BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002J02

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007202991.1|  hypothetical protein PRUPE_ppa019010mg             154   8e-42   Prunus persica
ref|XP_004288052.1|  PREDICTED: patatin-like protein 1                  152   3e-41   Fragaria vesca subsp. vesca
ref|XP_006339914.1|  PREDICTED: patatin-05-like                         149   4e-40   Solanum tuberosum [potatoes]
ref|XP_008241509.1|  PREDICTED: patatin-like protein 3                  149   5e-40   Prunus mume [ume]
ref|XP_008339923.1|  PREDICTED: patatin-like protein 1 isoform X1       148   1e-39   
ref|XP_008354710.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    149   1e-39   
ref|XP_010269002.1|  PREDICTED: patatin-like protein 2 isoform X2       146   2e-39   Nelumbo nucifera [Indian lotus]
ref|XP_006339912.1|  PREDICTED: patatin-05-like                         147   2e-39   Solanum tuberosum [potatoes]
ref|XP_009366942.1|  PREDICTED: patatin-like protein 1 isoform X1       147   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_010268994.1|  PREDICTED: patatin-like protein 2 isoform X1       147   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_009606859.1|  PREDICTED: patatin-like protein 2                  139   1e-38   Nicotiana tomentosiformis
ref|XP_009390266.1|  PREDICTED: patatin-like protein 2 isoform X2       145   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009603683.1|  PREDICTED: patatin-like protein 1                  145   1e-38   Nicotiana tomentosiformis
ref|XP_009792908.1|  PREDICTED: patatin-like protein 1                  145   2e-38   Nicotiana sylvestris
ref|XP_011008336.1|  PREDICTED: patatin-like protein 3                  145   2e-38   Populus euphratica
ref|XP_006380710.1|  hypothetical protein POPTR_0007s11200g             144   2e-38   
ref|XP_011007290.1|  PREDICTED: patatin-like protein 3                  145   2e-38   Populus euphratica
ref|XP_009390265.1|  PREDICTED: patatin-like protein 2 isoform X1       145   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004233636.1|  PREDICTED: patatin-like protein 1                  147   5e-38   
ref|XP_009794733.1|  PREDICTED: patatin-like protein 2                  144   5e-38   Nicotiana sylvestris
ref|XP_002310732.1|  patatin family protein                             144   5e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006354913.1|  PREDICTED: patatin-3-Kuras 1-like                  142   2e-37   Solanum tuberosum [potatoes]
emb|CDP01332.1|  unnamed protein product                                141   6e-37   Coffea canephora [robusta coffee]
ref|XP_011099181.1|  PREDICTED: patatin-like protein 1                  140   6e-37   Sesamum indicum [beniseed]
ref|XP_004238176.1|  PREDICTED: patatin-like protein 2                  140   7e-37   Solanum lycopersicum
ref|XP_002277305.1|  PREDICTED: patatin-like protein 1                  140   1e-36   Vitis vinifera
gb|AAF98368.1|AF158027_1  patatin-like protein 1                        140   1e-36   Nicotiana tabacum [American tobacco]
emb|CBI19558.3|  unnamed protein product                                140   1e-36   Vitis vinifera
ref|XP_009617797.1|  PREDICTED: patatin-like protein 2 isoform X1       140   2e-36   Nicotiana tomentosiformis
emb|CBI21444.3|  unnamed protein product                                140   2e-36   Vitis vinifera
ref|XP_009769118.1|  PREDICTED: patatin-like protein 2 isoform X2       139   2e-36   Nicotiana sylvestris
ref|XP_009801077.1|  PREDICTED: patatin-like protein 2                  139   2e-36   Nicotiana sylvestris
ref|XP_009769117.1|  PREDICTED: patatin-like protein 2 isoform X1       139   2e-36   Nicotiana sylvestris
ref|XP_010320347.1|  PREDICTED: patatin-like protein 2 isoform X2       139   2e-36   
ref|XP_009797490.1|  PREDICTED: patatin-like protein 2                  139   2e-36   Nicotiana sylvestris
ref|XP_010320346.1|  PREDICTED: patatin-like protein 2 isoform X1       139   2e-36   Solanum lycopersicum
ref|XP_004148052.1|  PREDICTED: patatin group A-3-like                  139   3e-36   Cucumis sativus [cucumbers]
emb|CDP02483.1|  unnamed protein product                                139   3e-36   Coffea canephora [robusta coffee]
ref|XP_002282391.3|  PREDICTED: uncharacterized protein LOC100264244    143   4e-36   
gb|ACU24007.1|  unknown                                                 134   4e-36   Glycine max [soybeans]
ref|XP_006354912.1|  PREDICTED: patatin-3-Kuras 1-like                  138   5e-36   
ref|XP_006354907.1|  PREDICTED: patatin-2-Kuras 4-like                  138   5e-36   
gb|AAF98370.1|AF158254_1  patatin-like protein 2                        134   6e-36   Nicotiana tabacum [American tobacco]
emb|CBI19549.3|  unnamed protein product                                138   6e-36   Vitis vinifera
gb|KFK30330.1|  hypothetical protein AALP_AA7G247800                    138   6e-36   Arabis alpina [alpine rockcress]
emb|CAN68798.1|  hypothetical protein VITISV_008805                     137   8e-36   Vitis vinifera
ref|XP_002282366.2|  PREDICTED: patatin-like protein 2                  137   9e-36   Vitis vinifera
emb|CBI19553.3|  unnamed protein product                                138   1e-35   Vitis vinifera
ref|XP_010664934.1|  PREDICTED: patatin-like protein 2                  137   1e-35   
gb|EMS50940.1|  Patatin group A-3                                       136   1e-35   Triticum urartu
emb|CDP04311.1|  unnamed protein product                                137   1e-35   Coffea canephora [robusta coffee]
ref|XP_002282432.1|  PREDICTED: patatin-like protein 2                  137   1e-35   Vitis vinifera
ref|XP_010680418.1|  PREDICTED: patatin-like protein 1                  137   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007160832.1|  hypothetical protein PHAVU_001G020300g             137   2e-35   Phaseolus vulgaris [French bean]
emb|CBI19560.3|  unnamed protein product                                137   2e-35   Vitis vinifera
ref|XP_010089434.1|  Patatin group A-3                                  137   2e-35   Morus notabilis
gb|EMT12540.1|  Patatin group A-3                                       136   2e-35   
ref|XP_003549405.1|  PREDICTED: patatin-3-Kuras 1                       137   2e-35   Glycine max [soybeans]
ref|XP_002281798.1|  PREDICTED: patatin-like protein 1                  137   2e-35   Vitis vinifera
ref|XP_010547841.1|  PREDICTED: patatin-like protein 2                  136   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_006354911.1|  PREDICTED: patatin-3-Kuras 1-like                  136   3e-35   Solanum tuberosum [potatoes]
gb|KHN04516.1|  Patatin group A-3                                       136   3e-35   Glycine soja [wild soybean]
ref|XP_003544452.1|  PREDICTED: patatin-3-Kuras 1-like                  136   4e-35   Glycine max [soybeans]
ref|XP_009612649.1|  PREDICTED: patatin-like protein 2                  136   4e-35   Nicotiana tomentosiformis
gb|KHN12765.1|  Patatin group A-3                                       135   4e-35   Glycine soja [wild soybean]
ref|XP_002282415.2|  PREDICTED: patatin-like protein 2                  135   5e-35   Vitis vinifera
ref|XP_006354910.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    135   5e-35   
gb|KCW66471.1|  hypothetical protein EUGRSUZ_F00268                     135   5e-35   Eucalyptus grandis [rose gum]
ref|XP_002523555.1|  Patatin precursor, putative                        135   5e-35   Ricinus communis
emb|CDP02475.1|  unnamed protein product                                135   6e-35   Coffea canephora [robusta coffee]
gb|KJB40252.1|  hypothetical protein B456_007G053800                    135   6e-35   Gossypium raimondii
gb|KDO79282.1|  hypothetical protein CISIN_1g015720mg                   135   6e-35   Citrus sinensis [apfelsine]
ref|XP_010548412.1|  PREDICTED: patatin-like protein 3 isoform X3       134   6e-35   Tarenaya hassleriana [spider flower]
emb|CBI19557.3|  unnamed protein product                                139   7e-35   Vitis vinifera
ref|XP_010064191.1|  PREDICTED: patatin-like protein 2                  135   7e-35   Eucalyptus grandis [rose gum]
ref|XP_008444643.1|  PREDICTED: patatin-like protein 2                  135   7e-35   Cucumis melo [Oriental melon]
gb|KFK30333.1|  hypothetical protein AALP_AA7G248300                    135   8e-35   Arabis alpina [alpine rockcress]
ref|XP_002277318.1|  PREDICTED: patatin-like protein 1                  135   9e-35   Vitis vinifera
ref|XP_010548401.1|  PREDICTED: patatin-like protein 1                  135   9e-35   Tarenaya hassleriana [spider flower]
ref|XP_010094388.1|  Patatin group A-3                                  135   9e-35   Morus notabilis
ref|XP_006354908.1|  PREDICTED: patatin-3-Kuras 1-like                  135   1e-34   Solanum tuberosum [potatoes]
ref|XP_008220192.1|  PREDICTED: patatin-like protein 2                  135   1e-34   Prunus mume [ume]
ref|XP_002445640.1|  hypothetical protein SORBIDRAFT_07g023220          135   1e-34   Sorghum bicolor [broomcorn]
ref|XP_009589750.1|  PREDICTED: patatin-like protein 2                  135   1e-34   Nicotiana tomentosiformis
ref|XP_009781952.1|  PREDICTED: patatin-like protein 3                  134   1e-34   Nicotiana sylvestris
ref|XP_004499076.1|  PREDICTED: patatin-2-Kuras 3-like isoform X2       134   1e-34   
ref|XP_009419098.1|  PREDICTED: patatin-like protein 2                  134   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010548410.1|  PREDICTED: patatin-like protein 3 isoform X1       134   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_009799856.1|  PREDICTED: patatin-like protein 2                  134   1e-34   Nicotiana sylvestris
ref|XP_010269079.1|  PREDICTED: patatin-like protein 2 isoform X3       133   2e-34   
ref|XP_010548411.1|  PREDICTED: patatin-like protein 3 isoform X2       134   2e-34   Tarenaya hassleriana [spider flower]
gb|AAF98369.1|AF158253_1  patatin-like protein 3                        134   2e-34   Nicotiana tabacum [American tobacco]
gb|AAK18751.1|  patatin-like protein                                    134   2e-34   Vigna unguiculata
ref|XP_004152794.1|  PREDICTED: patatin group A-3-like                  134   2e-34   Cucumis sativus [cucumbers]
ref|XP_007156813.1|  hypothetical protein PHAVU_002G019700g             134   2e-34   Phaseolus vulgaris [French bean]
ref|XP_010041051.1|  PREDICTED: patatin-like protein 2                  134   2e-34   Eucalyptus grandis [rose gum]
ref|XP_010061769.1|  PREDICTED: patatin-like protein 2                  134   2e-34   Eucalyptus grandis [rose gum]
ref|XP_004499075.1|  PREDICTED: patatin-2-Kuras 3-like isoform X1       134   2e-34   Cicer arietinum [garbanzo]
ref|XP_010942708.1|  PREDICTED: patatin-like protein 2                  134   2e-34   Elaeis guineensis
ref|XP_008457871.1|  PREDICTED: patatin-like protein 3                  134   2e-34   Cucumis melo [Oriental melon]
ref|XP_003527713.1|  PREDICTED: patatin-like                            134   2e-34   Glycine max [soybeans]
ref|XP_009380972.1|  PREDICTED: patatin-like protein 2                  134   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010269072.1|  PREDICTED: patatin-like protein 2 isoform X2       133   2e-34   
ref|XP_009366946.1|  PREDICTED: patatin-like protein 1 isoform X2       133   2e-34   Pyrus x bretschneideri [bai li]
sp|Q6ZJD3.1|PLP2_ORYSJ  RecName: Full=Patatin-like protein 2; Sho...    134   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010269056.1|  PREDICTED: patatin-like protein 2 isoform X1       134   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006285520.1|  hypothetical protein CARUB_v10006962mg             134   3e-34   Capsella rubella
ref|XP_004169210.1|  PREDICTED: patatin group A-3-like                  130   3e-34   
ref|XP_010238242.1|  PREDICTED: patatin-like protein 2 isoform X2       133   3e-34   Brachypodium distachyon [annual false brome]
ref|XP_009613240.1|  PREDICTED: patatin-like protein 2                  133   3e-34   Nicotiana tomentosiformis
ref|XP_003611771.1|  Patatin-like protein                               133   4e-34   Medicago truncatula
ref|XP_011038245.1|  PREDICTED: patatin-like protein 2 isoform X1       133   4e-34   Populus euphratica
ref|XP_007226924.1|  hypothetical protein PRUPE_ppa015844mg             133   4e-34   
ref|XP_011038243.1|  PREDICTED: patatin-like protein 2 isoform X1       133   4e-34   Populus euphratica
ref|XP_003576611.1|  PREDICTED: patatin-like protein 2 isoform X1       133   4e-34   Brachypodium distachyon [annual false brome]
ref|XP_007227189.1|  hypothetical protein PRUPE_ppa019532mg             133   4e-34   
ref|XP_007047215.1|  Uncharacterized protein TCM_000589                 133   4e-34   
ref|XP_010525997.1|  PREDICTED: patatin-like protein 2                  133   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_003611772.1|  Patatin-like protein                               133   5e-34   Medicago truncatula
ref|XP_004973690.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1       133   5e-34   Setaria italica
ref|XP_008457873.1|  PREDICTED: patatin-like protein 2                  132   5e-34   Cucumis melo [Oriental melon]
ref|XP_003589238.1|  Patatin-like protein                               133   5e-34   
ref|XP_003589236.1|  Patatin-like protein                               133   6e-34   Medicago truncatula
ref|XP_006425859.1|  hypothetical protein CICLE_v10027498mg             132   6e-34   
ref|XP_002282440.1|  PREDICTED: patatin-like protein 2                  133   6e-34   Vitis vinifera
gb|KDP38383.1|  hypothetical protein JCGZ_04308                         133   6e-34   Jatropha curcas
emb|CAN71271.1|  hypothetical protein VITISV_001907                     133   6e-34   Vitis vinifera
gb|ACN25198.1|  unknown                                                 132   7e-34   Zea mays [maize]
ref|XP_006425860.1|  hypothetical protein CICLE_v10027314mg             132   7e-34   
ref|NP_001151190.1|  LOC100284823                                       132   7e-34   Zea mays [maize]
gb|ACG31156.1|  patatin T5 precursor                                    132   7e-34   Zea mays [maize]
ref|XP_006354909.1|  PREDICTED: patatin-3-Kuras 1-like                  132   7e-34   Solanum tuberosum [potatoes]
ref|XP_006466737.1|  PREDICTED: patatin-14-like                         132   8e-34   
ref|XP_009383171.1|  PREDICTED: patatin-like protein 2                  132   8e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006354914.1|  PREDICTED: patatin-3-Kuras 1-like                  132   8e-34   Solanum tuberosum [potatoes]
ref|XP_010437270.1|  PREDICTED: patatin-like protein 1 isoform X2       132   8e-34   
ref|XP_008339929.1|  PREDICTED: patatin-like protein 1 isoform X2       132   8e-34   
ref|XP_003538815.1|  PREDICTED: patatin group D-2-like                  132   8e-34   Glycine max [soybeans]
emb|CDP07844.1|  unnamed protein product                                132   8e-34   Coffea canephora [robusta coffee]
gb|KJB58441.1|  hypothetical protein B456_009G210000                    132   8e-34   Gossypium raimondii
gb|AEF30538.1|  patatin-like phospholipase 1                            132   9e-34   Capsicum annuum
ref|XP_004238177.1|  PREDICTED: patatin-like protein 2                  132   9e-34   Solanum lycopersicum
ref|XP_010437269.1|  PREDICTED: patatin-like protein 1 isoform X1       132   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010548405.1|  PREDICTED: patatin-like protein 1 isoform X2       132   1e-33   
ref|XP_006360248.1|  PREDICTED: patatin-05-like                         132   1e-33   Solanum tuberosum [potatoes]
ref|XP_010432097.1|  PREDICTED: patatin-like protein 1                  132   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010098699.1|  Patatin group A-3                                  132   1e-33   
ref|XP_011038246.1|  PREDICTED: patatin-like protein 2 isoform X2       132   1e-33   Populus euphratica
ref|XP_010548404.1|  PREDICTED: patatin-like protein 1 isoform X1       132   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_011038244.1|  PREDICTED: patatin-like protein 2 isoform X2       132   1e-33   Populus euphratica
ref|XP_008801772.1|  PREDICTED: patatin-like protein 2                  132   1e-33   Phoenix dactylifera
gb|KJB58445.1|  hypothetical protein B456_009G210500                    132   1e-33   Gossypium raimondii
ref|XP_008808514.1|  PREDICTED: patatin-like protein 2                  132   1e-33   
gb|AFK45431.1|  unknown                                                 132   1e-33   Lotus japonicus
ref|XP_006360228.1|  PREDICTED: patatin-3-Kuras 1-like                  132   1e-33   Solanum tuberosum [potatoes]
ref|XP_010911162.1|  PREDICTED: patatin-like protein 2                  126   1e-33   Elaeis guineensis
ref|XP_002305891.2|  hypothetical protein POPTR_0004s08270g             132   2e-33   
ref|XP_010028264.1|  PREDICTED: patatin-like protein 1                  132   2e-33   Eucalyptus grandis [rose gum]
gb|KFK30335.1|  hypothetical protein AALP_AA7G248500                    132   2e-33   Arabis alpina [alpine rockcress]
ref|XP_006829699.1|  hypothetical protein AMTR_s00126p00054960          128   2e-33   
ref|XP_004291132.1|  PREDICTED: patatin-like protein 2                  131   2e-33   Fragaria vesca subsp. vesca
gb|KHN42072.1|  Patatin group A-3                                       131   2e-33   Glycine soja [wild soybean]
ref|XP_007156814.1|  hypothetical protein PHAVU_002G019800g             131   2e-33   Phaseolus vulgaris [French bean]
gb|KJB63811.1|  hypothetical protein B456_010G0176002                   126   2e-33   Gossypium raimondii
ref|XP_008220193.1|  PREDICTED: patatin-like protein 2 isoform X1       131   2e-33   Prunus mume [ume]
ref|XP_011081971.1|  PREDICTED: patatin-like protein 1                  131   2e-33   Sesamum indicum [beniseed]
ref|XP_004310193.1|  PREDICTED: patatin-like protein 2                  131   3e-33   Fragaria vesca subsp. vesca
gb|KCW66169.1|  hypothetical protein EUGRSUZ_F000051                    125   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010446710.1|  PREDICTED: patatin-like protein 1 isoform X3       130   3e-33   
emb|CDX75621.1|  BnaA01g00810D                                          131   3e-33   
ref|XP_010061771.1|  PREDICTED: patatin-like protein 2 isoform X2       130   3e-33   
ref|XP_002445638.1|  hypothetical protein SORBIDRAFT_07g023200          131   3e-33   
ref|XP_009139093.1|  PREDICTED: patatin-like protein 3                  130   3e-33   Brassica rapa
ref|XP_009797489.1|  PREDICTED: patatin-like protein 2 isoform X2       129   3e-33   Nicotiana sylvestris
ref|XP_009138468.1|  PREDICTED: patatin-like protein 3                  130   4e-33   Brassica rapa
ref|XP_010446709.1|  PREDICTED: patatin-like protein 1 isoform X2       130   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007017308.1|  Phospholipase A 2A, IIA,PLA2A isoform 2            128   4e-33   
gb|KFK30332.1|  hypothetical protein AALP_AA7G248200                    132   4e-33   Arabis alpina [alpine rockcress]
ref|XP_004167584.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    130   4e-33   
ref|XP_004501586.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1       130   4e-33   Cicer arietinum [garbanzo]
ref|XP_009409669.1|  PREDICTED: patatin-like protein 1                  130   4e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006338216.1|  PREDICTED: patatin-3-Kuras 1-like                  130   4e-33   Solanum tuberosum [potatoes]
ref|NP_568015.1|  patatin-related phospholipase A                       130   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232051.1|  PREDICTED: patatin-like protein 3                  130   5e-33   Solanum lycopersicum
ref|XP_010064131.1|  PREDICTED: patatin-like protein 2                  127   5e-33   Eucalyptus grandis [rose gum]
ref|XP_009133998.1|  PREDICTED: patatin-like protein 2                  130   5e-33   Brassica rapa
gb|AAM64566.1|  patatin-like protein                                    130   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004233432.1|  PREDICTED: patatin-like protein 1                  130   5e-33   Solanum lycopersicum
ref|XP_010061770.1|  PREDICTED: patatin-like protein 2 isoform X1       130   5e-33   Eucalyptus grandis [rose gum]
gb|EMS66123.1|  Patatin group A-3                                       130   5e-33   Triticum urartu
emb|CDY21469.1|  BnaC03g27280D                                          130   5e-33   Brassica napus [oilseed rape]
gb|KFK32501.1|  hypothetical protein AALP_AA6G250900                    130   5e-33   Arabis alpina [alpine rockcress]
ref|XP_007160830.1|  hypothetical protein PHAVU_001G020100g             130   6e-33   Phaseolus vulgaris [French bean]
gb|KCW54973.1|  hypothetical protein EUGRSUZ_I00941                     130   6e-33   Eucalyptus grandis [rose gum]
ref|NP_849511.1|  patatin-related phospholipase A                       130   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008813728.1|  PREDICTED: patatin-like protein 2                  125   6e-33   Phoenix dactylifera
emb|CAA05628.1|  patatin-like protein                                   130   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009780402.1|  PREDICTED: patatin-like protein 2                  130   6e-33   Nicotiana sylvestris
ref|XP_006411935.1|  hypothetical protein EUTSA_v10025343mg             130   6e-33   Eutrema salsugineum [saltwater cress]
gb|AFK35290.1|  unknown                                                 130   6e-33   Medicago truncatula
gb|KDO79284.1|  hypothetical protein CISIN_1g0425841mg                  128   7e-33   Citrus sinensis [apfelsine]
ref|XP_008776250.1|  PREDICTED: patatin-like protein 2                  130   7e-33   
ref|XP_006660213.1|  PREDICTED: patatin-3-Kuras 1-like                  130   7e-33   Oryza brachyantha
ref|XP_006660710.1|  PREDICTED: patatin-2-Kuras 2-like isoform X2       129   7e-33   
ref|XP_009589751.1|  PREDICTED: patatin-like protein 1                  130   7e-33   Nicotiana tomentosiformis
ref|XP_009797488.1|  PREDICTED: patatin-like protein 2 isoform X1       129   8e-33   Nicotiana sylvestris
ref|XP_010059972.1|  PREDICTED: patatin-like protein 2                  129   9e-33   Eucalyptus grandis [rose gum]
gb|EEC84713.1|  hypothetical protein OsI_31673                          129   9e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_008813724.1|  PREDICTED: patatin-like protein 2 isoform X1       129   1e-32   Phoenix dactylifera
ref|NP_001063402.2|  Os09g0462400                                       129   1e-32   
ref|XP_006829702.1|  hypothetical protein AMTR_s00126p00063230          129   1e-32   Amborella trichopoda
ref|XP_006829694.1|  hypothetical protein AMTR_s00126p00050070          129   1e-32   Amborella trichopoda
ref|XP_009367484.1|  PREDICTED: patatin-like protein 2                  129   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_006419185.1|  hypothetical protein CICLE_v10030450mg             129   1e-32   Citrus clementina [clementine]
ref|XP_002510260.1|  Patatin T5 precursor, putative                     129   1e-32   
emb|CDX72620.1|  BnaC07g46420D                                          129   1e-32   
ref|XP_009589625.1|  PREDICTED: patatin-like protein 3                  129   1e-32   Nicotiana tomentosiformis
ref|XP_006829697.1|  hypothetical protein AMTR_s00126p00052700          129   1e-32   
ref|XP_009410116.1|  PREDICTED: patatin-like protein 2                  129   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004973692.1|  PREDICTED: patatin-3-Kuras 1-like                  129   1e-32   Setaria italica
ref|XP_009393655.1|  PREDICTED: patatin-like protein 2                  129   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007136666.1|  hypothetical protein PHAVU_009G063500g             129   2e-32   Phaseolus vulgaris [French bean]
ref|XP_010059758.1|  PREDICTED: patatin-like protein 2                  127   2e-32   
ref|XP_002523557.1|  Patatin class 1 precursor, putative                129   2e-32   Ricinus communis
ref|XP_010101003.1|  Patatin group A-3                                  129   2e-32   Morus notabilis
ref|XP_006829698.1|  hypothetical protein AMTR_s00126p00052810          127   2e-32   
ref|XP_008776828.1|  PREDICTED: patatin-like protein 2                  129   2e-32   
ref|XP_006388385.1|  hypothetical protein POPTR_0202s00220g             129   2e-32   
ref|XP_009349524.1|  PREDICTED: patatin-like protein 2                  129   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_006387188.1|  hypothetical protein POPTR_1581s00200g             129   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_007203506.1|  hypothetical protein PRUPE_ppa024781mg             129   2e-32   Prunus persica
ref|XP_006372536.1|  hypothetical protein POPTR_0017s02540g             128   2e-32   
ref|XP_009370192.1|  PREDICTED: patatin-like protein 2                  128   2e-32   
ref|XP_007017307.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            129   2e-32   
ref|XP_008220195.1|  PREDICTED: patatin-like protein 2 isoform X2       129   2e-32   
ref|XP_011017230.1|  PREDICTED: patatin-like protein 2                  129   2e-32   Populus euphratica
ref|XP_002869007.1|  PLA IVA/PLP1                                       129   2e-32   
ref|XP_010942709.1|  PREDICTED: patatin-like protein 2                  127   2e-32   Elaeis guineensis
ref|XP_009780403.1|  PREDICTED: patatin-like protein 2                  129   2e-32   Nicotiana sylvestris
ref|XP_004152795.1|  PREDICTED: patatin group A-3-like                  128   2e-32   
emb|CDX83197.1|  BnaA03g23090D                                          128   2e-32   
ref|NP_001149326.1|  patatin class 1                                    129   2e-32   
ref|XP_010939457.1|  PREDICTED: patatin-like protein 2 isoform X2       128   3e-32   
ref|XP_006424637.1|  hypothetical protein CICLE_v10030027mg             128   3e-32   Citrus clementina [clementine]
tpg|DAA48471.1|  TPA: patatin class 1                                   128   3e-32   
ref|XP_010939456.1|  PREDICTED: patatin-like protein 2 isoform X1       128   3e-32   Elaeis guineensis
ref|XP_011099197.1|  PREDICTED: patatin-like protein 2                  128   3e-32   Sesamum indicum [beniseed]
gb|KFK30329.1|  hypothetical protein AALP_AA7G247700                    128   3e-32   Arabis alpina [alpine rockcress]
ref|XP_004957049.1|  PREDICTED: patatin-05-like                         128   3e-32   
ref|XP_006473887.1|  PREDICTED: patatin-05-like                         128   3e-32   Citrus sinensis [apfelsine]
ref|XP_010926367.1|  PREDICTED: patatin-like protein 2                  128   3e-32   Elaeis guineensis
ref|XP_008241846.1|  PREDICTED: patatin-like protein 1                  128   3e-32   
emb|CDY42720.1|  BnaA03g53730D                                          128   3e-32   Brassica napus [oilseed rape]
ref|XP_008337062.1|  PREDICTED: patatin-like protein 2                  128   4e-32   
ref|XP_002456787.1|  hypothetical protein SORBIDRAFT_03g042730          128   4e-32   Sorghum bicolor [broomcorn]
gb|KCW66178.1|  hypothetical protein EUGRSUZ_F00014                     128   4e-32   Eucalyptus grandis [rose gum]
ref|XP_008671929.1|  PREDICTED: patatin-like protein 1                  127   4e-32   
ref|XP_009773110.1|  PREDICTED: patatin-like protein 2                  128   4e-32   Nicotiana sylvestris
emb|CDP07842.1|  unnamed protein product                                127   4e-32   Coffea canephora [robusta coffee]
ref|XP_009403085.1|  PREDICTED: patatin-like protein 2                  127   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010429587.1|  PREDICTED: patatin-like protein 2                  127   4e-32   Camelina sativa [gold-of-pleasure]
tpg|DAA42306.1|  TPA: patatin T5                                        127   5e-32   
ref|XP_008241848.1|  PREDICTED: patatin-like protein 2                  127   5e-32   Prunus mume [ume]
ref|XP_002449852.1|  hypothetical protein SORBIDRAFT_05g024390          127   5e-32   Sorghum bicolor [broomcorn]
ref|XP_006601293.1|  PREDICTED: patatin-11-like                         127   5e-32   Glycine max [soybeans]
ref|XP_010317808.1|  PREDICTED: patatin-like protein 2 isoform X1       127   5e-32   Solanum lycopersicum
ref|XP_004234672.1|  PREDICTED: patatin-like protein 3 isoform X2       127   5e-32   Solanum lycopersicum
ref|XP_006488152.1|  PREDICTED: patatin-05-like                         127   5e-32   Citrus sinensis [apfelsine]
ref|XP_009370176.1|  PREDICTED: patatin-like protein 2                  127   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_003544453.1|  PREDICTED: patatin-05                              127   5e-32   Glycine max [soybeans]
ref|XP_003544451.1|  PREDICTED: patatin-05-like                         127   5e-32   Glycine max [soybeans]
ref|XP_004160046.1|  PREDICTED: patatin group A-3-like                  127   6e-32   
ref|XP_002301194.1|  patatin-like family protein                        127   6e-32   Populus trichocarpa [western balsam poplar]
ref|NP_195423.1|  PATATIN-like protein 5                                127   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010942710.1|  PREDICTED: patatin-like protein 2                  128   6e-32   
ref|XP_004979723.1|  PREDICTED: uncharacterized protein LOC101762...    130   6e-32   Setaria italica
ref|XP_002282597.1|  PREDICTED: patatin-like protein 2 isoform X1       127   6e-32   Vitis vinifera
emb|CDP01333.1|  unnamed protein product                                127   6e-32   Coffea canephora [robusta coffee]
ref|XP_008779684.1|  PREDICTED: patatin-like protein 2                  122   6e-32   
ref|XP_010268982.1|  PREDICTED: patatin-like protein 2                  127   6e-32   
ref|XP_011099198.1|  PREDICTED: patatin-like protein 2                  127   7e-32   
gb|KCW66463.1|  hypothetical protein EUGRSUZ_F00261                     127   7e-32   
gb|ACR34670.1|  unknown                                                 124   7e-32   
ref|XP_009589752.1|  PREDICTED: patatin-like protein 2                  127   8e-32   
ref|XP_010064187.1|  PREDICTED: patatin-like protein 2                  127   8e-32   
gb|KJB29508.1|  hypothetical protein B456_005G104200                    127   8e-32   
ref|XP_008779158.1|  PREDICTED: patatin-like protein 2                  127   9e-32   
ref|XP_002510258.1|  Patatin T5 precursor, putative                     127   9e-32   
ref|XP_010446708.1|  PREDICTED: patatin-like protein 1 isoform X1       127   9e-32   
ref|XP_002880809.1|  hypothetical protein ARALYDRAFT_344337             127   9e-32   
ref|XP_008444641.1|  PREDICTED: patatin-like protein 2 isoform X1       127   9e-32   
ref|XP_004973688.1|  PREDICTED: patatin-2-Kuras 1-like isoform X2       127   9e-32   
gb|KJB58444.1|  hypothetical protein B456_009G210400                    127   1e-31   
gb|EMS45954.1|  Patatin group A-3                                       126   1e-31   
ref|XP_010059969.1|  PREDICTED: patatin-like protein 2 isoform X2       127   1e-31   
ref|XP_006434813.1|  hypothetical protein CICLE_v10001337mg             126   1e-31   
ref|XP_006408594.1|  hypothetical protein EUTSA_v10002000mg             126   1e-31   
ref|XP_004979713.1|  PREDICTED: patatin-3-Kuras 1-like                  126   1e-31   
ref|XP_007222710.1|  hypothetical protein PRUPE_ppa006466mg             126   1e-31   
ref|XP_006488153.1|  PREDICTED: patatin-3-Kuras 1-like                  126   1e-31   
emb|CDP01335.1|  unnamed protein product                                127   1e-31   
ref|XP_010059967.1|  PREDICTED: patatin-like protein 2                  126   1e-31   
ref|XP_003603015.1|  Patatin-like protein                               126   1e-31   
gb|ACN33435.1|  unknown                                                 127   1e-31   
ref|XP_006434815.1|  hypothetical protein CICLE_v10001337mg             126   1e-31   
ref|XP_010059968.1|  PREDICTED: patatin-like protein 2 isoform X1       126   1e-31   
emb|CBI25857.3|  unnamed protein product                                122   1e-31   
ref|XP_009138467.1|  PREDICTED: patatin-like protein 1 isoform X2       126   1e-31   
ref|XP_009138466.1|  PREDICTED: patatin-like protein 1 isoform X1       126   1e-31   
ref|XP_010432095.1|  PREDICTED: patatin-like protein 3                  126   1e-31   
emb|CDX75619.1|  BnaA01g00830D                                          126   1e-31   
ref|XP_009370177.1|  PREDICTED: patatin-like protein 2                  126   1e-31   
emb|CBI21441.3|  unnamed protein product                                129   1e-31   
ref|XP_008228776.1|  PREDICTED: patatin-like protein 2                  126   1e-31   
gb|KHG27256.1|  Patatin group M-3                                       126   1e-31   
ref|XP_010030595.1|  PREDICTED: patatin-like protein 2                  126   1e-31   
ref|XP_010446707.1|  PREDICTED: patatin-like protein 3                  126   1e-31   
ref|XP_006434817.1|  hypothetical protein CICLE_v10003658mg             126   1e-31   
ref|XP_008393826.1|  PREDICTED: patatin-like protein 2                  126   1e-31   
tpg|DAA42305.1|  TPA: hypothetical protein ZEAMMB73_127435              127   1e-31   
emb|CDX72619.1|  BnaC07g46410D                                          126   1e-31   
ref|XP_009139399.1|  PREDICTED: patatin-like protein 1 isoform X2       126   2e-31   
ref|XP_010235203.1|  PREDICTED: patatin-like protein 2                  126   2e-31   
ref|XP_007227183.1|  hypothetical protein PRUPE_ppa019615mg             125   2e-31   
gb|KCW66173.1|  hypothetical protein EUGRSUZ_F00009                     122   2e-31   
ref|XP_004980604.1|  PREDICTED: patatin-3-Kuras 1-like                  126   2e-31   
ref|XP_009139351.1|  PREDICTED: patatin-like protein 1 isoform X1       126   2e-31   
ref|XP_007224534.1|  hypothetical protein PRUPE_ppa024261mg             126   2e-31   
ref|XP_002880810.1|  hypothetical protein ARALYDRAFT_481516             126   2e-31   
ref|XP_010664585.1|  PREDICTED: patatin-like protein 2 isoform X3       126   2e-31   
ref|XP_010101004.1|  Patatin group A-3                                  126   2e-31   
gb|EAZ07350.1|  hypothetical protein OsI_29600                          126   2e-31   
ref|XP_009367378.1|  PREDICTED: patatin-like protein 2                  125   2e-31   
ref|XP_002451118.1|  hypothetical protein SORBIDRAFT_05g024380          125   2e-31   
ref|XP_008444642.1|  PREDICTED: patatin-like protein 2 isoform X2       125   2e-31   
ref|XP_008220177.1|  PREDICTED: patatin-like protein 2                  125   3e-31   
ref|XP_007226655.1|  hypothetical protein PRUPE_ppa021897mg             125   3e-31   
ref|XP_006291236.1|  hypothetical protein CARUB_v10017367mg             125   3e-31   
ref|XP_004511941.1|  PREDICTED: patatin-05-like                         125   3e-31   
gb|EAZ06806.1|  hypothetical protein OsI_29050                          125   3e-31   
emb|CDY42719.1|  BnaA03g53720D                                          127   3e-31   
ref|XP_008777430.1|  PREDICTED: patatin-like protein 2                  125   3e-31   
ref|XP_008777590.1|  PREDICTED: patatin-like protein 2                  125   3e-31   
ref|NP_001061678.1|  Os08g0376500                                       125   4e-31   
gb|ABK24809.1|  unknown                                                 125   4e-31   
ref|NP_001151996.1|  patatin T5                                         125   4e-31   
gb|EAZ07347.1|  hypothetical protein OsI_29596                          125   4e-31   
ref|XP_004501587.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2       125   4e-31   
ref|XP_002510255.1|  Patatin precursor, putative                        125   5e-31   
ref|XP_008393827.1|  PREDICTED: patatin-like protein 2 isoform X1       125   5e-31   
gb|EMT13605.1|  Patatin group A-3                                       124   5e-31   
ref|XP_008393824.1|  PREDICTED: patatin-like protein 2                  124   5e-31   
gb|KDO79308.1|  hypothetical protein CISIN_1g0308261mg                  120   5e-31   
ref|XP_010652820.1|  PREDICTED: patatin-like protein 1                  124   5e-31   
ref|XP_010417357.1|  PREDICTED: patatin-like protein 2                  124   5e-31   
ref|XP_008393828.1|  PREDICTED: patatin-like protein 2 isoform X2       124   5e-31   
ref|XP_002523558.1|  Patatin precursor, putative                        124   5e-31   
ref|XP_008228777.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    124   5e-31   
ref|XP_008241529.1|  PREDICTED: patatin-like protein 3                  124   5e-31   
ref|NP_180224.1|  phospholipase A 2A                                    124   6e-31   
dbj|BAK02816.1|  predicted protein                                      125   6e-31   
ref|XP_002510259.1|  Patatin T5 precursor, putative                     124   6e-31   
gb|AAM63157.1|  similar to latex allergen from Hevea brasiliensis       124   6e-31   
ref|XP_002301195.2|  hypothetical protein POPTR_0002s12980g             124   6e-31   
ref|XP_011038242.1|  PREDICTED: patatin-like protein 2                  124   6e-31   
gb|KCW88897.1|  hypothetical protein EUGRSUZ_A01223                     124   6e-31   
emb|CDX69271.1|  BnaC01g01820D                                          124   6e-31   
ref|XP_010065725.1|  PREDICTED: patatin-like protein 2                  124   6e-31   
ref|XP_008220197.1|  PREDICTED: patatin-like protein 2 isoform X2       123   6e-31   
emb|CDX69269.1|  BnaC01g01840D                                          124   6e-31   
ref|XP_006425839.1|  hypothetical protein CICLE_v10025791mg             124   7e-31   
ref|XP_008220198.1|  PREDICTED: patatin-like protein 2                  124   7e-31   
ref|XP_010068219.1|  PREDICTED: patatin-like protein 2                  124   8e-31   
ref|XP_010068174.1|  PREDICTED: patatin-like protein 2                  124   8e-31   
ref|XP_004499077.1|  PREDICTED: patatin-2-Kuras 3-like isoform X3       124   8e-31   
ref|XP_009370175.1|  PREDICTED: patatin-like protein 2                  124   8e-31   
emb|CAN71270.1|  hypothetical protein VITISV_001906                     122   8e-31   
ref|XP_008797306.1|  PREDICTED: patatin-like protein 2                  124   8e-31   
ref|XP_004291128.2|  PREDICTED: patatin-like protein 2                  124   8e-31   
ref|XP_003574632.1|  PREDICTED: patatin-like protein 2                  124   9e-31   
ref|XP_009370196.1|  PREDICTED: patatin-like protein 2                  124   9e-31   
ref|XP_007017310.1|  Phospholipase A 2A, IIA,PLA2A                      124   9e-31   
ref|NP_195422.3|  PATATIN-like protein 4                                124   9e-31   
ref|XP_008245283.1|  PREDICTED: patatin-like protein 2                  122   9e-31   
ref|XP_008220196.1|  PREDICTED: patatin-like protein 2 isoform X1       124   9e-31   
ref|XP_010268755.1|  PREDICTED: patatin-like protein 2                  124   1e-30   
tpg|DAA40258.1|  TPA: hypothetical protein ZEAMMB73_846494              124   1e-30   
ref|XP_006374982.1|  hypothetical protein POPTR_0014s03330g             124   1e-30   
gb|AGS13487.1|  PLP protein                                             123   1e-30   
ref|XP_007047219.1|  Acyl transferase/acyl hydrolase/lysophosphol...    124   1e-30   
ref|XP_008670247.1|  PREDICTED: patatin-like protein 2 isoform X2       124   1e-30   
ref|NP_001141843.1|  hypothetical protein                               124   1e-30   
ref|XP_010437267.1|  PREDICTED: patatin-like protein 3                  124   1e-30   
ref|XP_010064133.1|  PREDICTED: patatin-like protein 2                  123   1e-30   
ref|XP_009367379.1|  PREDICTED: patatin-like protein 2                  124   1e-30   
ref|XP_008670246.1|  PREDICTED: patatin-like protein 2 isoform X1       124   1e-30   
ref|XP_007227369.1|  hypothetical protein PRUPE_ppa026872mg             123   1e-30   
ref|XP_004288050.1|  PREDICTED: patatin-like protein 1                  123   1e-30   
ref|XP_006425840.1|  hypothetical protein CICLE_v10025791mg             123   1e-30   
ref|XP_010064188.1|  PREDICTED: patatin-like protein 2                  123   1e-30   
ref|NP_001062043.1|  Os08g0477100                                       124   1e-30   
ref|XP_006425841.1|  hypothetical protein CICLE_v10025791mg             122   1e-30   
ref|XP_010503027.1|  PREDICTED: patatin-like protein 2                  123   1e-30   
ref|XP_008378197.1|  PREDICTED: patatin-like protein 2                  123   2e-30   
ref|XP_007203278.1|  hypothetical protein PRUPE_ppa025529mg             123   2e-30   
ref|XP_011030324.1|  PREDICTED: patatin-like protein 2 isoform X1       123   2e-30   
ref|XP_010064186.1|  PREDICTED: patatin-like protein 2                  123   2e-30   
ref|XP_008378189.1|  PREDICTED: patatin-like protein 2                  123   2e-30   
ref|XP_006659498.1|  PREDICTED: patatin-T5-like                         123   2e-30   
ref|XP_011030334.1|  PREDICTED: patatin-like protein 2 isoform X2       123   2e-30   
gb|AAB08427.1|  patatin homolog                                         121   2e-30   
gb|EMS48649.1|  Patatin group A-3                                       124   2e-30   
emb|CAA73328.1|  patatin-like protein                                   123   2e-30   
ref|XP_010664933.1|  PREDICTED: patatin-like protein 2                  123   2e-30   
ref|XP_009367377.1|  PREDICTED: patatin-like protein 2                  123   2e-30   
ref|XP_002460354.1|  hypothetical protein SORBIDRAFT_02g026818          122   2e-30   
ref|XP_006645174.1|  PREDICTED: patatin-2-Kuras 4-like                  123   2e-30   
ref|XP_008457877.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    123   2e-30   
gb|KDP31895.1|  hypothetical protein JCGZ_12356                         122   2e-30   
ref|XP_010101001.1|  Patatin group A-3                                  123   2e-30   
ref|XP_006365363.1|  PREDICTED: patatin group M-2-like                  123   2e-30   
ref|XP_009367381.1|  PREDICTED: patatin-like protein 2                  122   2e-30   
ref|XP_009799007.1|  PREDICTED: patatin-like protein 3                  123   2e-30   
gb|KDP38381.1|  hypothetical protein JCGZ_04306                         122   2e-30   
gb|KCW66458.1|  hypothetical protein EUGRSUZ_F00254                     123   2e-30   
ref|XP_009366807.1|  PREDICTED: patatin-like protein 2                  122   3e-30   
ref|XP_007047188.1|  Phospholipase A 2A, IIA,PLA2A, putative            122   3e-30   
emb|CBI19554.3|  unnamed protein product                                122   3e-30   
ref|XP_010064137.1|  PREDICTED: patatin-like protein 2                  122   3e-30   
ref|XP_006380722.1|  hypothetical protein POPTR_0007s11370g             122   3e-30   
ref|XP_010064139.1|  PREDICTED: patatin-like protein 2                  122   3e-30   
ref|XP_004165471.1|  PREDICTED: patatin group A-3-like                  123   3e-30   
ref|XP_008241530.1|  PREDICTED: patatin-like protein 2                  122   3e-30   
ref|XP_008664528.1|  PREDICTED: patatin-like protein 2                  122   3e-30   
gb|EMT18762.1|  Patatin group A-3                                       122   3e-30   
gb|AAB08428.1|  patatin homolog                                         122   4e-30   
gb|KHN12764.1|  Patatin group A-3                                       122   4e-30   
gb|KCW78409.1|  hypothetical protein EUGRSUZ_D02575                     122   4e-30   
ref|XP_006374981.1|  hypothetical protein POPTR_0014s03320g             122   5e-30   
ref|XP_010472600.1|  PREDICTED: patatin-like protein 2                  122   5e-30   
ref|XP_002869006.1|  hypothetical protein ARALYDRAFT_490916             122   5e-30   
tpg|DAA48470.1|  TPA: hypothetical protein ZEAMMB73_976536              122   5e-30   
ref|XP_004233945.1|  PREDICTED: patatin-like protein 2                  122   5e-30   
ref|XP_010054916.1|  PREDICTED: patatin-like protein 2                  122   5e-30   
ref|XP_006374978.1|  hypothetical protein POPTR_0014s03290g             122   5e-30   
ref|XP_004291131.1|  PREDICTED: patatin-like protein 2                  122   5e-30   
ref|XP_010509131.1|  PREDICTED: patatin-like protein 2                  122   6e-30   
ref|XP_003603014.1|  Patatin-like protein                               122   6e-30   
ref|XP_007017303.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            122   6e-30   
ref|XP_007017304.1|  Phospholipase A 2A, IIA,PLA2A isoform 2            122   6e-30   
gb|KCW54995.1|  hypothetical protein EUGRSUZ_I00969                     120   6e-30   
ref|XP_009368084.1|  PREDICTED: patatin-like protein 3                  121   7e-30   
ref|XP_004958340.1|  PREDICTED: patatin-3-Kuras 1-like                  121   7e-30   
ref|XP_003574631.1|  PREDICTED: patatin-like protein 2                  121   7e-30   
ref|XP_008668146.1|  PREDICTED: patatin T5 isoform X1                   121   7e-30   
ref|XP_010064136.1|  PREDICTED: patatin-like protein 2                  121   8e-30   
ref|XP_010446706.1|  PREDICTED: patatin-like protein 3                  121   8e-30   
ref|XP_006829696.1|  hypothetical protein AMTR_s00126p00051390          118   8e-30   
ref|XP_010059970.1|  PREDICTED: patatin-like protein 2 isoform X1       121   9e-30   
ref|XP_010102581.1|  Patatin group A-3                                  121   1e-29   
ref|XP_008664527.1|  PREDICTED: patatin-like protein 2                  121   1e-29   
ref|XP_008384958.1|  PREDICTED: patatin-like protein 2                  121   1e-29   
gb|EMT32376.1|  Patatin group A-3                                       121   1e-29   
ref|XP_009366768.1|  PREDICTED: patatin-like protein 2                  120   1e-29   
ref|XP_010270650.1|  PREDICTED: patatin-like protein 2                  121   1e-29   
ref|XP_006285080.1|  hypothetical protein CARUB_v10006413mg             121   1e-29   
ref|XP_010028280.1|  PREDICTED: patatin-like protein 2 isoform X3       120   1e-29   
ref|XP_007202145.1|  hypothetical protein PRUPE_ppa007009mg             120   1e-29   
ref|XP_002449853.1|  hypothetical protein SORBIDRAFT_05g024430          120   1e-29   
emb|CBI19552.3|  unnamed protein product                                121   1e-29   
gb|AAD22169.1|AF061282_23  patatin-like protein                         120   1e-29   
emb|CAN76066.1|  hypothetical protein VITISV_001725                     120   1e-29   
ref|XP_002310157.1|  hypothetical protein POPTR_0007s11360g             120   1e-29   
ref|XP_002282481.1|  PREDICTED: patatin-like protein 2                  120   1e-29   
gb|KJB58442.1|  hypothetical protein B456_009G210300                    120   1e-29   
ref|XP_010664584.1|  PREDICTED: patatin-like protein 2 isoform X2       120   1e-29   
gb|AAX99411.1|  patatin-like protein                                    120   1e-29   
gb|EMS54202.1|  Patatin group A-3                                       122   1e-29   
emb|CDM80597.1|  unnamed protein product                                120   2e-29   
ref|XP_008241523.1|  PREDICTED: patatin-like protein 3 isoform X1       120   2e-29   
emb|CAN59809.1|  hypothetical protein VITISV_002456                     120   2e-29   
ref|XP_008361010.1|  PREDICTED: patatin-like protein 2                  120   2e-29   
ref|XP_008367973.1|  PREDICTED: patatin-like protein 2                  120   2e-29   
ref|XP_011458944.1|  PREDICTED: patatin-like protein 2                  118   2e-29   
ref|XP_003572284.1|  PREDICTED: patatin-like protein 2                  120   2e-29   
gb|KCW66171.1|  hypothetical protein EUGRSUZ_F00007                     120   2e-29   
ref|XP_010064132.1|  PREDICTED: patatin-like protein 2                  120   2e-29   
ref|XP_008357460.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    122   2e-29   
ref|XP_004973689.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-2-Ku...    120   2e-29   
ref|XP_004288059.1|  PREDICTED: patatin-like protein 1                  120   2e-29   
ref|XP_004289234.1|  PREDICTED: patatin-like protein 2                  120   3e-29   
ref|XP_007017306.1|  Phospholipase A 2A, IIA,PLA2A                      120   3e-29   
ref|XP_010028278.1|  PREDICTED: patatin-like protein 2 isoform X1       120   3e-29   
ref|NP_001140826.1|  uncharacterized protein LOC100272901               120   3e-29   
gb|EMT30617.1|  Patatin group A-3                                       120   3e-29   
ref|XP_008813727.1|  PREDICTED: patatin-like protein 2                  119   4e-29   
emb|CDP01331.1|  unnamed protein product                                119   4e-29   
ref|XP_011039207.1|  PREDICTED: patatin-like protein 2                  119   4e-29   
emb|CBI19544.3|  unnamed protein product                                119   4e-29   
ref|XP_002284571.1|  PREDICTED: patatin-like protein 2                  119   4e-29   



