BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I23

Length=556
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK48495.1|AF259983_1  putative cysteine protease                    300   1e-96   Ipomoea batatas [batate]
ref|XP_011069730.1|  PREDICTED: low-temperature-induced cysteine ...    238   2e-72   Sesamum indicum [beniseed]
dbj|BAF46304.1|  cysteine proteinase precursor                          230   1e-69   Ipomoea nil [qian niu]
emb|CDP01294.1|  unnamed protein product                                224   2e-67   Coffea canephora [robusta coffee]
ref|XP_011074404.1|  PREDICTED: low-temperature-induced cysteine ...    224   4e-67   Sesamum indicum [beniseed]
dbj|BAE80740.1|  cysteine proteinase                                    221   5e-66   Platycodon grandiflorus [balloon-flower]
ref|XP_009769754.1|  PREDICTED: low-temperature-induced cysteine ...    216   3e-64   Nicotiana sylvestris
gb|AGV15823.1|  cysteine protease CP15                                  216   3e-64   Nicotiana tabacum [American tobacco]
ref|XP_009613155.1|  PREDICTED: low-temperature-induced cysteine ...    216   3e-64   Nicotiana tomentosiformis
ref|XP_010059895.1|  PREDICTED: low-temperature-induced cysteine ...    216   4e-64   Eucalyptus grandis [rose gum]
ref|XP_009775102.1|  PREDICTED: low-temperature-induced cysteine ...    216   5e-64   Nicotiana sylvestris
ref|XP_006473275.1|  PREDICTED: cysteine proteinase RD21a-like          215   8e-64   Citrus sinensis [apfelsine]
ref|NP_001234324.1|  low-temperature-induced cysteine proteinase ...    214   1e-63   Solanum lycopersicum
ref|XP_011029381.1|  PREDICTED: cysteine proteinase RD21a               214   1e-63   Populus euphratica
gb|KCW66364.1|  hypothetical protein EUGRSUZ_F00184                     214   2e-63   Eucalyptus grandis [rose gum]
ref|XP_009604895.1|  PREDICTED: low-temperature-induced cysteine ...    214   2e-63   Nicotiana tomentosiformis
ref|XP_003545327.1|  PREDICTED: cysteine proteinase RD21a-like          214   4e-63   
gb|KHG05637.1|  Cysteinease RD21a -like protein                         213   6e-63   Gossypium arboreum [tree cotton]
gb|EPS63305.1|  hypothetical protein M569_11479                         212   6e-63   Genlisea aurea
gb|KJB14609.1|  hypothetical protein B456_002G133800                    213   7e-63   Gossypium raimondii
ref|XP_003550321.1|  PREDICTED: cysteine proteinase RD21a-like          213   7e-63   Glycine max [soybeans]
gb|KHN22488.1|  Cysteine proteinase RD21a                               212   7e-63   Glycine soja [wild soybean]
gb|KJB14610.1|  hypothetical protein B456_002G133800                    212   8e-63   Gossypium raimondii
emb|CAN61026.1|  hypothetical protein VITISV_001146                     212   2e-62   Vitis vinifera
ref|XP_002284973.1|  PREDICTED: low-temperature-induced cysteine ...    211   2e-62   Vitis vinifera
gb|AAX84673.1|  cysteine protease CP1                                   211   2e-62   Manihot esculenta [manioc]
ref|XP_007160879.1|  hypothetical protein PHAVU_001G024500g             211   2e-62   Phaseolus vulgaris [French bean]
gb|EYU36326.1|  hypothetical protein MIMGU_mgv1a005614mg                211   3e-62   Erythranthe guttata [common monkey flower]
emb|CAB17076.1|  cysteine proteinase precursor                          211   3e-62   Phaseolus vulgaris [French bean]
ref|XP_006342644.1|  PREDICTED: low-temperature-induced cysteine ...    211   3e-62   Solanum tuberosum [potatoes]
ref|NP_001274877.1|  low-temperature-induced cysteine proteinase-...    211   4e-62   Solanum tuberosum [potatoes]
gb|AFO83614.1|  papain-like cysteine protease                           211   4e-62   Fagopyrum esculentum
ref|XP_004238129.1|  PREDICTED: low-temperature-induced cysteine ...    211   4e-62   Solanum lycopersicum
ref|XP_006354848.1|  PREDICTED: cysteine proteinase RD21a-like          210   5e-62   
gb|KDP41692.1|  hypothetical protein JCGZ_16099                         209   1e-61   Jatropha curcas
ref|XP_006374886.1|  cysteine proteinase                                209   1e-61   Populus trichocarpa [western balsam poplar]
ref|XP_007017153.1|  Granulin repeat cysteine protease family pro...    207   5e-61   Theobroma cacao [chocolate]
dbj|BAD29957.1|  cysteine protease                                      206   2e-60   Daucus carota [carrots]
gb|ABG33750.1|  cysteine protease                                       205   4e-60   Hevea brasiliensis [jebe]
gb|AER60490.1|  cysteine proteases                                      202   4e-60   Gossypium hirsutum [American cotton]
ref|XP_009359945.1|  PREDICTED: low-temperature-induced cysteine ...    205   4e-60   Pyrus x bretschneideri [bai li]
ref|XP_003589134.1|  Cysteine proteinase                                201   5e-60   
ref|XP_006434711.1|  hypothetical protein CICLE_v100010541mg            196   5e-60   
ref|XP_002510170.1|  cysteine protease, putative                        205   7e-60   Ricinus communis
ref|XP_009354165.1|  PREDICTED: low-temperature-induced cysteine ...    204   8e-60   Pyrus x bretschneideri [bai li]
ref|XP_008393776.1|  PREDICTED: low-temperature-induced cysteine ...    204   8e-60   
gb|ABQ10204.1|  cysteine protease Cp6                                   204   9e-60   Actinidia deliciosa [Chinese gooseberry]
gb|KJB48623.1|  hypothetical protein B456_008G078300                    198   1e-59   Gossypium raimondii
ref|XP_006494485.1|  PREDICTED: cysteine proteinase RD21a-like          201   1e-59   Citrus sinensis [apfelsine]
gb|KJB48626.1|  hypothetical protein B456_008G078300                    199   2e-59   Gossypium raimondii
gb|KDO79088.1|  hypothetical protein CISIN_1g017419mg                   201   2e-59   Citrus sinensis [apfelsine]
ref|XP_010270819.1|  PREDICTED: cysteine proteinase RD21a-like          204   2e-59   Nelumbo nucifera [Indian lotus]
gb|KJB48624.1|  hypothetical protein B456_008G078300                    199   2e-59   Gossypium raimondii
gb|ABQ10200.1|  cysteine protease Cp2                                   200   7e-59   Actinidia deliciosa [Chinese gooseberry]
gb|KJB48625.1|  hypothetical protein B456_008G078300                    199   2e-58   Gossypium raimondii
gb|KJB48622.1|  hypothetical protein B456_008G078300                    199   2e-58   Gossypium raimondii
ref|XP_006425969.1|  hypothetical protein CICLE_v10025887mg             197   7e-58   Citrus clementina [clementine]
ref|XP_004230752.1|  PREDICTED: cysteine proteinase RD21a-like          199   8e-58   Solanum lycopersicum
ref|XP_003589135.1|  Cysteine proteinase                                199   1e-57   
ref|XP_009772520.1|  PREDICTED: cysteine proteinase RD21a-like          199   1e-57   Nicotiana sylvestris
ref|XP_010556436.1|  PREDICTED: cysteine proteinase RD21a-like          198   1e-57   Tarenaya hassleriana [spider flower]
gb|AEZ65083.1|  cysteine protease                                       198   2e-57   Carica papaya [mamon]
dbj|BAD29960.1|  cysteine protease                                      198   2e-57   Daucus carota [carrots]
ref|XP_006346518.1|  PREDICTED: cysteine proteinase RD21a-like          198   2e-57   Solanum tuberosum [potatoes]
ref|XP_004499026.1|  PREDICTED: cysteine proteinase RD21a-like          198   2e-57   Cicer arietinum [garbanzo]
ref|XP_003589133.1|  Cysteine proteinase                                198   2e-57   Medicago truncatula
ref|XP_004291075.1|  PREDICTED: cysteine proteinase RD21a               198   3e-57   Fragaria vesca subsp. vesca
ref|XP_011088223.1|  PREDICTED: low-temperature-induced cysteine ...    198   3e-57   Sesamum indicum [beniseed]
gb|KJB58559.1|  hypothetical protein B456_009G214900                    197   3e-57   Gossypium raimondii
gb|EYU25464.1|  hypothetical protein MIMGU_mgv1a006201mg                197   3e-57   Erythranthe guttata [common monkey flower]
gb|AJA74414.1|  cysteine protease                                       198   3e-57   Cicer arietinum [garbanzo]
ref|XP_008365104.1|  PREDICTED: low-temperature-induced cysteine ...    198   3e-57   
ref|XP_008236565.1|  PREDICTED: cysteine proteinase RD21a-like          198   4e-57   Prunus mume [ume]
emb|CAE54307.1|  cysteine proteinase                                    195   4e-57   Gossypium hirsutum [American cotton]
ref|XP_007222885.1|  hypothetical protein PRUPE_ppa005199mg             197   5e-57   Prunus persica
gb|KJB58557.1|  hypothetical protein B456_009G214900                    197   5e-57   Gossypium raimondii
ref|XP_009591184.1|  PREDICTED: cysteine proteinase RD21a-like          197   6e-57   Nicotiana tomentosiformis
ref|XP_008220266.1|  PREDICTED: low-temperature-induced cysteine ...    196   1e-56   Prunus mume [ume]
ref|XP_007199820.1|  hypothetical protein PRUPE_ppa005328mg             196   1e-56   
gb|KHG12125.1|  Cysteinease RD21a -like protein                         199   1e-56   Gossypium arboreum [tree cotton]
dbj|BAD29958.1|  cysteine protease                                      197   1e-56   Daucus carota [carrots]
ref|XP_010094652.1|  Cysteine proteinase RD21a                          196   1e-56   Morus notabilis
gb|KDP31986.1|  hypothetical protein JCGZ_12447                         193   2e-56   Jatropha curcas
emb|CDO97206.1|  unnamed protein product                                195   2e-56   Coffea canephora [robusta coffee]
gb|KJB63901.1|  hypothetical protein B456_010G022700                    195   3e-56   Gossypium raimondii
dbj|BAC75923.1|  cysteine protease-1                                    194   6e-56   Helianthus annuus
ref|XP_008342944.1|  PREDICTED: cysteine proteinase RD21a-like          194   9e-56   
gb|ABQ10202.1|  cysteine protease Cp4                                   194   1e-55   Actinidia deliciosa [Chinese gooseberry]
ref|XP_008361440.1|  PREDICTED: cysteine proteinase RD21a-like          189   1e-55   
gb|KHG00992.1|  Cysteinease RD21a -like protein                         191   1e-55   Gossypium arboreum [tree cotton]
ref|XP_002863697.1|  hypothetical protein ARALYDRAFT_917391             193   2e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_011097243.1|  PREDICTED: cysteine proteinase COT44               190   2e-55   Sesamum indicum [beniseed]
ref|XP_002524912.1|  cysteine protease, putative                        190   3e-55   
ref|NP_568620.1|  Granulin repeat cysteine protease family protein      192   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244238.1|  PREDICTED: cysteine proteinase RD21a-like          192   3e-55   Nelumbo nucifera [Indian lotus]
ref|XP_008377786.1|  PREDICTED: cysteine proteinase RD21a-like          189   5e-55   
emb|CAA46863.1|  thiolprotease                                          192   6e-55   Pisum sativum [garden pea]
ref|XP_010494270.1|  PREDICTED: cysteine proteinase RD21a-like          192   7e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010549252.1|  PREDICTED: cysteine proteinase RD21a-like          191   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_010481911.1|  PREDICTED: cysteine proteinase RD21a               191   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_003603086.1|  Cysteine proteinase                                191   2e-54   Medicago truncatula
ref|XP_009395501.1|  PREDICTED: oryzain alpha chain-like                190   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAQ00115.1|  papain-like cysteine proteinase                        182   3e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR19827.1|  cysteine proteinase                                     189   5e-54   Elaeis guineensis
gb|KJB43804.1|  hypothetical protein B456_007G216900                    184   5e-54   Gossypium raimondii
ref|XP_010906541.1|  PREDICTED: oryzain alpha chain-like                189   6e-54   Elaeis guineensis
ref|XP_009335017.1|  PREDICTED: cysteine proteinase RD21a-like is...    189   8e-54   Pyrus x bretschneideri [bai li]
ref|XP_009335016.1|  PREDICTED: cysteine proteinase RD21a-like is...    189   8e-54   Pyrus x bretschneideri [bai li]
ref|XP_010070600.1|  PREDICTED: cysteine proteinase COT44-like          187   1e-53   Eucalyptus grandis [rose gum]
ref|XP_008799871.1|  PREDICTED: oryzain alpha chain-like isoform X1     188   1e-53   
ref|XP_010540378.1|  PREDICTED: cysteine proteinase RD21a-like          188   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_009618803.1|  PREDICTED: cysteine proteinase COT44-like          186   2e-53   Nicotiana tomentosiformis
gb|AAK07730.1|  CPR1-like cysteine proteinase                           185   2e-53   Nicotiana tabacum [American tobacco]
ref|XP_006343212.1|  PREDICTED: cysteine proteinase RD21a-like          185   2e-53   
ref|XP_002518705.1|  cysteine protease, putative                        187   2e-53   Ricinus communis
ref|XP_010442084.1|  PREDICTED: cysteine proteinase RD21a-like          187   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010928366.1|  PREDICTED: oryzain alpha chain-like                187   3e-53   Elaeis guineensis
gb|EYU37647.1|  hypothetical protein MIMGU_mgv1a005905mg                187   4e-53   Erythranthe guttata [common monkey flower]
ref|XP_009784112.1|  PREDICTED: cysteine proteinase COT44-like          185   4e-53   Nicotiana sylvestris
ref|XP_011000919.1|  PREDICTED: cysteine proteinase RD21a-like          187   4e-53   Populus euphratica
ref|XP_007042494.1|  Granulin repeat cysteine protease family pro...    189   4e-53   
gb|KHN27075.1|  Cysteine proteinase RD21a                               184   5e-53   Glycine soja [wild soybean]
ref|XP_006280322.1|  hypothetical protein CARUB_v10026245mg             187   5e-53   
gb|AAQ62999.1|  oil palm polygalacturonase allergen PEST472             187   6e-53   Elaeis guineensis
gb|ACU13684.1|  unknown                                                 180   6e-53   Glycine max [soybeans]
ref|XP_003550041.1|  PREDICTED: cysteine proteinase RD21a-like          184   8e-53   Glycine max [soybeans]
ref|XP_002285299.1|  PREDICTED: cysteine proteinase RD21a-like          186   1e-52   Vitis vinifera
ref|XP_010061721.1|  PREDICTED: low-temperature-induced cysteine ...    186   1e-52   Eucalyptus grandis [rose gum]
emb|CDX71540.1|  BnaC04g17750D                                          185   1e-52   
ref|XP_008813817.1|  PREDICTED: low-temperature-induced cysteine ...    186   1e-52   Phoenix dactylifera
ref|XP_002310708.2|  hypothetical protein POPTR_0007s10650g             183   1e-52   Populus trichocarpa [western balsam poplar]
gb|AAL60579.1|AF454957_1  senescence-associated cysteine protease       185   1e-52   Brassica oleracea
ref|XP_002306486.2|  hypothetical protein POPTR_0005s18520g             184   2e-52   
gb|KFK31760.1|  hypothetical protein AALP_AA6G155800                    185   2e-52   Arabis alpina [alpine rockcress]
ref|XP_007047371.1|  Granulin repeat cysteine protease family pro...    183   2e-52   
gb|KJB43805.1|  hypothetical protein B456_007G216900                    183   2e-52   Gossypium raimondii
gb|KJB43803.1|  hypothetical protein B456_007G216900                    183   2e-52   Gossypium raimondii
emb|CAB16317.1|  cysteine proteinase precursor                          183   2e-52   Nicotiana tabacum [American tobacco]
gb|KFK44641.1|  hypothetical protein AALP_AA1G285100                    184   3e-52   Arabis alpina [alpine rockcress]
gb|EYU34557.1|  hypothetical protein MIMGU_mgv1a007408mg                183   3e-52   Erythranthe guttata [common monkey flower]
gb|KDP47124.1|  hypothetical protein JCGZ_22120                         178   3e-52   Jatropha curcas
emb|CDY22370.1|  BnaA06g36920D                                          184   4e-52   Brassica napus [oilseed rape]
ref|XP_009101816.1|  PREDICTED: cysteine proteinase RD21a               184   4e-52   Brassica rapa
gb|KCW68708.1|  hypothetical protein EUGRSUZ_F02310                     184   6e-52   Eucalyptus grandis [rose gum]
ref|XP_008350332.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    184   7e-52   
ref|XP_002894032.1|  F2G19.31/F2G19.31                                  183   9e-52   
gb|KHN04480.1|  Cysteine proteinase RD21a                               181   1e-51   Glycine soja [wild soybean]
ref|XP_009358749.1|  PREDICTED: cysteine proteinase RD21a-like          183   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_010028205.1|  PREDICTED: cysteine proteinase COT44-like          181   1e-51   Eucalyptus grandis [rose gum]
ref|XP_002313136.2|  hypothetical protein POPTR_0009s10090g             183   1e-51   
ref|XP_010691718.1|  PREDICTED: cysteine proteinase RD21a-like          183   1e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|AEZ65082.1|  cysteine protease                                       182   2e-51   Carica papaya [mamon]
gb|KHN30007.1|  Cysteine proteinase RD21a                               180   2e-51   Glycine soja [wild soybean]
gb|ACB87490.1|  mucunain                                                181   2e-51   Mucuna pruriens
ref|XP_006393620.1|  hypothetical protein EUTSA_v10011464mg             182   3e-51   Eutrema salsugineum [saltwater cress]
ref|XP_002283263.1|  PREDICTED: cysteine proteinase COT44               179   4e-51   Vitis vinifera
ref|XP_004234718.1|  PREDICTED: cysteine proteinase COT44-like          179   4e-51   
ref|XP_003547817.1|  PREDICTED: cysteine proteinase RD21a               179   4e-51   Glycine max [soybeans]
gb|KEH31479.1|  papain family cysteine protease                         179   5e-51   Medicago truncatula
ref|XP_009390984.1|  PREDICTED: oryzain alpha chain-like                181   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006403303.1|  hypothetical protein EUTSA_v10003205mg             181   5e-51   Eutrema salsugineum [saltwater cress]
ref|XP_007205396.1|  hypothetical protein PRUPE_ppa007467mg             179   7e-51   Prunus persica
gb|KHG18408.1|  Cysteinease RD21a -like protein                         179   7e-51   Gossypium arboreum [tree cotton]
dbj|BAG16371.1|  cysteine protease                                      180   8e-51   Brassica oleracea var. italica [asparagus broccoli]
ref|NP_001242660.1|  uncharacterized protein LOC100807362 precursor     178   1e-50   Glycine max [soybeans]
emb|CDY17093.1|  BnaC06g00260D                                          180   1e-50   Brassica napus [oilseed rape]
ref|XP_009398671.1|  PREDICTED: oryzain alpha chain-like                180   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006307278.1|  hypothetical protein CARUB_v10008893mg             181   2e-50   
gb|AAL60580.1|AF454958_1  senescence-associated cysteine protease       180   2e-50   Brassica oleracea
ref|XP_002298740.2|  hypothetical protein POPTR_0001s30950g             180   2e-50   
gb|ABQ10198.1|  actinidin Act4b                                         178   2e-50   Actinidia eriantha
gb|AFK47737.1|  unknown                                                 177   2e-50   Medicago truncatula
dbj|BAD95392.1|  cysteine proteinase RD21A                              179   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231872.1|  PREDICTED: zingipain-2-like                        177   3e-50   Solanum lycopersicum
ref|XP_011000142.1|  PREDICTED: cysteine proteinase RD21a-like          179   4e-50   Populus euphratica
ref|NP_564497.1|  cysteine proteinase RD21a                             179   4e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAK62661.1|  F2G19.31/F2G19.31                                       179   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011008779.1|  PREDICTED: cysteine proteinase COT44               177   4e-50   Populus euphratica
dbj|BAG16377.1|  cysteine protease                                      178   4e-50   Brassica rapa var. perviridis [kabuna]
gb|KHN12823.1|  Cysteine proteinase RD21a                               176   7e-50   Glycine soja [wild soybean]
ref|XP_009123448.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    178   7e-50   
ref|NP_001242584.1|  uncharacterized protein LOC100804015 precursor     176   8e-50   Glycine max [soybeans]
ref|XP_004136967.1|  PREDICTED: cysteine proteinase RD21a-like          178   8e-50   Cucumis sativus [cucumbers]
emb|CDY06760.1|  BnaA10g05390D                                          178   8e-50   
ref|XP_008454976.1|  PREDICTED: low-temperature-induced cysteine ...    178   1e-49   Cucumis melo [Oriental melon]
ref|XP_006339859.1|  PREDICTED: cysteine proteinase RD21a-like          175   2e-49   Solanum tuberosum [potatoes]
ref|XP_010500237.1|  PREDICTED: cysteine proteinase RD21a-like          177   2e-49   Camelina sativa [gold-of-pleasure]
ref|NP_001150196.1|  cysteine protease 1 precursor                      177   2e-49   Zea mays [maize]
ref|XP_010461511.1|  PREDICTED: cysteine proteinase RD21a-like          177   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009396268.1|  PREDICTED: oryzain alpha chain-like                177   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD16614.1|  cysteine proteinase                                    176   3e-49   Dianthus caryophyllus [carnation]
ref|XP_008238897.1|  PREDICTED: cysteine proteinase COT44               174   4e-49   Prunus mume [ume]
gb|AAL14614.1|AF417109_1  cysteine proteinase precursor                 169   4e-49   Vasconcellea cundinamarcensis
gb|ABQ10191.1|  actinidin Act1c                                         174   5e-49   Actinidia eriantha
ref|NP_001150266.1|  cysteine protease 1 precursor                      176   7e-49   
gb|ACR34204.1|  unknown                                                 176   8e-49   Zea mays [maize]
ref|XP_008668054.1|  PREDICTED: cysteine protease 1 isoform X1          175   9e-49   Zea mays [maize]
ref|XP_010688590.1|  PREDICTED: low-temperature-induced cysteine ...    175   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008452589.1|  PREDICTED: low-temperature-induced cysteine ...    176   1e-48   
ref|XP_010028191.1|  PREDICTED: cysteine proteinase COT44-like          173   1e-48   Eucalyptus grandis [rose gum]
dbj|BAH20463.1|  cysteine protease                                      175   1e-48   Spinacia oleracea
ref|XP_006595983.1|  PREDICTED: cysteine proteinase RD21a-like          169   1e-48   
emb|CDY17044.1|  BnaA08g04080D                                          174   2e-48   Brassica napus [oilseed rape]
tpg|DAA35450.1|  TPA: cysteine protease 1                               176   2e-48   
ref|XP_009367558.1|  PREDICTED: cysteine proteinase COT44-like          172   2e-48   
emb|CDY63586.1|  BnaCnng42340D                                          174   2e-48   Brassica napus [oilseed rape]
ref|XP_004304028.1|  PREDICTED: cysteine proteinase RD21a-like          174   2e-48   Fragaria vesca subsp. vesca
gb|ABQ10192.1|  actinidin Act2a                                         172   3e-48   Actinidia deliciosa [Chinese gooseberry]
ref|XP_008338342.1|  PREDICTED: cysteine proteinase COT44-like          171   6e-48   
ref|XP_010093524.1|  Germination-specific cysteine protease 1           171   7e-48   
gb|ACU18172.1|  unknown                                                 170   8e-48   Glycine max [soybeans]
ref|XP_010107858.1|  Cysteine proteinase RD21a                          173   8e-48   Morus notabilis
gb|AHY28813.1|  cysteine protease                                       165   8e-48   Pinus elliottii [American pitch pine]
gb|KJB58558.1|  hypothetical protein B456_009G214900                    172   9e-48   Gossypium raimondii
ref|XP_004169515.1|  PREDICTED: cysteine proteinase RD21a-like          172   1e-47   
dbj|BAC75927.1|  cysteine protease-5                                    170   1e-47   Helianthus annuus
gb|ABQ10196.1|  actinidin Act3a                                         171   1e-47   Actinidia eriantha
gb|KGN55227.1|  hypothetical protein Csa_4G641600                       172   1e-47   Cucumis sativus [cucumbers]
ref|XP_006422960.1|  hypothetical protein CICLE_v10028338mg             172   1e-47   Citrus clementina [clementine]
emb|CDY25228.1|  BnaC02g30040D                                          172   1e-47   Brassica napus [oilseed rape]
gb|AHY28814.1|  cysteine protease                                       165   2e-47   Pinus palustris [longleaf pine]
ref|XP_010479116.1|  PREDICTED: cysteine proteinase RD21a               172   2e-47   Camelina sativa [gold-of-pleasure]
gb|ABQ10197.1|  actinidin Act4a                                         170   2e-47   Actinidia eriantha
ref|XP_004141271.1|  PREDICTED: cysteine proteinase RD21a-like          172   2e-47   
gb|AAW66796.1|  cysteine protease                                       165   2e-47   Pinus taeda
ref|XP_008340386.1|  PREDICTED: cysteine proteinase COT44-like          170   2e-47   
ref|XP_009400290.1|  PREDICTED: oryzain alpha chain-like                172   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006652996.1|  PREDICTED: oryzain beta chain-like                 171   3e-47   Oryza brachyantha
