVLVHRPCHGAWSWYKIVALMRSSGHNVTAIDLGASGINPKQALQIPHFSDYLSPLM  89

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+LPA EKVVLVGH   G  +S AMESFP KISVAVFVTA M  P L+F A    + 
Sbjct  90   EFMASLPAHEKVVLVGHEFSGFVISKAMESFPEKISVAVFVTAVM--PGLTFNATATLYT  147

Query  409  RQLESN-----MDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              L  +     +D +  Y     + P +  +G + L   +Y  SP +DL LA  LVR
Sbjct  148  ELLAESGALTLLDNRVAYDNGPTNPPTTFSYGPKYLAAKLYDKSPIQDLALATTLVR  204



>ref|XP_009791932.1| PREDICTED: uncharacterized protein LOC104239099 [Nicotiana sylvestris]
Length=716

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 116/177 (66%), Gaps = 3/177 (2%)
 Frame = +1

Query  34   IMDERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEY  213
            I  +  KHFVLVHGACHGAW WYK+ A L+  GH V+ALD+ ASG++PK   ++  +++Y
Sbjct  71   IWPKASKHFVLVHGACHGAWSWYKIMASLKTSGHNVTALDLGASGVNPKQGLEIPHLSDY  130

Query  214  NEPLTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAV  393
              PL +FMA+LPA EKV+LVGHS+GG  +S AME+FP KISVAVFVTA M GP L+   +
Sbjct  131  FSPLMKFMASLPADEKVILVGHSLGGFAISKAMENFPEKISVAVFVTALMPGPTLNATTI  190

Query  394  KQEFHRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              E  +   S +D +  +     + P +  FG + L   +Y LSP +D  LA  +VR
Sbjct  191  FIESSKAAISVLDNRVTFDSGPMNPPTTFSFGPKYLASYLYPLSPIQDWALATTVVR  247


 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            +  KHFVLVHGACHGAW WYK+ AL++  GH V+A+D+ ASG++PK   ++  +++Y  P
Sbjct  459  KTSKHFVLVHGACHGAWSWYKIMALIKTSGHNVTAMDLGASGVNPKQVLEIPHLSDYFSP  518

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQE  402
            L EFMA+LPA +KV+LVGHS GG+ +S AME FP KI VAVFVTA M G  L+   +  E
Sbjct  519  LMEFMASLPAHQKVILVGHSYGGLAISKAMERFPEKILVAVFVTAHMPGLTLNATTLLTE  578

Query  403  FHRQLE--SNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                 E  S +D +  Y     + P +  FG + L + VYQ SP +D  LA  L R
Sbjct  579  LQSSSEMVSQLDNRVTYDNGPTNPPTAFFFGPKYLARNVYQQSPIQDWVLATTLAR  634


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKV  141
            +  KHFVLVHGACHGAW WYK+ A ++  GHK+
Sbjct  335  KTSKHFVLVHGACHGAWSWYKIMASIKTSGHKI  367



>ref|XP_008459228.1| PREDICTED: salicylic acid-binding protein 2-like isoform X2 [Cucumis 
melo]
Length=288

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = +1

Query  52   KHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLTE  231
            KHFVLVHGAC GAW WYK++ LLR+ GH+V+ALDMA +GI P+ AE + +  EY EPL  
Sbjct  35   KHFVLVHGACLGAWSWYKLSTLLRSAGHRVTALDMAGAGIDPREAESL-TFNEYVEPLRS  93

Query  232  FMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL--SFLAVKQEF  405
            FMA +   EKV+LVGHS GG+ +S AME +P KI VAVFV A+M GP L  SFL V  + 
Sbjct  94   FMAEVGEDEKVILVGHSQGGLCISKAMEEYPEKICVAVFVVAAMPGPALNASFLIV--QL  151

Query  406  HRQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             ++L+   D +  Y       P ++ FG   L   V+  SPPEDLTL ++LVR
Sbjct  152  RKRLDFGPDSRYTYGNGPTSPPTTLTFGPLFLAASVFNKSPPEDLTLGRILVR  204



>ref|XP_002459047.1| hypothetical protein SORBIDRAFT_03g045070 [Sorghum bicolor]
 gb|EES04167.1| hypothetical protein SORBIDRAFT_03g045070 [Sorghum bicolor]
Length=271

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 115/177 (65%), Gaps = 9/177 (5%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            + HFVLVHG CHGAWCWYKVA  L A GH+V+ALD+AASG HP    +V S  +Y+ PL 
Sbjct  8    RHHFVLVHGLCHGAWCWYKVATALEAAGHRVTALDLAASGAHPARLHEVRSFEDYSRPLL  67