>ref|XP_007202991.1| hypothetical protein PRUPE_ppa019010mg [Prunus persica]
 gb|EMJ04190.1| hypothetical protein PRUPE_ppa019010mg [Prunus persica]
Length=407

 Score =   154 bits (388),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPG ++AYLE QLQ LDG DAR+ADYFDVI+GTSTGGL+ TMLAA
Sbjct  19   LITVLSIDGGGIRGIIPGVLLAYLESQLQELDGEDARLADYFDVISGTSTGGLIATMLAA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+ N RPLYA KDIVPFY ++  KIFP S+G+   V D  ++L+GPKYDGKYLHKLI+N+
Sbjct  79   PNDNNRPLYAAKDIVPFYLDNCPKIFPQSSGLCAAVVDLVKVLTGPKYDGKYLHKLIRNI  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT+VVIPTFD+
Sbjct  139  VGDKRLDQTLTNVVIPTFDV  158



>ref|XP_004288052.1| PREDICTED: patatin-like protein 1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPG ++ YLE QLQ LDG DAR+ADYFDVI+GTSTGGL+T MLAA
Sbjct  20   LITVLSIDGGGIRGIIPGVLLTYLESQLQHLDGEDARIADYFDVISGTSTGGLITAMLAA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+N RPL+A KDIVPFY ++  KIFP S G+  TV D  ++L GPKYDGKYLHKLI+++
Sbjct  80   PDENNRPLFAAKDIVPFYLDNCPKIFPQSRGLCATVTDLVKVLIGPKYDGKYLHKLIRSI  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RLSQTLT+V+IPTFDI
Sbjct  140  VGDKRLSQTLTNVIIPTFDI  159



>ref|XP_006339914.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=405

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITIL+IDGGGIRGIIPG I+AYLE QLQ LDG +AR+ADYFDVIAGTSTGGL+T MLAA
Sbjct  22   LITILAIDGGGIRGIIPGVILAYLESQLQELDGENARIADYFDVIAGTSTGGLVTAMLAA  81

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K+KRPLYA KDI PFY EH  KIFP  +G+F  V + T++++GPKYDGKYLH L + L
Sbjct  82   PNKDKRPLYAAKDITPFYIEHSPKIFPQISGLFAGVINLTKMMNGPKYDGKYLHALTKRL  141

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL  TLT VVIPTFDI
Sbjct  142  LGGTRLHDTLTAVVIPTFDI  161



>ref|XP_008241509.1| PREDICTED: patatin-like protein 3 [Prunus mume]
Length=405

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPG ++AYLE QLQ LDG DAR+ADYFDVI+GTSTGGL+ TMLAA
Sbjct  19   LITVLSIDGGGIRGIIPGVLLAYLESQLQELDGEDARLADYFDVISGTSTGGLIATMLAA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+ N RPLYA KDIVPFY ++  KIFP   G+   + +  ++L+GPKYDGKYLHKLI+N+
Sbjct  79   PNDNNRPLYAAKDIVPFYLDNCPKIFPQPRGLCAQIVELVKVLTGPKYDGKYLHKLIRNI  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT+VVIPTFD+
Sbjct  139  VGDKRLDQTLTNVVIPTFDV  158



>ref|XP_008339923.1| PREDICTED: patatin-like protein 1 isoform X1 [Malus domestica]
Length=379

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG ++AYLE +LQ LDG DAR+ADYFDVI+GTSTGGL+ TML A
Sbjct  13   LITILSIDGGGIRGIIPGALLAYLESELQKLDGEDARLADYFDVISGTSTGGLIATMLVA  72

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++N RPL+A KDIVPFY  +  KIFP S+G+  TV D  + L+GPKYDGKYLHKL++ +
Sbjct  73   PNENNRPLFAAKDIVPFYLSNCPKIFPRSSGLCATVNDLVKALTGPKYDGKYLHKLVREI  132

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT++V+PTFDI
Sbjct  133  IGDKRLDQTLTNLVVPTFDI  152



>ref|XP_008354710.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 1 [Malus 
domestica]
Length=463

 Score =   149 bits (376),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 96/140 (69%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG ++AYLE +LQ LDG DAR+ADYFDVI+GTSTGGL+ TML A
Sbjct  13   LITILSIDGGGIRGIIPGALLAYLESELQKLDGEDARLADYFDVISGTSTGGLIATMLVA  72

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++N RPL+A KDIVPFY  +  KIFP S+G+  TV D  + L+GPKYDGKYLHKL++ +
Sbjct  73   PNENNRPLFAAKDIVPFYLSNCPKIFPRSSGLCATVNDLVKALTGPKYDGKYLHKLVREI  132

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT++V+PTFDI
Sbjct  133  IGDKRLDQTLTNLVVPTFDI  152



>ref|XP_010269002.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=345

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPGTI+A+LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  18   LVTILSIDGGGIRGIIPGTILAFLESQLQKLDGEDARLADYFDVIAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++N RPL+A KDIVPFY E   KIFP ++GIF +  +  +L++GPKYDGKYLH L++  
Sbjct  78   PNENNRPLFAAKDIVPFYLEDCPKIFPQTSGIFGSALNLIKLMNGPKYDGKYLHSLVEKK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL QTLT++VIPTFDI
Sbjct  138  LGETRLHQTLTNIVIPTFDI  157



>ref|XP_006339912.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=399

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG I+AYLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T MLAA
Sbjct  19   LITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLIAGTSTGGLVTAMLAA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIF-PSAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K KRPLYA KDI PFY EH  KIF  + G F  V + T++L+GPKYDGKYLH LI+ L
Sbjct  79   PNKAKRPLYAAKDITPFYLEHSPKIFHQTGGPFGGVINLTKMLNGPKYDGKYLHTLIKGL  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL  TLT VVIPTFDI
Sbjct  139  LGGTRLHDTLTAVVIPTFDI  158



>ref|XP_009366942.1| PREDICTED: patatin-like protein 1 isoform X1 [Pyrus x bretschneideri]
Length=379

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPG ++ YLE +LQ LDG DAR+ADYFDVI+GTSTGGL+ TML A
Sbjct  13   LVTILSIDGGGIRGIIPGVLLTYLESELQKLDGEDARLADYFDVISGTSTGGLIATMLVA  72

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++N RPL+A KDIVPFY  +  KIFP S+G+  TV+D  + L+GPKYDGKYLHKL++ +
Sbjct  73   PNENNRPLFAAKDIVPFYHSNCPKIFPQSSGLCATVKDLVKALTGPKYDGKYLHKLVREI  132

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT++V+PTFDI
Sbjct  133  IGDKRLDQTLTNLVVPTFDI  152



>ref|XP_010268994.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=409

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPGTI+A+LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  18   LVTILSIDGGGIRGIIPGTILAFLESQLQKLDGEDARLADYFDVIAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++N RPL+A KDIVPFY E   KIFP ++GIF +  +  +L++GPKYDGKYLH L++  
Sbjct  78   PNENNRPLFAAKDIVPFYLEDCPKIFPQTSGIFGSALNLIKLMNGPKYDGKYLHSLVEKK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL QTLT++VIPTFDI
Sbjct  138  LGETRLHQTLTNIVIPTFDI  157