gb|AEV41117.1|  putative oryzain beta chain precursor                   171   3e-47   Oryza officinalis
gb|KDO59789.1|  hypothetical protein CISIN_1g012022mg                   171   3e-47   Citrus sinensis [apfelsine]
gb|ABZ69059.1|  cysteine protease                                       164   3e-47   Pinus radiata
gb|AIF75886.1|  cysteine protease                                       164   3e-47   Pinus massoniana [Chinese red pine]
ref|XP_006487026.1|  PREDICTED: cysteine proteinase RD21a-like          171   4e-47   Citrus sinensis [apfelsine]
gb|AEV41071.1|  putative oryzain beta chain precursor                   171   4e-47   Oryza minuta
ref|XP_009372437.1|  PREDICTED: cysteine proteinase COT44-like          169   4e-47   Pyrus x bretschneideri [bai li]
gb|AIF75887.1|  cysteine protease                                       164   4e-47   Pinus massoniana [Chinese red pine]
gb|KHN22490.1|  Cysteine proteinase RD21a                               169   4e-47   Glycine soja [wild soybean]
ref|XP_010548429.1|  PREDICTED: germination-specific cysteine pro...    169   4e-47   Tarenaya hassleriana [spider flower]
gb|AAW66797.1|  cysteine protease                                       164   5e-47   Pinus taeda
gb|AEV40973.1|  putative oryzain beta chain precursor                   171   5e-47   Oryza punctata
gb|AAW66794.1|  cysteine protease                                       164   5e-47   Pinus taeda
gb|AAW66804.1|  cysteine protease                                       164   5e-47   Pinus taeda
gb|KHN08598.1|  Cysteine proteinase RD21a                               170   5e-47   Glycine soja [wild soybean]
gb|ABK24233.1|  unknown                                                 170   9e-47   Picea sitchensis
gb|ABS83496.1|  cysteine protease                                       163   9e-47   Pinus pinaster [cluster pine]
emb|CAA53377.1|  cysteine protease                                      168   9e-47   Vicia sativa [spring vetch]
gb|ABQ10195.1|  actinidin Act2d                                         168   1e-46   Actinidia eriantha
dbj|BAD29954.1|  cysteine protease                                      170   1e-46   Daucus carota [carrots]
ref|XP_004496966.1|  PREDICTED: cysteine proteinase RD21a-like is...    170   1e-46   
ref|XP_004496965.1|  PREDICTED: cysteine proteinase RD21a-like is...    170   1e-46   Cicer arietinum [garbanzo]
gb|AAW66799.1|  cysteine protease                                       162   1e-46   Pinus taeda
gb|AIF75890.1|  cysteine protease                                       162   1e-46   Pinus massoniana [Chinese red pine]
gb|ABZ69061.1|  cysteine protease                                       163   2e-46   Pinus sylvestris [Scotch pine]
gb|AAW66801.1|  cysteine protease                                       162   2e-46   Pinus taeda
ref|XP_004960237.1|  PREDICTED: oryzain beta chain-like isoform X2      169   2e-46   Setaria italica
ref|XP_004960236.1|  PREDICTED: oryzain beta chain-like isoform X1      169   2e-46   
gb|ABQ10193.1|  actinidin Act2b                                         167   3e-46   Actinidia eriantha
emb|CAB17074.1|  cysteine proteinase precursor                          166   4e-46   Phaseolus vulgaris [French bean]
gb|KEH44128.1|  papain family cysteine protease                         168   4e-46   Medicago truncatula
ref|XP_002448736.1|  hypothetical protein SORBIDRAFT_06g032320          168   5e-46   Sorghum bicolor [broomcorn]
dbj|BAJ92693.1|  predicted protein                                      163   8e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFO83613.1|  papain-like cysteine protease                           165   1e-45   Fagopyrum esculentum
gb|AAC49455.1|  Pseudotzain                                             167   1e-45   Pseudotsuga menziesii
gb|AAU81594.1|  cysteine proteinase                                     159   1e-45   Petunia x hybrida [garden petunia]
emb|CDY17193.1|  BnaA05g09950D                                          164   1e-45   Brassica napus [oilseed rape]
gb|AAB68374.1|  cysteine endopeptidase 1                                164   2e-45   Phaseolus vulgaris [French bean]
ref|XP_010906543.1|  PREDICTED: ervatamin-B-like                        164   2e-45   Elaeis guineensis
ref|XP_004141903.1|  PREDICTED: germination-specific cysteine pro...    164   2e-45   Cucumis sativus [cucumbers]
gb|ADQ85986.1|  actinidin                                               164   3e-45   Actinidia chinensis
pir||TAGB  actinidain (EC 3.4.22.14) precursor - kiwi fruit             164   3e-45
sp|A5HII1.1|ACTN_ACTDE  RecName: Full=Actinidain; Short=Actinidin...    164   3e-45   Actinidia deliciosa [Chinese gooseberry]
gb|ABK24495.1|  unknown                                                 165   4e-45   Picea sitchensis
ref|XP_007136708.1|  hypothetical protein PHAVU_009G067300g             164   5e-45   Phaseolus vulgaris [French bean]
gb|ADQ85985.1|  actinidin                                               164   5e-45   Actinidia chinensis
dbj|BAJ85145.1|  predicted protein                                      165   6e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007155893.1|  hypothetical protein PHAVU_003G240800g             162   8e-45   Phaseolus vulgaris [French bean]
ref|XP_008796668.1|  PREDICTED: oryzain alpha chain-like                165   9e-45   Phoenix dactylifera
ref|XP_008440309.1|  PREDICTED: cysteine proteinase COT44-like          162   9e-45   Cucumis melo [Oriental melon]
ref|XP_008796470.1|  PREDICTED: oryzain alpha chain-like                164   1e-44   Phoenix dactylifera
ref|XP_010555986.1|  PREDICTED: LOW QUALITY PROTEIN: probable cys...    164   2e-44   
emb|CAA34486.1|  unnamed protein product                                162   2e-44   
ref|XP_006283942.1|  hypothetical protein CARUB_v10005061mg             162   2e-44   
ref|XP_006652923.1|  PREDICTED: oryzain alpha chain-like                163   3e-44   
gb|ABQ10194.1|  actinidin Act2c                                         161   4e-44   
gb|AFR11773.1|  cysteine protease                                       160   4e-44   
ref|XP_004171356.1|  PREDICTED: cysteine proteinase RD21a-like          155   4e-44   
tpg|DAA35682.1|  TPA: cysteine proteinase Mir3                          163   4e-44   
emb|CAQ00105.1|  papain-like cysteine proteinase                        162   5e-44   
ref|XP_003579458.1|  PREDICTED: oryzain beta chain-like                 162   6e-44   
ref|XP_010487882.1|  PREDICTED: probable cysteine proteinase At3g...    158   6e-44   
ref|XP_004289205.2|  PREDICTED: cysteine proteinase COT44               160   6e-44   
gb|ABQ10190.1|  actinidin Act1b                                         160   7e-44   
sp|P00785.4|ACTN_ACTCH  RecName: Full=Actinidain; Short=Actinidin...    160   7e-44   
ref|XP_008344336.1|  PREDICTED: probable cysteine proteinase At3g...    154   9e-44   
ref|XP_010679531.1|  PREDICTED: cysteine proteinase COT44-like          160   1e-43   
gb|AIE88288.1|  hypothetical protein OG_BBa0063K01.19                   161   2e-43   
ref|XP_006855225.1|  hypothetical protein AMTR_s00051p00208220          161   3e-43   
ref|NP_001266166.1|  uncharacterized protein LOC101492472               157   3e-43   
ref|NP_001148706.1|  cysteine protease 1 precursor                      160   3e-43   
ref|XP_010919166.1|  PREDICTED: oryzain alpha chain-like                154   4e-43   
ref|NP_001054211.2|  Os04g0670200                                       160   4e-43   
ref|NP_974341.1|  putative cysteine proteinase                          156   4e-43   
dbj|BAF02546.1|  triticain alpha                                        160   5e-43   
dbj|BAA14403.1|  oryzain beta precursor                                 160   5e-43   
gb|EMT10408.1|  Oryzain alpha chain                                     160   5e-43   
ref|XP_003580684.2|  PREDICTED: oryzain alpha chain-like                160   9e-43   
gb|EEE61807.1|  hypothetical protein OsJ_16426                          159   9e-43   
gb|AFW59667.1|  hypothetical protein ZEAMMB73_680472                    157   9e-43   
dbj|BAA14402.1|  oryzain alpha precursor                                159   1e-42   
sp|P25776.2|ORYA_ORYSJ  RecName: Full=Oryzain alpha chain; Flags:...    159   1e-42   
ref|XP_009137836.1|  PREDICTED: cysteine proteinase COT44               157   1e-42   
ref|XP_008678577.1|  PREDICTED: oryzain alpha chain-like                157   2e-42   
ref|NP_195406.2|  cysteine proteinase1                                  157   2e-42   
ref|XP_010507701.1|  PREDICTED: probable cysteine proteinase At3g...    158   2e-42   
ref|XP_004977049.1|  PREDICTED: oryzain alpha chain-like                158   3e-42   
dbj|BAF00916.1|  cysteine proteinase                                    156   3e-42   
ref|XP_008357550.1|  PREDICTED: probable cysteine proteinase At3g...    150   3e-42   
gb|EEC78138.1|  hypothetical protein OsI_17694                          158   3e-42   
emb|CDY46179.1|  BnaA05g20660D                                          157   3e-42   
emb|CAJ86180.1|  H0212B02.7                                             158   3e-42   
emb|CDX75633.1|  BnaA01g00690D                                          156   3e-42   
ref|NP_001105993.1|  cysteine protease component of protease-inhi...    158   3e-42   
ref|XP_010466084.1|  PREDICTED: probable cysteine proteinase At3g...    157   3e-42   
gb|ABU51882.1|  ervatamin-C precursor                                   155   4e-42   
ref|XP_010466085.1|  PREDICTED: probable cysteine proteinase At3g...    157   4e-42   
gb|EPS71857.1|  senescence-associated cysteine protease                 155   4e-42   
ref|NP_001104879.1|  cysteine proteinase Mir3 precursor                 158   4e-42   
dbj|BAC43113.1|  putative cysteine proteinase RD21A precursor           155   4e-42   
gb|AAL60578.1|AF454956_1  senescence-associated cysteine protease       157   4e-42   
sp|Q94B08.2|GCP1_ARATH  RecName: Full=Germination-specific cystei...    155   4e-42   
ref|NP_566634.2|  putative cysteine proteinase                          155   7e-42   
dbj|BAN33746.1|  cysteine protease a2                                   155   7e-42   
gb|AAP41847.1|  senescence-associated cysteine protease                 156   1e-41   
ref|XP_009145796.1|  PREDICTED: probable cysteine proteinase At3g...    156   1e-41   
gb|AFW59668.1|  LOW QUALITY PROTEIN: cysteine protease 1                156   1e-41   
ref|XP_010932205.1|  PREDICTED: oryzain alpha chain-like                156   1e-41   
ref|XP_010437247.1|  PREDICTED: germination-specific cysteine pro...    154   1e-41   
emb|CDX99227.1|  BnaC05g33420D                                          156   2e-41   
dbj|BAH11164.1|  cysteine protease                                      156   2e-41   
ref|XP_002868998.1|  cysteine proteinase                                154   2e-41   
gb|EPS63179.1|  hypothetical protein M569_11610                         151   2e-41   
ref|NP_001149658.1|  cysteine protease 1 precursor                      155   2e-41   
dbj|BAN33745.1|  cysteine protease a                                    154   2e-41   
ref|NP_566633.1|  Granulin repeat cysteine protease family protein      155   2e-41   
gb|KFK39253.1|  hypothetical protein AALP_AA3G220200                    155   2e-41   
ref|XP_009412959.1|  PREDICTED: oryzain alpha chain-like                154   2e-41   
ref|XP_006297656.1|  hypothetical protein CARUB_v10013678mg             155   4e-41   
ref|XP_010432076.1|  PREDICTED: germination-specific cysteine pro...    153   4e-41   
emb|CDX69285.1|  BnaC01g01680D                                          153   5e-41   
ref|XP_009396437.1|  PREDICTED: oryzain alpha chain-like                155   5e-41   
emb|CAA20473.1|  cysteine proteinase-like protein                       152   5e-41   
ref|NP_567686.2|  putative cysteine proteinase                          152   6e-41   
emb|CDY50157.1|  BnaA01g26170D                                          154   6e-41   
ref|XP_009388208.1|  PREDICTED: oryzain alpha chain-like                152   7e-41   
ref|XP_009420643.1|  PREDICTED: oryzain alpha chain-like                154   9e-41   
ref|XP_009109364.1|  PREDICTED: cysteine proteinase COT44-like          152   9e-41   
ref|XP_006411912.1|  hypothetical protein EUTSA_v10025483mg             152   1e-40   
ref|XP_010446685.1|  PREDICTED: germination-specific cysteine pro...    152   1e-40   
gb|ACI00280.1|  triticain beta 2                                        153   1e-40   
dbj|BAK03074.1|  predicted protein                                      153   1e-40   
ref|XP_007145379.1|  hypothetical protein PHAVU_007G234100g             153   2e-40   
ref|XP_002883178.1|  hypothetical protein ARALYDRAFT_479457             153   2e-40   
emb|CDX95457.1|  BnaC01g33490D                                          153   2e-40   
ref|XP_010487883.1|  PREDICTED: probable cysteine proteinase At3g...    152   2e-40   
gb|AJA74416.1|  cysteine protease                                       150   2e-40   
emb|CAQ00106.1|  papain-like cysteine proteinase                        153   3e-40   
emb|CDY50154.1|  BnaA01g26140D                                          152   4e-40   
ref|XP_009111886.1|  PREDICTED: probable cysteine proteinase At3g...    152   5e-40   
ref|XP_009111878.1|  PREDICTED: probable cysteine proteinase At3g...    152   5e-40   
gb|AEV41024.1|  putative oryzain beta chain precursor                   152   5e-40   
ref|XP_006406504.1|  hypothetical protein EUTSA_v10020714mg             152   5e-40   
ref|XP_010927504.1|  PREDICTED: oryzain alpha chain-like                152   6e-40   
gb|KFK39254.1|  hypothetical protein AALP_AA3G220300                    149   7e-40   
gb|EMS68758.1|  Oryzain beta chain                                      152   7e-40   
emb|CAE04498.2|  OSJNBb0059K02.8                                        151   8e-40   
emb|CDY22445.1|  BnaC03g61580D                                          150   8e-40   
gb|KFK30309.1|  hypothetical protein AALP_AA7G245200                    149   1e-39   
ref|XP_006297986.1|  hypothetical protein CARUB_v10014028mg             148   3e-39   
ref|XP_010466086.1|  PREDICTED: probable cysteine proteinase At3g...    148   3e-39   
dbj|BAF93840.1|  triticain beta 2                                       149   5e-39   
emb|CDX95456.1|  BnaC01g33480D                                          147   6e-39   
gb|EMS56635.1|  Oryzain alpha chain                                     147   2e-38   
dbj|BAF02547.1|  triticain beta                                         147   3e-38   
ref|XP_002867702.1|  hypothetical protein ARALYDRAFT_329301             145   4e-38   
ref|XP_002877310.1|  hypothetical protein ARALYDRAFT_484828             145   7e-38   
dbj|BAG50406.1|  peptidase                                              139   1e-37   
ref|XP_010433893.1|  PREDICTED: zingipain-2-like                        143   1e-37   
ref|XP_002447300.1|  hypothetical protein SORBIDRAFT_06g032360          144   3e-37   
ref|NP_566867.1|  putative cysteine proteinase                          143   3e-37   
dbj|BAD29956.1|  cysteine protease                                      144   3e-37   
gb|AFW59666.1|  hypothetical protein ZEAMMB73_680472                    138   4e-37   
gb|EPS64955.1|  cysteine protease                                       137   4e-37   
gb|AEV41119.1|  putative cysteine protease                              144   5e-37   
gb|AEV41073.1|  putative cysteine protease                              144   5e-37   
gb|AAB23155.1|  COT44=cysteine proteinase homolog                       141   5e-37   
sp|P25251.1|CYSP4_BRANA  RecName: Full=Cysteine proteinase COT44;...    141   5e-37   
ref|XP_010448692.1|  PREDICTED: zingipain-2-like                        141   7e-37   
ref|XP_004292313.1|  PREDICTED: xylem cysteine proteinase 1             141   7e-37   
emb|CDX95451.1|  BnaC01g33430D                                          143   8e-37   
gb|KJB14608.1|  hypothetical protein B456_002G133800                    141   9e-37   
ref|XP_007043092.1|  Xylem cysteine peptidase 1                         141   1e-36   
ref|XP_006396922.1|  hypothetical protein EUTSA_v10028681mg             142   1e-36   
dbj|BAJ33895.1|  unnamed protein product                                141   1e-36   
ref|XP_010445171.1|  PREDICTED: zingipain-2-like                        140   2e-36   
emb|CDY44047.1|  BnaA08g15590D                                          140   2e-36   
gb|AAM65468.1|  cysteine proteinase                                     140   3e-36   
ref|NP_001054087.2|  Os04g0650000                                       134   3e-36   
ref|XP_010435084.1|  PREDICTED: probable cysteine proteinase At4g...    140   4e-36   
ref|XP_006285150.1|  hypothetical protein CARUB_v10006494mg             139   7e-36   
ref|XP_006396923.1|  hypothetical protein EUTSA_v10028733mg             139   7e-36   
ref|XP_006287995.1|  hypothetical protein CARUB_v10001228mg             139   7e-36   
emb|CDY63262.1|  BnaCnng41770D                                          136   8e-36   
gb|KDP47019.1|  hypothetical protein JCGZ_10746                         139   8e-36   
gb|EPS62067.1|  cysteine proteinase                                     137   1e-35   
ref|XP_009128675.1|  PREDICTED: probable cysteine proteinase At4g...    138   2e-35   
ref|XP_009145795.1|  PREDICTED: probable cysteine proteinase At3g...    139   2e-35   
ref|XP_002989790.1|  hypothetical protein SELMODRAFT_184826             137   2e-35   
emb|CDY46178.1|  BnaA05g20650D                                          138   2e-35   
gb|AEV41026.1|  putative cysteine protease                              139   3e-35   
ref|XP_010422085.1|  PREDICTED: probable cysteine proteinase At4g...    137   3e-35   
ref|XP_006384862.1|  XYLEM CYSTEINE PEPTIDASE 1 family protein          137   3e-35   
ref|XP_010422086.1|  PREDICTED: probable cysteine proteinase At4g...    137   3e-35   
ref|XP_010455538.1|  PREDICTED: probable cysteine proteinase At4g...    137   3e-35   
emb|CAR31335.1|  pro-asclepain f                                        137   4e-35   
ref|XP_006291187.1|  hypothetical protein CARUB_v10017312mg             138   4e-35   
ref|XP_010435073.1|  PREDICTED: probable cysteine proteinase At4g...    137   4e-35   
gb|AEV40975.1|  putative cysteine protease                              138   4e-35   
ref|XP_002990132.1|  hypothetical protein SELMODRAFT_428615             137   5e-35   
ref|XP_009384829.1|  PREDICTED: xylem cysteine proteinase 1-like        136   7e-35   
gb|KJB77459.1|  hypothetical protein B456_012G138700                    136   7e-35   
gb|AAB41816.1|  NTH1                                                    136   9e-35   
gb|KCW70346.1|  hypothetical protein EUGRSUZ_F03589                     134   9e-35   
ref|XP_006415025.1|  hypothetical protein EUTSA_v10007664mg             137   9e-35   
ref|NP_974687.1|  xylem cysteine proteinase 1                           134   1e-34   
gb|KDO85216.1|  hypothetical protein CISIN_1g0186492mg                  134   1e-34   
ref|XP_010455537.1|  PREDICTED: probable cysteine proteinase At4g...    136   1e-34   
ref|XP_002872576.1|  hypothetical protein ARALYDRAFT_489965             136   1e-34   
ref|XP_010928427.1|  PREDICTED: xylem cysteine proteinase 2-like        135   1e-34   
emb|CDY01351.1|  BnaA07g11240D                                          135   1e-34   
ref|XP_011040826.1|  PREDICTED: xylem cysteine proteinase 1             135   2e-34   
ref|XP_004971418.1|  PREDICTED: xylem cysteine proteinase 2-like        135   2e-34   
ref|XP_010231852.1|  PREDICTED: xylem cysteine proteinase 1-like        135   2e-34   
ref|XP_006289222.1|  hypothetical protein CARUB_v10002678mg             134   4e-34   
emb|CDY31861.1|  BnaC07g15110D                                          134   4e-34   
ref|NP_567983.1|  xylem cysteine proteinase 1                           134   4e-34   
ref|XP_010436251.1|  PREDICTED: xylem cysteine proteinase 1-like        133   5e-34   
gb|ACE96957.1|  peptidase C1A papain                                    128   5e-34   
ref|XP_009103325.1|  PREDICTED: xylem cysteine proteinase 2             134   5e-34   
ref|XP_010498526.1|  PREDICTED: xylem cysteine proteinase 2-like        134   5e-34   
ref|XP_008799257.1|  PREDICTED: xylem cysteine proteinase 1-like        134   5e-34   
emb|CDX75496.1|  BnaA01g02060D                                          134   6e-34   
ref|XP_009102734.1|  PREDICTED: xylem cysteine proteinase 1             134   6e-34   
gb|ACE96960.1|  peptidase C1A papain                                    128   6e-34   
ref|XP_002980210.1|  hypothetical protein SELMODRAFT_153766             135   6e-34   
ref|XP_007018686.1|  Xylem cysteine peptidase 1                         134   6e-34   
ref|NP_567377.1|  putative cysteine proteinase                          134   7e-34   
ref|XP_010063152.1|  PREDICTED: xylem cysteine proteinase 2             134   7e-34   
gb|AAA79915.1|  cysteine proteinase                                     134   7e-34   
ref|XP_006844723.1|  hypothetical protein AMTR_s00016p00253110          134   8e-34   
ref|XP_006435429.1|  hypothetical protein CICLE_v10001665mg             133   8e-34   
emb|CAH67695.1|  H0624F09.3                                             135   8e-34   
ref|NP_001054213.1|  Os04g0670500                                       135   8e-34   
ref|XP_006473845.1|  PREDICTED: xylem cysteine proteinase 2-like        133   8e-34   
ref|XP_010090710.1|  Xylem cysteine proteinase 1                        133   9e-34   
ref|XP_008451198.1|  PREDICTED: xylem cysteine proteinase 1-like        133   9e-34   
emb|CAQ00103.1|  papain-like cysteine proteinase                        133   9e-34   
ref|XP_009128676.1|  PREDICTED: probable cysteine proteinase At4g...    134   9e-34   
gb|ACE96974.1|  peptidase C1A papain                                    127   9e-34   
gb|AAW34136.1|  cysteine protease gp3a                                  134   1e-33   
ref|XP_006412113.1|  hypothetical protein EUTSA_v10025568mg             133   1e-33   
ref|XP_002963113.1|  hypothetical protein SELMODRAFT_270344             134   1e-33   
gb|EMT26055.1|  Xylem cysteine proteinase 1                             133   1e-33   
ref|XP_009137125.1|  PREDICTED: zingipain-2                             133   1e-33   
ref|XP_007135980.1|  hypothetical protein PHAVU_009G008100g             132   1e-33   
ref|XP_009115337.1|  PREDICTED: probable cysteine proteinase At4g...    133   2e-33   
gb|AAC35211.1|  cysteine proteinase                                     132   2e-33   
ref|XP_004144898.1|  PREDICTED: xylem cysteine proteinase 1-like        132   2e-33   
ref|XP_010459776.1|  PREDICTED: xylem cysteine proteinase 2             132   2e-33   
ref|XP_004161017.1|  PREDICTED: xylem cysteine proteinase 1-like        132   2e-33   
ref|XP_009390652.1|  PREDICTED: xylem cysteine proteinase 1-like        132   2e-33   
ref|XP_006422409.1|  hypothetical protein CICLE_v10028739mg             132   2e-33   
gb|KFK30176.1|  hypothetical protein AALP_AA7G227600                    132   2e-33   
gb|KFK31907.1|  hypothetical protein AALP_AA6G174500                    132   2e-33   
ref|XP_010690568.1|  PREDICTED: xylem cysteine proteinase 2             132   3e-33   
gb|KDO36580.1|  hypothetical protein CISIN_1g037262mg                   125   3e-33   
ref|XP_006413545.1|  hypothetical protein EUTSA_v10027165mg             132   3e-33   
ref|XP_007135981.1|  hypothetical protein PHAVU_009G008200g             132   3e-33   
gb|AIE88271.1|  hypothetical protein OG_BBa0063K01.2                    132   5e-33   
ref|XP_010943503.1|  PREDICTED: xylem cysteine proteinase 1-like        131   5e-33   
gb|AAF80626.1|AC069251_19  F2D10.37                                     130   6e-33   
gb|ACR34737.1|  unknown                                                 132   6e-33   
ref|XP_010446933.1|  PREDICTED: xylem cysteine proteinase 1             131   7e-33   
emb|CDX69132.1|  BnaC01g03210D                                          131   7e-33   
ref|XP_010928804.1|  PREDICTED: xylem cysteine proteinase 1-like        130   7e-33   
gb|ACE96966.1|  peptidase C1A papain                                    125   7e-33   
ref|XP_010437483.1|  PREDICTED: xylem cysteine proteinase 1-like ...    130   8e-33   
gb|ACU18142.1|  unknown                                                 130   8e-33   
ref|XP_002872575.1|  hypothetical protein ARALYDRAFT_911472             131   9e-33   
ref|XP_003522989.1|  PREDICTED: xylem cysteine proteinase 2             130   1e-32   
ref|XP_006849990.1|  hypothetical protein AMTR_s00022p00165270          130   1e-32   