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            + +AA P G+++VLVGHS GG N++LAME FP K++VAVF++A M  P      V ++ H
Sbjct  68   DAVAAAPDGDRLVLVGHSFGGHNLALAMERFPRKVAVAVFISAPMPVPGRPMSTVLEQ-H  126

Query  409  RQLESNMDQKTEYK--------EDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
             + +S  D   +          E+   + L G E + + +YQLSP EDLTLAK LVR
Sbjct  127  LEGDSTPDSFLDSTFGVMERGLENPAETFLLGPEWMSQRMYQLSPAEDLTLAKTLVR  183



>ref|XP_004142018.1| PREDICTED: methylesterase 1-like [Cucumis sativus]
 gb|KGN48490.1| hypothetical protein Csa_6G490050 [Cucumis sativus]
Length=246

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 115/178 (65%), Gaps = 9/178 (5%)
 Frame = +1

Query  43   ERKKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEP  222
            ++ KHFVLVHGACHGAWCWYK+  LL A GH+V+ LDMA +G++ +  ++V S  EY+EP
Sbjct  2    DQMKHFVLVHGACHGAWCWYKIKPLLEAAGHRVTMLDMAGAGVNRRAIQEVKSFEEYSEP  61

Query  223  LTEFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLA--VK  396
            L + MA L   EKV+LVGHS GG++++LAME+FPHKIS +VFVTA  F PD       V 
Sbjct  62   LLKTMACLGPNEKVILVGHSFGGMSLALAMENFPHKISASVFVTA--FVPDTHHPPSYVL  119

Query  397  QEFHRQLESNMDQKTEYKEDRPVS-----VLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
            ++F   L     + TE  E+R         LFG + +   +YQLSP ED  L   LVR
Sbjct  120  EQFLESLPREFWRDTELGENREDGGSSSWFLFGPKCMANKIYQLSPTEDQALGSSLVR  177



>ref|XP_006346533.1| PREDICTED: methylesterase 10-like [Solanum tuberosum]
Length=285

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 111/172 (65%), Gaps = 3/172 (2%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
            KKHFVLVH   HGAW WYK+ AL+R+ G+ V+A+D+ ASGI+PK A ++   ++Y  PL 
Sbjct  30   KKHFVLVHTVGHGAWSWYKIVALMRSSGYNVTAIDLGASGINPKQALEIPHFSDYLSPLM  89

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDLSFLAVKQEFH  408
            EFMA+ P  +KV  VGHS+GG+ +S AME FP KISVAVFVTA M GP L+   +  +  
Sbjct  90   EFMASFPTNKKVARVGHSLGGLAISKAMEIFPEKISVAVFVTALMPGPTLNAATLYTQTF  149

Query  409  RQLESNMDQKTEYKE---DRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
              +   +D +  Y     + P +++ G + L   +YQLS  +DL LA  LVR
Sbjct  150  SAVIGQLDNRVAYDNGLTNPPTTLILGLKYLATNIYQLSSNQDLALATTLVR  201



>ref|XP_007155974.1| hypothetical protein PHAVU_003G248200g [Phaseolus vulgaris]
 gb|ESW27968.1| hypothetical protein PHAVU_003G248200g [Phaseolus vulgaris]
Length=277

 Score =   166 bits (420),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (66%), Gaps = 7/173 (4%)
 Frame = +1

Query  49   KKHFVLVHGACHGAWCWYKVAALLRAEGHKVSALDMAASGIHPKLAEQVSSMAEYNEPLT  228
             KH+VLVHG CHGAW WYK+  LL + GHKV+ LD+AASGI+ +  E V + ++Y EPL 
Sbjct  25   NKHYVLVHGGCHGAWSWYKLKPLLESAGHKVTVLDLAASGINMQKIEDVHTFSQYTEPLL  84

Query  229  EFMAALPAGEKVVLVGHSIGGVNVSLAMESFPHKISVAVFVTASMFGPDL----SFLAVK  396
            + +A +P  EKV+LVGHS+GG+N++LAME FP KI   VFVTA  F PD     S++  K
Sbjct  85   QLLAKIPPNEKVILVGHSLGGLNIALAMEKFPEKILAGVFVTA--FVPDTEHSPSYVLEK  142

Query  397  QEFHRQLESNMDQKTEYKEDRPVSVLFGHEMLEKLVYQLSPPEDLTLAKLLVR  555
                  L + MD K E   ++  S+ FG + L   +YQLSP +DL LAK LVR
Sbjct  143  YGERTPLSAWMDTKFEPSGNK-TSMFFGPKFLANKLYQLSPAQDLELAKTLVR  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800