>ref|XP_009606859.1| PREDICTED: patatin-like protein 2, partial [Nicotiana tomentosiformis]
Length=161

 Score =   139 bits (351),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+++LE QLQ LDG DAR+ADYFDVIAGTSTGG++T ML A
Sbjct  16   LITVLSIDGGGIRGIIPATILSFLESQLQELDGKDARLADYFDVIAGTSTGGVVTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPLYA KDI PFY EH  KIFP    G+F  + +  + + GPKYDGKYLH++++ 
Sbjct  76   PDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEVVKE  135

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
               DTRLS T+T+VVIPTFDI
Sbjct  136  KLKDTRLSNTITNVVIPTFDI  156



>ref|XP_009390266.1| PREDICTED: patatin-like protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = +1

Query  61   VAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAPDKNKRPLYAGKDIVPFYKE  240
            +A+LE +LQ LDGP+AR+ADYFDVIAGTSTGGL+T ML AP+K KRPL+A KDIV FY +
Sbjct  45   IAFLEAELQKLDGPEARIADYFDVIAGTSTGGLVTAMLTAPNKEKRPLFAAKDIVQFYLD  104

Query  241  HGAKIFP--SAGIFETVRDATRLLSGPKYDGKYLHKLIQNLCGDTRLSQTLTHVVIPTFD  414
            +  KIFP  +AG+F +  +    +SGPKYDGKYLH +I+ L GDTRLSQTLT+VVIPTFD
Sbjct  105  NSPKIFPQKNAGLFNSALNLVGAVSGPKYDGKYLHAIIRQLLGDTRLSQTLTNVVIPTFD  164

Query  415  I  417
            I
Sbjct  165  I  165



>ref|XP_009603683.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=407

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITIL+IDGGGIRGIIPG I++YLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T MLAA
Sbjct  21   LITILAIDGGGIRGIIPGVILSYLESQLQELDGKDARIADYFDLIAGTSTGGLVTAMLAA  80

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K+KRPLYA KDI PFY EH  KIFP  +G    + + T+ + GPKYDGKYLHKLI+++
Sbjct  81   PNKDKRPLYAAKDITPFYLEHSPKIFPQISGPLAGIINLTKAMGGPKYDGKYLHKLIKDI  140

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL  TLT VVIPTFDI
Sbjct  141  LGGTRLHDTLTAVVIPTFDI  160



>ref|XP_009792908.1| PREDICTED: patatin-like protein 1 [Nicotiana sylvestris]
Length=406

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITIL+IDGGGIRGIIPG I++YLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T MLAA
Sbjct  20   LITILTIDGGGIRGIIPGVILSYLESQLQELDGKDARIADYFDLIAGTSTGGLVTAMLAA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K+KRPLYA KDI PFY EH  KIFP   G    + + T+ + GPKYDGKYLHKLI+ +
Sbjct  80   PNKDKRPLYAAKDITPFYLEHSPKIFPQMGGPLAGIINLTKAMGGPKYDGKYLHKLIKGI  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL  TLT VVIPTFDI
Sbjct  140  LGGTRLHDTLTAVVIPTFDI  159



>ref|XP_011008336.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
 ref|XP_011015438.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGI+PG I+AYLE QLQALDG DAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  19   ITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAMLAAP  78

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            ++ +RPL+  KDIVPFY  +  KIFP ++G+F   ++  + +SGPKYDGKYLHKL++++ 
Sbjct  79   NEQQRPLFEAKDIVPFYLNNSPKIFPQTSGMFAWPKNVWKAISGPKYDGKYLHKLVRDIL  138

Query  361  GDTRLSQTLTHVVIPTFDI  417
             DTRL QTLT+VVIPTFDI
Sbjct  139  KDTRLQQTLTNVVIPTFDI  157



>ref|XP_006380710.1| hypothetical protein POPTR_0007s11200g [Populus trichocarpa]
 gb|ERP58507.1| hypothetical protein POPTR_0007s11200g [Populus trichocarpa]
Length=353

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGI+PG I+AYLE QLQALDG DAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  19   ITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAMLAAP  78

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            ++ +RPL+  KDIVPFY  +  KIFP ++GIF    +  + +SGPKYDGKYLHKL++++ 
Sbjct  79   NEQQRPLFDAKDIVPFYLNNSPKIFPQTSGIFAWPTNVWKAISGPKYDGKYLHKLVRDIL  138

Query  361  GDTRLSQTLTHVVIPTFDI  417
             DTRL QTLT+VVIPTFDI
Sbjct  139  KDTRLHQTLTNVVIPTFDI  157



>ref|XP_011007290.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGI+PG I+AYLE QLQALDG DAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  19   ITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAMLAAP  78

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            ++ +RPL+  KDIVPFY  +  KIFP ++G+F   ++  + +SGPKYDGKYLHKL++++ 
Sbjct  79   NEQQRPLFEAKDIVPFYLNNSPKIFPQTSGMFAWPKNVWKAISGPKYDGKYLHKLVRDIL  138

Query  361  GDTRLSQTLTHVVIPTFDI  417
             DTRL QTLT+VVIPTFDI
Sbjct  139  KDTRLQQTLTNVVIPTFDI  157



>ref|XP_009390265.1| PREDICTED: patatin-like protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 99/125 (79%), Gaps = 6/125 (5%)
 Frame = +1

Query  61   VAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAPDKNKRPLYAGKDIVPFYKE  240
            +A+LE +LQ LDGP+AR+ADYFDVIAGTSTGGL+T ML AP+K KRPL+A KDIV FY +
Sbjct  45   IAFLEAELQKLDGPEARIADYFDVIAGTSTGGLVTAMLTAPNKEKRPLFAAKDIVQFYLD  104

Query  241  HGAKIFP------SAGIFETVRDATRLLSGPKYDGKYLHKLIQNLCGDTRLSQTLTHVVI  402
            +  KIFP      SAG+F +  +    +SGPKYDGKYLH +I+ L GDTRLSQTLT+VVI
Sbjct  105  NSPKIFPQKKFGCSAGLFNSALNLVGAVSGPKYDGKYLHAIIRQLLGDTRLSQTLTNVVI  164

Query  403  PTFDI  417
            PTFDI
Sbjct  165  PTFDI  169



>ref|XP_004233636.1| PREDICTED: patatin-like protein 1 [Solanum lycopersicum]
Length=816

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 116/143 (81%), Gaps = 4/143 (3%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITIL+IDGGGIRGIIPG I+AYLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T MLAA
Sbjct  22   LITILTIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLIAGTSTGGLVTAMLAA  81

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS----AGIFETVRDATRLLSGPKYDGKYLHKLI  348
            P+K+KRPLYA KDI PFY EH  KIFP     +G+F    +  ++++GPKYDGKYLH+LI
Sbjct  82   PNKDKRPLYAAKDITPFYIEHSPKIFPQISCCSGLFAGAINLAKMINGPKYDGKYLHELI  141

Query  349  QNLCGDTRLSQTLTHVVIPTFDI  417
            + L G TRL  TLT VVIPTFDI
Sbjct  142  KRLLGGTRLHDTLTAVVIPTFDI  164


 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG I+AYLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T MLAA
Sbjct  433  LITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLIAGTSTGGLVTAMLAA  492

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K KRPLYA KDI PFY EH  KIF    G F    + T++L+ PKYDGKYLH LI+ L
Sbjct  493  PNKAKRPLYAAKDITPFYLEHSPKIFHQIGGPFGGAINLTKMLNRPKYDGKYLHTLIKGL  552

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL  TLT VVIPTFDI
Sbjct  553  LGGTRLHDTLTAVVIPTFDI  572



>ref|XP_009794733.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=410

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+ YLE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  20   LVTILSIDGGGIRGIIPATILEYLESQLQELDGKDARLADYFDVIAGTSTGGLVTAMLTA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PDK  RPL+A KDIVPFY EHG KIFP + G+  +++   + L  PKYDGKYLHK+I+  
Sbjct  80   PDKEGRPLFAAKDIVPFYLEHGPKIFPHNGGLLGSIKRMLKSLVRPKYDGKYLHKVIKEK  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL +TLT++VIPTFDI
Sbjct  140  LGETRLHETLTNIVIPTFDI  159



>ref|XP_002310732.1| patatin family protein [Populus trichocarpa]
 gb|EEE91182.1| patatin family protein [Populus trichocarpa]
Length=407

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGI+PG I+AYLE QLQALDG DAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  19   ITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAMLAAP  78

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            ++ +RPL+  KDIVPFY  +  KIFP ++GIF    +  + +SGPKYDGKYLHKL++++ 
Sbjct  79   NEQQRPLFDAKDIVPFYLNNSPKIFPQTSGIFAWPTNVWKAISGPKYDGKYLHKLVRDIL  138

Query  361  GDTRLSQTLTHVVIPTFDI  417
             DTRL QTLT+VVIPTFDI
Sbjct  139  KDTRLHQTLTNVVIPTFDI  157



>ref|XP_006354913.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+++LE QLQ LDG DAR+ADYFDV+AGTSTGGL+T ML A
Sbjct  16   LITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTSTGGLVTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+N RPLYA KDI PFY EH  KIFP  +G+F  +R+  + L G KYDGKYLH++++  
Sbjct  76   PDENNRPLYAAKDITPFYLEHCPKIFPQKSGLFAPIRNIVQTLIGSKYDGKYLHEVVKEK  135

Query  358  CGDTRLSQTLTHVVIPTFDI  417
              DTRLS T+T+VVIPTFDI
Sbjct  136  LKDTRLSNTITNVVIPTFDI  155



>emb|CDP01332.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG+IPG I+ YLE QLQ LDG DAR+ADYFDVIAGTSTGGL+T+MLAA
Sbjct  19   LITILSIDGGGIRGLIPGVILEYLESQLQELDGEDARLADYFDVIAGTSTGGLITSMLAA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+NKRPL+A KDI PFY E+G KIFP   G   +VR A + + GPKYDG+YLH++++  
Sbjct  79   PDENKRPLFAAKDIKPFYLENGPKIFPQKWGRLASVRSALKAVFGPKYDGRYLHQVVREK  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL +TLT++V+PTFDI
Sbjct  139  LGEIRLHETLTNIVVPTFDI  158



>ref|XP_011099181.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=399

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGG+RGIIP  ++AYLE QLQ LDG D R+ADYFDVIAGTSTGGL+TTML A
Sbjct  20   LITILSIDGGGVRGIIPAVLLAYLESQLQELDGEDVRIADYFDVIAGTSTGGLVTTMLTA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD N RPLYA KDIVPFY EH  KIFP   G F  +    R   GPKYDGKYLH L + +
Sbjct  80   PDTNNRPLYAAKDIVPFYLEHSPKIFPQPRGPFAGLISMMRGFHGPKYDGKYLHSLTREM  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL QTLT+VV+ TFDI
Sbjct  140  LGNTRLHQTLTNVVLTTFDI  159



>ref|XP_004238176.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=405

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+++LE QLQ LDG +AR+ADYFDVIAGTSTGGL+T ML A
Sbjct  16   LITVLSIDGGGIRGIIPATILSFLESQLQELDGKEARLADYFDVIAGTSTGGLVTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPLYA KDI PFY EH  KIFP    G+F  + +  + L GPKYDGKYLH++++ 
Sbjct  76   PDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLIGPKYDGKYLHQVVKE  135

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
               DTRLS T+T+VVIPTFDI
Sbjct  136  KLKDTRLSNTITNVVIPTFDI  156



>ref|XP_002277305.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
Length=407

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGG+RGIIPG I+A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  20   LITILSIDGGGVRGIIPGIILAFLESELQKLDGEDARLADYFDVIAGTSTGGLITAMLTA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPLYA   I PFY E+  KIFP  +GIF T+ +  ++L+GPKYDGKYLH L++N+
Sbjct  80   PNQENRPLYAASGIKPFYLENCPKIFPPRSGIFGTIVNLFKVLTGPKYDGKYLHNLLKNV  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT+VVIPTFDI
Sbjct  140  LGDKRLHQTLTNVVIPTFDI  159



>gb|AAF98368.1|AF158027_1 patatin-like protein 1 [Nicotiana tabacum]
Length=420

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+++LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  22   LITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDVIAGTSTGGLVTAMLTA  81

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPLYA KDI PFY EH  KIFP    G+F  + +  + + GPKYDGKYLH++++ 
Sbjct  82   PDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEVVKE  141

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
               DTRLS T+T+VVIPTFDI
Sbjct  142  KLKDTRLSNTITNVVIPTFDI  162



>emb|CBI19558.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A LE QLQA+DG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  17   LVTILSIDGGGIRGIIPATILALLESQLQAVDGDDARIADYFDVIAGTSTGGLVTAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD  KRPL+A K+I+PFY EHG KIFP   GIF  +    R L GPKYDGKYL ++I+  
Sbjct  77   PDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDGKYLKRIIKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL +TLT VVIPTFDI
Sbjct  137  LGGTRLHETLTSVVIPTFDI  156



>ref|XP_009617797.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=420

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+++LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  22   LITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDVIAGTSTGGLVTAMLTA  81

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPLYA KDI PFY EH  KIFP    G+F  + +  + + GPKYDGKYLH++++ 
Sbjct  82   PDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEVVKE  141

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
               DTRLS T+T+VVIPTFDI
Sbjct  142  KLKDTRLSNTITNVVIPTFDI  162



>emb|CBI21444.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGG+RGIIPG I+A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  20   LITILSIDGGGVRGIIPGIILAFLESELQKLDGEDARLADYFDVIAGTSTGGLITAMLTA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPLYA   I PFY E+  KIFP  +GIF T+ +  ++L+GPKYDGKYLH L++N+
Sbjct  80   PNQENRPLYAASGIKPFYLENCPKIFPPRSGIFGTIVNLFKVLTGPKYDGKYLHNLLKNV  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT+VVIPTFDI
Sbjct  140  LGDKRLHQTLTNVVIPTFDI  159



>ref|XP_009769118.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=386

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP TI+ YLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T ML A
Sbjct  21   LITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLTA  80

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAG-IFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PDK+KRPL+A KDI PFY EHG KIFP    +F ++    + L GPKY+GKYLH++I+  
Sbjct  81   PDKDKRPLFAAKDIKPFYLEHGPKIFPQKKMVFGSIVKTLKSLIGPKYNGKYLHQVIEEK  140

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T L +TLT+VVIPTFDI
Sbjct  141  LGETLLHETLTNVVIPTFDI  160



>ref|XP_009801077.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=403

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+++LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  16   LITVLSIDGGGIRGIIPATILSFLEAQLQELDGNDARLADYFDVIAGTSTGGLVTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPLYA KDI PFY EH  KIFP    G+F  + +  + + GPKYDGKYLH++++ 
Sbjct  76   PDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEVVKE  135

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
               DTRLS T+T+VVIPTFDI
Sbjct  136  KLKDTRLSNTITNVVIPTFDI  156



>ref|XP_009769117.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP TI+ YLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T ML A
Sbjct  21   LITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLTA  80

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAG-IFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PDK+KRPL+A KDI PFY EHG KIFP    +F ++    + L GPKY+GKYLH++I+  
Sbjct  81   PDKDKRPLFAAKDIKPFYLEHGPKIFPQKKMVFGSIVKTLKSLIGPKYNGKYLHQVIEEK  140

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T L +TLT+VVIPTFDI
Sbjct  141  LGETLLHETLTNVVIPTFDI  160



>ref|XP_010320347.1| PREDICTED: patatin-like protein 2 isoform X2 [Solanum lycopersicum]
Length=388

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  I+ YLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T ML A
Sbjct  22   LITILSIDGGGIRGIIPAIILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLTA  81

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI--FETVRDATRLLSGPKYDGKYLHKLIQN  354
            P+K+KRP++A KDI PFY EHG KIFP  G+  F ++    + L GPKY+GKYLH++I+ 
Sbjct  82   PNKDKRPIFAAKDIKPFYLEHGPKIFPQKGMLFFGSIIKTLKSLIGPKYNGKYLHQVIKE  141

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              G+T L +TLT+VVIPTFDI
Sbjct  142  KLGETHLHETLTNVVIPTFDI  162



>ref|XP_009797490.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=412

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 114/142 (80%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP TI+ YLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T ML A
Sbjct  21   LITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLTA  80

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP---SAGIFETVRDATRLLSGPKYDGKYLHKLIQ  351
            P K+KRPL+A KDI PFY EHG KIFP   S  +F +V    + L GPKY+GKYLH++I+
Sbjct  81   PHKDKRPLFAAKDIKPFYLEHGPKIFPQKKSMILFGSVMKTLKSLMGPKYNGKYLHQVIE  140

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
               G+T+L +TLT+VVIPTFDI
Sbjct  141  EKLGETQLHETLTNVVIPTFDI  162



>ref|XP_010320346.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=412

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  I+ YLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T ML A
Sbjct  22   LITILSIDGGGIRGIIPAIILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLTA  81

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI--FETVRDATRLLSGPKYDGKYLHKLIQN  354
            P+K+KRP++A KDI PFY EHG KIFP  G+  F ++    + L GPKY+GKYLH++I+ 
Sbjct  82   PNKDKRPIFAAKDIKPFYLEHGPKIFPQKGMLFFGSIIKTLKSLIGPKYNGKYLHQVIKE  141

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              G+T L +TLT+VVIPTFDI
Sbjct  142  KLGETHLHETLTNVVIPTFDI  162



>ref|XP_004148052.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004169209.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=394

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGPD R+ADYFDVI+GTSTGGL+T+ML AP
Sbjct  12   ITILSIDGGGIRGIIPGTILAFLESKLQELDGPDVRIADYFDVISGTSTGGLVTSMLTAP  71

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIF-ETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            D+N RPLYA KD+  FY EHG KIFP    F  +V D    ++GPKYDGKYL  LI NL 
Sbjct  72   DENNRPLYAAKDLTRFYIEHGPKIFPQRNHFLSSVMDIFGKVTGPKYDGKYLRTLINNLL  131

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GDT L +TLT V+IP FDI
Sbjct  132  GDTTLKETLTQVIIPAFDI  150



>emb|CDP02483.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPG I+AYLE QLQ LDG +AR+ADYFDVIAGTSTGGL+T MLAA
Sbjct  21   LVTILSIDGGGIRGIIPGVILAYLESQLQELDGEEARIADYFDVIAGTSTGGLITAMLAA  80

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++N RPLYA KDIVPFY E+  KIFP   G F  V +A + L GP YDGKY+ +LI++ 
Sbjct  81   PNENHRPLYAAKDIVPFYLENSPKIFPQIGGPFGGVVNAFKTLIGPGYDGKYVQQLIKSN  140

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL QTLT +V+PTFDI
Sbjct  141  LGSTRLHQTLTSIVVPTFDI  160



>ref|XP_002282391.3| PREDICTED: uncharacterized protein LOC100264244 [Vitis vinifera]
Length=1152

 Score =   143 bits (360),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 97/140 (69%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A LE QLQA+DG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  17   LVTILSIDGGGIRGIIPATILALLESQLQAVDGDDARIADYFDVIAGTSTGGLVTAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD  KRPL+A K+I+PFY EHG KIFP + GIF  +    R L GPKYDGKYL ++I+  
Sbjct  77   PDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDGKYLKRIIKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL +TLT VVIPTFDI
Sbjct  137  LGGTRLHETLTSVVIPTFDI  156



>gb|ACU24007.1| unknown [Glycine max]
Length=188

 Score =   134 bits (336),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 112/142 (79%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+ +LE +LQ LDGPDAR+ADYFDVI+GTSTGGL+T M+ A
Sbjct  19   LVTILSIDGGGIRGIIPATIIDFLESRLQELDGPDARLADYFDVISGTSTGGLVTAMITA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETV--RDATRLLSGPKYDGKYLHKLIQ  351
            PD N RPL+A KDI PFY +H  KIFP  +G+  T+  +    LL GPKYDGKYLH +++
Sbjct  79   PDNNNRPLFAAKDIKPFYMDHSPKIFPQHSGLGGTILAKVVKSLLGGPKYDGKYLHGVVR  138

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
               GD RL +TLT+VVIPTFDI
Sbjct  139  EKLGDIRLHETLTNVVIPTFDI  160



>ref|XP_006354912.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=404

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+++LE QLQ LDG DAR+ADYFDV+AGTSTG L+T ML A
Sbjct  16   LITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTSTGSLVTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPLYA KDI PFY EH  KIFP    G+F  + +  + L G KYDGKYLH++++ 
Sbjct  76   PDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLIGSKYDGKYLHEVVKE  135

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
               DTRLS T+T+VVIPTFDI
Sbjct  136  KLKDTRLSNTITNVVIPTFDI  156



>ref|XP_006354907.1| PREDICTED: patatin-2-Kuras 4-like [Solanum tuberosum]
Length=384

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 114/141 (81%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP TI+ YLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T ML A
Sbjct  18   LITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI--FETVRDATRLLSGPKYDGKYLHKLIQN  354
            P+K+KRP++A KDI PFY EHG KIFP  G+  F ++    + L GPKY+GKYLH++I+ 
Sbjct  78   PNKDKRPMFAAKDIKPFYLEHGPKIFPQKGMLFFGSIVKTLKSLIGPKYNGKYLHQVIKE  137

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              G+T + +TLT+VVIPTFDI
Sbjct  138  KLGETYIHETLTNVVIPTFDI  158



>gb|AAF98370.1|AF158254_1 patatin-like protein 2 [Nicotiana tabacum]
Length=207

 Score =   134 bits (336),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            I+T+LSIDGGGIRGIIPGT++A+LE +LQ +DGP+AR+ADYFDV+AGTSTGGL++TML A
Sbjct  6    IVTVLSIDGGGIRGIIPGTLLAFLESKLQDIDGPNARIADYFDVVAGTSTGGLISTMLTA  65

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            P+K+ RPLYA K+I  FY EHG+KIFP +     V+  T L  GPKYDGKYL  L++++ 
Sbjct  66   PNKDNRPLYAAKNITNFYMEHGSKIFPESSRSGFVKRITNLFGGPKYDGKYLKTLVKSIL  125

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G+  + QTLT  VIP FDI
Sbjct  126  GNLTMKQTLTQTVIPAFDI  144



>emb|CBI19549.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDG GIRGIIP TI+A LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  17   LVTILSIDGRGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+  KRPL+A KDI PFY EHG KIFP   GIF  + +  R + GP YDGKYLH LI+  
Sbjct  77   PNDEKRPLFAAKDIKPFYLEHGPKIFPHRRGIFGWIMNIFRSIVGPNYDGKYLHNLIKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL QTLT VVIPTFDI
Sbjct  137  LGRTRLHQTLTSVVIPTFDI  156



>gb|KFK30330.1| hypothetical protein AALP_AA7G247800 [Arabis alpina]
Length=401

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 107/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGGIRGII G ++AYLEKQLQ LDG + R+ADYFDVIAGTSTGGLMT ML  
Sbjct  18   LVTILSLDGGGIRGIIAGVVLAYLEKQLQELDGENVRLADYFDVIAGTSTGGLMTAMLTL  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDA-TRLLSGPKYDGKYLHKLIQNL  357
            PDK  RP +AGKDIVPFY EH  KIFP  G +   +   T+ L GPKYDGKYL  LI  L
Sbjct  78   PDKTGRPTFAGKDIVPFYLEHAPKIFPQPGFWSPWKPKFTKSLYGPKYDGKYLRNLISKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL  TLT+VVIPTFDI
Sbjct  138  TGEARLRDTLTNVVIPTFDI  157



>emb|CAN68798.1| hypothetical protein VITISV_008805 [Vitis vinifera]
Length=400

 Score =   137 bits (346),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  11   LVTILSIDGGGIRGIIPATILALLESQLQXLDGDDARIADYFDVIAGTSTGGLVTAMLTA  70

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD  KRPL+A K+I+PFY EHG KIFP + GIF  +    R L GPKYDGKYL ++ +  
Sbjct  71   PDDQKRPLFAAKEIMPFYLEHGPKIFPZTRGIFGWIMSIVRSLIGPKYDGKYLKRITKEK  130

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL +TLT VVIPTFDI
Sbjct  131  LGGTRLHETLTSVVIPTFDI  150



>ref|XP_002282366.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=411

 Score =   137 bits (346),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  22   LVTILSIDGGGIRGIIPATILALLESQLQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  81

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD  KRPL+A K+I+PFY EHG KIFP + GIF  +    R L GPKYDGKYL ++ +  
Sbjct  82   PDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDGKYLKRITKEK  141

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL +TLT VVIPTFDI
Sbjct  142  LGGTRLHETLTSVVIPTFDI  161



>emb|CBI19553.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  63   LVTILSIDGGGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  122

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+  KRPL+A KDI PFY +HG KIFP   GIF  + +  R + GP YDGKYLH LI+  
Sbjct  123  PNDEKRPLFAAKDIKPFYLKHGPKIFPQRRGIFGWIMNIFRSIVGPNYDGKYLHNLIKEK  182

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL QTLT VVIPTFDI
Sbjct  183  LGRTRLHQTLTSVVIPTFDI  202



>ref|XP_010664934.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  17   LVTILSIDGGGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P+  KRPL+A KDI PFY +HG KIFP    GIF  + +  R + GP YDGKYLH LI+ 
Sbjct  77   PNDEKRPLFAAKDIKPFYLKHGPKIFPQRRWGIFGWIMNIFRSIVGPNYDGKYLHNLIKE  136

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              G TRL QTLT VVIPTFDI
Sbjct  137  KLGRTRLHQTLTSVVIPTFDI  157



>gb|EMS50940.1| Patatin group A-3 [Triticum urartu]
Length=336

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGG+RGIIP  ++A+LEK+LQ LDGPDAR+ADYFDV+AGTSTGGL+T MLAA
Sbjct  15   VVTILSIDGGGVRGIIPAIVLAFLEKELQKLDGPDARIADYFDVVAGTSTGGLLTVMLAA  74

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAG-IFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PDK+ RPL+  KD+  FY +   KIFP  G IF  +  A  L +GPKYDGKYLH L+   
Sbjct  75   PDKDGRPLFDAKDLAQFYIDESPKIFPQKGSIFSKIGSALALATGPKYDGKYLHSLLHRH  134

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GDT+L   LTHVVIP FDI
Sbjct  135  LGDTKLDGALTHVVIPAFDI  154



>emb|CDP04311.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            +TILSIDGGGIRGIIP  I+ +LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T MLAAP
Sbjct  18   VTILSIDGGGIRGIIPSVILGFLESELQKLDGKDARLADYFDVIAGTSTGGLVTAMLAAP  77

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIF-ETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            ++N RPLYA KDI  FY E+  KIFP    F    +   RLLSGPKYDGKYLH L+Q   
Sbjct  78   NENNRPLYAAKDIKDFYLENCPKIFPQESNFLGQAQQELRLLSGPKYDGKYLHNLLQQKV  137

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G T+L QTLT+VVIPTFDI
Sbjct  138  GKTKLHQTLTNVVIPTFDI  156



>ref|XP_002282432.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19556.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A LE +LQ LDG DAR+ADYFDVIAGTSTGG++T ML A
Sbjct  17   LVTILSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTGGIVTAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD  KRPL+A KDI PFY EHG KIFP + GIF  +    R + GPKYDGKYL +LI+  
Sbjct  77   PDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYLKRLIKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL +TLT VVIPTFDI
Sbjct  137  LGGTRLHETLTSVVIPTFDI  156



>ref|XP_010680418.1| PREDICTED: patatin-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=407

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  ++ +LE QLQ LDG +AR+ADYFDVIAGTSTGGL+T ML A
Sbjct  21   LITILSIDGGGIRGIIPAVMLEFLESQLQKLDGEEARLADYFDVIAGTSTGGLITAMLTA  80

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+   RPLYA K+I PFY EH  KIF   +GIF ++    +LLSGPKYDGKYLH L++ L
Sbjct  81   PNDKTRPLYAAKEITPFYLEHCPKIFRQPSGIFGSIGTLMKLLSGPKYDGKYLHNLVKEL  140

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G  RL Q LT+VVIPTFDI
Sbjct  141  LGQRRLHQALTNVVIPTFDI  160



>ref|XP_007160832.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
 gb|ESW32826.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
Length=413

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+ +LE QLQ LDGP+AR+ADYFDVI+GTSTGGL+T ML A
Sbjct  19   LVTILSIDGGGIRGIIPATIIDFLESQLQELDGPEARLADYFDVISGTSTGGLVTAMLTA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFET-VRDATRLLSGPKYDGKYLHKLIQN  354
            PD N RPL+A KDI PFY EHG KIFP  +G+  T + +  R L GPKYDGKYLH++++ 
Sbjct  79   PDNNHRPLFAAKDIKPFYLEHGPKIFPHHSGLGGTIIANLVRSLGGPKYDGKYLHEVVRE  138

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              G+ RL  TLT+VVIPTFDI
Sbjct  139  KLGEIRLHDTLTNVVIPTFDI  159