>gb|AAK48495.1|AF259983_1 putative cysteine protease [Ipomoea batatas]
Length=462

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/148 (97%), Positives = 145/148 (98%), Gaps = 0/148 (0%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSIITYDEEHPAKGLSR+DEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID
Sbjct  23   DMSIITYDEEHPAKGLSRSDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  82

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            EQNSR DR+YKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPK GGSLPDS
Sbjct  83   EQNSRGDRSYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKAGGSLPDS  142

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            IDWREKGAVAEVKDQGSCGSCWAFSTI 
Sbjct  143  IDWREKGAVAEVKDQGSCGSCWAFSTIA  170



>ref|XP_011069730.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=471

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE H   G  R+DEEVM++YESW+V+HGKSYN LG EK+KRFEIFKDNLRYI+
Sbjct  29   DMSIISYDESHGGPGFVRSDEEVMSMYESWMVKHGKSYNALG-EKEKRFEIFKDNLRYIE  87

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            EQN+  +R YKLGLNRFADL+NEEYR TY+G +TDA+RR +K KSD RYAPKVG SLPDS
Sbjct  88   EQNAMPNRTYKLGLNRFADLSNEEYRRTYMGTRTDAKRRFSKVKSD-RYAPKVGDSLPDS  146

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            IDWREKGAVA +KDQG CGSCWAFSTI 
Sbjct  147  IDWREKGAVAPIKDQGGCGSCWAFSTIA  174



>dbj|BAF46304.1| cysteine proteinase precursor [Ipomoea nil]
Length=474

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSIITYD++HPAKGL R+++EV  ++ESWLV+HGKSYN +  EKDKRF+IF+DNL+YID
Sbjct  24   DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD-EKDKRFKIFRDNLKYID  82

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E+NS E+R+YKLGLNRFAD+TNEEYR+ YLGAK DA R + K+KSD RYAP  G SLPDS
Sbjct  83   EKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSD-RYAPVAGDSLPDS  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            IDWREKGAV  VKDQGSCGSCWAFSTI 
Sbjct  142  IDWREKGAVTGVKDQGSCGSCWAFSTIA  169



>emb|CDP01294.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 123/149 (83%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  DMSIITYDEEH-PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSI++Y   +    G  RTDEEVMALYE WLV+HGKSYNGLG EKDKRFEIFKDNLRYI
Sbjct  20   DMSILSYGNANLKTSGSGRTDEEVMALYEEWLVKHGKSYNGLG-EKDKRFEIFKDNLRYI  78

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DEQNS   R Y+LGLNRFADL+NEEYRSTYLG + D +RR+AKT SD RY PKVG SLP+
Sbjct  79   DEQNSLPSRTYQLGLNRFADLSNEEYRSTYLGTRPDPKRRLAKTSSD-RYRPKVGDSLPN  137

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            SIDWREKGAV  VKDQGSCGSCWAFS + 
Sbjct  138  SIDWREKGAVLPVKDQGSCGSCWAFSAVA  166



>ref|XP_011074404.1| PREDICTED: low-temperature-induced cysteine proteinase [Sesamum 
indicum]
Length=469

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 125/149 (84%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  DMSIITYDEE-HPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSIITYDE  H A    R+ +EVM++YESWL++HGKSYN LG EK++RFEIFKDNLRYI
Sbjct  26   DMSIITYDENNHLAGPGLRSHDEVMSMYESWLMKHGKSYNALG-EKERRFEIFKDNLRYI  84

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DEQN+   R YKLGLNRFADLTNEEYR T+LGA+ D +RR+  TKSD RYAPKVG SLPD
Sbjct  85   DEQNALGGRTYKLGLNRFADLTNEEYRKTFLGARPDGKRRLTSTKSD-RYAPKVGESLPD  143

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            SIDWR KGAVA VKDQGSCGSCWAFSTI 
Sbjct  144  SIDWRAKGAVAPVKDQGSCGSCWAFSTIA  172



>dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus]
Length=462

 Score =   221 bits (562),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 127/147 (86%), Gaps = 4/147 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII YD  H +K   RTD+EVMA+YESWLV+HGKSYN LG EK+KRF+IFKDNLR+ID
Sbjct  24   DMSIINYDATHASKSSWRTDDEVMAMYESWLVKHGKSYNALG-EKEKRFQIFKDNLRFID  82

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+ E+ +YK+GLNRFADLTNEEYRSTYLGAK+  + +++K KSD RYAP+VG SLP+S
Sbjct  83   EHNAEENLSYKVGLNRFADLTNEEYRSTYLGAKS--KPKLSKVKSD-RYAPRVGDSLPES  139

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR KGAVA +KDQGSCGSCWAFST+
Sbjct  140  VDWRAKGAVAPIKDQGSCGSCWAFSTV  166



>ref|XP_009769754.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=470

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 120/147 (82%), Gaps = 6/147 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSI+TYDE        RTD+EVM+LYESWL+EHGKSYN L  EKDKRF+IFKDNLRYID
Sbjct  32   DMSILTYDENQHF----RTDDEVMSLYESWLLEHGKSYNALD-EKDKRFQIFKDNLRYID  86

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            EQNS  +++YKLGL +FADLTNEEYRS YLG KT  RRR+ K KSD RY PKVG SLPDS
Sbjct  87   EQNSVPNKSYKLGLTKFADLTNEEYRSMYLGTKTSDRRRLLKNKSD-RYLPKVGDSLPDS  145

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKG +  VKDQGSCGSCWAFS I
Sbjct  146  VDWREKGVLVGVKDQGSCGSCWAFSAI  172



>gb|AGV15823.1| cysteine protease CP15 [Nicotiana tabacum]
Length=474

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 124/150 (83%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  282
            DMSII+Y+E+H   G S   RTD+EVM+LYESWLVEH K YN LG EKDKRF+IFKDNLR
Sbjct  28   DMSIISYNEKHHTNGESTVWRTDDEVMSLYESWLVEHKKVYNALG-EKDKRFQIFKDNLR  86

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
            YIDEQNS  +++YKLGL +FADLTNEEY+S YLG K D R R++ T+SD RYAPKVG SL
Sbjct  87   YIDEQNSAPEKSYKLGLTQFADLTNEEYKSIYLGTKPDGRSRLSYTQSD-RYAPKVGDSL  145

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            PDS+DWR+KG + +VK+QG CGSCWAFS +
Sbjct  146  PDSVDWRKKGVLVDVKNQGQCGSCWAFSAV  175



>ref|XP_009613155.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
 gb|AGV15820.1| cysteine protease CP6 [Nicotiana tabacum]
Length=466

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 120/147 (82%), Gaps = 6/147 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSI+TYDE        RTD+EVM+LYESWLVEHGKSYN L  EKDKRF+IFK+NLRYID
Sbjct  28   DMSILTYDENQHF----RTDDEVMSLYESWLVEHGKSYNALD-EKDKRFQIFKENLRYID  82

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            EQNS  +++YKLGL +FADLTNEEYRS YLG KT  RRR+ K KSD RY PKVG SLPDS
Sbjct  83   EQNSVPNKSYKLGLTKFADLTNEEYRSMYLGTKTSDRRRLLKNKSD-RYLPKVGDSLPDS  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKG +  VKDQGSCGSCWAFS I
Sbjct  142  VDWREKGVLVGVKDQGSCGSCWAFSAI  168



>ref|XP_010059895.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW66363.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD  H      RTD EVMALYESWLV+HGK+YN LG EK++RF+IFKDNLR+ID
Sbjct  27   DMSIISYDRAHGGDPGQRTDAEVMALYESWLVKHGKAYNALG-EKERRFDIFKDNLRFID  85

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS  +R Y LGLNRFADLTNEEYRSTYLG + DA RR+ K++S RRY P++G  LP+S
Sbjct  86   EHNS-GNRTYTLGLNRFADLTNEEYRSTYLGTRPDASRRLTKSRSSRRYEPRLGEQLPES  144

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWR++GAV  VKDQGSCGSCWAFSTI 
Sbjct  145  VDWRKEGAVVGVKDQGSCGSCWAFSTIA  172



>ref|XP_009775102.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=473

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 122/150 (81%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  282
            DMSII+Y+E+H   G S   RTD+EVM+LYESWLVEH K YN LG EKDKRF+IFKDNLR
Sbjct  28   DMSIISYNEKHHTNGESTVWRTDDEVMSLYESWLVEHKKVYNALG-EKDKRFQIFKDNLR  86

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
            YIDE NS  D++YKLGL +FADLTNEEY+S YLG K D R R+  T+SD RYAPKVG SL
Sbjct  87   YIDEHNSVPDKSYKLGLTQFADLTNEEYKSIYLGTKPDGRSRLLNTQSD-RYAPKVGDSL  145

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            PDS+DWR+KG + +VK+QG CGSCWAFS +
Sbjct  146  PDSVDWRKKGVLVDVKNQGQCGSCWAFSAV  175



>ref|XP_006473275.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=468

 Score =   215 bits (547),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 127/149 (85%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSI++YD+ H +K  S RTD+EVMA++E+WLV+HGK+YN LG EK+KRFEIFK+NLR+I
Sbjct  24   DMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYNALG-EKEKRFEIFKENLRFI  82

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DE NS E+R YK+GLNRFADLTNEEYRS +LGA+  A+R   K+K   RY P+VG +LPD
Sbjct  83   DEHNS-ENRTYKVGLNRFADLTNEEYRSMHLGARFGAKRTSLKSKRSNRYLPRVGEALPD  141

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWR+KGAVAEVKDQGSCGSCWAFSTI 
Sbjct  142  SVDWRKKGAVAEVKDQGSCGSCWAFSTIA  170



>ref|NP_001234324.1| low-temperature-induced cysteine proteinase precursor [Solanum 
lycopersicum]
 gb|AAD48496.1|AF172856_1 cysteine protease TDI-65 [Solanum lycopersicum]
 emb|CAA05894.1| CYP1 [Solanum lycopersicum]
 emb|CEL26633.1| cysteine protease [Solanum lycopersicum]
Length=466

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 123/148 (83%), Gaps = 6/148 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE H  +   RTD+EV ALYESWL+EHGKSYN LG EKDKRF+IFKDNLRYID
Sbjct  26   DMSIISYDETHIHR---RTDDEVSALYESWLIEHGKSYNALG-EKDKRFQIFKDNLRYID  81

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAKTKSDRRYAPKVGGSLPD  468
            EQNS  +++YKLGL +FADLTNEEYRS YLG K+   R++++K KSDR Y PKVG SLP+
Sbjct  82   EQNSVPNQSYKLGLTKFADLTNEEYRSIYLGTKSSGDRKKLSKNKSDR-YLPKVGDSLPE  140

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            SIDWREKG +  VKDQGSCGSCWAFS +
Sbjct  141  SIDWREKGVLVGVKDQGSCGSCWAFSAV  168



>ref|XP_011029381.1| PREDICTED: cysteine proteinase RD21a [Populus euphratica]
Length=465

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 123/148 (83%), Gaps = 4/148 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H  K   RTD+EVMA+YE WLV+HGK+YN LG EK+KRFEIFKDNL +ID
Sbjct  25   DMSIISYDQTHVTKSSWRTDDEVMAMYEEWLVKHGKNYNALG-EKEKRFEIFKDNLMFID  83

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            + NS E+R YK+GLNRFADLTNEEYRS YLG +T  ++R+ KT    RYAP+VG SLPDS
Sbjct  84   QHNS-ENRTYKVGLNRFADLTNEEYRSMYLGTRTGHKKRLPKTSD--RYAPRVGDSLPDS  140

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWR++GAVAEVKDQG CGSCWAFSTI 
Sbjct  141  VDWRKEGAVAEVKDQGGCGSCWAFSTIA  168



>gb|KCW66364.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD  H      RTD EVMALYESWLV+HGK+YN LG EK++RF+IFKDNLR+ID
Sbjct  27   DMSIISYDRAHGGDPGQRTDAEVMALYESWLVKHGKAYNALG-EKERRFDIFKDNLRFID  85

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS  +R Y LGLNRFADLTNEEYRSTYLG + DA RR+ K++S RRY P++G  LP+S
Sbjct  86   EHNSG-NRTYTLGLNRFADLTNEEYRSTYLGTRPDASRRLTKSRSSRRYEPRLGEQLPES  144

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWR++GAV  VKDQGSCG CWAFSTI 
Sbjct  145  VDWRKEGAVVGVKDQGSCGDCWAFSTIA  172



>ref|XP_009604895.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 124/150 (83%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  282
            DMSII+Y+E+H   G S   RTD+E+++LYESWLVEH K YN LG EKDKRF+IFKDNLR
Sbjct  27   DMSIISYNEKHHTNGESTVWRTDDEIVSLYESWLVEHKKVYNALG-EKDKRFQIFKDNLR  85