>emb|CBI19560.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  48   LVTILSIDGGGIRGIIPATILALLESQLQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  107

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD  KRPL+A K+I+PFY EHG KIFP + GIF  +    R L GPKYDGKYL ++ +  
Sbjct  108  PDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDGKYLKRITKEK  167

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL +TLT VVIPTFDI
Sbjct  168  LGGTRLHETLTSVVIPTFDI  187



>ref|XP_010089434.1| Patatin group A-3 [Morus notabilis]
 gb|EXB37800.1| Patatin group A-3 [Morus notabilis]
Length=399

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG I+ +LE  LQ LDG D R+ADYFDVI GTSTGGL+T MLAA
Sbjct  18   VITILSIDGGGIRGIIPGVILNFLESHLQELDGEDVRLADYFDVITGTSTGGLVTAMLAA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD N RPL++ KDIVPFY EHG KIFP + G F +V D  + L GPKY+GKYL KL++  
Sbjct  78   PDANNRPLFSAKDIVPFYIEHGPKIFPQTRGPFASVVDFVKELIGPKYNGKYLRKLVREK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G T L QTLT+VVIPTFD+
Sbjct  138  LGQTGLQQTLTNVVIPTFDL  157



>gb|EMT12540.1| Patatin group A-3 [Aegilops tauschii]
Length=390

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGG+RGIIP T++A+LEK+LQ LDGPDAR+ADYFDV+AGTSTGGL+T MLAA
Sbjct  15   VVTILSIDGGGVRGIIPATVLAFLEKELQKLDGPDARIADYFDVVAGTSTGGLLTVMLAA  74

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAG-IFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PDK+ RPL+  KD+  FY +   KIFP  G IF  +  A  L +GPKYDGKYLH L++  
Sbjct  75   PDKDGRPLFDAKDLAKFYIDESPKIFPQKGSIFSKIGSALALATGPKYDGKYLHSLLRRH  134

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GDT+L   LTHVVIP FDI
Sbjct  135  LGDTKLDGALTHVVIPAFDI  154



>ref|XP_003549405.1| PREDICTED: patatin-3-Kuras 1 [Glycine max]
Length=409

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+ +LE QLQ LDGPDAR+ADYFDVI+GTSTGGL+T M+ A
Sbjct  19   LVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYFDVISGTSTGGLVTAMITA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETV--RDATRLLSGPKYDGKYLHKLIQ  351
            PD N RPL+A KDI PFY +H  KIFP  +G+  T+  +    LL GPKYDGKYLH +++
Sbjct  79   PDNNNRPLFAAKDIKPFYMDHSPKIFPQHSGLGGTILAKVVKSLLGGPKYDGKYLHGVVR  138

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
               GD RL +TLT+VVIPTFDI
Sbjct  139  EKLGDIRLHETLTNVVIPTFDI  160



>ref|XP_002281798.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21445.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGG+RGII G I+A LE +LQ LDG DAR++DYFDVIAGTS+GGL+TTMLAA
Sbjct  19   LITILSIDGGGVRGIISGIILASLESELQKLDGEDARLSDYFDVIAGTSSGGLITTMLAA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIF-PSAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++N RPLYA  +I PF  EH  KIF P +GI  +V +  ++L+GPKYDGKYLH  I  L
Sbjct  79   PNQNNRPLYAASEIKPFLFEHSPKIFPPRSGIIGSVVNFFKILTGPKYDGKYLHSQINKL  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L QTLT+VVIPTFDI
Sbjct  139  LGNTKLDQTLTNVVIPTFDI  158



>ref|XP_010547841.1| PREDICTED: patatin-like protein 2 [Tarenaya hassleriana]
Length=407

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP TI+A+LE ++Q LDG +AR+ADYFDVIAGTSTGGL+T ML A
Sbjct  16   LITILSIDGGGIRGIIPATILAFLEAEIQKLDGEEARLADYFDVIAGTSTGGLVTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K  RPL+AG +I  FY EH  KIFP     F + ++  + LSGPKYDGKYLH+L++  
Sbjct  76   PNKKGRPLFAGNEIKDFYLEHCPKIFPQDHFPFSSAKNLVKTLSGPKYDGKYLHQLVKEK  135

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GDTRL+QTLT+VVIPTFDI
Sbjct  136  LGDTRLNQTLTNVVIPTFDI  155



>ref|XP_006354911.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+++LE QLQ LDG DAR+ADYFDV+AGTSTGGL+T ML A
Sbjct  16   LITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVMAGTSTGGLVTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+N RPLYA KDI PFY E+  KIFP  +G+F  +R+  + L G K DGKYLH++++  
Sbjct  76   PDENNRPLYAAKDITPFYLENCPKIFPQKSGLFTPIRNIVQTLIGSKCDGKYLHEVVKEK  135

Query  358  CGDTRLSQTLTHVVIPTFDI  417
              DTRLS T+T+VVIPTFDI
Sbjct  136  LKDTRLSNTITNVVIPTFDI  155



>gb|KHN04516.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A+LE QLQ LDG DAR+ADYFDVIAGTSTGG++T ML A
Sbjct  19   LVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGGIVTAMLTA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+ N+RPL+A KDI PFY EH  KIFP  +G++ +V    R L GPKY+GKYL ++++  
Sbjct  79   PNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLRSLGGPKYNGKYLQEVVREK  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL +TLT++VIPTFDI
Sbjct  139  VGETRLHETLTNIVIPTFDI  158



>ref|XP_003544452.1| PREDICTED: patatin-3-Kuras 1-like [Glycine max]
 gb|KHN46308.1| Patatin group A-3 [Glycine soja]
Length=408

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+ +LE QLQ LDGP+AR+ADYFDVI+GTSTGGL+T M+ A
Sbjct  19   LVTILSIDGGGIRGIIPATIIGFLESQLQELDGPEARLADYFDVISGTSTGGLVTAMITA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETV-RDATRLLSGPKYDGKYLHKLIQN  354
            PD N RPL+A KDI PFY +H  KIFP  +G+  T+     R L GPKYDGKYLH++++ 
Sbjct  79   PDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKMIRSLGGPKYDGKYLHEVVKE  138

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GD RL +TLT+VVIPTFDI
Sbjct  139  KLGDIRLHETLTNVVIPTFDI  159



>ref|XP_009612649.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=413

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 115/143 (80%), Gaps = 4/143 (3%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG+IPGTI+ +LE QLQALDG DAR+ADYFDVIAGTSTGGL+T MLAA
Sbjct  21   LITILSIDGGGIRGLIPGTILEFLESQLQALDGVDARLADYFDVIAGTSTGGLVTAMLAA  80

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI----FETVRDATRLLSGPKYDGKYLHKLI  348
            P+K+KRPL+A KDI PFY EHG +IFP   +      T+ +  +L +GPKY GKYLHK+I
Sbjct  81   PNKDKRPLFAAKDIKPFYLEHGPRIFPQNTMNWFGIGTITNMWKLATGPKYAGKYLHKVI  140

Query  349  QNLCGDTRLSQTLTHVVIPTFDI  417
            +   G T L +TLT+VVIPTFDI
Sbjct  141  KEKLGGTHLHETLTNVVIPTFDI  163



>gb|KHN12765.1| Patatin group A-3 [Glycine soja]
Length=409

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+ +LE QLQ LDGPDAR+ADYFDVI+GTSTGGL+T M+ A
Sbjct  19   LVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYFDVISGTSTGGLVTAMITA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETV--RDATRLLSGPKYDGKYLHKLIQ  351
            PD N RPL+A KDI PFY +H  KIFP  +G+  T+  +    LL GPKYDGKYLH +++
Sbjct  79   PDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKVVKSLLGGPKYDGKYLHGVVR  138

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
               GD RL +TLT+VVIPTFDI
Sbjct  139  EKLGDIRLHETLTNVVIPTFDI  160



>ref|XP_002282415.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=406

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TI SIDGGGIRGIIP TI+A LE +LQ LDG DAR+ADYFDVIAGTSTGG++T ML A
Sbjct  17   LVTIFSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTGGIVTAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD  KRPL+A KDI PFY EHG KIFP + GIF  +    R + GPKYDGKYL +LI+  
Sbjct  77   PDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYLKRLIKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL +TLT VVIPTFDI
Sbjct  137  LGGTRLHETLTSVVIPTFDI  156



>ref|XP_006354910.1| PREDICTED: LOW QUALITY PROTEIN: patatin group M-3-like [Solanum 
tuberosum]
Length=405

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 2/140 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIP TI+++LE QLQ  DG DAR+A+YFDVIAGTSTGGL+T ML AP
Sbjct  17   ITVLSIDGGGIRGIIPATILSFLESQLQEFDGKDARLAEYFDVIAGTSTGGLVTAMLTAP  76

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            D+N RP YA KDI PFY EH  KIFP    G+F ++R   + L GPKYDGKYLH++I+  
Sbjct  77   DENNRPFYAAKDITPFYLEHCPKIFPQNKCGLFASMRKMVQALIGPKYDGKYLHEVIKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
              D+ LS T+T+VVIPTFDI
Sbjct  137  LKDSLLSNTITNVVIPTFDI  156



>gb|KCW66471.1| hypothetical protein EUGRSUZ_F00268 [Eucalyptus grandis]
Length=390

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            IITILSIDGGGIRGIIP TI+A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  15   IITILSIDGGGIRGIIPATILAFLESELQELDGEDARLADYFDVIAGTSTGGLVTAMLTA  74

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  R L+A KDI  FY EH  KIFP   G++  VR+  + L+GPKYDGKYLH LI+  
Sbjct  75   PNEKNRSLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDGKYLHGLIREK  134

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL  TLTHVVIPTFD+
Sbjct  135  LGEARLHDTLTHVVIPTFDV  154



>ref|XP_002523555.1| Patatin precursor, putative [Ricinus communis]
 gb|EEF38750.1| Patatin precursor, putative [Ricinus communis]
Length=405

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG I+ YLE +LQ LDG DAR+ADYFDVIAGTSTGGL+ TML A
Sbjct  17   LITILSIDGGGIRGIIPGVILDYLESKLQELDGEDARLADYFDVIAGTSTGGLIATMLVA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++ +RPLYA  DIVPFY E+  KIFP + GIF  + D  + L+GPKY+G+YLH LI+++
Sbjct  77   PNEEERPLYAANDIVPFYLENCPKIFPETKGIFACIIDLWKALTGPKYNGRYLHSLIRSI  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
              DT+L QTLT++VIP FDI
Sbjct  137  LKDTKLHQTLTNLVIPAFDI  156



>emb|CDP02475.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            + T+LSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR+ADYFDV+AGTSTGGL+TTML A
Sbjct  32   LATVLSIDGGGIRGIIPGTILAFLEAKLQELDGPNARIADYFDVVAGTSTGGLVTTMLTA  91

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            P+K+ RPLYA KDI  FY ++  +IFP +   + V+  T LL GPKYDGKYLH LI+ L 
Sbjct  92   PNKDSRPLYAAKDITSFYLQNSPQIFPESSRKDVVKSLTNLLGGPKYDGKYLHSLIKRLL  151

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G+  +  TLT VVIPTFDI
Sbjct  152  GNLTMENTLTDVVIPTFDI  170



>gb|KJB40252.1| hypothetical protein B456_007G053800 [Gossypium raimondii]
Length=397

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPG I+A LE +LQ LDG D R+ADYFDV+AGTSTGGL+T MLAA
Sbjct  18   LITVLSIDGGGIRGIIPGVILAALESELQKLDGEDVRLADYFDVMAGTSTGGLITAMLAA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD++ RPL+A KDIVPFY ++G +IFP  +GI       T+ L+GP+YDGKYL+KLI++L
Sbjct  78   PDESGRPLFAAKDIVPFYVKNGPQIFPQPSGILAWASTITKALTGPRYDGKYLYKLIRDL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L QTLT + IPTFDI
Sbjct  138  LGNTKLHQTLTSIAIPTFDI  157



>gb|KDO79282.1| hypothetical protein CISIN_1g015720mg [Citrus sinensis]
Length=402

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG I+AYLE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  17   LITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARLADYFDVIAGTSTGGLLTAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P +  RP+YA KDIVPFY  HG KIFP     +  +V +  R L G KYDGKYLHK+I+ 
Sbjct  77   PSEQNRPMYAAKDIVPFYIRHGPKIFPQLRGMLANSVVNLVRALMGTKYDGKYLHKVIKE  136

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
               DT+L QTLT+V IPTFDI
Sbjct  137  NLKDTKLHQTLTNVAIPTFDI  157



>ref|XP_010548412.1| PREDICTED: patatin-like protein 3 isoform X3 [Tarenaya hassleriana]
Length=350

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPG I+++LE  LQ LDG DAR+ DYFDVI+GTSTGGL+T ML+A
Sbjct  31   LVTILSIDGGGIRGIIPGVILSHLESMLQELDGEDARLVDYFDVISGTSTGGLITAMLSA  90

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P K+ RPL++ KDIVPFY  H  KIFP + GI   V +  R++ GPKY+GKYLHKLI+  
Sbjct  91   PSKDGRPLFSAKDIVPFYVNHSPKIFPQTRGICGWVENVIRVIRGPKYNGKYLHKLIRGF  150

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD +LSQTLT +V+P FDI
Sbjct  151  LGDMKLSQTLTDIVVPCFDI  170



>emb|CBI19557.3| unnamed protein product [Vitis vinifera]
Length=849

 Score =   139 bits (349),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 95/140 (68%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TI SIDGGGIRGIIP TI+A LE +LQ LDG DAR+ADYFDVIAGTSTGG++T ML A
Sbjct  17   LVTIFSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTGGIVTAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD  KRPL+A KDI PFY EHG KIFP + GIF  +    R + GPKYDGKYL +LI+  
Sbjct  77   PDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYLKRLIKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL +TLT VVIPTFDI
Sbjct  137  LGGTRLHETLTSVVIPTFDI  156



>ref|XP_010064191.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=422

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            IITILSIDGGGIRGIIP TI+A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  15   IITILSIDGGGIRGIIPATILAFLESELQELDGEDARLADYFDVIAGTSTGGLVTAMLTA  74

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  R L+A KDI  FY EH  KIFP   G++  VR+  + L+GPKYDGKYLH LI+  
Sbjct  75   PNEKNRSLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDGKYLHGLIREK  134

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL  TLTHVVIPTFD+
Sbjct  135  LGEARLHDTLTHVVIPTFDV  154



>ref|XP_008444643.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=416

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPGTI+ +LE +LQ LDG + R+ADYFDVIAGTSTGGL+T M+AA
Sbjct  16   LITILSIDGGGIRGIIPGTILNFLESELQKLDGKEVRLADYFDVIAGTSTGGLVTAMIAA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            PD+N RPL++ KDI  FY +H  KIFP    +   R   +LLSGPKYDGKYLHKL++   
Sbjct  76   PDQNNRPLFSAKDINQFYLDHCPKIFPQNRTWPLGR-IVKLLSGPKYDGKYLHKLVKEKL  134

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GDT+L QTLT+VVIPTFDI
Sbjct  135  GDTKLHQTLTNVVIPTFDI  153



>gb|KFK30333.1| hypothetical protein AALP_AA7G248300 [Arabis alpina]
Length=411

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G I+AYLEKQLQ LDG D R+ADYFDV+AGTSTGGLMT ML  
Sbjct  18   LVTILSLDGGGVRGIIAGVILAYLEKQLQELDGEDMRLADYFDVVAGTSTGGLMTAMLTV  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+  RP +A KDIVP Y EH  KIFP   G+F  +    +LLSGPKYDGKYL  L+  +
Sbjct  78   PDETGRPQFAAKDIVPVYLEHSPKIFPQPEGLFARLPKLPKLLSGPKYDGKYLKNLLSKV  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L QTLT++VIPTFDI
Sbjct  138  LGETKLHQTLTNIVIPTFDI  157



>ref|XP_002277318.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21443.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGI+GIIPG I+ +LE +LQ LDG DAR+ADYFDV++GTSTGGL+ TML A
Sbjct  13   LITVLSIDGGGIKGIIPGIILDFLESELQKLDGEDARLADYFDVVSGTSTGGLIATMLTA  72

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++N RPLYA   I PFY E+G KIFP  +GI  +V +  +  +GPKYDGKYLH L+++ 
Sbjct  73   PNENNRPLYAASGIKPFYLENGPKIFPQKSGILASVENLFKAFTGPKYDGKYLHSLLKDK  132

Query  358  CGDTRLSQTLTHVVIPTFDI  417
              DTRL QTLT+VVIPTFDI
Sbjct  133  LRDTRLHQTLTNVVIPTFDI  152



>ref|XP_010548401.1| PREDICTED: patatin-like protein 1 [Tarenaya hassleriana]
Length=395

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G I+A LEK+LQ LDG  AR+ADYFDV+AGTSTGGL+T ML A
Sbjct  11   LVTILSLDGGGVRGIIAGVILARLEKELQELDGEGARLADYFDVMAGTSTGGLVTAMLTA  70

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDA-TRLLSGPKYDGKYLHKLIQNL  357
            P++  RPL+A K+IVPFY EH  KIF   G + +V     RLLSGPKYDGKYLH+L++ L
Sbjct  71   PNELGRPLFAAKEIVPFYMEHSPKIFSQPGGWLSVLPMPPRLLSGPKYDGKYLHELLRKL  130

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT++VIPTFDI
Sbjct  131  LGDKRLHQTLTNIVIPTFDI  150



>ref|XP_010094388.1| Patatin group A-3 [Morus notabilis]
 gb|EXB55925.1| Patatin group A-3 [Morus notabilis]
Length=397

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 107/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG ++ YLE QLQ LDG D R+ADYFDVI GTSTGGL+T ML A
Sbjct  13   LITILSIDGGGIRGIIPGVLLEYLESQLQELDGKDVRLADYFDVITGTSTGGLITAMLTA  72

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K+ RPLYA   IVPFY EH  KIFP A G F ++  +     GPKY+GKYLH LI  L
Sbjct  73   PNKDNRPLYAANGIVPFYLEHCPKIFPQASGFFGSILGSIENAVGPKYNGKYLHSLINGL  132

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL +TLT++VIPTFDI
Sbjct  133  LGTTRLHETLTNIVIPTFDI  152



>ref|XP_006354908.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=409

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 111/140 (79%), Gaps = 2/140 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRG+IP TI+ YLE QLQ LDG DAR+ADYFD+IAGTSTGGL+T ML AP
Sbjct  18   ITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAMLTAP  77

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAG--IFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            +K+ RPL+A KDI PFY EHG KIFP     +  ++    R L+GPKYDGKYL ++I+  
Sbjct  78   NKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGWRFLTGPKYDGKYLREVIKEK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L +TLT+VVIPTFDI
Sbjct  138  LGETKLHETLTNVVIPTFDI  157



>ref|XP_008220192.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=417

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 112/142 (79%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            I+T+LSIDGGGIRGIIPGTI+ +LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  23   IVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTT  82

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDA---TRLLSGPKYDGKYLHKLIQ  351
            PD+N RPL+A KDI  FY EH  KIFP    +  + DA    + +SGPKYDGKYLHK+++
Sbjct  83   PDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGDAMDMVKAVSGPKYDGKYLHKIVK  142

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
             + GD RLS TLT+V+IPTFDI
Sbjct  143  EILGDIRLSDTLTNVIIPTFDI  164



>ref|XP_002445640.1| hypothetical protein SORBIDRAFT_07g023220 [Sorghum bicolor]
 gb|EES15135.1| hypothetical protein SORBIDRAFT_07g023220 [Sorghum bicolor]
Length=487

 Score =   135 bits (340),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 89/140 (64%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGGIRGIIP TI+A+LE +LQ LDGPDAR+ADYFDV+AGTSTGGL+T ML A
Sbjct  20   LVTVLSIDGGGIRGIIPATILAFLEAKLQELDGPDARIADYFDVVAGTSTGGLLTAMLTA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD N+RPL+A KD+  FY +H  KIF   +G+   +    R+  GPKYDGKYLH L++  
Sbjct  80   PDANERPLFAAKDLARFYIQHSPKIFRHKSGMRSKLASTLRMACGPKYDGKYLHGLLRRY  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL +TLT+VVIPTFDI
Sbjct  140  LGNTRLDRTLTNVVIPTFDI  159



>ref|XP_009589750.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=427

 Score =   135 bits (339),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 88/139 (63%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            I+T+LSIDGGGIRGIIPGT++A+LE +LQ +DGPDAR+ADYFDV+AGTSTGGL++TML A
Sbjct  31   IVTVLSIDGGGIRGIIPGTLLAFLESKLQDIDGPDARIADYFDVVAGTSTGGLISTMLTA  90

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            P+K+ RPLYA K+I  FY EHG+KIFP +     V+  T L  GPKYDGKYL  L++++ 
Sbjct  91   PNKDNRPLYAAKNITNFYMEHGSKIFPESSRSGFVKRITNLFGGPKYDGKYLKTLVKSIL  150

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G+  + QTLT  VIP FDI
Sbjct  151  GNLTMKQTLTQTVIPAFDI  169



>ref|XP_009781952.1| PREDICTED: patatin-like protein 3 [Nicotiana sylvestris]
Length=411

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LS+DGGGIRGIIPGT++A+LE +LQ LDGP+AR+ADYFDV+AGTSTGGL+TTML A
Sbjct  32   MVTVLSVDGGGIRGIIPGTVLAFLESKLQELDGPNARLADYFDVVAGTSTGGLITTMLTA  91

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            P+K+ RPLY  KDI  FY EHG +IFP +     VR  T L  GPKYDGKYL  +I ++ 
Sbjct  92   PNKDNRPLYQAKDISNFYMEHGPQIFPQSRRNSFVRRVTNLFGGPKYDGKYLRSMINSIL  151

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G+  + QTLT+ +IPTFDI
Sbjct  152  GNLTMKQTLTNTIIPTFDI  170



>ref|XP_004499076.1| PREDICTED: patatin-2-Kuras 3-like isoform X2 [Cicer arietinum]
Length=386

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 110/143 (77%), Gaps = 6/143 (4%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRG+IP TI+ +LE QLQ LDG DAR+ADYFDVI+GTSTGGL+T M+AA
Sbjct  20   LVTILSIDGGGIRGLIPATIIEFLESQLQELDGEDARLADYFDVISGTSTGGLVTAMIAA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS----AGIFETVRDATRLLSGPKYDGKYLHKLI  348
            PDKN RPL+A KDI PFY EH  KIFP      GI   +    R L GPKYDGKYLH +I
Sbjct  80   PDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIM--LAKVVRSLGGPKYDGKYLHDVI  137

Query  349  QNLCGDTRLSQTLTHVVIPTFDI  417
            +   GD RL +T+T++VIPTFDI
Sbjct  138  REKLGDIRLHETITNIVIPTFDI  160



>ref|XP_009419098.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP TI+++LE +LQ LDG DAR+ADYFDVI+GTSTGGL+T ML A
Sbjct  19   LITILSIDGGGIRGIIPATILSFLESELQKLDGEDARIADYFDVISGTSTGGLVTAMLTA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD N RPL+A KDI  FY EH +KIFP   G+   VR   + + GPKY+GKYLH LI+  
Sbjct  79   PDDNNRPLFAAKDIKSFYLEHSSKIFPQIGGLLAGVRRMFQAVWGPKYNGKYLHSLIKEK  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G  RL QTLT+V+IPTFDI
Sbjct  139  LGGVRLHQTLTNVIIPTFDI  158



>ref|XP_010548410.1| PREDICTED: patatin-like protein 3 isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPG I+++LE  LQ LDG DAR+ DYFDVI+GTSTGGL+T ML+A
Sbjct  31   LVTILSIDGGGIRGIIPGVILSHLESMLQELDGEDARLVDYFDVISGTSTGGLITAMLSA  90

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P K+ RPL++ KDIVPFY  H  KIFP + GI   V +  R++ GPKY+GKYLHKLI+  
Sbjct  91   PSKDGRPLFSAKDIVPFYVNHSPKIFPQTRGICGWVENVIRVIRGPKYNGKYLHKLIRGF  150

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD +LSQTLT +V+P FDI
Sbjct  151  LGDMKLSQTLTDIVVPCFDI  170



>ref|XP_009799856.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=403

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 111/138 (80%), Gaps = 3/138 (2%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGG+RGIIPGTI+++LE +LQ LDGP+AR+ADYFD IAGTSTGGL+ TML AP
Sbjct  21   ITVLSIDGGGVRGIIPGTILSFLESKLQELDGPEARLADYFDTIAGTSTGGLIATMLTAP  80

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLCG  363
            D++ RPLYA KDI+PFY EH  KIFP      T+    R+L GPKYDGKYL  LI+ +CG
Sbjct  81   DQDGRPLYAAKDIIPFYLEHSPKIFPQRNEILTL---LRMLCGPKYDGKYLRNLIRGICG  137

Query  364  DTRLSQTLTHVVIPTFDI  417
            + R  +T+TH++IPT+DI
Sbjct  138  NRRFHETITHLLIPTYDI  155



>ref|XP_010269079.1| PREDICTED: patatin-like protein 2 isoform X3 [Nelumbo nucifera]
Length=324

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  I+ +LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  16   LITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVIAGTSTGGLVTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PDK+ RPL+A KDI  FY EH  KIFP   G F + +   R L+GPKY+GKYLH L++  
Sbjct  76   PDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAGPKYNGKYLHGLVKEK  135

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G +RL  TLT+VVIPTFDI
Sbjct  136  LGASRLRDTLTNVVIPTFDI  155



>ref|XP_010548411.1| PREDICTED: patatin-like protein 3 isoform X2 [Tarenaya hassleriana]
Length=406

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPG I+++LE  LQ LDG DAR+ DYFDVI+GTSTGGL+T ML+A
Sbjct  31   LVTILSIDGGGIRGIIPGVILSHLESMLQELDGEDARLVDYFDVISGTSTGGLITAMLSA  90

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P K+ RPL++ KDIVPFY  H  KIFP + GI   V +  R++ GPKY+GKYLHKLI+  
Sbjct  91   PSKDGRPLFSAKDIVPFYVNHSPKIFPQTRGICGWVENVIRVIRGPKYNGKYLHKLIRGF  150

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD +LSQTLT +V+P FDI
Sbjct  151  LGDMKLSQTLTDIVVPCFDI  170



>gb|AAF98369.1|AF158253_1 patatin-like protein 3 [Nicotiana tabacum]
Length=411

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LS+DGGGIRGIIPGT++A+LE +LQ LDGP+AR+ADYFDV+AGTSTGGL+TTML A
Sbjct  32   MVTVLSVDGGGIRGIIPGTVLAFLESKLQELDGPNARLADYFDVVAGTSTGGLITTMLTA  91

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            P+K+ RPLY  KDI  FY EHG +IFP +     VR  T L  GPKYDGKYL  +I ++ 
Sbjct  92   PNKDNRPLYQAKDISNFYMEHGPQIFPQSRRNSFVRRVTNLFGGPKYDGKYLRSIINSIL  151

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G+  + QTLT+ +IPTFDI
Sbjct  152  GNLTMKQTLTNTIIPTFDI  170



>gb|AAK18751.1| patatin-like protein [Vigna unguiculata]
 gb|AAK27797.1| patatin-like protein [Vigna unguiculata]
Length=400

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPG ++A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  15   LITVLSIDGGGIRGIIPGILLAFLESELQKLDGADARLADYFDVIAGTSTGGLVTAMLTA  74

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDAT---RLLSGPKYDGKYLHKLIQ  351
            P++N RPLYA KDI  FY EH  KIFP +  +  +  A    R L GP+YDGKYLHKL++
Sbjct  75   PNENNRPLYAAKDIKDFYLEHTPKIFPQSSSWNLIATAMKKGRSLMGPQYDGKYLHKLVR  134

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
               G+T+L  TLT+VVIP FDI
Sbjct  135  EKLGNTKLEHTLTNVVIPAFDI  156



>ref|XP_004152794.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004160047.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=416

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPGTI+ +LE +LQ LDG + RVADYFDVIAGTSTGGL+T M++A
Sbjct  16   LITILSIDGGGIRGIIPGTILNFLESELQKLDGKEVRVADYFDVIAGTSTGGLVTAMISA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            PD+N RPL++ KDI  FY +H  KIFP   I+   R   +LLSGPKYDGKYL KL++   
Sbjct  76   PDQNNRPLFSAKDINQFYLDHCPKIFPQNRIWPIGR-IVKLLSGPKYDGKYLRKLVKEKL  134

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GDT+L QTLT+VVIPTFDI
Sbjct  135  GDTKLHQTLTNVVIPTFDI  153



>ref|XP_007156813.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
 gb|ESW28807.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
Length=406

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 112/141 (79%), Gaps = 3/141 (2%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIP  ++AYLE QLQ LDG DAR+ADYFDVIAGTSTGGL+  ML AP
Sbjct  18   ITVLSIDGGGIRGIIPSVLLAYLESQLQELDGEDARLADYFDVIAGTSTGGLVAAMLTAP  77

Query  184  D--KNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            +   NK PL+A  +IVPFY ++  +IFP + G+F  +++  + L+GPKYDGKYLH+LI+ 
Sbjct  78   NPNANKHPLFAANEIVPFYLQNSPQIFPQTRGLFGWLKNIVKALTGPKYDGKYLHELIRK  137

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GDT+  QTLT+VVIPTFDI
Sbjct  138  KLGDTKFHQTLTNVVIPTFDI  158



>ref|XP_010041051.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW44683.1| hypothetical protein EUGRSUZ_L01783 [Eucalyptus grandis]
Length=405

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            IITILSIDGGG+RGII  TI+A LE +L+ LDG DAR+ADYFDVI GTSTGGL+T ML A
Sbjct  15   IITILSIDGGGVRGIIAATILASLESELEELDGEDARLADYFDVIGGTSTGGLVTAMLTA  74

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPL+A KDI  FY EH  KIFP   G++  VR+  + L+GPKYDGKYLH LI++ 
Sbjct  75   PNEKNRPLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDGKYLHGLIKDK  134

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL  TLTHV+IPTFDI
Sbjct  135  LGEARLHDTLTHVIIPTFDI  154



>ref|XP_010061769.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW68764.1| hypothetical protein EUGRSUZ_F02363 [Eucalyptus grandis]
Length=395

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 108/142 (76%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPG I+ +LE +LQ LDG DAR+ADYFDVI+GTSTGGL+  MLAA
Sbjct  9    LVTILSIDGGGIRGIIPGIILGFLESELQKLDGEDARIADYFDVISGTSTGGLIAAMLAA  68

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLS---GPKYDGKYLHKLIQ  351
            PDK  RPLY GKDI  FY EH  KIFP       + +A R +    GP+Y GKYLH+LI+
Sbjct  69   PDKKNRPLYGGKDIKAFYLEHSPKIFPQLRCPSIIANAVRTIKAMVGPQYSGKYLHRLIK  128

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
               GDTRL QTLT+V+IPTFD+
Sbjct  129  EKLGDTRLHQTLTNVIIPTFDV  150



>ref|XP_004499075.1| PREDICTED: patatin-2-Kuras 3-like isoform X1 [Cicer arietinum]
Length=418

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 110/143 (77%), Gaps = 6/143 (4%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRG+IP TI+ +LE QLQ LDG DAR+ADYFDVI+GTSTGGL+T M+AA
Sbjct  20   LVTILSIDGGGIRGLIPATIIEFLESQLQELDGEDARLADYFDVISGTSTGGLVTAMIAA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS----AGIFETVRDATRLLSGPKYDGKYLHKLI  348
            PDKN RPL+A KDI PFY EH  KIFP      GI   +    R L GPKYDGKYLH +I
Sbjct  80   PDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIM--LAKVVRSLGGPKYDGKYLHDVI  137

Query  349  QNLCGDTRLSQTLTHVVIPTFDI  417
            +   GD RL +T+T++VIPTFDI
Sbjct  138  REKLGDIRLHETITNIVIPTFDI  160



>ref|XP_010942708.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=411

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGG+RGIIPGTI+A+LE +LQ LDG DAR+ DYFDVIAGTSTGGL+T ML A
Sbjct  18   LVTVLSIDGGGVRGIIPGTILAFLESKLQELDGEDARIVDYFDVIAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+KN RPL+A KDI  FY E+ +KIFP   GIF ++ +    ++GPKY GKYLH  IQ L
Sbjct  78   PNKNNRPLFAAKDITKFYLENSSKIFPQKNGIFSSIFNLFTAVTGPKYSGKYLHSKIQEL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL Q LT +VIPTFDI
Sbjct  138  LGETRLHQVLTDIVIPTFDI  157



>ref|XP_008457871.1| PREDICTED: patatin-like protein 3 [Cucumis melo]
Length=394

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGPD R+ADYFDVI GTSTGGL+T+ML AP
Sbjct  12   ITILSIDGGGIRGIIPGTILAFLESKLQELDGPDVRIADYFDVITGTSTGGLVTSMLTAP  71

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIF-ETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            DKN RPLYA KD+  FY EH  KIFP    F  +V ++   + GP+YDGKYL  LI NL 
Sbjct  72   DKNNRPLYAAKDLTRFYVEHAPKIFPQRNHFLSSVMNSLGKVMGPRYDGKYLRTLINNLL  131

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GD  L +TLT V+IP FDI
Sbjct  132  GDITLKETLTQVIIPAFDI  150



>ref|XP_003527713.1| PREDICTED: patatin-like [Glycine max]
 gb|KHN22305.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A+LE QLQ LDG DAR+ADYFDVIAGTSTGG++T ML+A
Sbjct  19   LVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGGIVTAMLSA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+ N+RPL+A KDI PFY EH  KIFP  +G++ +V      L GPKYDGKYL ++++  
Sbjct  79   PNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLGSLGGPKYDGKYLKEVVREK  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL +TLT++VIPTFDI
Sbjct  139  LGQTRLHETLTNIVIPTFDI  158



>ref|XP_009380972.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGG+RG+IP T++A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  18   LVTVLSIDGGGVRGLIPATLLAFLESKLQELDGADARIADYFDVIAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP--SAGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PDK+KRPL+  K I+ FY ++  KIFP   AG+   + +    ++GPKYDGKYLH  +Q 
Sbjct  78   PDKDKRPLFTAKQIIQFYLDNCPKIFPRKKAGLLNPLLNLFGAVTGPKYDGKYLHSKVQQ  137

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
            L GDT+LSQTLT+VVIPTFDI
Sbjct  138  LLGDTKLSQTLTNVVIPTFDI  158



>ref|XP_010269072.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=345

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  I+ +LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  16   LITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVIAGTSTGGLVTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PDK+ RPL+A KDI  FY EH  KIFP   G F + +   R L+GPKY+GKYLH L++  
Sbjct  76   PDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAGPKYNGKYLHGLVKEK  135

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G +RL  TLT+VVIPTFDI
Sbjct  136  LGASRLRDTLTNVVIPTFDI  155



>ref|XP_009366946.1| PREDICTED: patatin-like protein 1 isoform X2 [Pyrus x bretschneideri]
Length=368

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +1

Query  91   LDGPDARVADYFDVIAgtstgglmttmlAAPDKNKRPLYAGKDIVPFYKEHGAKIFP-SA  267
            LDG DAR+ADYFDVI+GTSTGGL+ TML AP++N RPL+A KDIVPFY  +  KIFP S+
Sbjct  32   LDGEDARLADYFDVISGTSTGGLIATMLVAPNENNRPLFAAKDIVPFYHSNCPKIFPQSS  91

Query  268  GIFETVRDATRLLSGPKYDGKYLHKLIQNLCGDTRLSQTLTHVVIPTFDI  417
            G+  TV+D  + L+GPKYDGKYLHKL++ + GD RL QTLT++V+PTFDI
Sbjct  92   GLCATVKDLVKALTGPKYDGKYLHKLVREIIGDKRLDQTLTNLVVPTFDI  141



>sp|Q6ZJD3.1|PLP2_ORYSJ RecName: Full=Patatin-like protein 2; Short=OsPLP2 [Oryza sativa 
Japonica Group]
 sp|A2YW91.1|PLP2_ORYSI RecName: Full=Patatin-like protein 2 [Oryza sativa Indica Group]
 dbj|BAD08998.1| putative patatin [Oryza sativa Japonica Group]
 gb|EAZ07352.1| hypothetical protein OsI_29602 [Oryza sativa Indica Group]
 gb|EAZ43081.1| hypothetical protein OsJ_27671 [Oryza sativa Japonica Group]
Length=405

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGG+RGIIP TI+A+LEK+LQ LDGPDAR+ADYFDV+AGTSTGGL+T ML A
Sbjct  20   MVTVLSIDGGGVRGIIPATILAFLEKELQKLDGPDARIADYFDVVAGTSTGGLLTAMLTA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAG-IFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++N RPL+A  ++  FY EH   IFP    +   +    R++SGPKYDGKYLH L++  
Sbjct  80   PNENNRPLFAADELAKFYIEHSPSIFPQKNWVLSKIAGTLRMVSGPKYDGKYLHSLLREK  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GDTRL + LT+VVIPTFDI
Sbjct  140  LGDTRLDKALTNVVIPTFDI  159



>ref|XP_010269056.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010269064.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=408

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  I+ +LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  16   LITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVIAGTSTGGLVTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PDK+ RPL+A KDI  FY EH  KIFP   G F + +   R L+GPKY+GKYLH L++  
Sbjct  76   PDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAGPKYNGKYLHGLVKEK  135

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G +RL  TLT+VVIPTFDI
Sbjct  136  LGASRLRDTLTNVVIPTFDI  155



>ref|XP_006285520.1| hypothetical protein CARUB_v10006962mg [Capsella rubella]
 gb|EOA18418.1| hypothetical protein CARUB_v10006962mg [Capsella rubella]
Length=414

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G ++AYLEKQLQ LDG DAR+ADYFDVIAGTSTGGL+T ML  
Sbjct  18   LVTILSLDGGGVRGIIAGVVLAYLEKQLQELDGEDARLADYFDVIAGTSTGGLVTAMLTV  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD   RP +A KDIVPFY EH  KIFP  +G+F  +    +LLSGPKY GKYL  L+  L
Sbjct  78   PDGTGRPYFAAKDIVPFYLEHCPKIFPQPSGVFALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ +L QTLT+VVIPTFDI
Sbjct  138  LGEAKLHQTLTNVVIPTFDI  157



>ref|XP_004169210.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=258

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 107/141 (76%), Gaps = 5/141 (4%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGPDARVADYFDVIAGTSTGGL+T+ML AP
Sbjct  14   ITILSIDGGGIRGIIPGTILAFLESKLQELDGPDARVADYFDVIAGTSTGGLVTSMLTAP  73

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLS---GPKYDGKYLHKLIQN  354
            ++N RPLYA KD+  FY EHG KIFP    F  +  A  +     GPKYDGKYL  LI  
Sbjct  74   NENNRPLYAAKDLTRFYIEHGPKIFPQRNHF--LSSAVNMFGKVMGPKYDGKYLRSLINR  131

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
            L GD  L +TLT V+IP FDI
Sbjct  132  LLGDITLKETLTQVIIPAFDI  152



>ref|XP_010238242.1| PREDICTED: patatin-like protein 2 isoform X2 [Brachypodium distachyon]
Length=399

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 107/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGII    +A+LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T ML A
Sbjct  18   LITVLSIDGGGIRGIIAAVALAFLETELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K++RPL+A KDI  FY +H  KIFP   G F  +    R LSGP YDGKYLH++++  
Sbjct  78   PNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDGKYLHEVVRKK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G  RL QTLT+VVIPTFDI
Sbjct  138  LGSIRLHQTLTNVVIPTFDI  157



>ref|XP_009613240.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=403

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 109/138 (79%), Gaps = 3/138 (2%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGG+RGIIPGTI+++LE +LQ LDGP+AR+ADYFD IAGTSTGGLM TML AP
Sbjct  21   ITVLSIDGGGVRGIIPGTILSFLELKLQELDGPEARLADYFDTIAGTSTGGLMATMLTAP  80

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLCG  363
            D++ RPLYA KDIVPFY EH   IFP       +    R+L GPKYDGKYL  LI+ LCG
Sbjct  81   DQHGRPLYAAKDIVPFYLEHSPNIFPQR---NEILSLLRMLCGPKYDGKYLRNLIRGLCG  137

Query  364  DTRLSQTLTHVVIPTFDI  417
            + R  +T+TH++IPT+DI
Sbjct  138  NRRFQETITHLLIPTYDI  155



>ref|XP_003611771.1| Patatin-like protein [Medicago truncatula]
 gb|AES94729.1| patatin-like phospholipase [Medicago truncatula]
Length=399

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 118/140 (84%), Gaps = 2/140 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGG+RGIIPG I+AYLE QLQ +DG DAR+ADYFDVIAGTSTGGL+TTMLAAP
Sbjct  16   ITVLSIDGGGVRGIIPGVILAYLESQLQEIDGEDARIADYFDVIAGTSTGGLITTMLAAP  75

Query  184  D-KNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            + K+ RPL+A K+IVPFY ++   IFP  +GIF  + + T+ L+G KY+G+YLHKLI+N+
Sbjct  76   NPKDNRPLFAAKEIVPFYLQNLPSIFPQKSGIFAPLINITKALTGAKYNGEYLHKLIRNM  135

Query  358  CGDTRLSQTLTHVVIPTFDI  417
              DT LSQTLT++VIP+FD+
Sbjct  136  TKDTLLSQTLTNIVIPSFDV  155



>ref|XP_011038245.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 112/140 (80%), Gaps = 2/140 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIPGTI+A+LE +LQ LDGPDAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  20   ITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGGLVTAMLAAP  79

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFP--SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            +K  RPL+A KDI  FY E+  KIFP  S+  F +  +  + L GPKYDGK+LH +++  
Sbjct  80   NKQNRPLFAAKDINDFYLENCPKIFPQDSSSKFASAANLVKTLRGPKYDGKFLHSIVKEK  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GDT L QTLT++VIPTFDI
Sbjct  140  LGDTWLQQTLTNIVIPTFDI  159



>ref|XP_007226924.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
 gb|EMJ28123.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
Length=410

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            I+T+LSIDGGGIRGIIPGTI+ +LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  16   IVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTT  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETV---RDATRLLSGPKYDGKYLHKLIQ  351
            PD+N RPL+A KDI  FY EH  KIFP    +  +    D  + +SGPKYDGKYLHK+++
Sbjct  76   PDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGEAMDMVKAVSGPKYDGKYLHKIVK  135

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
             + GD RLS TLT+V+IPTFDI
Sbjct  136  EILGDIRLSDTLTNVIIPTFDI  157



>ref|XP_011038243.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 112/140 (80%), Gaps = 2/140 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIPGTI+A+LE +LQ LDGPDAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  20   ITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGGLVTAMLAAP  79

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFP--SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            +K  RPL+A KDI  FY E+  KIFP  S+  F +  +  + L GPKYDGK+LH +++  
Sbjct  80   NKQNRPLFAAKDINEFYLENCPKIFPQDSSSKFASAANLVKTLRGPKYDGKFLHGIVKEK  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GDT L QTLT++VIPTFDI
Sbjct  140  LGDTWLQQTLTNIVIPTFDI  159



>ref|XP_003576611.1| PREDICTED: patatin-like protein 2 isoform X1 [Brachypodium distachyon]
Length=404

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 107/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGII    +A+LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T ML A
Sbjct  18   LITVLSIDGGGIRGIIAAVALAFLETELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K++RPL+A KDI  FY +H  KIFP   G F  +    R LSGP YDGKYLH++++  
Sbjct  78   PNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDGKYLHEVVRKK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G  RL QTLT+VVIPTFDI
Sbjct  138  LGSIRLHQTLTNVVIPTFDI  157



>ref|XP_007227189.1| hypothetical protein PRUPE_ppa019532mg [Prunus persica]
 gb|EMJ28388.1| hypothetical protein PRUPE_ppa019532mg [Prunus persica]
Length=410

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            I+T+LSIDGGGIRGIIPGTI+ +LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  16   IVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTT  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETV---RDATRLLSGPKYDGKYLHKLIQ  351
            PD+N RPL+A KDI  FY EH  KIFP    +  +    D  + +SGPKYDGKYLHK+++
Sbjct  76   PDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGEAMDMVKAVSGPKYDGKYLHKIVK  135

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
             + GD RLS TLT+V+IPTFDI
Sbjct  136  EILGDIRLSDTLTNVIIPTFDI  157



>ref|XP_007047215.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
 gb|EOX91372.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
Length=401

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGG+RGIIPG I+A LE +LQ +DG DAR+ADYFDVIAGTSTGGL+TTM+AA
Sbjct  18   LITILSIDGGGVRGIIPGVILAKLESELQNIDGEDARLADYFDVIAGTSTGGLITTMVAA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++N RPLYA KDIVPFY E+  KIFP  +G+        + L+GP+YDGKYL KLI+ +
Sbjct  78   PNENDRPLYAAKDIVPFYLENSPKIFPQMSGVLGWAAKLLKALTGPRYDGKYLRKLIRGI  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G T+L QTLT V IPTFDI
Sbjct  138  LGTTKLHQTLTSVAIPTFDI  157



>ref|XP_010525997.1| PREDICTED: patatin-like protein 2 [Tarenaya hassleriana]
Length=406

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T ML A
Sbjct  16   LITVLSIDGGGIRGIIPATILSFLESELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K  RPL+A  +I  FY EH  KIFP     F   ++  + L+GPKYDGKYLHKL+   
Sbjct  76   PNKQGRPLFAASEIKDFYLEHCPKIFPQEHFPFSAAKNLVKTLTGPKYDGKYLHKLVMEK  135

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GDTRL+QTLT+VVIPTFDI
Sbjct  136  LGDTRLNQTLTNVVIPTFDI  155



>ref|XP_003611772.1| Patatin-like protein [Medicago truncatula]
 gb|AES94730.1| patatin-like phospholipase [Medicago truncatula]
Length=396

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 116/141 (82%), Gaps = 3/141 (2%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGG+RGIIPG I+AYLE QLQ +DG DAR+ADYFDVIAGTSTGGL+TTMLA P
Sbjct  10   ITVLSIDGGGVRGIIPGVILAYLESQLQEIDGEDARIADYFDVIAGTSTGGLITTMLATP  69

Query  184  DK--NKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            ++  N RPL+A K+IVPFY ++   IFP  +GIF  +   T+ L+G KY+G+YLHKLI+N
Sbjct  70   NRKANNRPLFAAKEIVPFYLQNLPNIFPQQSGIFAPLISTTKALTGSKYNGEYLHKLIRN  129

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
            +  DT LSQTLT+VVIP+FD+
Sbjct  130  MTQDTLLSQTLTNVVIPSFDV  150



>ref|XP_004973690.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Setaria italica]
Length=412

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A+LE +LQ LDGPDAR+ADYFDV+AGTSTGGL+T ML A
Sbjct  20   LVTILSIDGGGIRGIIPATILAFLEAKLQELDGPDARIADYFDVVAGTSTGGLLTAMLTA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAG-IFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD N RPL+A KD+  FY +H  KIF     I   +    R+LSGPKYDGKYLH L++  
Sbjct  80   PDTNGRPLFAAKDLARFYIKHSPKIFRQKNHIRSKIASKLRMLSGPKYDGKYLHALLRRY  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL +TLT++VIPTFDI
Sbjct  140  LGDMRLDRTLTNIVIPTFDI  159



>ref|XP_008457873.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=392

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGPDAR+ADYFDVIAGTSTGGL+T+ML AP
Sbjct  11   ITILSIDGGGIRGIIPGTILAFLESKLQELDGPDARIADYFDVIAGTSTGGLVTSMLTAP  70

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIF-ETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            ++N RPLYA KD+  FY EHG KIFP    F  ++ +    + GPKYDGKYL  LI  L 
Sbjct  71   NENNRPLYAAKDLTRFYIEHGPKIFPQRNHFLSSMVNMFGKVMGPKYDGKYLRSLINRLL  130

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GD  L QTLT V+IP FDI
Sbjct  131  GDITLKQTLTEVIIPAFDI  149



>ref|XP_003589238.1| Patatin-like protein [Medicago truncatula]
 gb|AES59489.1| patatin-like phospholipase [Medicago truncatula]
Length=415

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRG+IP  I+ +LE  LQ LDG DAR+ADYFDVI+GTSTGGL+T MLAA
Sbjct  20   LVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGGLVTAMLAA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFET-VRDATRLLSGPKYDGKYLHKLIQN  354
            PDKN RPL+A KDI PFY EH  KIFP   G+  T +    R L GPKYDGKYLH++++ 
Sbjct  80   PDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRSLGGPKYDGKYLHQVVRE  139

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GD RL +TLT++V+PTFDI
Sbjct  140  KLGDIRLHETLTNIVVPTFDI  160



>ref|XP_003589236.1| Patatin-like protein [Medicago truncatula]
 gb|AES59487.1| patatin-like phospholipase [Medicago truncatula]
Length=417

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRG+IP  I+ +LE  LQ LDG DAR+ADYFDVI+GTSTGGL+T MLAA
Sbjct  20   LVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGGLVTAMLAA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFET-VRDATRLLSGPKYDGKYLHKLIQN  354
            PDKN RPL+A KDI PFY EH  KIFP   G+  T +    R L GPKYDGKYLH++++ 
Sbjct  80   PDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRSLGGPKYDGKYLHQVVRE  139

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GD RL +TLT++V+PTFDI
Sbjct  140  KLGDIRLHETLTNIVVPTFDI  160



>ref|XP_006425859.1| hypothetical protein CICLE_v10027498mg [Citrus clementina]
 gb|ESR39099.1| hypothetical protein CICLE_v10027498mg [Citrus clementina]
Length=385

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG I+AYLE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  17   LITILSIDGGGIRGIIPGVILAYLESQLQELDGQDARLADYFDVIAGTSTGGLITAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P +  RP+ A KDIVPFY  HG +IFP     +  +V +  R L G KYDGKYLHK+I+ 
Sbjct  77   PKEQNRPMSAAKDIVPFYIRHGPQIFPQLRGMLANSVVNRVRALMGSKYDGKYLHKVIKE  136

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
               DT+L QTLT+VVIPTFDI
Sbjct  137  NLKDTKLHQTLTNVVIPTFDI  157



>ref|XP_002282440.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19555.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 105/140 (75%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A LE  LQ LDG DAR+ADYFDVIAGTSTGGL+  ML A
Sbjct  17   LVTILSIDGGGIRGIIPATILACLESHLQELDGDDARIADYFDVIAGTSTGGLVAAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD  KRPL+A KDI PFY EHG KIFP   GIF  +    R + GPKYDGKYL  LI+  
Sbjct  77   PDDQKRPLFAAKDIRPFYLEHGPKIFPQIRGIFGWIMSILRSIVGPKYDGKYLKSLIKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G T L +TLT VVIPTFDI
Sbjct  137  LGGTWLHETLTSVVIPTFDI  156



>gb|KDP38383.1| hypothetical protein JCGZ_04308 [Jatropha curcas]
Length=412

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPGTI+++LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T MLAA
Sbjct  17   LITVLSIDGGGIRGIIPGTILSFLESQLQKLDGEDARIADYFDVIAGTSTGGLVTAMLAA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP--SAGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P++  RP++A KDI  FY     KIFP  S  +F       + +SGPKYDGKYLH+L++ 
Sbjct  77   PNEKNRPVFAAKDIKDFYLNECPKIFPQRSCALFPQTTKVIKAISGPKYDGKYLHRLVKE  136

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              G+TRL+QTLT+VVIPTFDI
Sbjct  137  KLGNTRLNQTLTNVVIPTFDI  157



>emb|CAN71271.1| hypothetical protein VITISV_001907 [Vitis vinifera]
Length=446

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 105/140 (75%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A LE  LQ LDG DAR+ADYFDVIAGTSTGGL+  ML A
Sbjct  17   LVTILSIDGGGIRGIIPATILACLESHLQELDGDDARIADYFDVIAGTSTGGLVAAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD  KRPL+A KDI PFY EHG KIFP   GIF  +    R + GPKYDGKYL  LI+  
Sbjct  77   PDDQKRPLFAAKDIRPFYLEHGPKIFPQIRGIFGWIMSILRSIVGPKYDGKYLKSLIKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G T L +TLT VVIPTFDI
Sbjct  137  LGGTWLHETLTSVVIPTFDI  156



>gb|ACN25198.1| unknown [Zea mays]
 gb|AFW60363.1| patatin T5 [Zea mays]
Length=410

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG+IP TI+AYLE +LQ LDGPDAR+ADYFDVIAGTSTG L+ +MLAA
Sbjct  24   LITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALLASMLAA  83

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPL+A KD+  FY E+G KIFP   AG+   +R+   L+ GPKYDG +LH  I++
Sbjct  84   PDENNRPLFAAKDLTTFYLENGPKIFPQKKAGLLTPLRNLLGLVRGPKYDGVFLHDKIKS  143

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
            L  D R++ T+T+V++P FD+
Sbjct  144  LTHDVRVADTVTNVIVPAFDV  164



>ref|XP_006425860.1| hypothetical protein CICLE_v10027314mg [Citrus clementina]
 gb|ESR39100.1| hypothetical protein CICLE_v10027314mg [Citrus clementina]
Length=386

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG I+A LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  17   LITILSIDGGGIRGIIPGVILACLESQLQELDGQDARLADYFDVIAGTSTGGLITAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIF-ETVRDATRLLSGPKYDGKYLHKLIQN  354
            P +  RP+YA KDIVPFY  HG KIFP   GI   +V +  R L G KYDGKYLHK+I+ 
Sbjct  77   PSEQNRPMYAAKDIVPFYIRHGPKIFPQLRGILANSVVNLVRALMGTKYDGKYLHKVIKE  136

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
               DT+L QTLT+V IPTFDI
Sbjct  137  NLKDTKLHQTLTNVAIPTFDI  157



>ref|NP_001151190.1| LOC100284823 [Zea mays]
 gb|ACG41923.1| patatin T5 precursor [Zea mays]
Length=410

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG+IP TI+AYLE +LQ LDGPDAR+ADYFDVIAGTSTG L+ +MLAA
Sbjct  24   LITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALLASMLAA  83

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPL+A KD+  FY E+G KIFP   AG+   +R+   L+ GPKYDG +LH  I++
Sbjct  84   PDENNRPLFAAKDLTTFYLENGPKIFPQKKAGLLTPLRNLLGLVRGPKYDGVFLHDKIKS  143

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
            L  D R++ T+T+V++P FD+
Sbjct  144  LTHDVRVADTVTNVIVPAFDV  164



>gb|ACG31156.1| patatin T5 precursor [Zea mays]
Length=410

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG+IP TI+AYLE +LQ LDGPDAR+ADYFDVIAGTSTG L+ +MLAA
Sbjct  24   LITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALLASMLAA  83

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPL+A KD+  FY E+G KIFP   AG+   +R+   L+ GPKYDG +LH  I++
Sbjct  84   PDENNRPLFAAKDLTTFYLENGPKIFPQKKAGLLTPLRNLLGLVRGPKYDGVFLHDKIKS  143

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
            L  D R++ T+T+V++P FD+
Sbjct  144  LTHDVRVADTVTNVIVPAFDV  164



>ref|XP_006354909.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=408

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 110/140 (79%), Gaps = 2/140 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRG+IP TI+ YLE QLQ LDG DAR+ADYFD+I GTSTGGL+T ML AP
Sbjct  18   ITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDIITGTSTGGLVTAMLTAP  77

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAG--IFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            +K+ RPL+A KDI PFY EHG KIFP     +  ++      L+GPKY+GKYLH++I+  
Sbjct  78   NKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGWTFLTGPKYNGKYLHQVIKEK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L +TLT+VVIPTFDI
Sbjct  138  LGETKLHETLTNVVIPTFDI  157



>ref|XP_006466737.1| PREDICTED: patatin-14-like [Citrus sinensis]
Length=402

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG I+AYLE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  17   LITILSIDGGGIRGIIPGVILAYLESQLQELDGQDARLADYFDVIAGTSTGGLITAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P +  RP+ A KDIVPFY  HG +IFP     +  +V +  R L G KYDGKYLHK+I+ 
Sbjct  77   PKEQNRPMSAAKDIVPFYIRHGPQIFPQLRGMLANSVVNRVRALMGSKYDGKYLHKVIKE  136

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
               DT+L QTLT+VVIPTFDI
Sbjct  137  NLKDTKLHQTLTNVVIPTFDI  157



>ref|XP_009383171.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009383172.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=409

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGI+GIIP TI+A+LE +LQ LDG DAR+ADYFD +AGTSTGGL+T ML A
Sbjct  18   LITILSIDGGGIKGIIPATILAFLESELQKLDGEDARLADYFDAMAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+   RPLYA KDI  FY  H  KIFP S+  F T     R + GP+YDGKYLH+LI+  
Sbjct  78   PNMQNRPLYAAKDIKEFYLNHSPKIFPQSSWPFNTAAKVIRAIIGPRYDGKYLHELIRRN  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL QTLT+VVIPTFDI
Sbjct  138  LGETRLHQTLTNVVIPTFDI  157



>ref|XP_006354914.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGIIP TI+++LE QLQ LDG DA +ADYFDVIAGTSTGGL+T ML +P
Sbjct  17   ITILSIDGGGIRGIIPATILSFLELQLQELDGKDATLADYFDVIAGTSTGGLVTAMLTSP  76