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
            YIDEQNS  +++YKLGL +FADLTNEEY+S YLG K D R R++ T+SD RYAPKVG SL
Sbjct  86   YIDEQNSAPEKSYKLGLTQFADLTNEEYKSIYLGTKPDGRSRLSYTQSD-RYAPKVGDSL  144

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            PDS+DWR+KG + +VK+QG CGSCWAFS +
Sbjct  145  PDSVDWRKKGVLVDVKNQGQCGSCWAFSAV  174



>ref|XP_003545327.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=496

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 121/147 (82%), Gaps = 4/147 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD  H A   SR+DEE+M++YE WLV+HGK YN LG EK+KRF+IFKDNLR+ID
Sbjct  55   DMSIISYDNAHAAT--SRSDEELMSMYEQWLVKHGKVYNALG-EKEKRFQIFKDNLRFID  111

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            + NS+EDR YKLGLNRFADLTNEEYR+ YLG K D  RR+ KT S+ RYAP+VG  LP+S
Sbjct  112  DHNSQEDRTYKLGLNRFADLTNEEYRAKYLGTKIDPNRRLGKTPSN-RYAPRVGDKLPES  170

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAV  VKDQG CGSCWAFS I
Sbjct  171  VDWRKEGAVPPVKDQGGCGSCWAFSAI  197



>gb|KHG05637.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=457

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 122/150 (81%), Gaps = 6/150 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YDE HP K  S  RTD+EVMA+YE WLV+HGK+YNGLG EK++R +IFKDNLR+
Sbjct  23   DMSIISYDEAHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGLG-EKERRLQIFKDNLRF  81

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE N+ E  ++K+GLNRFADLTNEEYR+ YLG K   R+    +K+  RYAP +G  LP
Sbjct  82   IDEHNADESHSFKVGLNRFADLTNEEYRAIYLGIKKPNRKV---SKASDRYAPLLGQKLP  138

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            DS+DWREKGAVAEVKDQGSCGSCWAFSTI 
Sbjct  139  DSVDWREKGAVAEVKDQGSCGSCWAFSTIA  168



>gb|EPS63305.1| hypothetical protein M569_11479, partial [Genlisea aurea]
Length=453

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSI++Y E    +   R++EE M+LYESW+VEHG+SYN LG EK++RFEIFKDNLRYID
Sbjct  24   DMSIVSYGESRGHRTPLRSEEEAMSLYESWIVEHGRSYNALG-EKERRFEIFKDNLRYID  82

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            EQN+  +R Y+LGLNRFADLTN+EYR+T+LG + DA+RR+ K +SD RYA K G SLPDS
Sbjct  83   EQNAIGNRTYRLGLNRFADLTNKEYRTTFLGTRIDAKRRLLKARSD-RYAAKAGDSLPDS  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR KGAVA +KDQG CGSCWAFSTI
Sbjct  142  VDWRSKGAVAPIKDQGGCGSCWAFSTI  168



>gb|KJB14609.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=477

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 125/149 (84%), Gaps = 6/149 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YDE HP K  S  RTD+EVMA+YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDETHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGLG-EKERRFQIFKDNLRF  81

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE N+ E +++K+GLNRFADLTNEEYR+ YLG K  A R++  +K+  RYA  +G  LP
Sbjct  82   IDEHNADESQSFKVGLNRFADLTNEEYRAIYLGIK-KANRKV--SKASDRYAALLGEKLP  138

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            DS+DWREKGAVAEVKDQGSCGSCWAFSTI
Sbjct  139  DSVDWREKGAVAEVKDQGSCGSCWAFSTI  167



>ref|XP_003550321.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
 gb|KHN12811.1| Cysteine proteinase RD21a [Glycine soja]
Length=476

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII+YD  H  K  + RT+EE+M++YE WLV+HGK YN LG EK+KRF+IFKDNLR+I
Sbjct  32   DMSIISYDSAHADKAATLRTEEELMSMYEQWLVKHGKVYNALG-EKEKRFQIFKDNLRFI  90

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            D+ NS EDR YKLGLNRFADLTNEEYR+ YLG K D  RR+ KT S+ RYAP+VG  LPD
Sbjct  91   DDHNSAEDRTYKLGLNRFADLTNEEYRAKYLGTKIDPNRRLGKTPSN-RYAPRVGDKLPD  149

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR++GAV  VKDQG CGSCWAFS I
Sbjct  150  SVDWRKEGAVPPVKDQGGCGSCWAFSAI  177



>gb|KHN22488.1| Cysteine proteinase RD21a [Glycine soja]
Length=464

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII+YD  H A   + RT+EE+M++YE WLV+HGK YN LG EK+KRF+IFKDNLR+I
Sbjct  20   DMSIISYDNAHAATAATLRTEEELMSMYEQWLVKHGKVYNALG-EKEKRFQIFKDNLRFI  78

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            D+ NS+EDR YKLGLNRFADLTNEEYR+ YLG K D  RR+ KT S+ RYAP+VG  LP+
Sbjct  79   DDHNSQEDRTYKLGLNRFADLTNEEYRAKYLGTKIDPNRRLGKTPSN-RYAPRVGDKLPE  137

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR++GAV  VKDQG CGSCWAFS I
Sbjct  138  SVDWRKEGAVPPVKDQGGCGSCWAFSAI  165



>gb|KJB14610.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=457

 Score =   212 bits (540),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 125/150 (83%), Gaps = 6/150 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YDE HP K  S  RTD+EVMA+YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDETHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGLG-EKERRFQIFKDNLRF  81

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE N+ E +++K+GLNRFADLTNEEYR+ YLG K  A R++  +K+  RYA  +G  LP
Sbjct  82   IDEHNADESQSFKVGLNRFADLTNEEYRAIYLGIKK-ANRKV--SKASDRYAALLGEKLP  138

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            DS+DWREKGAVAEVKDQGSCGSCWAFSTI 
Sbjct  139  DSVDWREKGAVAEVKDQGSCGSCWAFSTIA  168



>emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera]
Length=469

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII YDE H  K   RTDE+VMA+YE+WL +HGKSYN LG EK++RF+IFKDNLR+ID
Sbjct  27   DMSIIGYDETHGDKSSWRTDEDVMAVYEAWLAKHGKSYNALG-EKERRFQIFKDNLRFID  85

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+ E+R YK+GLNRFADLTNEEYRS YLG +T A+RR +   SDR YA +VG SLP+S
Sbjct  86   EHNA-ENRTYKVGLNRFADLTNEEYRSMYLGTRTAAKRRSSNKISDR-YAFRVGDSLPES  143

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWR+KGAV EVKDQGSCGSCWAFSTI 
Sbjct  144  VDWRKKGAVVEVKDQGSCGSCWAFSTIA  171



>ref|XP_002284973.1| PREDICTED: low-temperature-induced cysteine proteinase [Vitis 
vinifera]
Length=467

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII YDE H  K   RTDE+VMA+YE+WL +HGKSYN LG EK++RF+IFKDNLR+ID
Sbjct  25   DMSIIGYDETHGDKSSWRTDEDVMAVYEAWLAKHGKSYNALG-EKERRFQIFKDNLRFID  83

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+ E+R YK+GLNRFADLTNEEYRS YLG +T A+RR +   SDR YA +VG SLP+S
Sbjct  84   EHNA-ENRTYKVGLNRFADLTNEEYRSMYLGTRTAAKRRSSNKISDR-YAFRVGDSLPES  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWR+KGAV EVKDQGSCGSCWAFSTI 
Sbjct  142  VDWRKKGAVVEVKDQGSCGSCWAFSTIA  169



>gb|AAX84673.1| cysteine protease CP1 [Manihot esculenta]
Length=467

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H  K   RTD+EVMA+YE WLV+ GK YN LG E++KRF++FKDNLR+ID
Sbjct  26   DMSIISYDQTHATKSSWRTDDEVMAIYEEWLVKQGKVYNALG-EREKRFQVFKDNLRFID  84

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS E+R YKLGLN FADLTNEEYRSTYLGA+   +R   +  SDR YAP+VG SLPDS
Sbjct  85   EHNS-ENRTYKLGLNGFADLTNEEYRSTYLGARGGMKRNRLRKTSDR-YAPRVGESLPDS  142

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWR++GAVAEVKDQGSCGSCWAFSTI 
Sbjct  143  VDWRKEGAVAEVKDQGSCGSCWAFSTIA  170



>ref|XP_007160879.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
 gb|ESW32873.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
Length=466

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD  H  K   RTDEEV +LYE WLV+HGK YN LG EKDKRF+IFKDNLR+ID
Sbjct  25   DMSIISYDNAHQDKATWRTDEEVNSLYEEWLVKHGKLYNALG-EKDKRFQIFKDNLRFID  83

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            +QN+ E+R YKLGLNRFADLTNEEYR+ YLG K D  RR+ +T S+R YAP+VG +LPDS
Sbjct  84   QQNA-ENRTYKLGLNRFADLTNEEYRARYLGTKIDPNRRLGRTPSNR-YAPRVGETLPDS  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAV  VKDQ SCGSCWAFS I
Sbjct  142  VDWRKEGAVVPVKDQASCGSCWAFSAI  168



>gb|EYU36326.1| hypothetical protein MIMGU_mgv1a005614mg [Erythranthe guttata]
Length=477

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 127/151 (84%), Gaps = 8/151 (5%)
 Frame = +1

Query  112  DMSIITYDEEH----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  279
            DMSII+YD ++    PA GL R+ +EV++++ESW+ EHGKSYN +G EK+KR EIFKDNL
Sbjct  32   DMSIISYDRKNNLAVPA-GL-RSHDEVVSMHESWMAEHGKSYNAVG-EKEKRLEIFKDNL  88

Query  280  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  459
            RYIDEQN+ E+R YKLGLNRFADLTN+EYR T+LG++ D +RR+   KSD RYAPKVG +
Sbjct  89   RYIDEQNAIENRTYKLGLNRFADLTNDEYRKTFLGSRPDGKRRLTGRKSD-RYAPKVGDA  147

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            LPDSIDWREKGAV  +KDQGSCGSCWAFSTI
Sbjct  148  LPDSIDWREKGAVVPIKDQGSCGSCWAFSTI  178



>emb|CAB17076.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=455

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 120/147 (82%), Gaps = 3/147 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD  H  K   RTDEEV +LYE WLV+HGK YN LG EKDKRF+IFKDNLR+ID
Sbjct  14   DMSIISYDNAHQDKATWRTDEEVNSLYEEWLVKHGKLYNALG-EKDKRFQIFKDNLRFID  72

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            +QN+ E+R YKLGLNRFADLTNEEYR+ YLG K D  RR+ +T S+R YAP+VG +LPDS
Sbjct  73   QQNA-ENRTYKLGLNRFADLTNEEYRARYLGTKIDPNRRLGRTPSNR-YAPRVGETLPDS  130

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAV  VKDQ SCGSCWAFS I
Sbjct  131  VDWRKEGAVVPVKDQASCGSCWAFSAI  157



>ref|XP_006342644.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Solanum 
tuberosum]
Length=466

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 121/148 (82%), Gaps = 6/148 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE H      RTD+EV ALYESWL+EHGKSYN LG EKDKRF+IFKDNL+YID
Sbjct  26   DMSIISYDETHIHH---RTDDEVSALYESWLIEHGKSYNALG-EKDKRFQIFKDNLKYID  81

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAKTKSDRRYAPKVGGSLPD  468
            EQNS  +++YKLGL +FADLT EEYRS YLG K+   RRR++K KSDR Y PKVG SLP+
Sbjct  82   EQNSVPNQSYKLGLTKFADLTTEEYRSIYLGTKSSGDRRRLSKNKSDR-YLPKVGDSLPE  140

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR+KG +  VKDQGSCGSCWAFS +
Sbjct  141  SVDWRDKGVLVGVKDQGSCGSCWAFSAV  168



>ref|NP_001274877.1| low-temperature-induced cysteine proteinase-like precursor [Solanum 
tuberosum]
 emb|CAB53515.1| cysteine protease [Solanum tuberosum]
Length=466

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 122/148 (82%), Gaps = 6/148 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE H      R+D+EV ALYESWL+EHGKSYN LG EKDKRF+IFKDNL+YID
Sbjct  26   DMSIISYDETHIHH---RSDDEVSALYESWLIEHGKSYNALG-EKDKRFQIFKDNLKYID  81

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAKTKSDRRYAPKVGGSLPD  468
            EQNS  +++YKLGL +FADLTNEEYRS YLG K+   RR+++K KSDR Y PKVG SLP+
Sbjct  82   EQNSVPNQSYKLGLTKFADLTNEEYRSIYLGTKSSGDRRKLSKNKSDR-YLPKVGDSLPE  140

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR+KG +  VKDQGSCGSCWAFS +
Sbjct  141  SVDWRDKGVLVGVKDQGSCGSCWAFSAV  168



>gb|AFO83614.1| papain-like cysteine protease [Fagopyrum esculentum]
Length=468

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 128/152 (84%), Gaps = 7/152 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS----RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  279
            D SII+YD  HP K  S    R+D+EVM+++ESWLV HGK+YN LG EK+KRF++FKDNL
Sbjct  27   DNSIISYDNTHPDKSSSSPNMRSDDEVMSMFESWLVHHGKNYNALG-EKEKRFQVFKDNL  85

Query  280  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  459
            R+IDE NS E+R+YKLGLN+FADL+NEEYR+ YLGAKTDARRR++K +S R YA + G S
Sbjct  86   RFIDEHNS-EERSYKLGLNKFADLSNEEYRNKYLGAKTDARRRLSKKRSSR-YAFRAGDS  143

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            LP+S+DWR++GAV +VKDQGSCGSCWAFSTI 
Sbjct  144  LPESVDWRKEGAVVDVKDQGSCGSCWAFSTIA  175



>ref|XP_004238129.1| PREDICTED: low-temperature-induced cysteine proteinase [Solanum 
lycopersicum]
Length=472

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+Y+E+H   G  RTD+EVM++YESWLVEH K YN LG EKDKRF+IFKDNL+YID
Sbjct  29   DMSIISYNEKHHTIGAGRTDDEVMSMYESWLVEHKKVYNALG-EKDKRFQIFKDNLKYID  87

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+  +++YKLGL +FADLTNEEYRS YLG K DA RR++  +SD RYAPKVG  LP+S
Sbjct  88   EHNAMPEKSYKLGLTKFADLTNEEYRSVYLGTKPDASRRLSSRQSD-RYAPKVGDRLPES  146

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DW +KG +  VKDQG CGSCWAFS +
Sbjct  147  VDWVKKGVLVGVKDQGQCGSCWAFSAV  173



>ref|XP_006354848.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=471

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (81%), Gaps = 2/147 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+Y+E+H   G  RTD+EVM+LYESWLVEH K YN LG EKDKRF+IFKDNL+YID
Sbjct  28   DMSIISYNEKHHKIGAGRTDDEVMSLYESWLVEHKKVYNALG-EKDKRFQIFKDNLKYID  86

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+  +++YKLGL +FADLTNEEYRS YLG K DA RR++  +SD RYAPKVG  LP+S
Sbjct  87   EHNAMPEKSYKLGLTKFADLTNEEYRSIYLGTKPDAGRRLSSRQSD-RYAPKVGDRLPES  145

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DW +KG +  VKDQG CGSCWAFS +
Sbjct  146  VDWVKKGVLVGVKDQGQCGSCWAFSAV  172



>gb|KDP41692.1| hypothetical protein JCGZ_16099 [Jatropha curcas]
Length=466

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 123/147 (84%), Gaps = 3/147 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H AK   RTD+EVMA+YE WL ++GK+YN LG EK++RF+IFKDNLR+ID
Sbjct  25   DMSIISYDQSHAAKSSWRTDDEVMAIYEEWLEKNGKAYNALG-EKERRFQIFKDNLRFID  83

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS E+RAYK+ LNRFAD++NEEYRS YLGA+   RR   +  SDR Y P+VG SLPDS
Sbjct  84   EHNS-ENRAYKVALNRFADISNEEYRSLYLGAQAGVRRNKLRKSSDR-YTPRVGESLPDS  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAVAEVKDQGSCGSCWAFSTI
Sbjct  142  VDWRKEGAVAEVKDQGSCGSCWAFSTI  168



>ref|XP_006374886.1| cysteine proteinase [Populus trichocarpa]
 gb|ABK95110.1| unknown [Populus trichocarpa]
 gb|ERP52683.1| cysteine proteinase [Populus trichocarpa]
Length=465

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 4/148 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+Y + H  K   RTD+EVMA+YE WLV+HGK+YN LG EK+KRFEIFKDNL +ID
Sbjct  25   DMSIISYHQTHATKSSWRTDDEVMAMYEEWLVKHGKNYNALG-EKEKRFEIFKDNLMFID  83

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            + NS E+R Y +GLNRFADLTNEE+RS YLG +T  ++R+ KT    RYAP+VG SLPDS
Sbjct  84   QHNS-ENRTYTVGLNRFADLTNEEFRSMYLGTRTGHKKRLPKTSD--RYAPRVGDSLPDS  140

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWR++GAVAEVKDQG CGSCWAFSTI 
Sbjct  141  VDWRKEGAVAEVKDQGGCGSCWAFSTIA  168



>ref|XP_007017153.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOY14378.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=466

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 120/150 (80%), Gaps = 6/150 (4%)
 Frame = +1

Query  112  DMSIITYDEEHP--AKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YDE HP  +K + RTD+EVMA+YE WLV+HGK+YNGLG EK++RFEIFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSIWRTDDEVMAMYEEWLVKHGKAYNGLG-EKERRFEIFKDNLRF  81

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE N+ +  ++K+GLNRFADLTNEEYR+ YLG K   R+    +K   RYAP +G  LP
Sbjct  82   IDEHNADDSHSFKVGLNRFADLTNEEYRAMYLGTKKPERKV---SKRSDRYAPSLGEELP  138

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            DSIDWREKGAVA VKDQG CGSCWAFS I 
Sbjct  139  DSIDWREKGAVAAVKDQGGCGSCWAFSAIA  168



>dbj|BAD29957.1| cysteine protease [Daucus carota]
Length=437

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII YD+ H    L RTD+EVM +Y SWLV+HGKSYN LG EK+ RF+IFKDNLRYID
Sbjct  24   DMSIINYDQTH-TNSLIRTDDEVMTMYNSWLVKHGKSYNALG-EKETRFQIFKDNLRYID  81

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKT-DARRRIAKTKSDRRYAPKVGGSLPD  468
              N+  DR+Y+LGLNRFADLTNEEYR+ YLG K+ ++R +++K  SDR YAP  G  LPD
Sbjct  82   NHNADPDRSYELGLNRFADLTNEEYRAKYLGTKSRESRPKLSKGPSDR-YAPVEGEELPD  140

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            SIDWREKGAVA VKDQGSCGSCWAFS I
Sbjct  141  SIDWREKGAVAAVKDQGSCGSCWAFSAI  168



>gb|ABG33750.1| cysteine protease [Hevea brasiliensis]
Length=457

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 120/148 (81%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            D+SII+YD+ H  K   RTD+EVMA+YE WLV+HGK+YN LG EK++RFE+FKDNLR+ID
Sbjct  16   DLSIISYDQSHGTKSSWRTDDEVMAIYEDWLVKHGKAYNSLG-EKERRFEVFKDNLRFID  74

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS E+R Y++GLNRFADLTNEEYRS YLGA +  RR   +  SDR Y P+VG SLPDS
Sbjct  75   EHNS-ENRTYRVGLNRFADLTNEEYRSMYLGALSGIRRNKLRKISDR-YTPRVGDSLPDS  132

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWR++GAV  VKDQGSCGSCWAFS + 
Sbjct  133  VDWRKEGAVVGVKDQGSCGSCWAFSAVA  160



>gb|AER60490.1| cysteine proteases [Gossypium hirsutum]
Length=371

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  294
            +S +T ++ HP+    R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+IDE
Sbjct  20   ISTLTLNQNHPSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFIDE  78

Query  295  QNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDS  471
             NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPDS
Sbjct  79   HNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRYAHRAGDNLPDS  138

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWR+ GAV+ VKDQGSCGSCWAFSTI 
Sbjct  139  VDWRDHGAVSPVKDQGSCGSCWAFSTIA  166



>ref|XP_009359945.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=474

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 130/155 (84%), Gaps = 11/155 (7%)
 Frame = +1

Query  112  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  276
            DMSII+YD  +      + G  RTD+EVM++YE WL EHGK+YN LG EK++RF+IFKDN
Sbjct  25   DMSIISYDSNNHLGDSKSSGSWRTDDEVMSIYEGWLAEHGKAYNALG-EKERRFQIFKDN  83

Query  277  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR-RRIAK--TKSDRRYAPK  447
            LRYIDEQNS+ + +YKLGLNRFADL+NEEYR+TYLGAKT A+ +R++   TKSDR YAP+
Sbjct  84   LRYIDEQNSK-NLSYKLGLNRFADLSNEEYRNTYLGAKTRAQMKRVSNRNTKSDR-YAPR  141

Query  448  VGGSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            VG SLPDS+DWR++GAV+ VKDQGSCGSCWAFSTI
Sbjct  142  VGDSLPDSVDWRKEGAVSPVKDQGSCGSCWAFSTI  176



>ref|XP_003589134.1| Cysteine proteinase [Medicago truncatula]
Length=299

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 117/150 (78%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII+YD+ HP K  S RT++EV+ +YE WLV+HGKSYNGLG EKDKRFEIFKDNL++I
Sbjct  28   DMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYNGLG-EKDKRFEIFKDNLKFI  86