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            D+N RPLYA KDI PFY EH  KIFP    G+F  +    + L GPKYDGKYLHK+++  
Sbjct  77   DENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALIGPKYDGKYLHKVVKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
              DT +S T+T+VVIPTFDI
Sbjct  137  LKDTCISNTITNVVIPTFDI  156



>ref|XP_010437270.1| PREDICTED: patatin-like protein 1 isoform X2 [Camelina sativa]
Length=384

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RG+I G I+AYLEKQLQ LDG DAR+ADYFDVIAGTSTGGL+T ML  
Sbjct  19   LVTILSLDGGGVRGVIAGVILAYLEKQLQELDGEDARLADYFDVIAGTSTGGLVTAMLTV  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+  RP +A KDIVPFY EH  KIFP  AG+   +    +LLSGPKY GKYL  L+  L
Sbjct  79   PDETGRPHFAAKDIVPFYLEHCPKIFPQPAGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L QTLT+VVIPT+DI
Sbjct  139  LGETKLHQTLTNVVIPTYDI  158



>ref|XP_008339929.1| PREDICTED: patatin-like protein 1 isoform X2 [Malus domestica]
Length=368

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +1

Query  91   LDGPDARVADYFDVIAgtstgglmttmlAAPDKNKRPLYAGKDIVPFYKEHGAKIFP-SA  267
            LDG DAR+ADYFDVI+GTSTGGL+ TML AP++N RPL+A KDIVPFY  +  KIFP S+
Sbjct  32   LDGEDARLADYFDVISGTSTGGLIATMLVAPNENNRPLFAAKDIVPFYLSNCPKIFPRSS  91

Query  268  GIFETVRDATRLLSGPKYDGKYLHKLIQNLCGDTRLSQTLTHVVIPTFDI  417
            G+  TV D  + L+GPKYDGKYLHKL++ + GD RL QTLT++V+PTFDI
Sbjct  92   GLCATVNDLVKALTGPKYDGKYLHKLVREIIGDKRLDQTLTNLVVPTFDI  141



>ref|XP_003538815.1| PREDICTED: patatin group D-2-like [Glycine max]
Length=403

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 113/143 (79%), Gaps = 4/143 (3%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPG I+ YLE QLQ LDG DAR+ADYFDVIAGTSTGGL+ +MLAA
Sbjct  17   LITVLSIDGGGIRGIIPGVILDYLESQLQELDGEDARLADYFDVIAGTSTGGLVASMLAA  76

Query  181  PD--KNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLI  348
            P+   N RPL+A  +IVPFY E+  +IFP    GIF  + +  + L+GPKYDGK+ H+LI
Sbjct  77   PNPKANNRPLFAANEIVPFYLENSPQIFPQKRGGIFAPLVNIGKALTGPKYDGKHFHELI  136

Query  349  QNLCGDTRLSQTLTHVVIPTFDI  417
            +N  G T+L QTLT+VVIPTFD+
Sbjct  137  RNKLGGTKLHQTLTNVVIPTFDV  159



>emb|CDP07844.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  I+ +LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  19   LITILSIDGGGIRGIIPAAILDFLESQLQELDGEDARIADYFDVIAGTSTGGLITAMLTA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPLYA K+I PFY  +G KIFP  +GI   ++     + GP YDGKYLHK+++  
Sbjct  79   PNEKNRPLYAAKEIKPFYLGNGPKIFPQKSGILGLIKPVQNFIPGPLYDGKYLHKILKEK  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL QTLT+VVIPTFD+
Sbjct  139  LGQTRLRQTLTNVVIPTFDV  158



>gb|KJB58441.1| hypothetical protein B456_009G210000 [Gossypium raimondii]
Length=412

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPGTI+A+LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T ML +
Sbjct  16   LITILSIDGGGIRGIIPGTILAFLESELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTS  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAG--IFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P++  RPL+A KDI  FY ++  KIFP  G  +F     A + LSGPKYDGK+LH L++ 
Sbjct  76   PNEKNRPLFAAKDIKDFYLQNSPKIFPQPGSQLFPQTTKAIKALSGPKYDGKFLHSLVKQ  135

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GDTRL QTLT+VVIPTFDI
Sbjct  136  KLGDTRLHQTLTNVVIPTFDI  156



>gb|AEF30538.1| patatin-like phospholipase 1 [Capsicum annuum]
Length=413

 Score =   132 bits (332),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGGIRGIIPGT++A+LE +LQ LDGP+ARVADYFDV+AGTSTGGL+TTML A
Sbjct  34   MVTVLSIDGGGIRGIIPGTLLAFLESKLQELDGPNARVADYFDVVAGTSTGGLVTTMLTA  93

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            P+K+ RPLY  K+I  FY +HG +IFP +     +R  T L  GPKYDGKYL  +I ++ 
Sbjct  94   PNKDNRPLYQAKEISSFYMQHGPQIFPQSRRNSFLRRVTNLFGGPKYDGKYLRTIITSIL  153

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G+  + QTLT+ VIPTFDI
Sbjct  154  GNLTMKQTLTNTVIPTFDI  172



>ref|XP_004238177.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=406

 Score =   132 bits (332),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 2/140 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGIIP TI+ +LE QLQ LDG +AR+ADYFDVIAGTSTGGL+  ML AP
Sbjct  17   ITILSIDGGGIRGIIPATILTFLESQLQELDGKNARIADYFDVIAGTSTGGLVAAMLTAP  76

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            D+N RPLYA KDI PFY EH  KIFP    G+F  +    + L GPKYDGKYLH++++  
Sbjct  77   DENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALIGPKYDGKYLHEVVKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
              D  +S T+T+VVIPTFDI
Sbjct  137  LKDICISNTITNVVIPTFDI  156



>ref|XP_010437269.1| PREDICTED: patatin-like protein 1 isoform X1 [Camelina sativa]
Length=415

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RG+I G I+AYLEKQLQ LDG DAR+ADYFDVIAGTSTGGL+T ML  
Sbjct  19   LVTILSLDGGGVRGVIAGVILAYLEKQLQELDGEDARLADYFDVIAGTSTGGLVTAMLTV  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+  RP +A KDIVPFY EH  KIFP  AG+   +    +LLSGPKY GKYL  L+  L
Sbjct  79   PDETGRPHFAAKDIVPFYLEHCPKIFPQPAGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L QTLT+VVIPT+DI
Sbjct  139  LGETKLHQTLTNVVIPTYDI  158



>ref|XP_010548405.1| PREDICTED: patatin-like protein 1 isoform X2 [Tarenaya hassleriana]
Length=383

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G I+  LE  LQ LDG  AR+ADYFDV+AGTSTGGL+T ML A
Sbjct  18   MVTILSMDGGGVRGIIVGVILTRLESYLQELDGEGARLADYFDVMAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPL+ GKDIVPFY EH  KIFP   G F  +    +LLSGPKYDGKYLH+L++ L
Sbjct  78   PNELGRPLFTGKDIVPFYMEHAPKIFPQPQGWFNLLPKLPKLLSGPKYDGKYLHELLRKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT+VVIPTFDI
Sbjct  138  LGDKRLHQTLTNVVIPTFDI  157



>ref|XP_006360248.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=411

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            +TILSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR+ADYFDV+AGTSTGGL+TTML AP
Sbjct  31   VTILSIDGGGIRGIIPGTILAFLESKLQELDGPNARIADYFDVVAGTSTGGLVTTMLTAP  90

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLCG  363
            +K+ RPLY  KDI  FY EHG KIFP       ++    L  GPKYDGKYL  L+++  G
Sbjct  91   NKDNRPLYVAKDINNFYMEHGPKIFPQNSRNNFMKKMLNLFGGPKYDGKYLRSLVRSELG  150

Query  364  DTRLSQTLTHVVIPTFDI  417
            +  + QTLTH +IPTFDI
Sbjct  151  NLTMKQTLTHTLIPTFDI  168



>ref|XP_010432097.1| PREDICTED: patatin-like protein 1 [Camelina sativa]
Length=414

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RG+I G I+AYLEKQLQ LDG DAR+ADYFDVIAGTSTGGL+T ML  
Sbjct  18   LVTILSLDGGGVRGVIAGVILAYLEKQLQELDGEDARLADYFDVIAGTSTGGLVTAMLTV  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+  RP +A KDIVPFY EH  KIFP  AG+   +    +LLSGPKY GKYL  L+  L
Sbjct  78   PDETGRPHFAAKDIVPFYLEHCPKIFPQPAGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L QTLT+VVIPT+DI
Sbjct  138  LGETKLHQTLTNVVIPTYDI  157



>ref|XP_010098699.1| Patatin group A-3 [Morus notabilis]
 gb|EXB75602.1| Patatin group A-3 [Morus notabilis]
Length=434

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+++ E QLQ LDG +AR+ADYFDVIAGTSTGGL+  MLAA
Sbjct  48   LITVLSIDGGGIRGIIPATILSFFESQLQELDGEEARLADYFDVIAGTSTGGLIAAMLAA  107

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIF-PSAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+NKRP  A KDI PFY EH +KIF  ++G  ++VR     L+GPKYD KYLH L+++ 
Sbjct  108  PDENKRPCIAAKDITPFYLEHASKIFQQTSGFLKSVRSFLGNLAGPKYDEKYLHGLMRDK  167

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL  T+T++VIPTFDI
Sbjct  168  LGETRLHDTVTNLVIPTFDI  187



>ref|XP_011038246.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIPGTI+A+LE +LQ LDGPDAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  20   ITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGGLVTAMLAAP  79

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            +K  RPL+A KDI  FY E+  KIFP  +  F +  +  + L GPKYDGK+LH +++   
Sbjct  80   NKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLRGPKYDGKFLHSIVKEKL  139

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GDT L QTLT++VIPTFDI
Sbjct  140  GDTWLQQTLTNIVIPTFDI  158



>ref|XP_010548404.1| PREDICTED: patatin-like protein 1 isoform X1 [Tarenaya hassleriana]
Length=407

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G I+  LE  LQ LDG  AR+ADYFDV+AGTSTGGL+T ML A
Sbjct  18   MVTILSMDGGGVRGIIVGVILTRLESYLQELDGEGARLADYFDVMAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPL+ GKDIVPFY EH  KIFP   G F  +    +LLSGPKYDGKYLH+L++ L
Sbjct  78   PNELGRPLFTGKDIVPFYMEHAPKIFPQPQGWFNLLPKLPKLLSGPKYDGKYLHELLRKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT+VVIPTFDI
Sbjct  138  LGDKRLHQTLTNVVIPTFDI  157



>ref|XP_011038244.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIPGTI+A+LE +LQ LDGPDAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  20   ITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVISGTSTGGLVTAMLAAP  79

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            +K  RPL+A KDI  FY E+  KIFP  +  F +  +  + L GPKYDGK+LH +++   
Sbjct  80   NKQNRPLFAAKDINEFYLENCPKIFPQDSSKFASAANLVKTLRGPKYDGKFLHGIVKEKL  139

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GDT L QTLT++VIPTFDI
Sbjct  140  GDTWLQQTLTNIVIPTFDI  158



>ref|XP_008801772.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGG+RGIIPGTI+A+LE +LQ LDG DAR+ADYFDV+AGTSTGGL+T ML A
Sbjct  18   LVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGEDARIADYFDVVAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+KN RPL+A +DI  FY E+  KIFP  AGI  + R+   +++GPKYDGKYL  +I+ L
Sbjct  78   PNKNNRPLFAAEDIPKFYLENSPKIFPQKAGICSSTRNLFSVVTGPKYDGKYLRSIIREL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL Q LT +VIPTFDI
Sbjct  138  LGETRLHQALTDIVIPTFDI  157



>gb|KJB58445.1| hypothetical protein B456_009G210500 [Gossypium raimondii]
Length=406

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            IITILSIDGGGIRGIIPGTI+A+LE QLQ LDG +AR+ADYFD+IAGTSTGGL+T M+ A
Sbjct  11   IITILSIDGGGIRGIIPGTILAFLEAQLQKLDGEEARLADYFDIIAGTSTGGLVTAMITA  70

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPL+A KDI  FY  H  KIFP     F       + ++GPKYDGKYLHKL++  
Sbjct  71   PNEKNRPLFAAKDIKDFYLGHCPKIFPQDTSPFAAAASLMKTMAGPKYDGKYLHKLLREK  130

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RLSQTLT+VVIPTFDI
Sbjct  131  LGDARLSQTLTNVVIPTFDI  150



>ref|XP_008808514.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=477

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGG+RGIIPGTI+A+LE +L  LDG DAR+ADYFDV+AGTSTGGL+T ML A
Sbjct  93   LVTVLSIDGGGVRGIIPGTILAFLESKLHDLDGEDARIADYFDVVAGTSTGGLVTAMLTA  152

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+KN RPL+A  DI  FY E+  KIFP   GIF +  +   +++GPKYDGKYLH +I+ L
Sbjct  153  PNKNNRPLFAADDITKFYLENSPKIFPQKTGIFSSTCNLFTVVTGPKYDGKYLHSIIREL  212

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL Q LT++VIPTFDI
Sbjct  213  LGETRLHQALTNIVIPTFDI  232



>gb|AFK45431.1| unknown [Lotus japonicus]
Length=401

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPG I++YLE QLQ LDG DAR+ADYF+VIAGTSTGGL++ MLAA
Sbjct  19   LITVLSIDGGGIRGIIPGVILSYLESQLQELDGEDARLADYFEVIAGTSTGGLISAMLAA  78

Query  181  P--DKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQ  351
            P      RPL+A K+IVPFY EHG  IFP + GIF  + +  + L+G KY+GKYLHK+++
Sbjct  79   PHPTTKNRPLFAAKEIVPFYLEHGPSIFPQTRGIFAPLINLIKALTGSKYNGKYLHKIVK  138

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
             L  DT L+QTLT VVIPTFD+
Sbjct  139  ELLRDTTLNQTLTKVVIPTFDV  160



>ref|XP_006360228.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=420

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            +TILSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR+ADYFDV+AGTSTGGL+ TML AP
Sbjct  32   LTILSIDGGGIRGIIPGTLLAFLESKLQELDGPNARIADYFDVVAGTSTGGLIATMLTAP  91

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLCG  363
            +K+ RPLYA K+I  FY +HG KIFP +     ++  T L  GPKYDGKYL  L++++ G
Sbjct  92   NKDNRPLYAAKNITNFYMDHGPKIFPESSRSSFLKRLTNLFGGPKYDGKYLKTLVRSILG  151

Query  364  DTRLSQTLTHVVIPTFDI  417
            +  ++QTLT +V+P+FDI
Sbjct  152  NLTVTQTLTQLVVPSFDI  169



>ref|XP_010911162.1| PREDICTED: patatin-like protein 2, partial [Elaeis guineensis]
Length=170

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGG+RGIIPGTI+A+LE +LQ LDG DAR+ADYFD+IAGTST GL+T MLAA
Sbjct  27   MVTVLSIDGGGVRGIIPGTILAFLESKLQELDGEDARLADYFDIIAGTSTCGLVTAMLAA  86

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA--GIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPL+  K+I  FY ++  KIFP +  GI  +V      ++GPKYDGKYLH  ++ 
Sbjct  87   PDENNRPLFTVKEINDFYLQNYPKIFPKSGKGILGSVASLFGSITGPKYDGKYLHSKVEQ  146

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
            L G TRL QTLT+VVIPTFDI
Sbjct  147  LLGGTRLHQTLTNVVIPTFDI  167



>ref|XP_002305891.2| hypothetical protein POPTR_0004s08270g [Populus trichocarpa]
 gb|EEE86402.2| hypothetical protein POPTR_0004s08270g [Populus trichocarpa]
Length=409

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGIIPGTI+++LE +LQ LDG DAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  23   ITILSIDGGGIRGIIPGTILSFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLAAP  82

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            +K  RPL+A KDI  FY E+  KIFP  G  F +  +    L GPKYDGK+LH +++   
Sbjct  83   NKQNRPLFAAKDINDFYLENSPKIFPQDGSPFASAENLIMTLKGPKYDGKFLHSIVKEKL  142

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GDTRL QTLT++VIPTFDI
Sbjct  143  GDTRLHQTLTNIVIPTFDI  161



>ref|XP_010028264.1| PREDICTED: patatin-like protein 1 [Eucalyptus grandis]
 gb|KCW54972.1| hypothetical protein EUGRSUZ_I00938 [Eucalyptus grandis]
Length=407

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGG+RGIIPG I+ YLE QLQ LDG  AR+ADYFDVIAGTSTGGL+T ML+A
Sbjct  18   LITILSIDGGGVRGIIPGVILGYLEAQLQELDGEGARLADYFDVIAGTSTGGLITAMLSA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD + RPL+A KDIVPFY E+  KIFP   G   +V +  + L+GPKY+G YLHKLI+ L
Sbjct  78   PDAHNRPLFAAKDIVPFYLENCPKIFPQGCGSLGSVLNTIKSLTGPKYNGVYLHKLIRKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL  TLT +VIPTFDI
Sbjct  138  LGSTRLHDTLTSLVIPTFDI  157



>gb|KFK30335.1| hypothetical protein AALP_AA7G248500 [Arabis alpina]
Length=410

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G I+ YLEKQLQ LDG D R+ADYFDV+AGTSTGGLMT ML  
Sbjct  20   LVTILSLDGGGVRGIIAGVILDYLEKQLQELDGKDVRLADYFDVVAGTSTGGLMTAMLTV  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PDK  RP +A KDIVPFY EH  KIFP   G+   +    +LLSGPKY GKYL KL+ +L
Sbjct  80   PDKTGRPHFAAKDIVPFYLEHSPKIFPQPTGLSALLPKLPKLLSGPKYSGKYLRKLLSDL  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L+QTLT++VIPTFDI
Sbjct  140  LGETKLNQTLTNIVIPTFDI  159



>ref|XP_006829699.1| hypothetical protein AMTR_s00126p00054960, partial [Amborella 
trichopoda]
 gb|ERM97115.1| hypothetical protein AMTR_s00126p00054960, partial [Amborella 
trichopoda]
Length=222

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 107/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP TI+++LE +LQ LDG + R+ADYFDVI+GTSTGGL+T M+ A
Sbjct  17   LITILSIDGGGIRGIIPSTILSFLESELQKLDGEEVRLADYFDVISGTSTGGLVTAMITA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P  N RPLYA KDI  FY +H  KIFP  +G+  + R     ++GPKY+GKYLHKL++  
Sbjct  77   PGDNNRPLYAAKDITSFYLDHCPKIFPQQSGLLGSARKFVSAITGPKYNGKYLHKLVRKQ  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT VVIP FDI
Sbjct  137  LGDKRLHQTLTKVVIPAFDI  156



>ref|XP_004291132.1| PREDICTED: patatin-like protein 2 [Fragaria vesca subsp. vesca]
Length=407

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPGTI+A+LE +LQ LDG DAR+ADYFDVI+GTSTGGL+T ML A
Sbjct  17   LITVLSIDGGGIRGIIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGGLVTAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP--SAGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P++N RPL++ KDI  FY  H  KIFP  S  +F   R   + L+GPKYDGKYLH L++ 
Sbjct  77   PNENNRPLFSAKDIKDFYLTHSPKIFPQKSGWLFPRARKIIKALAGPKYDGKYLHGLVRE  136

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GD +L+QTLT+VVIP FDI
Sbjct  137  KLGDKKLNQTLTNVVIPAFDI  157



>gb|KHN42072.1| Patatin group A-3 [Glycine soja]
Length=434

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 113/143 (79%), Gaps = 4/143 (3%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPG I+ YLE QLQ LDG DAR+ADYFDVIAGTSTGGL+ +MLAA
Sbjct  17   LITVLSIDGGGIRGIIPGVILDYLESQLQELDGEDARLADYFDVIAGTSTGGLVASMLAA  76

Query  181  PD--KNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLI  348
            P+   N RPL+A  +IVPFY E+  +IFP    GIF  + +  + L+GPKYDGK+ H+LI
Sbjct  77   PNPKANNRPLFAANEIVPFYLENSPQIFPQKRGGIFAPLVNIGKALTGPKYDGKHFHELI  136

Query  349  QNLCGDTRLSQTLTHVVIPTFDI  417
            +N  G T+L QTLT+VVIPTFD+
Sbjct  137  RNKLGGTKLHQTLTNVVIPTFDV  159



>ref|XP_007156814.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
 gb|ESW28808.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
Length=401

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 112/141 (79%), Gaps = 3/141 (2%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIPG ++AYLE +LQ LDG +AR+ADYFDV+ GTSTGGL+ +MLAAP
Sbjct  17   ITVLSIDGGGIRGIIPGVVLAYLESELQELDGDNARLADYFDVMTGTSTGGLVASMLAAP  76

Query  184  D--KNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            D   N RPL++ KDIVPFY ++  +IFP   GIF  + +  + L GPKYDGKYLH+LI+ 
Sbjct  77   DPKANNRPLFSAKDIVPFYLKNSPQIFPQKRGIFTPLVNIGKALMGPKYDGKYLHELIRK  136

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GDT L QTLT+VVIPTFD+
Sbjct  137  NLGDTMLHQTLTNVVIPTFDV  157



>gb|KJB63811.1| hypothetical protein B456_010G0176002, partial [Gossypium raimondii]
Length=168

 Score =   126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPGTI+ +LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML  
Sbjct  16   LITILSIDGGGIRGIIPGTILGFLESQLQELDGEDARLADYFDVIAGTSTGGLVTAMLTC  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAG--IFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P++  RPL+A KDI  FY  +   IFP  G  +F       + LSGPKYDGK+LH ++++
Sbjct  76   PNEKNRPLFAAKDIKDFYLTNCPNIFPQPGCPLFSRTTKVIKALSGPKYDGKFLHNVVKD  135

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              G+TRL QTLT+VVIPTFDI
Sbjct  136  RLGETRLHQTLTNVVIPTFDI  156



>ref|XP_008220193.1| PREDICTED: patatin-like protein 2 isoform X1 [Prunus mume]
Length=417

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 110/142 (77%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            I+T+LSIDGGGIRGIIPGTI+ +LE +LQ LDG +AR+ DYFDVIAGTSTGGL+T ML  
Sbjct  23   IVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLVDYFDVIAGTSTGGLVTAMLTT  82

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETV---RDATRLLSGPKYDGKYLHKLIQ  351
            PD+N RPL+A KDI  FY EH  KIFP    +  +    D  + +SGPKYDGKYLHK+++
Sbjct  83   PDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGKAMDMVKAVSGPKYDGKYLHKIMK  142

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
             + GD RLS TLT+V+IPTFDI
Sbjct  143  EILGDIRLSDTLTNVIIPTFDI  164



>ref|XP_011081971.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=403

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 105/140 (75%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  I+  LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  17   LITILSIDGGGIRGIIPAKILESLESELQKLDGQDARIADYFDVIAGTSTGGLVTAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD N RPLYA KDI  FY +HG KIFP   G+  ++      L  PKY GKYLHKLI++ 
Sbjct  77   PDANNRPLYAAKDIAAFYVKHGPKIFPHKGGVIGSLESMVVQLGRPKYKGKYLHKLIRDN  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL  TLT+VVIPTFDI
Sbjct  137  LGQTRLHDTLTNVVIPTFDI  156



>ref|XP_004310193.1| PREDICTED: patatin-like protein 2 [Fragaria vesca subsp. vesca]
Length=407

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPGTI+A+LE +LQ LDG +AR+ADYFDVI+GTSTGGL+T ML A
Sbjct  17   LITVLSIDGGGIRGIIPGTILAFLESELQMLDGENARLADYFDVISGTSTGGLVTAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP--SAGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P++N RPL+A KDI  FY  H  KIFP  S  +F   R   + L+GPKYDGKYLH L++ 
Sbjct  77   PNENNRPLFAAKDIKDFYLTHSPKIFPQKSGWLFPRARKIIKALAGPKYDGKYLHGLVRE  136

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GD +L+QTLT+VVIP FDI
Sbjct  137  KLGDKKLNQTLTNVVIPAFDI  157



>gb|KCW66169.1| hypothetical protein EUGRSUZ_F000051, partial [Eucalyptus grandis]
Length=168

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG+IPGTI+A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML  
Sbjct  17   LITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTT  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD N RPL+A KDI  FY ++  KIFP     F       + ++GPKYDGKYLHKL++  
Sbjct  77   PDDNNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLHKLVKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL QTLT+VVIPTFDI
Sbjct  137  LGNARLHQTLTNVVIPTFDI  156



>ref|XP_010446710.1| PREDICTED: patatin-like protein 1 isoform X3 [Camelina sativa]
Length=383

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RG+I G ++AYLEKQLQ +DG  AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  18   LVTILSLDGGGVRGVIAGVVLAYLEKQLQEIDGEGARLADYFDVIAGTSTGGLVTAMLTV  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD   RP +A KDIVPFY EH  KIFP  AG+F  +    +LLSGPKY GKYL  L+  L
Sbjct  78   PDGTGRPHFAAKDIVPFYLEHCPKIFPQPAGVFALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L QTLT+VVIPT+DI
Sbjct  138  LGETKLHQTLTNVVIPTYDI  157



>emb|CDX75621.1| BnaA01g00810D [Brassica napus]
Length=407

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 111/141 (79%), Gaps = 3/141 (2%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            +TILSIDGGG+RGIIPG ++AYLE QLQ LDG +AR+ DYFDVI+GTSTGGL+  ML AP
Sbjct  20   VTILSIDGGGVRGIIPGIVLAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAMLTAP  79

Query  184  DKNKR--PLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            DK  R  PL+A K+IVPFY++H  KIFP   G F   +   RL+ GPKY+GKYL ++I++
Sbjct  80   DKTNRNRPLFAAKEIVPFYRKHCPKIFPHPRGAFAWAQILVRLVRGPKYNGKYLREVIED  139

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GDTRL+QTLT+VVIP FDI
Sbjct  140  FLGDTRLTQTLTNVVIPCFDI  160



>ref|XP_010061771.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=380

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG++PG I+A+LE +LQ LDG DAR+ADYFDVIAGTSTG L+T ML A
Sbjct  16   LITILSIDGGGIRGVVPGVILAFLESELQKLDGEDARIADYFDVIAGTSTGALLTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPL+A K I  FY ++G KIFP  + +F ++  + +L+ GPKYDGKYLH L++  
Sbjct  76   PNEENRPLFAAKGIKSFYFDNGPKIFPQKSCLFSSITQSAKLVFGPKYDGKYLHSLLRAK  135

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL QTLT+VVIPTFDI
Sbjct  136  LGNLRLHQTLTNVVIPTFDI  155



>ref|XP_002445638.1| hypothetical protein SORBIDRAFT_07g023200 [Sorghum bicolor]
 gb|EES15133.1| hypothetical protein SORBIDRAFT_07g023200 [Sorghum bicolor]
Length=438

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 115/145 (79%), Gaps = 13/145 (9%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            I+T+LSIDGGG+RGIIPGTI+ +LE++LQ LDGPDAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  51   IVTVLSIDGGGVRGIIPGTILGFLEEKLQELDGPDARLADYFDVIAGTSTGGLVTAMLTA  110

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA------GIFETVRDATRLLSGPKYDGKYLHK  342
            P+K+ RPL+A KDI  FY EH  KIFPS       G+F++       ++GPKYDGKYLH 
Sbjct  111  PNKDGRPLFAAKDINDFYLEHCPKIFPSGSSGGPLGLFKS-------MAGPKYDGKYLHS  163

Query  343  LIQNLCGDTRLSQTLTHVVIPTFDI  417
            +++ L G+TR+SQ L ++VIPTFDI
Sbjct  164  IVRELLGETRVSQALQNIVIPTFDI  188



>ref|XP_009139093.1| PREDICTED: patatin-like protein 3 [Brassica rapa]
Length=407

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 111/141 (79%), Gaps = 3/141 (2%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            +TILSIDGGG+RGIIPG ++AYLE QLQ LDG +AR+ DYFDVI+GTSTGGL+  ML AP
Sbjct  20   VTILSIDGGGVRGIIPGIVLAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAMLTAP  79

Query  184  DKNKR--PLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            DK  R  PL+A K+IVPFY++H  KIFP   G F   +   RL+ GPKY+GKYL ++I++
Sbjct  80   DKTNRNRPLFAAKEIVPFYRKHCPKIFPHPRGAFAWAQILVRLVRGPKYNGKYLREVIED  139

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GDTRL+QTLT+VVIP FDI
Sbjct  140  FLGDTRLTQTLTNVVIPCFDI  160



>ref|XP_009797489.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=333

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
             ITILSIDGGGIRG+IPGTI+ Y E QLQALDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  21   FITILSIDGGGIRGLIPGTILEYFESQLQALDGEDARLADYFDVIAGTSTGGLVTAMLTA  80

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K+KRPL+A KDI PFY EHG +IFP     +  +    + ++GPKY GKYLHK+I+  
Sbjct  81   PNKDKRPLFAAKDIKPFYLEHGPRIFPQNTFNWFGIGTMWKSVTGPKYGGKYLHKVIKEK  140