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDR--RYAPKVGGSL  462
            DE N   +  Y+LGL RFADLTNEEYRS +LG K D  RR+ K    +  RYAP+VG  L
Sbjct  87   DEHNGL-NSTYRLGLTRFADLTNEEYRSKFLGTKIDPNRRMKKLGGSKSNRYAPRVGDKL  145

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+S+DWR++GAV  VKDQ SCGSCWAFS I
Sbjct  146  PESVDWRKEGAVVGVKDQASCGSCWAFSAI  175



>ref|XP_006434711.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
 gb|ESR47951.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
Length=160

 Score =   196 bits (498),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 116/139 (83%), Gaps = 3/139 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSI++YD+ H +K  S RTD+EVM ++E+W V+HGK+YN LG EK+KRFEIFKDNLR+I
Sbjct  24   DMSIVSYDKTHESKSSSWRTDDEVMGMFEAWFVKHGKAYNALG-EKEKRFEIFKDNLRFI  82

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DE NS E+R YK+GLNRFADLTNEEYRS YLGA+  A+R   K+K   RY P+VG +LPD
Sbjct  83   DEHNS-ENRTYKVGLNRFADLTNEEYRSMYLGARFGAKRTSLKSKRSDRYLPRVGEALPD  141

Query  469  SIDWREKGAVAEVKDQGSC  525
            S+DWR+KGAVAEVKDQGSC
Sbjct  142  SVDWRKKGAVAEVKDQGSC  160



>ref|XP_002510170.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52357.1| cysteine protease, putative [Ricinus communis]
Length=469

 Score =   205 bits (521),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 125/150 (83%), Gaps = 4/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSY--NGLGGEKDKRFEIFKDNLRY  285
            DMSI++YD+ H  K   RTD+EVMA+YE WLV++GK++  N   GEK++RF++FKDNLR+
Sbjct  25   DMSIVSYDQTHLTKSSWRTDDEVMAIYEEWLVKNGKAHSNNNALGEKERRFQVFKDNLRF  84

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE NS E+R+YK+GLNRFADLTNEEYRS YLGA++ A+R    ++S  RY P+VG SLP
Sbjct  85   IDEHNS-ENRSYKVGLNRFADLTNEEYRSMYLGARSGAKRN-RLSRSSNRYLPRVGDSLP  142

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            DS+DWR++GAVAEVKDQGSCGSCWAFSTI 
Sbjct  143  DSVDWRKEGAVAEVKDQGSCGSCWAFSTIA  172



>ref|XP_009354165.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=469

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 128/153 (84%), Gaps = 9/153 (6%)
 Frame = +1

Query  112  DMSIITYDE---EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  282
            DMSI++YD    +  + G  RTD+EVM++YE WL EHGK+YN LG EK++RF+IFKDNLR
Sbjct  25   DMSIVSYDNNLGDGKSTGSWRTDDEVMSMYEGWLAEHGKAYNALG-EKERRFQIFKDNLR  83

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAK--TKSDRRYAPKVG  453
            YIDEQNS+ + +YKLGLNRFADL+NEEYR+TYLG KT A ++R++   TKSDR YAP+VG
Sbjct  84   YIDEQNSK-NLSYKLGLNRFADLSNEEYRNTYLGTKTRAQKKRLSNRNTKSDR-YAPRVG  141

Query  454  GSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             SLPDSIDWRE+GAV  VKDQGSCGSCWAFSTI
Sbjct  142  DSLPDSIDWREEGAVNPVKDQGSCGSCWAFSTI  174



>ref|XP_008393776.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=475

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 130/155 (84%), Gaps = 11/155 (7%)
 Frame = +1

Query  112  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  276
            DMSII+YD  +      + G  RTD+EVM++YE WL EHGK+YN LG EK++RF+IFKDN
Sbjct  26   DMSIISYDSNNHVGDSKSSGSWRTDDEVMSIYEGWLXEHGKAYNALG-EKERRFQIFKDN  84

Query  277  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR-RRIAK--TKSDRRYAPK  447
            LRYIDEQNS+ + +YKLGLNRFADL+NEEYR+TYLGAKT A+ +R++   TKSDR YAP+
Sbjct  85   LRYIDEQNSK-NLSYKLGLNRFADLSNEEYRNTYLGAKTRAQMKRVSNRNTKSDR-YAPR  142

Query  448  VGGSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            VG SLPDS+DWR++GAV+ VKDQGSCGSCWAFSTI
Sbjct  143  VGDSLPDSVDWRKEGAVSPVKDQGSCGSCWAFSTI  177



>gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa]
Length=461

 Score =   204 bits (519),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = +1

Query  160  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  339
            SRTD+EVMA+YESWLV+HGKSYN +G EK+KRF+IFKDNLR+IDE N+ E R YK+GLNR
Sbjct  36   SRTDDEVMAMYESWLVKHGKSYNAIG-EKEKRFQIFKDNLRFIDEHNA-ESRTYKVGLNR  93

Query  340  FADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQG  519
            FADLTN+EYRS YLGA+T +RRR++  K   RY P  G SLPDS+DWREKGAV  VKDQG
Sbjct  94   FADLTNDEYRSMYLGARTGSRRRLSTQKRSDRYVPVAGESLPDSVDWREKGAVVGVKDQG  153

Query  520  SCGSCWAFSTIV  555
            SCGSCWAFSTI 
Sbjct  154  SCGSCWAFSTIA  165



>gb|KJB48623.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=240

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 121/149 (81%), Gaps = 3/149 (2%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  468
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPD  138

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWR+ GAV+ VKDQGSCGSCWAFSTI 
Sbjct  139  SVDWRDHGAVSPVKDQGSCGSCWAFSTIA  167



>ref|XP_006494485.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=372

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 119/149 (80%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD  H      RTD+EVM +Y++WL +HGK+ NG+G   +KRF+IFKDNLR+ID
Sbjct  26   DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKHGKTSNGMG-HNEKRFQIFKDNLRFID  84

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  468
            E NS  +R YK+GLN+FADLTNEEYR+ YLG ++DA+RR+ K+K + +RYA K G  LP+
Sbjct  85   EHNSL-NRTYKVGLNKFADLTNEEYRAMYLGTRSDAKRRLMKSKVASQRYACKAGDELPE  143

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWREKGAV  VKDQGSCGSCWAFST+ 
Sbjct  144  SVDWREKGAVNPVKDQGSCGSCWAFSTVA  172



>gb|KJB48626.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=286

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 121/149 (81%), Gaps = 3/149 (2%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  468
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPD  138

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWR+ GAV+ VKDQGSCGSCWAFSTI 
Sbjct  139  SVDWRDHGAVSPVKDQGSCGSCWAFSTIA  167



>gb|KDO79088.1| hypothetical protein CISIN_1g017419mg [Citrus sinensis]
Length=372

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 119/149 (80%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD  H      RTD+EVM +Y++WL +HGK+ NG+G   +KRF+IFKDNLR+ID
Sbjct  26   DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKHGKTSNGMG-HNEKRFQIFKDNLRFID  84

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  468
            E NS  +R YK+GLN+FADLTNEEYR+ YLG ++DA+RR+ K+K + +RYA K G  LP+
Sbjct  85   EHNSL-NRTYKVGLNKFADLTNEEYRAMYLGTRSDAKRRLMKSKVASQRYACKAGDELPE  143

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWREKGAV  VKDQGSCGSCWAFST+ 
Sbjct  144  SVDWREKGAVNPVKDQGSCGSCWAFSTVA  172



>ref|XP_010270819.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=474

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 119/148 (80%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSI+ YDEEH  K   R+D+EV  LYESWLV HGK+YN LG EK++RFEIFKDNLR+ID
Sbjct  30   DMSIVKYDEEHGMKTGWRSDQEVRGLYESWLVTHGKAYNALG-EKERRFEIFKDNLRFID  88

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS  +R YK+GLNRFADLTN+EYR+ YLG K +  RR ++ KS+R YA + G +LPDS
Sbjct  89   EHNS-GNRTYKVGLNRFADLTNDEYRAMYLGTKLNPNRRASRPKSNR-YAFQAGDALPDS  146

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWR+KGAV  VKDQGSCGSCWAFSTI 
Sbjct  147  VDWRDKGAVVAVKDQGSCGSCWAFSTIA  174



>gb|KJB48624.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=314

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 121/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  468
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPD  138

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR+ GAV+ VKDQGSCGSCWAFSTI
Sbjct  139  SVDWRDHGAVSPVKDQGSCGSCWAFSTI  166



>gb|ABQ10200.1| cysteine protease Cp2 [Actinidia deliciosa]
Length=376

 Score =   200 bits (508),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 3/148 (2%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  294
            MSII Y+     K  SRTDEEVM +Y  WL +HGK+YNG+G E+++RFEIFKDNL+++DE
Sbjct  22   MSIIDYNTNPNHKSSSRTDEEVMGIYAEWLAKHGKAYNGIG-ERERRFEIFKDNLKFVDE  80

Query  295  QNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDS  471
             NS E+R+YK+GLNRFADLTNEEYRS +LG KTD++RR  K+KS  RRYA +    LP+S
Sbjct  81   HNS-ENRSYKVGLNRFADLTNEEYRSMFLGTKTDSKRRFMKSKSASRRYAVQDSDMLPES  139

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWRE GAVA +KDQGSCGSCWAFST+ 
Sbjct  140  VDWRESGAVAPIKDQGSCGSCWAFSTVA  167



>gb|KJB48625.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=372

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 121/149 (81%), Gaps = 3/149 (2%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  468
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPD  138

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWR+ GAV+ VKDQGSCGSCWAFSTI 
Sbjct  139  SVDWRDHGAVSPVKDQGSCGSCWAFSTIA  167



>gb|KJB48622.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=372

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 121/149 (81%), Gaps = 3/149 (2%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  468
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPD  138

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWR+ GAV+ VKDQGSCGSCWAFSTI 
Sbjct  139  SVDWRDHGAVSPVKDQGSCGSCWAFSTIA  167



>ref|XP_006425969.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
 gb|ESR39209.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
Length=372

 Score =   197 bits (501),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD  H      RTD+EVM +Y++WL + GK+ NG+G   +KRF+IFKDNLR+ID
Sbjct  26   DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKRGKTSNGMG-HNEKRFQIFKDNLRFID  84

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  468
            E NS  +R YK+GLN+FADLTNEEYR+ YLG ++DA+RR+ K+K + +RYA K G  LP+
Sbjct  85   EHNSL-NRTYKVGLNKFADLTNEEYRAMYLGTRSDAKRRLMKSKVASQRYAFKAGDELPE  143

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWREKGAV  VKDQGSCGSCWAFST+ 
Sbjct  144  SVDWREKGAVNPVKDQGSCGSCWAFSTVA  172



>ref|XP_004230752.1| PREDICTED: cysteine proteinase RD21a-like [Solanum lycopersicum]
Length=470

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YDE+H   G +  RTD+EV  LYESW+V+HGK+YN +G EK+KRFEIFKDNLR+
Sbjct  22   DMSIISYDEKHADLGATNHRTDDEVKGLYESWIVKHGKNYNAIG-EKEKRFEIFKDNLRF  80

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDEQN+ E R YKLGLNRF+DLTN+EYR+ ++G + D + R+ K     RYA K G  LP
Sbjct  81   IDEQNA-ETRPYKLGLNRFSDLTNDEYRALFVGGRFDKKTRLLKNPKSERYAFKAGEKLP  139

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +S+DWR+KGAVA VKDQG CGSCWAFST+
Sbjct  140  ESVDWRQKGAVAPVKDQGQCGSCWAFSTV  168



>ref|XP_003589135.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59386.1| papain family cysteine protease [Medicago truncatula]
Length=457

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 117/150 (78%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII+YD+ HP K  S RT++EV+ +YE WLV+HGKSYNGLG EKDKRFEIFKDNL++I
Sbjct  28   DMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYNGLG-EKDKRFEIFKDNLKFI  86

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDR--RYAPKVGGSL  462
            DE N   +  Y+LGL RFADLTNEEYRS +LG K D  RR+ K    +  RYAP+VG  L
Sbjct  87   DEHNGL-NSTYRLGLTRFADLTNEEYRSKFLGTKIDPNRRMKKLGGSKSNRYAPRVGDKL  145

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+S+DWR++GAV  VKDQ SCGSCWAFS I
Sbjct  146  PESVDWRKEGAVVGVKDQASCGSCWAFSAI  175



>ref|XP_009772520.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana sylvestris]
Length=468

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+Y+E+H   G +  RTD+EV  LYESWLV+HGK+YN +G EK+KRFEIFKDNLR+
Sbjct  22   DMSIISYNEQHGQMGTTHHRTDDEVRGLYESWLVKHGKNYNAIG-EKEKRFEIFKDNLRF  80

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE N+ E+R+YKLGLNRF+DLTNEEYR+ ++G + D + R+ K     RY  + G  LP
Sbjct  81   IDEHNA-ENRSYKLGLNRFSDLTNEEYRAMFVGGRLDRKTRLMKNPKSDRYTFQAGEKLP  139

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +S+DWREKGAVA VKDQG CGSCWAFST+
Sbjct  140  ESVDWREKGAVAPVKDQGQCGSCWAFSTV  168



>ref|XP_010556436.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=459

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 126/184 (68%), Gaps = 25/184 (14%)
 Frame = +1

Query  1    SSFPFLFTTVITLSSPDMakllilslfvlaavsaaaaDMSIITYDEEHPAKGLSRTDEEV  180
            S+  +LF  V+  SS                    A+DM+I +Y + H AK   RTDEE 
Sbjct  6    SNLAYLFMAVLVTSS--------------------ASDMTITSYGQSHVAKTDWRTDEEA  45

Query  181  MALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFADLTNE  360
            MA+YE+WLV+HGK YN LG EK+KR EIFKDNLR+IDE NS  +R Y+LGLNRFADLTNE
Sbjct  46   MAMYEAWLVKHGKIYNELG-EKEKRLEIFKDNLRFIDEHNSV-NRTYRLGLNRFADLTNE  103

Query  361  EYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGSCGSCWA  540
            EYRS YLG     R+ +   K+  RY P+VG  LP+S+DWREKGAVAEVKDQGSCGSCWA
Sbjct  104  EYRSMYLGLGKPKRKPL---KTTNRYMPRVGDDLPESVDWREKGAVAEVKDQGSCGSCWA  160

Query  541  FSTI  552
            FS I
Sbjct  161  FSAI  164



>gb|AEZ65083.1| cysteine protease [Carica papaya]
Length=467

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 119/150 (79%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSI++YD+ H  K   RTD+EVMA+YE+WLV+HGK+YN LG EK+KRF IFKDNLR+ID
Sbjct  23   DMSIVSYDQRHADKSSWRTDDEVMAMYEAWLVKHGKAYNALG-EKEKRFGIFKDNLRFID  81

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARR--RIAKTKSDRRYAPKVGGSLP  465
            E NS ++  Y+LGLNRFADLTNEEYRS YLG K  A R  R    KSDR +A +VG +LP
Sbjct  82   EHNS-QNLTYRLGLNRFADLTNEEYRSMYLGVKPGATRVTRKVSRKSDR-FAARVGDALP  139

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            D IDWR++GAV  VKDQGSCGSCWAFSTI 
Sbjct  140  DFIDWRKEGAVVGVKDQGSCGSCWAFSTIA  169



>dbj|BAD29960.1| cysteine protease [Daucus carota]
Length=460

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 115/147 (78%), Gaps = 5/147 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSIITYD+ H    +  TD+ +MA YESWLV+HGKSYN LG EK++RF+IFKDN  YID
Sbjct  21   DMSIITYDQTH---AVGSTDDVIMAAYESWLVKHGKSYNALG-EKEQRFQIFKDNFLYID  76

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            EQN+ +DR++KLGLNRFADLTNEEYRS Y G +T   R+    KS +RYA   G SLP+S
Sbjct  77   EQNAAKDRSFKLGLNRFADLTNEEYRSKYTGIRTKDSRKKVSGKS-QRYASLAGESLPES  135

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWRE GAVA VKDQG CGSCWAFSTI
Sbjct  136  VDWREHGAVASVKDQGQCGSCWAFSTI  162



>ref|XP_006346518.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=470

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+Y E+H   G++  RTD+EV  LYESW+V+HGK+YN +G EK+KRFEIFKDNLR+
Sbjct  22   DMSIISYGEKHADLGVTSHRTDDEVKGLYESWIVKHGKNYNAIG-EKEKRFEIFKDNLRF  80

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDEQN+ E R YKLGLNRF+DLTN+EYR+ ++G + D + R+ K     RYA K G  LP
Sbjct  81   IDEQNA-ETRPYKLGLNRFSDLTNDEYRAVFVGGRFDKKTRLLKNPKSERYAFKAGEELP  139

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +S+DWR+KGAVA VKDQG CGSCWAFST+
Sbjct  140  ESVDWRQKGAVAPVKDQGQCGSCWAFSTV  168



>ref|XP_004499026.1| PREDICTED: cysteine proteinase RD21a-like [Cicer arietinum]
Length=472

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 116/148 (78%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H  K   RT++EV+ LYE WLV+HGK YNGLG EKDKRF+IFKDNL++ID
Sbjct  28   DMSIISYDKTHTDKSSHRTEKEVLTLYEEWLVKHGKVYNGLG-EKDKRFDIFKDNLKFID  86

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPD  468
            E N   +  Y+LGL RFADLTNEEYR+ +LG + D  R+I K  S   RYAP+VG  LP+
Sbjct  87   EHNVL-NSTYRLGLTRFADLTNEEYRAKFLGTRVDPNRKIRKVNSPSNRYAPRVGDKLPE  145

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR++GAVA VKDQGSCGSCWAFS I
Sbjct  146  SVDWRKEGAVAAVKDQGSCGSCWAFSAI  173



>ref|XP_003589133.1| Cysteine proteinase [Medicago truncatula]
 gb|ABD32628.1| Granulin; Peptidase C1A, papain [Medicago truncatula]
 gb|AES59384.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 117/151 (77%), Gaps = 5/151 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII+YD+ HP K  S RT++EV+ +YE WLV+HGKSYNGLG EKDKRFEIFKDNL++I
Sbjct  28   DMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYNGLG-EKDKRFEIFKDNLKFI  86

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDR--RYAPKVGGSL  462
            DE N   +  Y+LGL RFADLTNEEYRS +LG K D  RR+ K    +  RYAP+VG  L
Sbjct  87   DEHNGL-NSTYRLGLTRFADLTNEEYRSKFLGTKIDPNRRMKKLGGSKSNRYAPRVGDKL  145

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            P+S+DWR++GAV  VKDQ SCGSCWAFS I 
Sbjct  146  PESVDWRKEGAVVGVKDQASCGSCWAFSAIA  176



>ref|XP_004291075.1| PREDICTED: cysteine proteinase RD21a [Fragaria vesca subsp. vesca]
Length=469

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDE-EVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII YD  H +   S   + EVM+LYE WL EHGK+YNGLG EK+KRF+IFKDNL++I
Sbjct  26   DMSIIAYDNNHASSSDSGRSDDEVMSLYERWLAEHGKAYNGLG-EKEKRFQIFKDNLKFI  84

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DE N+  + +YKLGLNRFADL+N+EYRST+LG K  A  R++KTKSDR YAP+VG  LPD
Sbjct  85   DEHNAL-NLSYKLGLNRFADLSNDEYRSTFLGTKPRAMNRLSKTKSDR-YAPRVGDQLPD  142

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWR++GAV  VKDQG CGSCWAFSTI 
Sbjct  143  SVDWRKEGAVTAVKDQGQCGSCWAFSTIC  171



>ref|XP_011088223.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=468

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 2/148 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSIITYDE H      R++ EVMALYESWL +HGK+YN +G EK+KRFEIFKDNL++ID
Sbjct  24   DMSIITYDENHKMGSPHRSENEVMALYESWLAKHGKAYNAIG-EKEKRFEIFKDNLKFID  82

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS  DR+YKLGLNRFADLTNEEYR  ++  + D + ++   ++  RYA K G  LP S
Sbjct  83   EHNS-ADRSYKLGLNRFADLTNEEYRMLFVSGRVDRKTKLINRRASDRYAFKAGEELPQS  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWR+KGAVA VKDQG CGSCWAFST+ 
Sbjct  142  VDWRKKGAVAPVKDQGQCGSCWAFSTVA  169



>gb|KJB58559.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=437

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 117/149 (79%), Gaps = 6/149 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLG-EKERRFKIFKDNLRF  81

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE N  E  ++K+GLNRFADLTN+EYR+ YLG K  +      +K   RYAP+VG  LP
Sbjct  82   IDEHNVDESHSFKVGLNRFADLTNDEYRAMYLGTKKSSN---KVSKKSNRYAPRVGEELP  138

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             SIDWREKGAV  VKDQGSCGSCWAFST+
Sbjct  139  ASIDWREKGAVVPVKDQGSCGSCWAFSTV  167



>gb|EYU25464.1| hypothetical protein MIMGU_mgv1a006201mg [Erythranthe guttata]
Length=453

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 121/149 (81%), Gaps = 5/149 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSY-NGLGGEKDKRFEIFKDNLRYI  288
            DMSI+++     ++   R+  E+++++ESW+V+HG+SY N   GEK++RFEIF+DNL YI
Sbjct  29   DMSILSHG---GSRSFLRSHSEMVSMHESWMVKHGRSYGNAAVGEKERRFEIFRDNLMYI  85

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DEQN+ + R +KLGLNRFADLTN EYR T+LG +TD +RR++K +SD RYAPKVG SLPD
Sbjct  86   DEQNAEDGRTHKLGLNRFADLTNAEYRKTFLGTRTDPKRRLSKVRSD-RYAPKVGDSLPD  144

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWR KGAVA VKDQGSCGSCWAFSTI 
Sbjct  145  SVDWRAKGAVAPVKDQGSCGSCWAFSTIA  173



>gb|AJA74414.1| cysteine protease [Cicer arietinum]
Length=495

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 116/148 (78%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H  K   RT++EV+ LYE WLV+HGK YNGLG EKDKRF+IFKDNL++ID
Sbjct  28   DMSIISYDKTHTDKSSHRTEKEVLTLYEEWLVKHGKVYNGLG-EKDKRFDIFKDNLKFID  86

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPD  468
            E N   +  Y+LGL RFADLTNEEYR+ +LG + D  R+I K  S   RYAP+VG  LP+
Sbjct  87   EHNVL-NSTYRLGLTRFADLTNEEYRAKFLGTRVDPNRKIRKVNSPSNRYAPRVGDKLPE  145

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR++GAVA VKDQGSCGSCWAFS I
Sbjct  146  SVDWRKEGAVAAVKDQGSCGSCWAFSAI  173



>ref|XP_008365104.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=472

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 125/153 (82%), Gaps = 9/153 (6%)
 Frame = +1

Query  112  DMSIITYDE---EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  282
            DMSII+ D    +  + G  RTD+EVM+ YE WL EHGK+YN LG EK++RF+IFKDNLR
Sbjct  25   DMSIISXDNXLGDGKSTGSWRTDDEVMSXYEGWLAEHGKAYNALG-EKERRFQIFKDNLR  83

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAK--TKSDRRYAPKVG  453
            YIDEQNS+ + +YKLGLNRFADL+N EYR+TYLG KT A ++R++   TKSDR YAP+VG
Sbjct  84   YIDEQNSK-NLSYKLGLNRFADLSNXEYRNTYLGTKTRAQKKRLSNRNTKSDR-YAPRVG  141

Query  454  GSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             SLPDSIDWRE+GAV  +KDQGSCGSCWAFSTI
Sbjct  142  DSLPDSIDWREEGAVNPIKDQGSCGSCWAFSTI  174



>ref|XP_008236565.1| PREDICTED: cysteine proteinase RD21a-like [Prunus mume]
Length=476

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 118/148 (80%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII YDE+H     S RT+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR++
Sbjct  30   DMSIIDYDEKHGMGVPSDRTEAEVKALYESWLVKHRKNYNALG-EKERRFEIFKDNLRFV  88

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DE N ++ R+YK+GLNRFADLTNEEYRS YLGAK D R R++ ++   RYA + G  LP+
Sbjct  89   DEHN-KQSRSYKVGLNRFADLTNEEYRSIYLGAKVDRRFRLSGSRKSNRYAYRAGDELPE  147

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR KGAVA VKDQG CGSCWAFST+
Sbjct  148  SVDWRAKGAVAPVKDQGQCGSCWAFSTV  175



>emb|CAE54307.1| cysteine proteinase [Gossypium hirsutum]
Length=372

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 120/149 (81%), Gaps = 3/149 (2%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  468
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRYAHRAGDNLPD  138

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S++WR+ GAV+ VKDQGSCGSCWAFS I 
Sbjct  139  SVNWRDHGAVSRVKDQGSCGSCWAFSAIA  167



>ref|XP_007222885.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
 gb|EMJ24084.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
Length=472

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 129/153 (84%), Gaps = 9/153 (6%)
 Frame = +1

Query  112  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  282
            DMSII+YD+++    +K   RTDEEVM++YE WL +HGK+YNGLG EK++RF+IFKDNLR
Sbjct  25   DMSIISYDDKNVVGESKSSWRTDEEVMSIYEGWLAKHGKAYNGLG-EKERRFQIFKDNLR  83

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAK--TKSDRRYAPKVG  453
            YID+ N++ + +YKLGLNRFADL+N+EYRST+LG KT A +RR++   TKSDR YAP+VG
Sbjct  84   YIDDHNAK-NLSYKLGLNRFADLSNDEYRSTFLGTKTRAQKRRLSNRNTKSDR-YAPRVG  141

Query  454  GSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             SLPDS+DWR++G V  +KDQGSCGSCWAF+TI
Sbjct  142  DSLPDSVDWRKEGVVNPIKDQGSCGSCWAFATI  174



>gb|KJB58557.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=467

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 117/149 (79%), Gaps = 6/149 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLG-EKERRFKIFKDNLRF  81

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE N  E  ++K+GLNRFADLTN+EYR+ YLG K  +      +K   RYAP+VG  LP
Sbjct  82   IDEHNVDESHSFKVGLNRFADLTNDEYRAMYLGTKKSSN---KVSKKSNRYAPRVGEELP  138

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             SIDWREKGAV  VKDQGSCGSCWAFST+
Sbjct  139  ASIDWREKGAVVPVKDQGSCGSCWAFSTV  167



>ref|XP_009591184.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana tomentosiformis]
Length=468

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 118/149 (79%), Gaps = 4/149 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            D SII+YDE+H   G +  RTD+EV  LYESWLV+HGK+YN +G EK++RFEIF DNLR+
Sbjct  22   DKSIISYDEQHGQMGTTHHRTDDEVRGLYESWLVKHGKNYNAIG-EKERRFEIFNDNLRF  80

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE N+ E+R YKLGLNRF+DLTNEEYR+ ++G + D + R+ K+    RYA + G  LP
Sbjct  81   IDEHNA-ENRPYKLGLNRFSDLTNEEYRAMFVGGRLDRKTRLMKSPKSNRYAFQAGEKLP  139

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +S+DWREKGAVA VKDQG CGSCWAFST+
Sbjct  140  ESVDWREKGAVAPVKDQGQCGSCWAFSTV  168



>ref|XP_008220266.1| PREDICTED: low-temperature-induced cysteine proteinase [Prunus 
mume]
Length=472

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 129/153 (84%), Gaps = 9/153 (6%)
 Frame = +1

Query  112  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  282
            DMSII+YD+++    +K   RTDEEVM++YE WL +HGK+YNGLG EK++RF+IFKDNLR
Sbjct  25   DMSIISYDDKNVVGESKSSWRTDEEVMSIYEGWLAKHGKAYNGLG-EKERRFQIFKDNLR  83

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAK--TKSDRRYAPKVG  453
            YID+ N++ + +YKLGLNRFADL+N+EYRST+LG KT A ++R++   TKSDR YAP+VG
Sbjct  84   YIDDHNAK-NLSYKLGLNRFADLSNDEYRSTFLGTKTRAQKKRLSNRNTKSDR-YAPRVG  141

Query  454  GSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             SLPDS+DWR++G V  +KDQGSCGSCWAF+TI
Sbjct  142  DSLPDSVDWRKEGVVNPIKDQGSCGSCWAFATI  174



>ref|XP_007199820.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
 gb|EMJ01019.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
Length=466

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 118/148 (80%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII YD++H     S RT+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR++
Sbjct  20   DMSIINYDDKHGMGVPSDRTEAEVKALYESWLVKHRKNYNALG-EKERRFEIFKDNLRFV  78

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DE N ++ R+YK+GLNRFADLTNEEYRS YLGAK D R R++ ++   RYA + G  LP+
Sbjct  79   DEHN-KQSRSYKVGLNRFADLTNEEYRSIYLGAKVDRRFRLSWSRKSNRYAYRAGDELPE  137

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR KGAVA VKDQG CGSCWAFST+
Sbjct  138  SVDWRAKGAVAPVKDQGQCGSCWAFSTV  165



>gb|KHG12125.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=615

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 118/149 (79%), Gaps = 6/149 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLG-EKERRFKIFKDNLRF  81

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE N+ E  ++K+GLNRFADLTN+EYR+ YLG K  +      +K   RYAP+VG  LP
Sbjct  82   IDEHNANESHSFKVGLNRFADLTNDEYRAMYLGTKKSSN---KVSKKSNRYAPRVGEELP  138

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             SIDWREKGAV  VKDQGSCGSCWAFST+
Sbjct  139  ASIDWREKGAVVPVKDQGSCGSCWAFSTV  167



>dbj|BAD29958.1| cysteine protease [Daucus carota]
Length=496

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 115/147 (78%), Gaps = 4/147 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSIITYDE H A G  +TD+E   L+ESWLV HGKSYN LG E++KRF+IFK+NLRYID
Sbjct  21   DMSIITYDETH-AVGF-KTDDEATTLFESWLVTHGKSYNALG-EEEKRFQIFKNNLRYID  77

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            EQN  EDR +KLGLN+FADLTNEEYRS Y G K+   R+    KS  RYA   G SLP+S
Sbjct  78   EQNLVEDRGFKLGLNKFADLTNEEYRSKYTGIKSKDLRKKVSAKSG-RYATLSGESLPES  136

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWRE GAVA VKDQGSCGSCWAFSTI
Sbjct  137  VDWRESGAVATVKDQGSCGSCWAFSTI  163



>ref|XP_010094652.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXB56503.1| Cysteine proteinase RD21a [Morus notabilis]
Length=463

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 128/183 (70%), Gaps = 29/183 (16%)
 Frame = +1

Query  4    SFPFLFTTVITLSSPDMakllilslfvlaavsaaaaDMSIITYDEEHPAKGLSRTDEEVM  183
            S  FL   + TLSS                    A DMSI++Y+    +   SRTD+EVM
Sbjct  11   SMAFLIFAIFTLSS--------------------ALDMSIVSYNLVDQSS--SRTDDEVM  48

Query  184  ALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFADLTNEE  363
            A+YE+WLV+HGK YN LG EK+KRF+IFKDNLR+IDE N+ +DR YKLGLNRFADLTNEE
Sbjct  49   AIYEAWLVKHGKVYNALG-EKEKRFQIFKDNLRFIDEHNA-QDRPYKLGLNRFADLTNEE  106

Query  364  YRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGSCGSCWAF  543
            YRSTYLG K   ++++++     RYAP+VG  LP  +DWR++GAV  VKDQGSCGSCWAF
Sbjct  107  YRSTYLGTKIRGQKKVSQ-----RYAPRVGDDLPSFVDWRKEGAVVGVKDQGSCGSCWAF  161

Query  544  STI  552
            STI
Sbjct  162  STI  164



>gb|KDP31986.1| hypothetical protein JCGZ_12447 [Jatropha curcas]
Length=366

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 116/147 (79%), Gaps = 2/147 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H  +   R+D+EVM +Y  WL +H K+YN LG E+++RFEIFK+NLR+ID
Sbjct  22   DMSIISYDDHHNHQSGWRSDDEVMDMYNWWLAKHQKAYNKLG-ERERRFEIFKNNLRFID  80

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS E+ +YKLGL +FADLTNEEYR+ +LG + D +RR+   K  RRYA KVG  LP+S
Sbjct  81   EHNS-ENHSYKLGLTKFADLTNEEYRAMFLGTRVDVKRRLMTKKPSRRYAFKVGDELPES  139

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWRE+GAV  +KDQG+CGSCWAFSTI
Sbjct  140  VDWREEGAVNPIKDQGNCGSCWAFSTI  166



>emb|CDO97206.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 116/147 (79%), Gaps = 6/147 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII YD++H     S  D+EV ALYESWLV+HGK+YN LG EK+KRFEIFKDNLR+I 
Sbjct  22   DMSIIDYDKKHK----SSDDDEVKALYESWLVKHGKNYNALG-EKEKRFEIFKDNLRFIK  76

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+ +DR YKLGLNRFADLTN+EYRS ++G + D   R+   +S+ RYA + G SLP+S
Sbjct  77   EHNA-QDRPYKLGLNRFADLTNDEYRSMFVGGRMDRSTRLMNRRSNDRYALRAGDSLPES  135

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR KGAVA VKDQG CGSCWAFSTI
Sbjct  136  VDWRAKGAVAPVKDQGQCGSCWAFSTI  162



>gb|KJB63901.1| hypothetical protein B456_010G022700 [Gossypium raimondii]
Length=467

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 122/150 (81%), Gaps = 7/150 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMS+++YD+ HP + +S  RT +E+MA+YE WLV+HGK YNGLG EK+KRFEIFKDNLR+
Sbjct  23   DMSVVSYDKSHPDRSMSSWRTFDEIMAMYEDWLVKHGKVYNGLG-EKEKRFEIFKDNLRF  81

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVG-GSL  462
            IDE NS E  ++KLGLN+FADLTNEEYR T+LG K    ++++K +SD RY   +G  +L
Sbjct  82   IDEHNSEETHSFKLGLNQFADLTNEEYRFTFLGVKK-PNKKVSK-RSD-RYVQLLGEAAL  138

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            PDS+DWR KGAVA VKDQGSCGSCWAFSTI
Sbjct  139  PDSVDWRTKGAVAPVKDQGSCGSCWAFSTI  168



>dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus]
Length=461

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 120/151 (79%), Gaps = 8/151 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS----RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  279
            DMSII YD  H +   S    RTD+EV ALYESWLV+HGK+YN LG EKD+RF+IFKDNL
Sbjct  22   DMSIINYDATHMSSSSSSAPLRTDDEVNALYESWLVKHGKTYNALG-EKDRRFQIFKDNL  80

Query  280  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKT-DARRRIAKTKSDRRYAPKVGG  456
            R+IDE NS  D  YKLGLN+FADLTNEEYR TY G KT D +++++K KSDR YA + G 
Sbjct  81   RFIDEHNSG-DHTYKLGLNKFADLTNEEYRMTYTGIKTIDDKKKLSKMKSDR-YAYRSGD  138

Query  457  SLPDSIDWREKGAVAEVKDQGSCGSCWAFST  549
            SLP+ +DWRE+GAV +VKDQGSCGSCWAFST
Sbjct  139  SLPEYVDWREQGAVTDVKDQGSCGSCWAFST  169



>ref|XP_008342944.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=473

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 115/148 (78%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSI+ Y+E+H     S RT+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR+I
Sbjct  31   DMSIVDYNEKHGMPASSDRTETEVKALYESWLVKHAKNYNALG-EKERRFEIFKDNLRFI  89

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DE N+ + R YK+GLNRFADLTNEEYRS YLGAK D R R+  ++   RYA + G  LP+
Sbjct  90   DEHNN-QSRTYKVGLNRFADLTNEEYRSVYLGAKVDRRSRLXGSRKSDRYAFRAGDKLPE  148

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR +GAV  VKDQG CGSCWAFST+
Sbjct  149  SVDWRAEGAVPAVKDQGQCGSCWAFSTV  176



>gb|ABQ10202.1| cysteine protease Cp4 [Actinidia deliciosa]
Length=463

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 114/147 (78%), Gaps = 6/147 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ HP +   RTD E MA+YE WL  HGK+YN +G EK++RFEIFKDNLR++D
Sbjct  24   DMSIISYDQTHPPQ---RTDAEAMAIYEKWLTTHGKAYNAIG-EKERRFEIFKDNLRFVD  79

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+    +Y++GLNRFADLTNEEYRS +LG   + + R A TKSDR YA + G  LP S
Sbjct  80   EHNAVAG-SYRVGLNRFADLTNEEYRSMFLGGNMEMKERSASTKSDR-YAFRAGDKLPGS  137

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKGAV+ VKDQG CGSCWAFSTI
Sbjct  138  VDWREKGAVSPVKDQGQCGSCWAFSTI  164



>ref|XP_008361440.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=289

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 122/155 (79%), Gaps = 11/155 (7%)
 Frame = +1

Query  112  DMSIITYDE-----EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  276
            DMSII+YD      ++ + G  RTD  VM++YE WL EHGK+YN LG EK++ F+IFKDN
Sbjct  25   DMSIISYDSNNHLGDNKSLGSWRTDNVVMSIYEGWLAEHGKAYNALG-EKERSFQIFKDN  83

Query  277  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR-RRIAK--TKSDRRYAPK  447
            LRYIDE+NS+ + +YKLGLNRF DL NEEYR+TYLGAKT A+ +R++    KSDR YAP 
Sbjct  84   LRYIDEKNSK-NLSYKLGLNRFVDLLNEEYRNTYLGAKTRAQMKRVSNRNIKSDR-YAPH  141

Query  448  VGGSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            VG SL DS+DWR++GAV+ VKDQGSCGSCW FSTI
Sbjct  142  VGDSLLDSVDWRKEGAVSPVKDQGSCGSCWTFSTI  176



>gb|KHG00992.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=375

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            +S +T ++ HP+   S   R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNL +
Sbjct  21   ISTLTLNQNHPSSSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLMF  79

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSL  462
            +DE NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +L
Sbjct  80   VDEHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRYAHRAGDNL  139

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            PDS++WR+ GAV+ VKDQGSCGSCWAFS I 
Sbjct  140  PDSVNWRDHGAVSRVKDQGSCGSCWAFSAIA  170



>ref|XP_002863697.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39956.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 120/151 (79%), Gaps = 9/151 (6%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK---SYNGLGGEKDKRFEIFKDNL  279
            DMSII+YDE H    +S R+D EV  +YE+W+VEHGK   + NGLG EKD+RFEIFKDNL
Sbjct  23   DMSIISYDENHHISTVSSRSDAEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNL  82

Query  280  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  459
            RYIDE N++ + +YKLGL RFADLTN+EYRS YLGAK    +R+ KT    RY  +VG +
Sbjct  83   RYIDEHNTK-NLSYKLGLTRFADLTNDEYRSMYLGAK--PVKRVLKTSD--RYEARVGDA  137

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            LPDS+DWR++GAVA+VKDQGSCGSCWAFSTI
Sbjct  138  LPDSVDWRKEGAVADVKDQGSCGSCWAFSTI  168



>ref|XP_011097243.1| PREDICTED: cysteine proteinase COT44 [Sesamum indicum]
Length=371

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            D SI+ Y+ +H A    R++E+V  LYE WL +HGK+YNG+G EKD+RF+IFKDNL+++D
Sbjct  22   DFSILDYNNKHAASN-PRSEEQVKGLYERWLAKHGKAYNGIG-EKDRRFQIFKDNLKFVD  79

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVG-GSLP  465
            E NS  +R YK+GLNRFADLTNEE+RS YLG +TDA+RR  K+K + RRYA + G   LP
Sbjct  80   EHNS-GNRTYKVGLNRFADLTNEEFRSVYLGTRTDAKRRFVKSKNASRRYAFRAGDDELP  138

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +S+DWRE+GAVA +K+QG+CGSCWAFST+ 
Sbjct  139  ESVDWRERGAVAPIKNQGTCGSCWAFSTVA  168



>ref|XP_002524912.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37409.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 118/148 (80%), Gaps = 2/148 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSI++++  H  +   R+D EV+++Y  WL +H K+YN LG E++KRFEIFK+NLR+ID
Sbjct  22   DMSILSHNHGHHHQSSWRSDNEVISMYNWWLAKHSKTYNKLG-EREKRFEIFKNNLRFID  80

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPD  468
            E N+ ++R YK+GL RFADLTNEEYR+ +LG K+D +RR+ K+K+  +RYA K G  LP+
Sbjct  81   EHNNSKNRTYKVGLTRFADLTNEEYRAKFLGTKSDPKRRLMKSKNPSQRYAFKAGDVLPE  140

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            SIDWR+ GAV+ +KDQGSCGSCWAFSTI
Sbjct  141  SIDWRQSGAVSAIKDQGSCGSCWAFSTI  168



>ref|NP_568620.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
 dbj|BAB08269.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAL32686.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAM47980.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AED94905.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
Length=463

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 119/151 (79%), Gaps = 9/151 (6%)
 Frame = +1

Query  112  DMSIITYDEEHPAKG-LSRTDEEVMALYESWLVEHGK---SYNGLGGEKDKRFEIFKDNL  279
            DMSII+YDE H      SR+D EV  +YE+W+VEHGK   + NGLG EKD+RFEIFKDNL
Sbjct  23   DMSIISYDENHHITTETSRSDSEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNL  82

Query  280  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  459
            R+IDE N++ + +YKLGL RFADLTNEEYRS YLGAK    +R+ KT    RY  +VG +
Sbjct  83   RFIDEHNTK-NLSYKLGLTRFADLTNEEYRSMYLGAK--PTKRVLKTSD--RYQARVGDA  137

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            LPDS+DWR++GAVA+VKDQGSCGSCWAFSTI
Sbjct  138  LPDSVDWRKEGAVADVKDQGSCGSCWAFSTI  168



>ref|XP_010244238.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=475

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 116/148 (78%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+Y++EH      RT+E+V ALYE+WLV HGK+YN LG EK+KRFEIFKDNL++ID
Sbjct  30   DMSIISYNKEHGLTSGGRTNEQVKALYETWLVRHGKAYNALG-EKEKRFEIFKDNLKFID  88

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS ++  Y+LGLNRFADLTN EYR+ YLG K +  +R ++ KS+R YA +    LP S
Sbjct  89   EHNS-QNHTYRLGLNRFADLTNAEYRALYLGKKPNPNKRDSRAKSNR-YAFQADDDLPSS  146

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWREKGAV  VKDQGSCGSCWAFST+ 
Sbjct  147  VDWREKGAVVPVKDQGSCGSCWAFSTVA  174



>ref|XP_008377786.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=349

 Score =   189 bits (480),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 122/155 (79%), Gaps = 11/155 (7%)
 Frame = +1