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T L +TLT+VVIP FDI
Sbjct  141  LGETHLHETLTNVVIPAFDI  160



>ref|XP_009138468.1| PREDICTED: patatin-like protein 3 [Brassica rapa]
Length=412

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 112/147 (76%), Gaps = 8/147 (5%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPGTI+AYLE QLQ LDG +AR+ DYFDVI+GTSTGGL+  ML A
Sbjct  19   LVTILSIDGGGIRGIIPGTILAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAMLTA  78

Query  181  PDKN-------KRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYL  336
             DK+        RPL+A K+IVPFY +H  KIFP   G+    +   RL+ GPKY+GKYL
Sbjct  79   EDKDVKNSRNRSRPLFAAKEIVPFYLKHSPKIFPQHRGVCSWAQTMRRLVRGPKYNGKYL  138

Query  337  HKLIQNLCGDTRLSQTLTHVVIPTFDI  417
            H++IQ   GDTRL+QT+T+VVIP FDI
Sbjct  139  HEVIQGYLGDTRLTQTMTNVVIPCFDI  165



>ref|XP_010446709.1| PREDICTED: patatin-like protein 1 isoform X2 [Camelina sativa]
Length=414

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RG+I G ++AYLEKQLQ +DG  AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  18   LVTILSLDGGGVRGVIAGVVLAYLEKQLQEIDGEGARLADYFDVIAGTSTGGLVTAMLTV  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD   RP +A KDIVPFY EH  KIFP  AG+F  +    +LLSGPKY GKYL  L+  L
Sbjct  78   PDGTGRPHFAAKDIVPFYLEHCPKIFPQPAGVFALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L QTLT+VVIPT+DI
Sbjct  138  LGETKLHQTLTNVVIPTYDI  157



>ref|XP_007017308.1| Phospholipase A 2A, IIA,PLA2A isoform 2, partial [Theobroma cacao]
 gb|EOY14533.1| Phospholipase A 2A, IIA,PLA2A isoform 2, partial [Theobroma cacao]
Length=280

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPGTI+A LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML  
Sbjct  16   LITILSIDGGGIRGIIPGTILAVLESELQKLDGEDARLADYFDVIAGTSTGGLVTGMLTC  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAG--IFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P++  RPL+A KDI  FY  +  KIFP  G  +F       + LSGPKYDGK+LH L++ 
Sbjct  76   PNEKNRPLFAAKDIKDFYLNYCPKIFPQPGCPLFAQTSKVIKALSGPKYDGKFLHSLVKE  135

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GDTRL QTLT+VVIPTFDI
Sbjct  136  KLGDTRLHQTLTNVVIPTFDI  156



>gb|KFK30332.1| hypothetical protein AALP_AA7G248200 [Arabis alpina]
Length=639

 Score =   132 bits (333),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 80/120 (67%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = +1

Query  61   VAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAPDKNKRPLYAGKDIVPFYKE  240
            +AYLEKQLQ LDG D R+ADYFDV+AGTSTGGLMT ML  PD+  RP +A KDIVPFY E
Sbjct  275  LAYLEKQLQELDGEDVRLADYFDVVAGTSTGGLMTAMLTVPDETGRPHFAAKDIVPFYLE  334

Query  241  HGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNLCGDTRLSQTLTHVVIPTFDI  417
            H  KIFP   G+F  +    +LLSGPKYDGKYL  L+    G+TRL QTLT+VVIPTFDI
Sbjct  335  HSPKIFPQPEGLFALLPKLPKLLSGPKYDGKYLKNLLSQFLGETRLHQTLTNVVIPTFDI  394



>ref|XP_004167584.1| PREDICTED: LOW QUALITY PROTEIN: patatin group A-3-like [Cucumis 
sativus]
Length=395

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGIIPGTI+A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T+ML AP
Sbjct  14   ITILSIDGGGIRGIIPGTILAFLESKLQELDGEDARIADYFDVIAGTSTGGLVTSMLTAP  73

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIF-ETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            ++N RPLYA KD+  FY EHG KIFP    F  +V +    + GPKYDGKYL  LI  L 
Sbjct  74   NENNRPLYAAKDLTRFYIEHGPKIFPQRNYFLSSVVNMFGKVMGPKYDGKYLRSLINRLL  133

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GD  L +TLT V+IP FDI
Sbjct  134  GDITLKETLTQVIIPAFDI  152



>ref|XP_004501586.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Cicer arietinum]
Length=409

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+ YLE QLQ LDG  AR+ADYFDVI GTSTGGL+T ML A
Sbjct  21   LVTILSIDGGGIRGIIPATILEYLETQLQELDGESARLADYFDVITGTSTGGLVTAMLTA  80

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+ N+RPL+A KDI PFY EH  KIFP    +F +V    R L+GPKYDGKYLH +++  
Sbjct  81   PNHNQRPLFAAKDIKPFYLEHCPKIFPQHKDLFGSVTKLFRSLAGPKYDGKYLHDMVREK  140

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ R+ +TLT++VIPTFDI
Sbjct  141  LGEIRVHETLTNIVIPTFDI  160



>ref|XP_009409669.1| PREDICTED: patatin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=433

 Score =   130 bits (328),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 92/140 (66%), Positives = 107/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG+IP TI+++LE +LQ LDG D R+ADYFDVIAGTSTGGL+T MLAA
Sbjct  17   LITILSIDGGGIRGVIPATILSFLESELQKLDGDDVRIADYFDVIAGTSTGGLVTAMLAA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIF-ETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+N RPL+A KD+  FY EH  KIFP  G F   VR   R L GPKY G YLH LI+  
Sbjct  77   PDENNRPLFAAKDMKSFYLEHSPKIFPQIGGFLAPVRRMFRSLWGPKYSGTYLHSLIREK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G  RL +TLT+V+IPTFDI
Sbjct  137  LGGVRLHETLTNVIIPTFDI  156



>ref|XP_006338216.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=412

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            +TILSIDGGGIRG+IPGT++A+LE +LQ LDGP+AR+ADYFDV+AGTSTGGL+TTML AP
Sbjct  35   VTILSIDGGGIRGVIPGTLLAFLESKLQELDGPNARLADYFDVVAGTSTGGLVTTMLTAP  94

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLCG  363
            +K+ RPLY  KDI  FY EHG +IFP +     VR  T L  GPKYDG YL  +I ++ G
Sbjct  95   NKDNRPLYQAKDISNFYMEHGPQIFPQSRRNSFVRRVTNLFGGPKYDGIYLRTIINSILG  154

Query  364  DTRLSQTLTHVVIPTFDI  417
            +  + QTLT+ VIPTFDI
Sbjct  155  NITMKQTLTNTVIPTFDI  172



>ref|NP_568015.1| patatin-related phospholipase A [Arabidopsis thaliana]
 ref|NP_849512.3| patatin-related phospholipase A [Arabidopsis thaliana]
 gb|AEE86745.1| patatin-related phospholipase A [Arabidopsis thaliana]
 gb|AEE86746.1| patatin-related phospholipase A [Arabidopsis thaliana]
Length=383

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G I+A+LEKQLQ LDG +AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  18   LVTILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTV  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+  RP +A KDIVPFY EH  KIFP   G+   +    +LLSGPKY GKYL  L+  L
Sbjct  78   PDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL QTLT++VIPTFDI
Sbjct  138  LGETRLHQTLTNIVIPTFDI  157



>ref|XP_004232051.1| PREDICTED: patatin-like protein 3 [Solanum lycopersicum]
Length=412

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            +T+LSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR+ADYFDV+AGTSTGGL+TTML AP
Sbjct  35   VTVLSIDGGGIRGIIPGTLLAFLESKLQELDGPNARIADYFDVVAGTSTGGLVTTMLTAP  94

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLCG  363
            +K+ RPLY  KDI  FY +HG +IFP +     VR  T L  GPKYDG YL  +I ++ G
Sbjct  95   NKDNRPLYQAKDISNFYMQHGPQIFPQSRRNSFVRRITNLFGGPKYDGIYLRTIINSILG  154

Query  364  DTRLSQTLTHVVIPTFDI  417
            +  + QTLT+ VIPTFDI
Sbjct  155  NLTMKQTLTNTVIPTFDI  172



>ref|XP_010064131.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66170.1| hypothetical protein EUGRSUZ_F00006 [Eucalyptus grandis]
Length=238

 Score =   127 bits (319),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG+IPGTI+A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML +
Sbjct  17   LITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTS  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+N RPL+A KDI  FY ++  KIFP     F       + ++GPKYDGKYLHKL++  
Sbjct  77   PDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLHKLVKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL QTLT+VVIPTFDI
Sbjct  137  LGNRRLHQTLTNVVIPTFDI  156



>ref|XP_009133998.1| PREDICTED: patatin-like protein 2 [Brassica rapa]
Length=407

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A+LE +LQ LDG +AR+ADYFDV+AGTSTGGL+T ML A
Sbjct  18   LVTILSIDGGGIRGIIPATILAFLESELQKLDGNEARLADYFDVVAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K  RPL+A  +I  FY EH  KIFP     F   ++  + L+GPKYDG+YLH+LI   
Sbjct  78   PNKEGRPLFAASEIKEFYLEHCPKIFPQNHFPFSATKNLVKSLTGPKYDGEYLHQLIHAK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GDTRL QTLT+VVIPTFDI
Sbjct  138  LGDTRLHQTLTNVVIPTFDI  157



>gb|AAM64566.1| patatin-like protein [Arabidopsis thaliana]
Length=383

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G I+A+LEKQLQ LDG +AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  18   LVTILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTV  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+  RP +A KDIVPFY EH  KIFP   G+   +    +LLSGPKY GKYL  L+  L
Sbjct  78   PDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL QTLT++VIPTFDI
Sbjct  138  LGETRLHQTLTNIVIPTFDI  157



>ref|XP_004233432.1| PREDICTED: patatin-like protein 1 [Solanum lycopersicum]
Length=420

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR+ADYFDV+AGTSTGGL+ TML AP
Sbjct  32   ITILSIDGGGIRGIIPGTILAFLESKLQELDGPNARIADYFDVVAGTSTGGLIATMLTAP  91

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLCG  363
            +K+ RPLYA K+I  FY +HG KIFP +     ++    +  GPKYDGKYL  L++++ G
Sbjct  92   NKDNRPLYAAKNITNFYMDHGPKIFPESSRTSFLKRLANIFGGPKYDGKYLRTLVRSILG  151

Query  364  DTRLSQTLTHVVIPTFDI  417
            +  ++QTLT +VIP+FDI
Sbjct  152  NLTVTQTLTQLVIPSFDI  169



>ref|XP_010061770.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW68765.1| hypothetical protein EUGRSUZ_F02366 [Eucalyptus grandis]
Length=404

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG++PG I+A+LE +LQ LDG DAR+ADYFDVIAGTSTG L+T ML A
Sbjct  16   LITILSIDGGGIRGVVPGVILAFLESELQKLDGEDARIADYFDVIAGTSTGALLTAMLTA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPL+A K I  FY ++G KIFP  + +F ++  + +L+ GPKYDGKYLH L++  
Sbjct  76   PNEENRPLFAAKGIKSFYFDNGPKIFPQKSCLFSSITQSAKLVFGPKYDGKYLHSLLRAK  135

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL QTLT+VVIPTFDI
Sbjct  136  LGNLRLHQTLTNVVIPTFDI  155



>gb|EMS66123.1| Patatin group A-3 [Triticum urartu]
Length=405

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 106/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP   +A+LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T ML A
Sbjct  18   LITILSIDGGGIRGIIPAVALAFLESELQKLDGEEARLADYFDVIAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K +RPL+A KDI  FY  H  +IFP   G F  +    R LSGP YDGKYLH++++  
Sbjct  78   PNKKRRPLFAAKDIQAFYMNHAPRIFPQLRGAFGRIMGILRSLSGPYYDGKYLHEVVRKK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G  RL QTLT+VVIPTFDI
Sbjct  138  LGSARLHQTLTNVVIPTFDI  157



>emb|CDY21469.1| BnaC03g27280D [Brassica napus]
Length=407

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A+LE +LQ LDG +AR+ADYFDV+AGTSTGGL+T ML A
Sbjct  18   LVTILSIDGGGIRGIIPATILAFLESELQKLDGNEARLADYFDVVAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K  RPL+A  +I  FY EH  KIFP     F   ++  + L+GPKYDG+YLH+LI   
Sbjct  78   PNKEGRPLFAASEIKEFYLEHCPKIFPQNHFPFSATKNLVKSLTGPKYDGEYLHQLIHAK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GDTRL QTLT+VVIPTFDI
Sbjct  138  LGDTRLHQTLTNVVIPTFDI  157



>gb|KFK32501.1| hypothetical protein AALP_AA6G250900, partial [Arabis alpina]
Length=384

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = +1

Query  61   VAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAPDKNKRPLYAGKDIVPFYKE  240
            +A+LE +LQ LDG +AR+ADYFDV+AGTSTGGL+T ML AP+K  RPL+A  DI  FY E
Sbjct  14   LAFLESELQKLDGEEARLADYFDVMAGTSTGGLVTAMLTAPNKEGRPLFAASDIKDFYLE  73

Query  241  HGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNLCGDTRLSQTLTHVVIPTFDI  417
            H  KIFP     F   +   + L+GPKYDG+YLH+LI +L GDTRL QTLT+VVIPTFDI
Sbjct  74   HCPKIFPQDHFPFSAAKTLVKSLTGPKYDGEYLHQLIHDLLGDTRLHQTLTNVVIPTFDI  133



>ref|XP_007160830.1| hypothetical protein PHAVU_001G020100g [Phaseolus vulgaris]
 gb|ESW32824.1| hypothetical protein PHAVU_001G020100g [Phaseolus vulgaris]
Length=407

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 108/142 (76%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGGIRGIIPG I+ +LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  20   MVTLLSIDGGGIRGIIPGVILGFLESELQKLDGDDARLADYFDVIAGTSTGGLVTAMLTA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA---GIFETVRDATRLLSGPKYDGKYLHKLIQ  351
            P++N RPLYA KDI  FY EH  KIFP      +  +V   +R L GP+YDGKYLH L++
Sbjct  80   PNENNRPLYAAKDIKDFYLEHTPKIFPQNKGWNLISSVMKLSRTLLGPQYDGKYLHNLVR  139

Query  352  NLCGDTRLSQTLTHVVIPTFDI  417
               GD +L QTLT+VVIP FDI
Sbjct  140  EKLGDIKLHQTLTNVVIPAFDI  161



>gb|KCW54973.1| hypothetical protein EUGRSUZ_I00941 [Eucalyptus grandis]
Length=403

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGG+RGIIPG I+ YLE QLQ LDG  AR+ADYFDVIAGTSTGGL+T ML+A
Sbjct  18   LITILSIDGGGVRGIIPGVILDYLEAQLQELDGEGARLADYFDVIAGTSTGGLITAMLSA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD + RPL+A KDIVPFY E+  KIFP   G   +V    R L+GPKY+G YLHKLI+ L
Sbjct  78   PDADNRPLFAAKDIVPFYLENCPKIFPQGCGCLGSVVSTLRSLAGPKYNGVYLHKLIRKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL  +LT +VIPTFDI
Sbjct  138  LGTTRLHASLTGLVIPTFDI  157



>ref|NP_849511.1| patatin-related phospholipase A [Arabidopsis thaliana]
 sp|O23179.2|PLP1_ARATH RecName: Full=Patatin-like protein 1; Short=AtPLP1; AltName: 
Full=Patatin-related phospholipase A IIgamma; Short=pPLAIIg; 
AltName: Full=Phospholipase A IVA; Short=AtPLAIVA [Arabidopsis 
thaliana]
 emb|CAB16787.1| patatin-like protein [Arabidopsis thaliana]
 emb|CAB80373.1| patatin-like protein [Arabidopsis thaliana]
 gb|ABM06020.1| At4g37070 [Arabidopsis thaliana]
 gb|AEE86744.1| patatin-related phospholipase A [Arabidopsis thaliana]
Length=414

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G I+A+LEKQLQ LDG +AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  18   LVTILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTV  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+  RP +A KDIVPFY EH  KIFP   G+   +    +LLSGPKY GKYL  L+  L
Sbjct  78   PDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL QTLT++VIPTFDI
Sbjct  138  LGETRLHQTLTNIVIPTFDI  157



>ref|XP_008813728.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=184

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 107/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  I+++LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  19   LITILSIDGGGIRGIIPAVILSFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD++ RPL+A KDI  FY     KIFP   G         R +SGP+Y+GKYLH+L++  
Sbjct  79   PDEDNRPLFAAKDIESFYLAESPKIFPQYGGPLGKAAKILRAISGPRYNGKYLHELVRRK  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L QTLT+VVIPTFD+
Sbjct  139  LGNTKLHQTLTNVVIPTFDV  158



>emb|CAA05628.1| patatin-like protein [Arabidopsis thaliana]
Length=410

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G I+A+LEKQLQ LDG +AR+ADYFDVIAGTSTGGL+T ML  
Sbjct  14   LVTILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTV  73

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+  RP +A KDIVPFY EH  KIFP   G+   +    +LLSGPKY GKYL  L+  L
Sbjct  74   PDETGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGKYLRNLLSKL  133

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL QTLT++VIPTFDI
Sbjct  134  LGETRLHQTLTNIVIPTFDI  153



>ref|XP_009780402.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=413

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            +T+LSIDGGGIRGIIPGT++A+LE +LQ LDGP+ARVADYFDV+AGTSTGGL+TTML AP
Sbjct  33   VTVLSIDGGGIRGIIPGTVLAFLESKLQELDGPNARVADYFDVVAGTSTGGLVTTMLTAP  92

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLCG  363
            +K+ RPLYA  DI  F+ EHG KIFP++     V+    +  GPKYDG+YL  L+++  G
Sbjct  93   NKDNRPLYAANDITSFFFEHGPKIFPASS-RNNVKKIFNIFGGPKYDGRYLRSLVRSKLG  151

Query  364  DTRLSQTLTHVVIPTFDI  417
            +  + QTLTH VIPTFDI
Sbjct  152  NLTMKQTLTHTVIPTFDI  169



>ref|XP_006411935.1| hypothetical protein EUTSA_v10025343mg [Eutrema salsugineum]
 gb|ESQ53388.1| hypothetical protein EUTSA_v10025343mg [Eutrema salsugineum]
Length=408

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G I+AYLEKQLQ LDG D R+ADYFDV+AGTSTGGL+T ML  
Sbjct  18   LVTILSLDGGGVRGIIAGVILAYLEKQLQELDGEDVRLADYFDVVAGTSTGGLVTAMLTV  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+  RP +A KDIVPFY EH  KIFP   G+F  +    +LLSGPKYDGKYL  L+  L
Sbjct  78   PDETGRPHFAAKDIVPFYLEHTPKIFPQPEGLFALLPKLPKLLSGPKYDGKYLKNLLSKL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL QTLT+VVI TFDI
Sbjct  138  LGEKRLHQTLTNVVITTFDI  157



>gb|AFK35290.1| unknown [Medicago truncatula]
Length=417

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRG+IP  I+ +LE  LQ LDG DAR+ADYFDVI+GTSTGGL+T MLAA
Sbjct  20   LVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTGGLVTAMLAA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFET-VRDATRLLSGPKYDGKYLHKLIQN  354
            PDKN RPL+A KDI PF  EH  KIFP   G+  T +    R L GPKYDGKYLH++++ 
Sbjct  80   PDKNNRPLFAAKDIKPFCLEHCPKIFPQHRGLSATLLAKVMRSLGGPKYDGKYLHQVVRE  139

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GD RL +TLT++V+PTFDI
Sbjct  140  KLGDIRLHETLTNIVVPTFDI  160



>gb|KDO79284.1| hypothetical protein CISIN_1g0425841mg, partial [Citrus sinensis]
Length=311

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 105/139 (76%), Gaps = 10/139 (7%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPG I+AYLE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  17   LITILSIDGGGIRGIIPGVILAYLESQLQELDGQDARLADYFDVIAGTSTGGLITAMLTA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            P +  RP+ A KDIVPFY  HG KIFP            R L G KYDGKYLHK+I+   
Sbjct  77   PKEQNRPMSAAKDIVPFYIRHGPKIFPQ----------LRALMGSKYDGKYLHKVIKEDL  126

Query  361  GDTRLSQTLTHVVIPTFDI  417
             DT+L QTLT+VVIPTFDI
Sbjct  127  KDTKLHQTLTNVVIPTFDI  145



>ref|XP_008776250.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=443

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 111/144 (77%), Gaps = 9/144 (6%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+A+LE QLQALDG DAR+ADYFDVIAGTSTGGL+T MLAA
Sbjct  15   LITVLSIDGGGIRGIIPATILAFLESQLQALDGLDARLADYFDVIAGTSTGGLVTAMLAA  74

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-----AGIFETVRDATRLLSGPKYDGKYLHKL  345
            P+   RP++A KDI  FY EH  KIFP      AG FE +    +L  GPKYDGKYLH++
Sbjct  75   PNAKNRPIFAAKDIKEFYLEHCPKIFPQPWDSVAGAFEKI----KLFLGPKYDGKYLHRI  130

Query  346  IQNLCGDTRLSQTLTHVVIPTFDI  417
            I+   G  +L QTLT+VVIPTFDI
Sbjct  131  IKEKLGTLKLHQTLTNVVIPTFDI  154



>ref|XP_006660213.1| PREDICTED: patatin-3-Kuras 1-like, partial [Oryza brachyantha]
Length=412

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 10/143 (7%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            I+T+LSIDGGG+RGIIPGTI+A+LE++LQ +DGP+AR+ADYFDV+AGTSTGG++T ML A
Sbjct  30   IVTVLSIDGGGVRGIIPGTILAFLEEKLQEIDGPEARIADYFDVVAGTSTGGVVTAMLTA  89

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP----SAGIFETVRDATRLLSGPKYDGKYLHKLI  348
            PD   RPL+A K I  FY EH  KIFP    + G+ ++      L+SGPKYDGKYLH ++
Sbjct  90   PDDQGRPLFAAKGINDFYLEHSPKIFPPRRSNLGLIKS------LMSGPKYDGKYLHSVV  143

Query  349  QNLCGDTRLSQTLTHVVIPTFDI  417
            Q L GD R++QTLT+VVIPTFDI
Sbjct  144  QKLLGDKRVNQTLTNVVIPTFDI  166



>ref|XP_006660710.1| PREDICTED: patatin-2-Kuras 2-like isoform X2 [Oryza brachyantha]
Length=387

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP  ++ +LE +LQ LDG +AR+ADYFDV+AGTSTGGL+T MLA 
Sbjct  18   LITVLSIDGGGIRGIIPAVVLTFLESELQKLDGEEARLADYFDVMAGTSTGGLVTAMLAT  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+KN+RPL+A KDI  FY  H  KIFP   G F  +    R +SGP YDGK+LH++++  
Sbjct  78   PNKNRRPLFAAKDIKEFYMNHSPKIFPQLRGPFGRMMRIVRSMSGPSYDGKHLHEVVREK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL QTLT+VVIPTFDI
Sbjct  138  LGSTRLHQTLTNVVIPTFDI  157



>ref|XP_009589751.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=412

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            +T+LSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR+ADYFDV+AGTSTGGL+T+ML AP
Sbjct  33   VTVLSIDGGGIRGIIPGTILAFLESKLQELDGPNARIADYFDVVAGTSTGGLVTSMLTAP  92

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLCG  363
            +K+ RPLYA  DI  FY EHG KIFP++   + V+    +  GPKYDG+YL  L+++  G
Sbjct  93   NKDNRPLYAANDITSFYFEHGPKIFPASSRND-VKKIFNIFGGPKYDGRYLRSLVRSKLG  151

Query  364  DTRLSQTLTHVVIPTFDI  417
            +  + QTLTH VIPTFDI
Sbjct  152  NLTMKQTLTHTVIPTFDI  169



>ref|XP_009797488.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=409

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGGIRG+IPGTI+ Y E QLQALDG DAR+ADYFDVIAGTSTGGL+T ML AP
Sbjct  22   ITILSIDGGGIRGLIPGTILEYFESQLQALDGEDARLADYFDVIAGTSTGGLVTAMLTAP  81

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            +K+KRPL+A KDI PFY EHG +IFP     +  +    + ++GPKY GKYLHK+I+   
Sbjct  82   NKDKRPLFAAKDIKPFYLEHGPRIFPQNTFNWFGIGTMWKSVTGPKYGGKYLHKVIKEKL  141

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G+T L +TLT+VVIP FDI
Sbjct  142  GETHLHETLTNVVIPAFDI  160



>ref|XP_010059972.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66467.1| hypothetical protein EUGRSUZ_F00264 [Eucalyptus grandis]
Length=409

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG+IPGTI+A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML +
Sbjct  17   LITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTS  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+N RPL+A KDI  FY ++  KIFP     F       + ++GPKYDGKYLHKL+Q  
Sbjct  77   PDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLHKLVQEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL QTLT+VVIPTFDI
Sbjct  137  LGNRRLHQTLTNVVIPTFDI  156



>gb|EEC84713.1| hypothetical protein OsI_31673 [Oryza sativa Indica Group]
Length=387

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP  ++ +LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T MLAA
Sbjct  18   LITVLSIDGGGIRGIIPAVVLTFLESELQKLDGEEARIADYFDVIAGTSTGGLVTAMLAA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K +RPL+A KDI  FY  H  KIFP   G F  +    R +SGP YDGK+LH++++  
Sbjct  78   PNKKRRPLFAAKDIKAFYMNHAPKIFPQLRGPFGRMMRIFRSMSGPSYDGKHLHEVVREK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL QTLT+VVIPTFDI
Sbjct  138  LGSTRLHQTLTNVVIPTFDI  157



>ref|XP_008813724.1| PREDICTED: patatin-like protein 2 isoform X1 [Phoenix dactylifera]
Length=410

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 106/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  I+++LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML A
Sbjct  19   LITILSIDGGGIRGIIPAVILSFLELELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD++ RPL+A KDI  FY     KIFP   GI   +    R L GP+Y+GKYLHKLI+  
Sbjct  79   PDEDNRPLFAAKDIESFYLAESPKIFPQYGGILAPITRMVRALWGPRYNGKYLHKLIREN  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G  RL QTLT+VVIPTFDI
Sbjct  139  LGSMRLHQTLTNVVIPTFDI  158



>ref|NP_001063402.2| Os09g0462400 [Oryza sativa Japonica Group]
 dbj|BAD38550.1| putative patatin homolog [Oryza sativa Japonica Group]
 gb|EAZ45016.1| hypothetical protein OsJ_29655 [Oryza sativa Japonica Group]
 dbj|BAF25316.2| Os09g0462400 [Oryza sativa Japonica Group]
Length=387

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP  ++ +LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T MLAA
Sbjct  18   LITVLSIDGGGIRGIIPAVVLTFLESELQKLDGEEARIADYFDVIAGTSTGGLVTAMLAA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K +RPL+A KDI  FY  H  KIFP   G F  +    R +SGP YDGK+LH++++  
Sbjct  78   PNKKRRPLFAAKDIKAFYMNHAPKIFPQLRGPFGRMMRIFRSMSGPSYDGKHLHEVVREK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL QTLT+VVIPTFDI
Sbjct  138  LGSTRLHQTLTNVVIPTFDI  157



>ref|XP_006829702.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
 gb|ERM97118.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
Length=407

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG IP TI+++LE QLQ LDG D R+ADYFDVIAGTSTGGL+T MLA 
Sbjct  19   MITILSIDGGGIRGTIPATILSFLEHQLQILDGEDVRIADYFDVIAGTSTGGLVTAMLAT  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P K+ RPLYA KDI  FY EH  KIFP S+G+  +      ++S PKYDGKYLH LI+  
Sbjct  79   PGKDNRPLYAAKDIPTFYLEHCPKIFPQSSGVLASTTKLWGVVSRPKYDGKYLHDLIRRE  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD +L QTLT++V+PTFDI
Sbjct  139  LGDKKLHQTLTNIVVPTFDI  158



>ref|XP_006829694.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
 gb|ERM97110.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
Length=405

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            ITILSIDGGG+RGIIPG I+++LE QLQALDG + R+ DYFDVIAGTSTGGL+TTML AP
Sbjct  18   ITILSIDGGGVRGIIPGIILSFLESQLQALDGEEVRLVDYFDVIAGTSTGGLVTTMLTAP  77

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            D+NKRPLYA KDIVPFY EH  KIFP   G F +       + GPKYDGKYL +L +   
Sbjct  78   DENKRPLYAAKDIVPFYLEHCPKIFPHPRGPFSSALKVISAVIGPKYDGKYLRRLARETL  137