Query  112  DMSIITYDE-----EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  276
            DMSII+YD      ++ + G  RTD  VM++YE WL EHGK+YN LG EK++ F+IFKDN
Sbjct  25   DMSIISYDSNNHLGDNKSLGSWRTDNVVMSIYEGWLAEHGKAYNALG-EKERSFQIFKDN  83

Query  277  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR-RRIAK--TKSDRRYAPK  447
            LRYIDE+NS+ + +YKLGLNRF DL NEEYR+TYLGAKT A+ +R++    KSDR YAP 
Sbjct  84   LRYIDEKNSK-NLSYKLGLNRFVDLLNEEYRNTYLGAKTRAQMKRVSNRNIKSDR-YAPH  141

Query  448  VGGSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            VG SL DS+DWR++GAV+ VKDQGSCGSCW FSTI
Sbjct  142  VGDSLLDSVDWRKEGAVSPVKDQGSCGSCWTFSTI  176



>emb|CAA46863.1| thiolprotease [Pisum sativum]
Length=464

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 116/149 (78%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DM II+YD+ HP K   RT+++V+ +YE WLV+HGK+YN LG EK+KRFEIFKDNL +ID
Sbjct  21   DMCIISYDKTHPDKSTPRTNDQVLTMYEEWLVKHGKNYNALG-EKEKRFEIFKDNLGFID  79

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSD-RRYAPKVGGSLPD  468
            E NS+ + +++LGLNRFADLTNEEYR+ +LG + +  RR  K  S   RYA +VG  LP+
Sbjct  80   EHNSK-NLSFRLGLNRFADLTNEEYRTRFLGTRINPNRRNRKVNSQTNRYATRVGDKLPE  138

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWR++GAV  VKDQGSCGSCWAFS I 
Sbjct  139  SVDWRKEGAVVGVKDQGSCGSCWAFSAIA  167



>ref|XP_010494270.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=467

 Score =   192 bits (487),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 120/155 (77%), Gaps = 13/155 (8%)
 Frame = +1

Query  112  DMSIITYDEEH----PAKGLSRTDEEVMALYESWLVEHGK----SYNGLGGEKDKRFEIF  267
            DMSII+YDE+H         SR+D EV  +Y++WLVEHGK      N LG EKD+RFEIF
Sbjct  23   DMSIISYDEKHHITTTTTVTSRSDAEVERIYDAWLVEHGKKKMNQKNVLGAEKDQRFEIF  82

Query  268  KDNLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPK  447
            KDNLR+IDE N++ + +YKLGLNRFADLTN+EYRS YLGAK    +R+ KT    RYA +
Sbjct  83   KDNLRFIDEHNTK-NLSYKLGLNRFADLTNQEYRSMYLGAKPS--KRVLKTSD--RYAAR  137

Query  448  VGGSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            VG SLPDS+DWR++GAVA+VKDQGSCGSCWAFSTI
Sbjct  138  VGDSLPDSVDWRKEGAVADVKDQGSCGSCWAFSTI  172



>ref|XP_010549252.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=458

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 113/147 (77%), Gaps = 6/147 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE+H   G  R++ E   +YE+WLV+HGK YN LG EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDEKHHVSGGGRSEAETEEMYEAWLVKHGKFYNALG-EKDRRFEIFKDNLRFID  81

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+R +  Y+LGL RFADLTN+EYRS YLGAK   R      ++  RY P+VG ++PDS
Sbjct  82   EHNAR-NLTYRLGLTRFADLTNDEYRSMYLGAKPHKR----TLRTSDRYLPRVGDAIPDS  136

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAV EVKDQG CGSCWAFS I
Sbjct  137  VDWRKEGAVPEVKDQGGCGSCWAFSAI  163



>ref|XP_010481911.1| PREDICTED: cysteine proteinase RD21a [Camelina sativa]
Length=467

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 119/155 (77%), Gaps = 13/155 (8%)
 Frame = +1

Query  112  DMSIITYDEEH----PAKGLSRTDEEVMALYESWLVEHGK----SYNGLGGEKDKRFEIF  267
            DMSIITYDE+H         SR+D EV  +Y++WLVEHGK      N LG EKD+RFEIF
Sbjct  23   DMSIITYDEKHHITTTTTVTSRSDAEVERIYDAWLVEHGKKKMNQNNVLGAEKDQRFEIF  82

Query  268  KDNLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPK  447
            KDNLR+IDE N++ + +YKLGLNRFADLTN+EYRS YLGAK    +R+ KT    RY  +
Sbjct  83   KDNLRFIDEHNTK-NLSYKLGLNRFADLTNQEYRSMYLGAK--PTKRVLKTSD--RYEAR  137

Query  448  VGGSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            VG SLPDS+DWR++GAVA+VKDQGSCGSCWAFSTI
Sbjct  138  VGDSLPDSVDWRKEGAVADVKDQGSCGSCWAFSTI  172



>ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula]
 gb|AES73337.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGL-GGEKDKRFEIFKDNLRYI  288
            DMSII+YD+ H  K   R+D+EV  +YE W V+HGK  N + G EKDKRFEIFKDNL++I
Sbjct  27   DMSIISYDKTHSDKSSRRSDKEVKNIYEEWRVKHGKLNNNIDGSEKDKRFEIFKDNLKFI  86

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAKTKS-DRRYAPKVGGSL  462
            DE N+ E+R YK+GLNRFADL+NEEYRS YLG K D     +A+TK+   RYAP VG  L
Sbjct  87   DEHNA-ENRTYKVGLNRFADLSNEEYRSRYLGTKIDPIGMMMARTKTRSNRYAPSVGDKL  145

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P S+DWR +GAV +VKDQGSCGSCWAFSTI
Sbjct  146  PKSVDWRSQGAVVQVKDQGSCGSCWAFSTI  175



>ref|XP_009395501.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 115/149 (77%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDEEH A+GL R++EEV  +Y++W+ EHG+ +N LG E+++RFE+FKDNLR+ID
Sbjct  25   DMSIISYDEEHGARGLERSEEEVRRMYDAWVAEHGRVHNALG-EREQRFEVFKDNLRFID  83

Query  292  EQNS-REDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
              N+  E   + LGLNRFADLTNEEYR+TYLG +     R  +  SDR Y  + G  LP+
Sbjct  84   AHNADAEAYGFSLGLNRFADLTNEEYRATYLGTRAGGTARRLRAPSDR-YRHEAGDELPE  142

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWREKGAVA VKDQGSCGSCWAFSTI 
Sbjct  143  SVDWREKGAVAAVKDQGSCGSCWAFSTIA  171



>emb|CAQ00115.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=190

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 116/151 (77%), Gaps = 5/151 (3%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            +S +T ++ HP+   S   R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNL +
Sbjct  21   ISTLTLNQNHPSSSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLMF  79

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSL  462
            +DE NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    R A +   +L
Sbjct  80   VDEHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRNAHRAADNL  139

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            PDS++WR+ GAV+ VKDQGS GSCWAFS I 
Sbjct  140  PDSVNWRDHGAVSRVKDQGSWGSCWAFSAIA  170



>gb|ABR19827.1| cysteine proteinase [Elaeis guineensis]
Length=470

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 114/151 (75%), Gaps = 5/151 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++YN LG EK++RFEIFKDN+ +ID
Sbjct  24   DMSIISYDEAHGVRGLERSEEEMRILYEGWLAKHGRAYNALG-EKERRFEIFKDNVLFID  82

Query  292  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
              N+  D   R+++LGLNRFAD+TNEEYR+ YLG +    RR A+  SDR Y    G  L
Sbjct  83   AHNAAADAGHRSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARVGSDR-YRYNAGEDL  141

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            P+S+DWR KGAVA VKDQGSCGSCWAFST+ 
Sbjct  142  PESVDWRAKGAVAAVKDQGSCGSCWAFSTVA  172



>gb|KJB43804.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=277

 Score =   184 bits (467),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 111/132 (84%), Gaps = 3/132 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R+D+EVM+LY++WLV+HGK YNG+G E++ RF+IFKDNL++ID+ NS+ +  YKLGLN+F
Sbjct  30   RSDDEVMSLYQAWLVKHGKQYNGIG-EEENRFDIFKDNLKFIDQHNSK-NTTYKLGLNKF  87

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDWREKGAVAEVKDQG  519
            ADLTN+EYRS +LG K+D +RR+ K+K+  +RYA + G SLP+S+DWR+ GAV  VKDQG
Sbjct  88   ADLTNQEYRSMFLGTKSDPKRRVMKSKNPSQRYASRAGDSLPESVDWRDHGAVTPVKDQG  147

Query  520  SCGSCWAFSTIV  555
             CGSCWAFSTI 
Sbjct  148  RCGSCWAFSTIA  159



>ref|XP_010906541.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=470

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 114/151 (75%), Gaps = 5/151 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++YN LG EK++RFEIFKDN+ +ID
Sbjct  24   DMSIISYDEAHGVRGLERSEEEMRILYEGWLAKHGRAYNALG-EKERRFEIFKDNVLFID  82

Query  292  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
              N+  D   R+++LGLNRFAD+TNEEYR+ YLG +    RR A+  SDR Y    G  L
Sbjct  83   AHNAAADAGHRSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARVGSDR-YRYNAGEDL  141

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            P+S+DWR KGAVA VKDQGSCGSCWAFST+ 
Sbjct  142  PESVDWRAKGAVAAVKDQGSCGSCWAFSTVA  172



>ref|XP_009335017.1| PREDICTED: cysteine proteinase RD21a-like isoform X2 [Pyrus x 
bretschneideri]
Length=474

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSI+ Y+E+H     S  T+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR+I
Sbjct  31   DMSIVDYNEKHGMPASSDPTEPEVRALYESWLVKHAKNYNALG-EKERRFEIFKDNLRFI  89

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRR--IAKTKSDRRYAPKVGGSL  462
            DE N ++ R YK+GLNRFADLTNEEYRS YLGAK D RRR  ++ ++   RYA +VG  L
Sbjct  90   DEHN-KQSRTYKVGLNRFADLTNEEYRSVYLGAKVDRRRRSGLSGSRKSDRYAFRVGDKL  148

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+ +DWR +GAV  VKDQG CGSCWAFST+
Sbjct  149  PELVDWRAEGAVPAVKDQGQCGSCWAFSTV  178



>ref|XP_009335016.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Pyrus x 
bretschneideri]
Length=474

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSI+ Y+E+H     S  T+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR+I
Sbjct  31   DMSIVDYNEKHGMPASSDPTETEVRALYESWLVKHAKNYNALG-EKERRFEIFKDNLRFI  89

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRR--IAKTKSDRRYAPKVGGSL  462
            DE N ++ R YK+GLNRFADLTNEEYRS YLGAK D RRR  ++ ++   RYA +VG  L
Sbjct  90   DEHN-KQSRTYKVGLNRFADLTNEEYRSVYLGAKVDRRRRSGLSGSRKSDRYAFRVGDKL  148

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+ +DWR +GAV  VKDQG CGSCWAFST+
Sbjct  149  PELVDWRAEGAVPAVKDQGQCGSCWAFSTV  178



>ref|XP_010070600.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW59473.1| hypothetical protein EUGRSUZ_H02220 [Eucalyptus grandis]
Length=386

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 113/146 (77%), Gaps = 2/146 (1%)
 Frame = +1

Query  118  SIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQ  297
            SII Y  +       RTD EV+ +YE WL  HGK+YNGLG E++ RF++FKDNLR+IDE 
Sbjct  28   SIIDYAAKGRTASAPRTDGEVVEMYELWLARHGKAYNGLG-EREMRFQVFKDNLRFIDEH  86

Query  298  NSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSI  474
            NS ++R Y LGLN+FADLTN+EYR+ YLG +++A+RR+ K++ + RRYA + G  LP+++
Sbjct  87   NSSQNRTYTLGLNKFADLTNDEYRAMYLGTRSEAKRRVMKSRNASRRYAVRAGDRLPEAV  146

Query  475  DWREKGAVAEVKDQGSCGSCWAFSTI  552
            DWR KGAV  VKDQG+CGSCWAFST+
Sbjct  147  DWRLKGAVNPVKDQGTCGSCWAFSTV  172



>ref|XP_008799871.1| PREDICTED: oryzain alpha chain-like isoform X1 [Phoenix dactylifera]
 ref|XP_008799878.1| PREDICTED: oryzain alpha chain-like isoform X2 [Phoenix dactylifera]
Length=473

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 113/151 (75%), Gaps = 5/151 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++YN LG EK++RFEIFKDN+R+ID
Sbjct  27   DMSIISYDEAHGVRGLERSEEEMRLLYEGWLAKHGRAYNALG-EKERRFEIFKDNVRFID  85

Query  292  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
              N+  D    +++LGLNRFAD+TNEEYR+ YLG +    RR A+  SDR Y    G  L
Sbjct  86   AHNAEADAGHHSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARFGSDR-YRYNAGEEL  144

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            P+S+DWR KGA A VKDQGSCGSCWAFST+ 
Sbjct  145  PESVDWRAKGAAAAVKDQGSCGSCWAFSTVA  175



>ref|XP_010540378.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=460

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 126/184 (68%), Gaps = 28/184 (15%)
 Frame = +1

Query  7    FPFLFTTVITLSSPDMakllilslfvlaavsaaaaDMSIITYDEEH--PAKGLSRTDEEV  180
               LF TVI+LSS                    A DMSII+YDE+H     G  R++ + 
Sbjct  8    LAILFLTVISLSS--------------------AMDMSIISYDEKHHVSGGGGGRSEVDT  47

Query  181  MALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFADLTNE  360
             ALYE+WLV+HGK YN LG EKD+RFEIFK+NLR+IDE N++ + +Y+LGL RFADLTNE
Sbjct  48   AALYEAWLVKHGKFYNALG-EKDRRFEIFKENLRFIDEHNAK-NLSYRLGLTRFADLTNE  105

Query  361  EYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGSCGSCWA  540
            EYRS YLGAK   R      ++  RY P+V  +LPDS+DWR++GAV++VKDQGSCGSCWA
Sbjct  106  EYRSMYLGAKPHKR----TLRTSDRYQPRVSDALPDSVDWRKEGAVSDVKDQGSCGSCWA  161

Query  541  FSTI  552
            FS I
Sbjct  162  FSAI  165



>ref|XP_009618803.1| PREDICTED: cysteine proteinase COT44-like [Nicotiana tomentosiformis]
Length=376

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 6/152 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSR----TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  279
            DMSII Y        + +     DEEV  +YE WL EHGK+YN LG EK+KRFEIFKDNL
Sbjct  22   DMSIIDYKNNQHVGNMKKWTWQNDEEVKGIYELWLAEHGKAYNALG-EKEKRFEIFKDNL  80

Query  280  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGG  456
            ++I+E N+  +R YK+GLN+FADLTNEEYR+ YLG ++DARRR  K+K+   RYA +   
Sbjct  81   KFIEEHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTRSDARRRFVKSKNPSHRYASRPNE  140

Query  457  SLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             +P S+DWR++GAVA +K+QGSCGSCWAFST+
Sbjct  141  LMPHSVDWRKRGAVAPIKNQGSCGSCWAFSTV  172



>gb|AAK07730.1| CPR1-like cysteine proteinase [Nicotiana tabacum]
Length=374

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAK--GLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII Y   H A+   L   +++V   YE WL EHG++YN LG EK+KRFEIFKDNLR+
Sbjct  22   DMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHGRAYNALG-EKEKRFEIFKDNLRF  80

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  462
            I+E N+  +R YK+GLN+FADLTNEEYR+ YLG K+DARRR  K+K+  +RYA +    +
Sbjct  81   IEEHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTKSDARRRFVKSKNPSQRYASRPNELM  140

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P S+DWR++GAVA +K+QGSCGSCWAFST+
Sbjct  141  PHSVDWRKRGAVAPIKNQGSCGSCWAFSTV  170



>ref|XP_006343212.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=366

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 106/129 (82%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  DEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFAD  348
            DEEV  +YE WLVEHGK YNGLG EK KRFEIFKDNLR+I+E N+ +++ Y LGLNRFAD
Sbjct  34   DEEVKGIYEIWLVEHGKIYNGLG-EKGKRFEIFKDNLRFIEEHNNLKNQTYVLGLNRFAD  92

Query  349  LTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGSC  525
            LTNEEYR+ +LG ++DARRR+ K+K +  RY  +    +P+S+DWR+KGAVA +KDQGSC
Sbjct  93   LTNEEYRTMFLGTRSDARRRLVKSKNASHRYVFRASDHVPESVDWRKKGAVAPIKDQGSC  152

Query  526  GSCWAFSTI  552
            GSCWAFST+
Sbjct  153  GSCWAFSTV  161



>ref|XP_002518705.1| cysteine protease, putative [Ricinus communis]
 gb|EEF43630.1| cysteine protease, putative [Ricinus communis]
Length=471

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 114/147 (78%), Gaps = 3/147 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSI+ Y+ +H  K   RTD +V  +YE WLVEHGK+YN LG EK+KRFEIFKDNLR+ID
Sbjct  25   DMSIVDYNIKHGTKYPLRTDSQVRRMYEMWLVEHGKAYNALG-EKEKRFEIFKDNLRFID  83

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS  DR+YK+GLNRFADLTNEEY++ +LG K + + R   T+S +RY  K G  LP++
Sbjct  84   EHNSV-DRSYKVGLNRFADLTNEEYKAMFLGTKMERKNRFLGTRS-QRYLFKDGDDLPEN  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKGAV  VKDQG CGSCWAFST+
Sbjct  142  VDWREKGAVVPVKDQGQCGSCWAFSTV  168



>ref|XP_010442084.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=466

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 118/154 (77%), Gaps = 12/154 (8%)
 Frame = +1

Query  112  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGK----SYNGLGGEKDKRFEIFK  270
            DMSII+YDE+H        SR+D EV  +Y++WLVEHGK      N LG EKD+RFEIFK
Sbjct  23   DMSIISYDEKHHITTTTVTSRSDAEVERIYDAWLVEHGKKKMNQNNVLGAEKDQRFEIFK  82

Query  271  DNLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKV  450
            DNLR+IDE N++ + +YKLGLNRFADLTN+EYRS YLGAK    +R+ KT    RY  +V
Sbjct  83   DNLRFIDEHNTK-NLSYKLGLNRFADLTNQEYRSMYLGAK--PSKRVLKTSD--RYEARV  137

Query  451  GGSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            G SLP S+DWR++GAVA+VKDQGSCGSCWAFSTI
Sbjct  138  GDSLPGSVDWRKEGAVADVKDQGSCGSCWAFSTI  171



>ref|XP_010928366.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=465

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 115/151 (76%), Gaps = 5/151 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++ N LG EK++RFEIFKDN+R+ID
Sbjct  24   DMSIISYDEAHGVQGLERSEEEMRLLYEGWLAKHGRADNALG-EKERRFEIFKDNVRFID  82

Query  292  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
              N+  D   R+++LGLNRFAD+TNEEYR+ YLG +  + RR A+  SDR Y    G  L
Sbjct  83   AHNAAADSGHRSFRLGLNRFADMTNEEYRAVYLGTRPASHRRRARLGSDR-YRYNAGEEL  141

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            P+S+DWR+KGAV  VKDQGSCGSCWAFSTI 
Sbjct  142  PESVDWRDKGAVTTVKDQGSCGSCWAFSTIA  172



>gb|EYU37647.1| hypothetical protein MIMGU_mgv1a005905mg [Erythranthe guttata]
Length=465

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 113/148 (76%), Gaps = 7/148 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSIITYDE+H      R++ + MA+YESWLV+HGK+YN +G EK+KRF+IFKDNL +++
Sbjct  25   DMSIITYDEKH-----QRSEGDAMAMYESWLVKHGKAYNAIG-EKEKRFQIFKDNLMFVE  78

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS  DR YK+G+NRFADLTNEEYRS ++  + D   R+   ++  RYA K G  LP+ 
Sbjct  79   EHNS-ADRPYKVGMNRFADLTNEEYRSMFVRGRLDRNARLMNRRASDRYALKAGEKLPEF  137

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            +DWREKGAVA VKDQG CGSCWAFSTI 
Sbjct  138  VDWREKGAVAPVKDQGQCGSCWAFSTIA  165



>ref|XP_009784112.1| PREDICTED: cysteine proteinase COT44-like [Nicotiana sylvestris]
Length=374

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 114/150 (76%), Gaps = 4/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAK--GLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII Y   H A    L   +++V   YE WL EHG++YN LG EK+KRFEIFKDNLR+
Sbjct  22   DMSIIDYKNNHYASKWTLQSDEDQVKNRYEMWLAEHGRAYNALG-EKEKRFEIFKDNLRF  80

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  462
            I+E N+  +R YK+GLN+FADLTNEEYR+ YLG K+DARRR  K+K+  +RYA +    +
Sbjct  81   IEEHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTKSDARRRFVKSKNPSQRYASRPNELM  140

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P S+DWR++GAVA +K+QGSCGSCWAFST+
Sbjct  141  PHSVDWRKRGAVAPIKNQGSCGSCWAFSTV  170



>ref|XP_011000919.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=488

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 112/147 (76%), Gaps = 2/147 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII Y+ +H  +   RT+ E + LYE WLVEHGK+YN LG EK++RFEIFKDNL+++D
Sbjct  35   DMSIIDYNLKH-GQVPERTEAETLRLYEMWLVEHGKAYNALG-EKERRFEIFKDNLKFVD  92