Query  361  GDTRLSQTLTHVVIPTFDI  417
             D RL  TLT+VVIPTFDI
Sbjct  138  KDKRLHDTLTNVVIPTFDI  156



>ref|XP_009367484.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=415

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGGIRGIIPGTI+++LE +LQ LDG DAR+ADYFDVI GTSTGGL+T ML  
Sbjct  22   LVTVLSIDGGGIRGIIPGTILSFLESELQKLDGEDARLADYFDVITGTSTGGLVTAMLTT  81

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP--SAGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPL++ KDI  FY EH  KIFP  SA +     D  + L+GPKYDGKYLH +++ 
Sbjct  82   PDENNRPLFSAKDINAFYLEHCPKIFPQGSAPLIGEAVDMVKNLTGPKYDGKYLHNIVKE  141

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GD RL+ TLT+V+IPTFDI
Sbjct  142  KLGDKRLNDTLTNVIIPTFDI  162



>ref|XP_006419185.1| hypothetical protein CICLE_v10030450mg, partial [Citrus clementina]
 gb|ESR32425.1| hypothetical protein CICLE_v10030450mg, partial [Citrus clementina]
Length=381

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A+LE +LQ LDG +AR+ADYFDVI+GTSTGGL+T ML A
Sbjct  18   LVTILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPL+A KDI  FY  H  KIFP S+G F       + L+GPKYDGKYLH+L++  
Sbjct  78   PNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDGKYLHRLVKEK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD +L +TLT+VVIPTFDI
Sbjct  138  LGDKKLHETLTNVVIPTFDI  157



>ref|XP_002510260.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52447.1| Patatin T5 precursor, putative [Ricinus communis]
Length=405

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPG I+++LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T MLA 
Sbjct  17   LVTILSIDGGGIRGIIPGIILSFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAC  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP--SAGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P++  RP++A KDI  FY     KIFP  S  +F  V    R LSGPKY+GKYLH L++ 
Sbjct  77   PNEKNRPVFAAKDIKDFYLNECPKIFPQHSWKLFPHVSRVIRALSGPKYNGKYLHNLVKE  136

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              G+T+L+QTLT+VVIPTFDI
Sbjct  137  KLGNTKLNQTLTNVVIPTFDI  157



>emb|CDX72620.1| BnaC07g46420D [Brassica napus]
Length=412

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 111/147 (76%), Gaps = 8/147 (5%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPGTI+AYLE QLQ LDG +AR+ DYFDVI+GTSTGGL+  ML A
Sbjct  19   LVTILSIDGGGIRGIIPGTILAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAMLTA  78

Query  181  PDKN-------KRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYL  336
             DK         RPL+A K+IV FY +H  KIFP S G+    +   RL+ GPKY+GKYL
Sbjct  79   EDKEFKSSRNRNRPLFAAKEIVSFYLKHSPKIFPQSRGMCSWAQTMRRLVCGPKYNGKYL  138

Query  337  HKLIQNLCGDTRLSQTLTHVVIPTFDI  417
            H++IQ   GDTRL+QT+T+VVIP FDI
Sbjct  139  HEVIQGYLGDTRLTQTMTNVVIPCFDI  165



>ref|XP_009589625.1| PREDICTED: patatin-like protein 3 [Nicotiana tomentosiformis]
Length=411

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LS+DGGGIRGIIPGT++A+LE +LQ LDGP+AR+ADYFDV+AGTSTGGL+TTML A
Sbjct  32   MVTVLSVDGGGIRGIIPGTVLAFLESKLQELDGPNARLADYFDVVAGTSTGGLITTMLTA  91

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            P+ + RPLY  KDI  FY EHG +IF  +     VR  T L  GPKYDGKYL  +I ++ 
Sbjct  92   PNMDNRPLYQAKDISNFYMEHGPQIFSQSRRNSFVRRVTNLFGGPKYDGKYLRSIINSIL  151

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G+  + QTLT+ +IPTFDI
Sbjct  152  GNLTMKQTLTNTIIPTFDI  170



>ref|XP_006829697.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
 gb|ERM97113.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
Length=404

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP TI+++LE +LQ LDG + R+ DYFDV+AGTSTGGL+T M+ A
Sbjct  17   LITILSIDGGGIRGIIPATILSFLESELQNLDGEEVRLVDYFDVMAGTSTGGLVTAMITA  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P  N RPLYA KDI  FY +H  KIF  ++G+  +VR     ++GPKYDGKYLHKL++  
Sbjct  77   PGDNNRPLYAAKDITSFYLDHCPKIFSQTSGLLGSVRKFVSAVTGPKYDGKYLHKLVRKQ  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RL QTLT VVIPTFDI
Sbjct  137  LGDKRLHQTLTKVVIPTFDI  156



>ref|XP_009410116.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=413

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGG+RG+IPGTI+++LE +LQ LDGPDAR+ADYFDVI GTSTGGL+T M+ A
Sbjct  29   LITVLSIDGGGVRGLIPGTIISFLESKLQELDGPDARIADYFDVITGTSTGGLLTAMITA  88

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++N RP+++ K+++ FY E+  KIFP A G   +V      + GPKYDGK+LH  +++L
Sbjct  89   PNENNRPMFSAKEVIDFYLENSPKIFPQAKGFLSSVTKLAGAIMGPKYDGKFLHTKVKDL  148

Query  358  CGDTRLSQTLTHVVIPTFDI  417
              +T+LSQTLT+V+IPTFDI
Sbjct  149  LTETKLSQTLTNVIIPTFDI  168



>ref|XP_004973692.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=401

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGG+RGIIP  ++A+LE++LQ LDGPDAR+ADYFDVIAGTSTGGL+TTMLAA
Sbjct  20   LVTVLSIDGGGVRGIIPAVVLAFLEEKLQELDGPDARIADYFDVIAGTSTGGLLTTMLAA  79

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAG-IFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P KN RPL+  KD+  FY +H  KIFP    I   +    R++ GPKYDGKYLH L+   
Sbjct  80   PGKNGRPLFNAKDLAQFYIDHSPKIFPQKNWILSKIFGTLRMVRGPKYDGKYLHALLGQY  139

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD +L + LT+V+IPTFDI
Sbjct  140  LGDMKLDKALTNVIIPTFDI  159



>ref|XP_009393655.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=414

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGG+RG+IPGT++A+LE +LQ LDGPDAR+ADYFDVI GTSTGGL++ M+ +
Sbjct  30   LITVLSIDGGGVRGLIPGTVLAFLELKLQELDGPDARIADYFDVITGTSTGGLLSAMITS  89

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+NKRPL++   ++ FY E+  KIFP  +G+F ++      + GPKYDGK+LH  ++ L
Sbjct  90   PDENKRPLFSANQVIDFYLENSPKIFPQGSGMFSSLTKLVSAIRGPKYDGKFLHSKVKQL  149

Query  358  CGDTRLSQTLTHVVIPTFDI  417
              +T+LS+TLT+V+IPTFDI
Sbjct  150  LTETKLSETLTNVIIPTFDI  169



>ref|XP_007136666.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
 gb|ESW08660.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
Length=408

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIR IIP TI+A+LE QLQ LDG DAR+ADYFDVIAGTSTGGL+T ML+A
Sbjct  19   LVTILSIDGGGIRAIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTGGLVTAMLSA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+ ++RPL+A KDI PFY +H  KIFP  + I+  ++   R L GPKYD KYL  +++  
Sbjct  79   PNDHQRPLFAAKDIRPFYLDHSPKIFPQRSSIWGWIQKLLRSLGGPKYDAKYLQGVVREK  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TRL +TLT++VIPTFDI
Sbjct  139  LGETRLHETLTNIVIPTFDI  158



>ref|XP_010059758.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=324

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG+IPGTI+A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML +
Sbjct  17   LITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTS  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+N RPL+A KDI  FY ++  KIFP     F       + ++GPKYDGKYLHKL++  
Sbjct  77   PDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYLHKLVKEK  136

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL QTLT+VVIPTFDI
Sbjct  137  LGNRRLHQTLTNVVIPTFDI  156



>ref|XP_002523557.1| Patatin class 1 precursor, putative [Ricinus communis]
 gb|EEF38752.1| Patatin class 1 precursor, putative [Ricinus communis]
Length=398

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 109/139 (78%), Gaps = 5/139 (4%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIP TI+++LE +LQ LDG   R+ADYFDVIAGTSTGGL+ +ML AP
Sbjct  19   ITVLSIDGGGIRGIIPATILSFLESKLQELDGEHVRIADYFDVIAGTSTGGLIASMLTAP  78

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            D+N+RPLY  KDIVPFY +H  +IFP S GI   +R     L GPKYDGKYL KLI+ + 
Sbjct  79   DENRRPLYKAKDIVPFYLKHCPQIFPQSWGIIMKIRS----LMGPKYDGKYLRKLIRKIL  134

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G+ RL +T+T VV+PTFDI
Sbjct  135  GNRRLHETVTRVVVPTFDI  153



>ref|XP_010101003.1| Patatin group A-3 [Morus notabilis]
 gb|EXB86651.1| Patatin group A-3 [Morus notabilis]
Length=411

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 109/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP  ++ +LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T MLAA
Sbjct  16   VITVLSIDGGGIRGIIPAIVLGFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVR--DATRLLSGPKYDGKYLHKLIQN  354
            P++  RPL+A KDI  FY +H  KIFP   I    R  +  + L+GPKYDGKYLHKL++ 
Sbjct  76   PNEKNRPLFAAKDIKNFYLQHCPKIFPQDSIPLAGRATEIIKSLTGPKYDGKYLHKLLKE  135

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GD +L QTLT+V+IPTFDI
Sbjct  136  KLGDLKLHQTLTNVIIPTFDI  156



>ref|XP_006829698.1| hypothetical protein AMTR_s00126p00052810, partial [Amborella 
trichopoda]
 gb|ERM97114.1| hypothetical protein AMTR_s00126p00052810, partial [Amborella 
trichopoda]
Length=323

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            +TILSIDGGGIRGIIP TI+++LE +LQ LDG + R+ADYFDVIAGTSTGGL+T M+  P
Sbjct  18   VTILSIDGGGIRGIIPATILSFLESELQKLDGEEVRLADYFDVIAGTSTGGLVTAMITTP  77

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
              N RPLYA KDI  FY +H  KIFP S+G   +    T  ++GPKYDGKYLHK+++   
Sbjct  78   GNNDRPLYAAKDITTFYLDHCPKIFPQSSGFLGSAFKFTSAVTGPKYDGKYLHKIVRKEL  137

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GD RL +TLT+VVIPTFDI
Sbjct  138  GDKRLHETLTNVVIPTFDI  156



>ref|XP_008776828.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=386

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGG+RGIIPGTI+A+LE +LQ LDG D R+ADYFDV+AGTSTGGL+T MLAA
Sbjct  1    MVTVLSIDGGGVRGIIPGTILAFLESKLQELDGEDVRIADYFDVVAGTSTGGLVTAMLAA  60

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP--SAGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RPL+A K+I  FY E+  KIFP    GI  +V+     ++GPKYDGKYLH  ++ 
Sbjct  61   PDENNRPLFAAKEINDFYLENCPKIFPKNGNGILGSVKSLLGSIAGPKYDGKYLHSKVKQ  120

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
            L G  RL QTLT++VIPTFDI
Sbjct  121  LLGGIRLHQTLTNIVIPTFDI  141



>ref|XP_006388385.1| hypothetical protein POPTR_0202s00220g [Populus trichocarpa]
 gb|ERP47299.1| hypothetical protein POPTR_0202s00220g [Populus trichocarpa]
Length=390

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIPGTI+A+LE +LQ LDG DAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  20   ITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLAAP  79

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            +K  RPL+A KDI  FY E+  KIFP  +  F +  +  + L GPKYDGK+LH +++   
Sbjct  80   NKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLGGPKYDGKFLHSIVKEKL  139

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GDT L QTLT++VIPTFDI
Sbjct  140  GDTWLHQTLTNIVIPTFDI  158



>ref|XP_009349524.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=412

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 107/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIPG I+++LE +LQ LDG DAR+ADYFDVI GTSTGGL+T ML  
Sbjct  14   LITVLSIDGGGIRGIIPGIILSFLESELQKLDGKDARLADYFDVITGTSTGGLVTAMLTT  73

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+N RPLYA KDI PFY E+G KIFP  + I   +    ++L  PKYDGK+LH L++  
Sbjct  74   PDENNRPLYAAKDITPFYLENGPKIFPQDSSIVANLAMNVKVLGRPKYDGKFLHSLLREK  133

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD  L  TLT+VVIPTFDI
Sbjct  134  LGDKHLRHTLTNVVIPTFDI  153



>ref|XP_006387188.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
 gb|ERP46102.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
Length=403

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIPGTI+A+LE +LQ LDG DAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  20   ITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLAAP  79

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            +K  RPL+A KDI  FY E+  KIFP  +  F +  +  + L GPKYDGK+LH +++   
Sbjct  80   NKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLGGPKYDGKFLHSIVKEKL  139

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GDT L QTLT++VIPTFDI
Sbjct  140  GDTWLHQTLTNIVIPTFDI  158



>ref|XP_007203506.1| hypothetical protein PRUPE_ppa024781mg [Prunus persica]
 gb|EMJ04705.1| hypothetical protein PRUPE_ppa024781mg [Prunus persica]
Length=398

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 108/139 (78%), Gaps = 5/139 (4%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIP TI+ +LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T ML AP
Sbjct  16   ITVLSIDGGGIRGIIPATILTFLESKLQELDGEEARIADYFDVIAGTSTGGLITAMLTAP  75

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            D+NKRPLY  KDIVPFY  H  KIFP S+G    +    R L GPKYDGKYL KL++ + 
Sbjct  76   DQNKRPLYEAKDIVPFYLNHCPKIFPQSSGPLMRM----RALRGPKYDGKYLRKLVRKIL  131

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G  RL +T+T +V+PTFDI
Sbjct  132  GTRRLHETVTRIVVPTFDI  150



>ref|XP_006372536.1| hypothetical protein POPTR_0017s02540g [Populus trichocarpa]
 gb|ERP50333.1| hypothetical protein POPTR_0017s02540g [Populus trichocarpa]
Length=368

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = +1

Query  4    ITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAAP  183
            IT+LSIDGGGIRGIIPGTI+A+LE +LQ LDG DAR+ADYFDVI+GTSTGGL+T MLAAP
Sbjct  20   ITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLAAP  79

Query  184  DKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            +K  RPL+A KDI  FY E+  KIFP  +  F +  +  + L GPKYDGK+LH +++   
Sbjct  80   NKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLRGPKYDGKFLHSIVKEKL  139

Query  361  GDTRLSQTLTHVVIPTFDI  417
            GDT L QTLT++VIPTFDI
Sbjct  140  GDTWLHQTLTNIVIPTFDI  158



>ref|XP_009370192.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=350

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            I+T+LSIDGGGIRG+IP TI+A+LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T MLAA
Sbjct  16   IVTVLSIDGGGIRGLIPATILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLAA  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP--SAGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P++N RPL+A KDI+ FY     KIFP  +  IF       + L+GPKY+GKYLH+LI+ 
Sbjct  76   PNENNRPLFAAKDIIDFYINQCPKIFPQNTWPIFPNTTKIIKALAGPKYNGKYLHRLIRE  135

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              G+ +L  TLT+VVIPTFDI
Sbjct  136  RLGNKKLHDTLTNVVIPTFDI  156



>ref|XP_007017307.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
 gb|EOY14532.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
Length=410

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPGTI+A LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML  
Sbjct  16   LITILSIDGGGIRGIIPGTILAVLESELQKLDGEDARLADYFDVIAGTSTGGLVTGMLTC  75

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAG--IFETVRDATRLLSGPKYDGKYLHKLIQN  354
            P++  RPL+A KDI  FY  +  KIFP  G  +F       + LSGPKYDGK+LH L++ 
Sbjct  76   PNEKNRPLFAAKDIKDFYLNYCPKIFPQPGCPLFAQTSKVIKALSGPKYDGKFLHSLVKE  135

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
              GDTRL QTLT+VVIPTFDI
Sbjct  136  KLGDTRLHQTLTNVVIPTFDI  156



>ref|XP_008220195.1| PREDICTED: patatin-like protein 2 isoform X2 [Prunus mume]
Length=415

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            I+T+LSIDGGGIRGIIPGTI+ +LE +LQ LDG +AR+ DYFDVIAGTSTGGL+T ML  
Sbjct  23   IVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLVDYFDVIAGTSTGGLVTAMLTT  82

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFET-VRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+N RPL+A KDI  FY EH  KIFP      + +    + +SGPKYDGKYLHK+++ +
Sbjct  83   PDENNRPLFAAKDINDFYLEHCPKIFPQDRYLTSYLTSMVKAVSGPKYDGKYLHKIMKEI  142

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD RLS TLT+V+IPTFDI
Sbjct  143  LGDIRLSDTLTNVIIPTFDI  162



>ref|XP_011017230.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
 ref|XP_011013052.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=408

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRG+IPGTI+ +LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T ML  
Sbjct  17   LITVLSIDGGGIRGLIPGTIINFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAMLTC  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS--AGIFETVRDATRLLSGPKYDGKYLHKLIQN  354
            PD+N RP++A KDI  FY     KIFP     +F  V+   + L+GPKYDGKYLH L++ 
Sbjct  77   PDENSRPMFAAKDIKDFYLNQCPKIFPQPRCSLFTQVKKVIKALTGPKYDGKYLHGLVKE  136

Query  355  LCGDTRLSQTLTHVVIPTFDI  417
            L G+ RL  TLT+VVIPTFDI
Sbjct  137  LLGNRRLHHTLTNVVIPTFDI  157



>ref|XP_002869007.1| PLA IVA/PLP1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45266.1| PLA IVA/PLP1 [Arabidopsis lyrata subsp. lyrata]
Length=411

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILS+DGGG+RGII G I+AYLEKQLQ LDG + R+ADYFDVIAGTSTGGL+T ML A
Sbjct  18   LVTILSLDGGGVRGIIAGVILAYLEKQLQELDGENVRLADYFDVIAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD   RP YA KDIVPFY EH  KIFP   G+   +    +LLSGPKY G YL  L+  L
Sbjct  78   PDGTGRPRYAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGNYLRTLVGTL  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+T+L QTLT++VIPTFDI
Sbjct  138  LGETKLHQTLTNIVIPTFDI  157



>ref|XP_010942709.1| PREDICTED: patatin-like protein 2, partial [Elaeis guineensis]
Length=299

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGG+RGI+PG I+A+LE +L  LDG DAR+ADYFD +AGTSTGGL+T ML A
Sbjct  76   LVTILSIDGGGVRGIVPGIILAFLESKLLELDGEDARIADYFDAVAGTSTGGLVTAMLTA  135

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PDKN RPL+A KDI  FY E+  KIFP   GIF ++ +    + GPKY+GKY HK IQ L
Sbjct  136  PDKNNRPLFAAKDINEFYLENCPKIFPQKTGIFSSMFNLFTAVRGPKYNGKYPHKKIQEL  195

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+TR+ Q LT++VIPTFDI
Sbjct  196  LGETRVHQALTNIVIPTFDI  215



>ref|XP_009780403.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=427

 Score =   129 bits (323),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 84/139 (60%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            I+T+LSIDGGGIRGIIPGT++A+LE +LQ +DGP+AR+ADYFDV+AGTSTGGL++TML A
Sbjct  31   IVTVLSIDGGGIRGIIPGTLLAFLESKLQDIDGPNARIADYFDVVAGTSTGGLISTMLTA  90

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            P+K+ RPLYA K+I  FY +HG KIFP +     V+  T L  GPKYDG YL  L++++ 
Sbjct  91   PNKDNRPLYAAKNITNFYMDHGPKIFPESSRSGFVKRITNLFGGPKYDGNYLRTLVKSIL  150

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G+  + QTLT  +IP FDI
Sbjct  151  GNLTMKQTLTQTIIPAFDI  169



>ref|XP_004152795.1| PREDICTED: patatin group A-3-like, partial [Cucumis sativus]
Length=406

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIPGTI+ +LE +LQ LDG DAR+ADYFDVIAGTSTGGL+T M+ +
Sbjct  17   LITILSIDGGGIRGIIPGTILTFLESELQKLDGEDARIADYFDVIAGTSTGGLLTAMITS  76

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            P++N RPLY+ KDI  F+ +H + IFP    +   +   + L GPKYDGKYLH+L++   
Sbjct  77   PNENNRPLYSAKDIKQFFLDHSSLIFPQKMKWSLAK-VLKSLEGPKYDGKYLHRLVREKL  135

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G+T+L+QTLT+VVIPTFDI
Sbjct  136  GNTKLNQTLTNVVIPTFDI  154



>emb|CDX83197.1| BnaA03g23090D [Brassica napus]
Length=407

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP TI+A+LE +LQ LDG +AR+ADYFDV+AGTSTGGL+T ML A
Sbjct  18   LVTILSIDGGGIRGIIPATILAFLESELQKLDGNEARLADYFDVVAGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGI-FETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K  RPL A  +I  FY EH  KIFP     F   ++  + L+GPKYDG+YLH+LI   
Sbjct  78   PNKEGRPLLAASEIKEFYLEHCPKIFPQNHFPFSATKNLVKSLTGPKYDGEYLHQLIHAK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GDTRL QTLT+VVIPTFDI
Sbjct  138  LGDTRLHQTLTNVVIPTFDI  157



>ref|NP_001149326.1| patatin class 1 [Zea mays]
 gb|ACG35038.1| patatin class 1 precursor [Zea mays]
Length=423

 Score =   129 bits (323),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+A+LE +LQ LDGPDAR+ADYFDV+AGTSTGGL+T ML A
Sbjct  21   LITVLSIDGGGIRGIIPATILAFLEAKLQELDGPDARIADYFDVVAGTSTGGLLTAMLTA  80

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFET-VRDATRLLSGPKYDGKYLHKLIQNL  357
            PD N+RPL+A KD+  FY +H  KIF       + +    R+  GPKYDGKYLH  ++ L
Sbjct  81   PDTNERPLFAAKDLARFYIQHSPKIFRQKNAMGSKLVGKLRMACGPKYDGKYLHAQLRRL  140

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL +TLT+VVIPTFDI
Sbjct  141  LGNMRLDRTLTNVVIPTFDI  160



>ref|XP_010939457.1| PREDICTED: patatin-like protein 2 isoform X2 [Elaeis guineensis]
Length=385

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  I+++LE +LQ LDG D R+ADYFDVIAGT+TG L+  ML A
Sbjct  19   LITILSIDGGGIRGIIPAIILSFLESELQKLDGEDVRIADYFDVIAGTNTGSLVAAMLTA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+ KRPL+  KDI  FY     KIFP   GI   +    R L GPKYDGKYLHKLI+  
Sbjct  79   PDEIKRPLFTAKDIKSFYLVESPKIFPQYGGILAPIMRMARALWGPKYDGKYLHKLIREY  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL QTLT++VIPTFD+
Sbjct  139  LGNLRLHQTLTNMVIPTFDM  158



>ref|XP_006424637.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
 gb|ESR37877.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
Length=408

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRG+IP TI+A+LE +LQ LDG +AR+ADYFDVI+GTSTGGL+T ML A
Sbjct  18   LITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPL+A KDI  FY  H  KIFP S+G F       + L+GPKYDGKYLH+L++  
Sbjct  78   PNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDGKYLHRLVKEK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             GD +L +TLT+VVIPTFDI
Sbjct  138  LGDKKLHETLTNVVIPTFDI  157



>tpg|DAA48471.1| TPA: patatin class 1 [Zea mays]
Length=423

 Score =   128 bits (322),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +IT+LSIDGGGIRGIIP TI+A+LE +LQ LDGPDAR+ADYFDV+AGTSTGGL+T ML A
Sbjct  21   LITVLSIDGGGIRGIIPATILAFLEAKLQELDGPDARIADYFDVVAGTSTGGLLTAMLTA  80

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFET-VRDATRLLSGPKYDGKYLHKLIQNL  357
            PD N+RPL+A KD+  FY +H  KIF       + +    R+  GPKYDGKYLH  ++ L
Sbjct  81   PDTNERPLFAAKDLARFYIQHSPKIFRQKNAMGSKLVGKLRMACGPKYDGKYLHAQLRRL  140

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL +TLT+VVIPTFDI
Sbjct  141  LGNMRLDRTLTNVVIPTFDI  160



>ref|XP_010939456.1| PREDICTED: patatin-like protein 2 isoform X1 [Elaeis guineensis]
Length=404

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP  I+++LE +LQ LDG D R+ADYFDVIAGT+TG L+  ML A
Sbjct  19   LITILSIDGGGIRGIIPAIILSFLESELQKLDGEDVRIADYFDVIAGTNTGSLVAAMLTA  78

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            PD+ KRPL+  KDI  FY     KIFP   GI   +    R L GPKYDGKYLHKLI+  
Sbjct  79   PDEIKRPLFTAKDIKSFYLVESPKIFPQYGGILAPIMRMARALWGPKYDGKYLHKLIREY  138

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ RL QTLT++VIPTFD+
Sbjct  139  LGNLRLHQTLTNMVIPTFDM  158



>ref|XP_011099197.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=433

 Score =   128 bits (322),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 88/139 (63%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++T+LSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR+ADYFDVIAGTSTGGL+T ML+A
Sbjct  33   MVTVLSIDGGGIRGIIPGTILAHLESKLQELDGPNARIADYFDVIAGTSTGGLITAMLSA  92

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSAGIFETVRDATRLLSGPKYDGKYLHKLIQNLC  360
            P K+ RP++A  +I  FY EH   IFP +     V   T L++GPKYDGKYL  L+Q L 
Sbjct  93   PGKDNRPVFAASNITNFYLEHCPNIFPESRRNNFVGTITNLVAGPKYDGKYLKSLVQELL  152

Query  361  GDTRLSQTLTHVVIPTFDI  417
            G  ++SQTLT+VVIPTFD+
Sbjct  153  GSVKVSQTLTNVVIPTFDL  171



>gb|KFK30329.1| hypothetical protein AALP_AA7G247700 [Arabis alpina]
Length=415

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 109/150 (73%), Gaps = 11/150 (7%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIPGTI+AYLE QLQ LDG +AR+ DYFDVI+GTSTGGL+  ML A
Sbjct  19   LVTILSIDGGGIRGIIPGTILAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAMLTA  78

Query  181  PDKN----------KRPLYAGKDIVPFYKEHGAKIFPS-AGIFETVRDATRLLSGPKYDG  327
             DK            RPL+A K+IVPFY  H  +IFP   G+   V    RL+ GPKY+G
Sbjct  79   EDKEDKGSDHSRRRNRPLFAAKEIVPFYLNHSPRIFPQPRGMCSWVDTIVRLVRGPKYNG  138

Query  328  KYLHKLIQNLCGDTRLSQTLTHVVIPTFDI  417
            KYLH LI+   GDT+LS++LTHVVIP FDI
Sbjct  139  KYLHNLIEGFLGDTKLSESLTHVVIPCFDI  168



>ref|XP_004957049.1| PREDICTED: patatin-05-like [Setaria italica]
Length=384

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            ++TILSIDGGGIRGIIP  ++++LE +LQ LDG +AR+ADYFDVIAGTSTGGL+T+MLAA
Sbjct  15   LVTILSIDGGGIRGIIPAVVLSFLESELQKLDGEEARLADYFDVIAGTSTGGLVTSMLAA  74

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFPSA-GIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P+K  RPL+A KDI  FY  H  KIFP   G F  +    R LSGP YDGKYLH++++  
Sbjct  75   PNKKNRPLFAAKDIQEFYMNHAPKIFPQKRGPFGGIMRIFRSLSGPSYDGKYLHEVVRKK  134

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G TRL +TLT VVIPTFDI
Sbjct  135  LGITRLHETLTDVVIPTFDI  154



>ref|XP_006473887.1| PREDICTED: patatin-05-like [Citrus sinensis]
Length=408

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 110/140 (79%), Gaps = 1/140 (1%)
 Frame = +1

Query  1    IITILSidgggirgiipgtiVAYLEKQLQALDGPDARVADYFDVIAgtstgglmttmlAA  180
            +ITILSIDGGGIRGIIP TI+A+LE +LQ LDG +AR+ADYFDVI+GTSTGGL+T ML A
Sbjct  18   LITILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFDVISGTSTGGLVTAMLTA  77

Query  181  PDKNKRPLYAGKDIVPFYKEHGAKIFP-SAGIFETVRDATRLLSGPKYDGKYLHKLIQNL  357
            P++  RPL+A KDI  FY  H  KIFP S+G F       + L+GPKYDGKYLH+L++  
Sbjct  78   PNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSLTGPKYDGKYLHRLVKEK  137

Query  358  CGDTRLSQTLTHVVIPTFDI  417
             G+ +L +TLT+VVIPTFDI
Sbjct  138  LGNKKLHETLTNVVIPTFDI  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560060235700