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            + NS  + +YKLGLN+FADL+NEEYR+ YLG + D +RR+       RY  K G  LP+S
Sbjct  93   QHNSVGNPSYKLGLNKFADLSNEEYRAAYLGTRMDGKRRLLGGPKSARYLFKDGDDLPES  152

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKGAVA VKDQG CGSCWAFST+
Sbjct  153  VDWREKGAVAPVKDQGQCGSCWAFSTV  179



>ref|XP_007042494.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX98325.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=579

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII YD +H  +   RT+ ++  +YE+WLV+HGK+YNGLG EK+KRFEIFKDNL++I+
Sbjct  134  DMSIIDYDLKHGGQQQKRTETQIRRMYETWLVKHGKAYNGLG-EKEKRFEIFKDNLKFIE  192

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR---RRIAKTKSDRRYAPKVGGSL  462
            E NS  +  YK+GLNRFADLTNEEY++ YLGA+ D +    R+A  +  +RY  +VG  L
Sbjct  193  EHNS-VNGTYKVGLNRFADLTNEEYKAMYLGARLDGKTVSHRLAGKEKSQRYVFRVGDKL  251

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+S+DWREKGAV  VKDQG CGSCWAFST+
Sbjct  252  PESVDWREKGAVVAVKDQGQCGSCWAFSTV  281



>gb|KHN27075.1| Cysteine proteinase RD21a [Glycine soja]
Length=368

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  166  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  345
            TD EVM +YE WLV+H K YNGLG EKDKRF++FKDNL +I E N+ ++  YKLGLN+FA
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLG-EKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNKFA  90

Query  346  DLTNEEYRSTYLGAKTDARRRIAKTKSD-RRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            D+TNEEYR  Y G K+DA+RR+ KTKS   RYA   G  LP  +DWR KGAVA +KDQGS
Sbjct  91   DMTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDQLPVHVDWRVKGAVAPIKDQGS  150

Query  523  CGSCWAFSTI  552
            CGSCWAFST+
Sbjct  151  CGSCWAFSTV  160



>ref|XP_006280322.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
 gb|EOA13220.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
Length=511

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 122/157 (78%), Gaps = 13/157 (8%)
 Frame = +1

Query  112  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGKS---YNGL-GGEKDK-RFE  261
            DMSII+YD+ H          SR+D EV  +Y+SWLVEHGK     NGL G +KD+ RFE
Sbjct  63   DMSIISYDKNHHITTTTTTVTSRSDAEVERIYDSWLVEHGKKKEKMNGLLGSDKDQERFE  122

Query  262  IFKDNLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYA  441
            IFKDNLR+IDE N++++ +YKLGLNRFADLTNEEYRS YLGAK +  +R+ K  SD RY 
Sbjct  123  IFKDNLRFIDEHNNKKNLSYKLGLNRFADLTNEEYRSMYLGAKPN--KRVLKKTSD-RYE  179

Query  442  PKVGGSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             +VG +LPDS+DWR++GAV++VKDQGSCGSCWAFSTI
Sbjct  180  ARVGDALPDSVDWRKEGAVSDVKDQGSCGSCWAFSTI  216



>gb|AAQ62999.1| oil palm polygalacturonase allergen PEST472 [Elaeis guineensis]
Length=525

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 115/151 (76%), Gaps = 5/151 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++ N LG EK++RFEIFKDN+R+ID
Sbjct  24   DMSIISYDEAHGVQGLERSEEEMRLLYEGWLAKHGRADNALG-EKERRFEIFKDNVRFID  82

Query  292  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
              N+  D   R+++LGLNRFAD+TNEEYR+ YLG +  + RR A+  SDR Y    G  L
Sbjct  83   AHNAAADSGHRSFRLGLNRFADMTNEEYRTVYLGTRPASHRRRARLGSDR-YRYNAGEEL  141

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            P+S+DWR+KGAV  VKDQGSCGSCWAFSTI 
Sbjct  142  PESVDWRDKGAVTTVKDQGSCGSCWAFSTIA  172



>gb|ACU13684.1| unknown [Glycine max]
Length=229

 Score =   180 bits (456),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = +1

Query  166  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  345
            TD EVM +YE WLV+H K YNGL  EKDKRF++FKDNL +I E N+ ++  YKLGLN+FA
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLR-EKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNQFA  90

Query  346  DLTNEEYRSTYLGAKTDARRRIAKTKSD-RRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            D+TNEEYR  Y G K+DA+RR+ KTKS   RYA   G  LP  +DWR KGAVA +KDQGS
Sbjct  91   DMTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDRLPVHVDWRVKGAVAPIKDQGS  150

Query  523  CGSCWAFSTI  552
            CGSCWAFST+
Sbjct  151  CGSCWAFSTV  160



>ref|XP_003550041.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=366

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +1

Query  166  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  345
            TD EVM +YE WLV+H K YNGLG EKDKRF++FKDNL +I E N+ ++  YKLGLN+FA
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLG-EKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNKFA  90

Query  346  DLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            D+TNEEYR  Y G K+DA+RR+ KTKS   RYA   G  LP  +DWR KGAVA +KDQGS
Sbjct  91   DMTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDQLPVHVDWRVKGAVAPIKDQGS  150

Query  523  CGSCWAFSTI  552
            CGSCWAFST+
Sbjct  151  CGSCWAFSTV  160



>ref|XP_002285299.1| PREDICTED: cysteine proteinase RD21a-like [Vitis vinifera]
Length=469

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 116/147 (79%), Gaps = 6/147 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+Y +    +   RTD EVMA+YE+WLV+HGKSYN LG E+++RFEIFKDNLR+I+
Sbjct  32   DMSIISYGD----RLEKRTDAEVMAVYEAWLVKHGKSYNALG-ERERRFEIFKDNLRFIE  86

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+  +R YK+GLNRFADLTNEEYRS YLG + + RR +  ++   RY+ + G  LP+S
Sbjct  87   EHNAV-NRTYKVGLNRFADLTNEEYRSRYLGRRDETRRGLRASRVSDRYSFRAGEDLPES  145

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKGAV  VKDQG+CGSCWAFSTI
Sbjct  146  VDWREKGAVVPVKDQGNCGSCWAFSTI  172



>ref|XP_010061721.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW68707.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 119/154 (77%), Gaps = 8/154 (5%)
 Frame = +1

Query  112  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  276
            DMSI++YD  H      +    R+D+EVMA+YESWL +HGK+YN LG EK+KRF++FKDN
Sbjct  29   DMSIVSYDRAHGDRSSSSSSSWRSDDEVMAVYESWLAKHGKAYNALG-EKEKRFQVFKDN  87

Query  277  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTD-ARRRIAKTKSDRRYAPKVG  453
            LR+ID+ N+  DR Y +GLN+FADLTNEEYRS YLGA+ D + RR+ + +SDR YA   G
Sbjct  88   LRFIDDHNAGGDRTYTVGLNQFADLTNEEYRSMYLGARMDRSGRRLGRARSDR-YAVAAG  146

Query  454  GSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
              LP S+DWR++GAV +VKDQGSCGSCWAFSTI 
Sbjct  147  EELPASVDWRKEGAVVDVKDQGSCGSCWAFSTIA  180



>emb|CDX71540.1| BnaC04g17750D [Brassica napus]
Length=460

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 9/151 (6%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  279
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITAENERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  280  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  459
            R+IDE N++ + +YKLGL RFADLTNEEYRS YLGAK+  ++R+ KT    RY P+VG +
Sbjct  82   RFIDEHNNK-NLSYKLGLTRFADLTNEEYRSIYLGAKS--KKRVLKTSD--RYQPRVGDA  136

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +PDS+DWR++GAVA VKDQGSCGSCWAFSTI
Sbjct  137  IPDSVDWRKEGAVAAVKDQGSCGSCWAFSTI  167



>ref|XP_008813817.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Phoenix 
dactylifera]
Length=469

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE H  +GL R++E++  LYE WL +HG++YN LG EK++RFEIFKDN+R+ID
Sbjct  25   DMSIISYDETHGVRGLERSEEDMRLLYEGWLAKHGRAYNALG-EKERRFEIFKDNVRFID  83

Query  292  EQNSRE-DRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
              N+     +++LGLNRFAD+TNEEYR+ YLG +    RR A+  SDR Y    G  LP+
Sbjct  84   AHNADAGHHSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARVGSDR-YRYDAGDVLPE  142

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            S+DWR KGAVA VKDQGSCGSCWAFST+ 
Sbjct  143  SVDWRVKGAVAAVKDQGSCGSCWAFSTVA  171



>ref|XP_002310708.2| hypothetical protein POPTR_0007s10650g [Populus trichocarpa]
 gb|EEE91158.2| hypothetical protein POPTR_0007s10650g [Populus trichocarpa]
Length=376

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 118/151 (78%), Gaps = 5/151 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSI  +D+ H +   S  R+D+EVM++Y+ WL +HGK+YN LG EK KRFEIFK+NLR+
Sbjct  20   DMSIFNHDDNHLSHDQSSWRSDDEVMSIYKWWLQKHGKAYNRLG-EKAKRFEIFKNNLRF  78

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  462
            IDE NS ++R YK+GL +FADLTN+EYR+ +LG ++D +RR+ K+K+   RYA K G  L
Sbjct  79   IDEHNS-QNRTYKVGLTKFADLTNQEYRAMFLGTRSDPKRRLMKSKNPSERYAYKAGDKL  137

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            P+S+DWR KGAV  +KDQGSCGSCWAFST+ 
Sbjct  138  PESVDWRGKGAVNPIKDQGSCGSCWAFSTVA  168



>gb|AAL60579.1|AF454957_1 senescence-associated cysteine protease [Brassica oleracea]
Length=460

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 9/151 (6%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  279
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITAENERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  280  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  459
            R+IDE N++ + +YKLGL RFADLTNEEYRS YLGAK+  ++R+ KT    RY P+VG +
Sbjct  82   RFIDEHNNK-NLSYKLGLTRFADLTNEEYRSIYLGAKS--KKRVLKTSD--RYQPRVGDA  136

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +PDS+DWR++GAVA VKDQGSCGSCWAFSTI
Sbjct  137  IPDSVDWRKEGAVAAVKDQGSCGSCWAFSTI  167



>ref|XP_002306486.2| hypothetical protein POPTR_0005s18520g [Populus trichocarpa]
 gb|EEE93482.2| hypothetical protein POPTR_0005s18520g [Populus trichocarpa]
Length=396

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 118/151 (78%), Gaps = 5/151 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSI+T ++  P    S  R+D+EVM++Y+ WL +HGK+YN LG E+ +RFEIFK+NLR+
Sbjct  20   DMSILTSNDNQPNHDRSSWRSDDEVMSMYKWWLAKHGKAYNRLG-EEAERFEIFKNNLRF  78

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  462
            IDE NS ++  YK+GL +FADLTNEEYR+ +LG ++DA+RR+ K+KS   RYA K G  L
Sbjct  79   IDEHNS-QNHTYKVGLTKFADLTNEEYRAMFLGTRSDAKRRLMKSKSPSERYAFKAGDKL  137

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            P+S+DWR KGAV  +KDQGSCGSCWAFST+ 
Sbjct  138  PESVDWRAKGAVNPIKDQGSCGSCWAFSTVA  168



>gb|KFK31760.1| hypothetical protein AALP_AA6G155800 [Arabis alpina]
Length=468

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 116/155 (75%), Gaps = 12/155 (8%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGL----SRTDEEVMALYESWLVEHGKSYNG----LGGEKDKRFEIF  267
            DMSII+YDE H         SRTD EV ++YE+WLV+HGK+ N     L GE  +RFEIF
Sbjct  23   DMSIISYDENHHITTTTTVNSRTDAEVASIYEAWLVKHGKNKNKNDLLLVGETKQRFEIF  82

Query  268  KDNLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPK  447
            KDNLRYIDE N+ ++ +YKLGL RFADLTNEEYRS YLGAK    +R+ KT    RY  +
Sbjct  83   KDNLRYIDEHNNNKNLSYKLGLTRFADLTNEEYRSIYLGAK--PTKRVFKTSD--RYEAR  138

Query  448  VGGSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            VG +LP+++DWR++GAVA VKDQGSCGSCWAFSTI
Sbjct  139  VGDALPETVDWRKEGAVAAVKDQGSCGSCWAFSTI  173



>ref|XP_007047371.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX91528.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=384

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 109/129 (84%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  DEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFAD  348
            D+EV +LY+SWLV+HGK+YNG+G E++ RF+IFKDNL++IDE NS  +R YKLGLN+FAD
Sbjct  50   DDEVRSLYKSWLVKHGKAYNGIG-EEEMRFDIFKDNLKFIDEHNSNNNRTYKLGLNKFAD  108

Query  349  LTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDWREKGAVAEVKDQGSC  525
            LTN+EYRS +LG ++D RRR+ K+K+  +RYA + G SLP+S+DWRE G+V  VKDQG C
Sbjct  109  LTNQEYRSKFLGTRSDPRRRVMKSKNPSQRYAFRAGDSLPESVDWREHGSVNPVKDQGYC  168

Query  526  GSCWAFSTI  552
            GSCWAFSTI
Sbjct  169  GSCWAFSTI  177



>gb|KJB43805.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=366

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 111/132 (84%), Gaps = 3/132 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R+D+EVM+LY++WLV+HGK YNG+G E++ RF+IFKDNL++ID+ NS+ +  YKLGLN+F
Sbjct  30   RSDDEVMSLYQAWLVKHGKQYNGIG-EEENRFDIFKDNLKFIDQHNSK-NTTYKLGLNKF  87

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDWREKGAVAEVKDQG  519
            ADLTN+EYRS +LG K+D +RR+ K+K+  +RYA + G SLP+S+DWR+ GAV  VKDQG
Sbjct  88   ADLTNQEYRSMFLGTKSDPKRRVMKSKNPSQRYASRAGDSLPESVDWRDHGAVTPVKDQG  147

Query  520  SCGSCWAFSTIV  555
             CGSCWAFSTI 
Sbjct  148  RCGSCWAFSTIA  159



>gb|KJB43803.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=367

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 111/132 (84%), Gaps = 3/132 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R+D+EVM+LY++WLV+HGK YNG+G E++ RF+IFKDNL++ID+ NS+ +  YKLGLN+F
Sbjct  30   RSDDEVMSLYQAWLVKHGKQYNGIG-EEENRFDIFKDNLKFIDQHNSK-NTTYKLGLNKF  87

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDWREKGAVAEVKDQG  519
            ADLTN+EYRS +LG K+D +RR+ K+K+  +RYA + G SLP+S+DWR+ GAV  VKDQG
Sbjct  88   ADLTNQEYRSMFLGTKSDPKRRVMKSKNPSQRYASRAGDSLPESVDWRDHGAVTPVKDQG  147

Query  520  SCGSCWAFSTIV  555
             CGSCWAFSTI 
Sbjct  148  RCGSCWAFSTIA  159



>emb|CAB16317.1| cysteine proteinase precursor [Nicotiana tabacum]
Length=374

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 114/150 (76%), Gaps = 4/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAK--GLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII Y   H A+   L   +++V   YE WL EHG++YN LG EK+KRFEIFKDNLR+
Sbjct  22   DMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHGRAYNALG-EKEKRFEIFKDNLRF  80

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  462
            I+  N+  +R YK+GLN+FADLTNEEYR+ YLG K+DARRR  K+K+  +RYA +    +
Sbjct  81   IEGHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTKSDARRRFVKSKNPSQRYASRPNELM  140

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P S+DWR++GAVA +K+QGSCGSCWAFST+
Sbjct  141  PHSVDWRKRGAVAPIKNQGSCGSCWAFSTV  170



>gb|KFK44641.1| hypothetical protein AALP_AA1G285100 [Arabis alpina]
Length=460

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 8/149 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YDE H      RTD EV  +YE+WLV+HGK  S N L  EKD RFEIFKDNLR+
Sbjct  23   DMSIISYDETHGLAVGGRTDAEVAKIYEAWLVKHGKKMSENSLV-EKDPRFEIFKDNLRF  81

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE NS+ + +YKLGL RFADLTNEEYRS YLGAK   + +    ++ +RY  +VG S+P
Sbjct  82   IDEHNSK-NLSYKLGLTRFADLTNEEYRSKYLGAKMMKKEK----RTSQRYEARVGDSIP  136

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +S+DWR++GAVAEVKDQGSCGSCWAFSTI
Sbjct  137  ESVDWRKEGAVAEVKDQGSCGSCWAFSTI  165



>gb|EYU34557.1| hypothetical protein MIMGU_mgv1a007408mg [Erythranthe guttata]
Length=408

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 111/132 (84%), Gaps = 3/132 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            RTDE+V  LYESWL +HGK+YNG+G EKD+RF+IFKDNL+++D+ NS  +R Y++GLN+F
Sbjct  36   RTDEQVKGLYESWLAKHGKAYNGIG-EKDRRFDIFKDNLKFVDDHNS-GNRTYEVGLNKF  93

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDWREKGAVAEVKDQG  519
            ADLTNEEYRSTYLG ++D  RR  K+K+  RRYA + G  LP+S+DWRE+GAV+ +K+QG
Sbjct  94   ADLTNEEYRSTYLGTRSDPTRRFVKSKNPSRRYALRSGEMLPESVDWRERGAVSPIKNQG  153

Query  520  SCGSCWAFSTIV  555
            +CGSCWAFST+ 
Sbjct  154  TCGSCWAFSTVA  165



>gb|KDP47124.1| hypothetical protein JCGZ_22120 [Jatropha curcas]
Length=242

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 110/148 (74%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII Y+  H      RTD  V  +YE WLV+HGK+YN LG EK+KRF+IFKDNL++ID
Sbjct  25   DMSIIDYNIRHGQNPEERTDANVRRIYEMWLVKHGKAYNALG-EKEKRFQIFKDNLKFID  83

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRI-AKTKSDRRYAPKVGGSLPD  468
            E NS  +R+YKLGLNRFADL+NEEYR+ +LG + + + R+ A   ++ RY  K G  LP+
Sbjct  84   EHNSV-NRSYKLGLNRFADLSNEEYRAMFLGTRMERKNRLGASMGTESRYLYKEGDDLPE  142

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             +DWREKGAV  VK+QG CGSCWAFST+
Sbjct  143  KVDWREKGAVVPVKNQGQCGSCWAFSTV  170



>emb|CDY22370.1| BnaA06g36920D [Brassica napus]
Length=460

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 119/151 (79%), Gaps = 9/151 (6%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  279
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITADNERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  280  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  459
            R+IDE N++ + +YKLGL RFADLTNEEYRS YLGAK   ++R+ KT    RY P+VG +
Sbjct  82   RFIDEHNNK-NLSYKLGLTRFADLTNEEYRSIYLGAKP--KKRVLKTSD--RYQPRVGDA  136

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +PDS+DWR++GAVA VKDQGSCGSCWAFSTI
Sbjct  137  IPDSVDWRKEGAVAAVKDQGSCGSCWAFSTI  167



>ref|XP_009101816.1| PREDICTED: cysteine proteinase RD21a [Brassica rapa]
Length=460

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 119/151 (79%), Gaps = 9/151 (6%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  279
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITADNERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  280  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  459
            R+IDE N++ + +YKLGL RFADLTNEEYRS YLGAK   ++R+ KT    RY P+VG +
Sbjct  82   RFIDEHNNK-NLSYKLGLTRFADLTNEEYRSIYLGAKP--KKRVLKTSD--RYQPRVGDA  136

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +PDS+DWR++GAVA VKDQGSCGSCWAFSTI
Sbjct  137  IPDSVDWRKEGAVAAVKDQGSCGSCWAFSTI  167



>gb|KCW68708.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 118/154 (77%), Gaps = 8/154 (5%)
 Frame = +1

Query  112  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  276
            DMSI++YD  H      +    R+D+EVMA+YESWL +HGK+YN LG EK+KRF++FKDN
Sbjct  29   DMSIVSYDRAHGDRSSSSSSSWRSDDEVMAVYESWLAKHGKAYNALG-EKEKRFQVFKDN  87

Query  277  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTD-ARRRIAKTKSDRRYAPKVG  453
            LR+ID+ N+  DR Y +GLN+FADLTNEEYRS YLGA+ D + RR+ + +SDR YA   G
Sbjct  88   LRFIDDHNAGGDRTYTVGLNQFADLTNEEYRSMYLGARMDRSGRRLGRARSDR-YAVAAG  146

Query  454  GSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
              LP S+DWR++GAV +VKDQGSCG CWAFSTI 
Sbjct  147  EELPASVDWRKEGAVVDVKDQGSCGDCWAFSTIA  180



>ref|XP_008350332.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Malus domestica]
Length=462

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 112/148 (76%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            D+SII Y+++H     S RT+ E  ALYESWL++HGK+YN LG EK++RFEIFKDNLR+I
Sbjct  20   DVSIIDYNDKHGMTTPSDRTEPEAKALYESWLIKHGKNYNALG-EKERRFEIFKDNLRFI  78

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DE N  + R YK+GLNRFADLTNEEYRS YL AK D   R++ ++   RY  + G  LP+
Sbjct  79   DEHN-LQSRTYKVGLNRFADLTNEEYRSVYLVAKVDRGSRLSGSRKSDRYPFRAGNELPE  137

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+ WR KGAVA VKDQG CGSCWAFST+
Sbjct  138  SVHWRAKGAVATVKDQGQCGSCWAFSTV  165



>ref|XP_002894032.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70291.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   183 bits (465),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 118/149 (79%), Gaps = 6/149 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLG-GEKDKRFEIFKDNLRY  285
            DMSII+YDE+H       R+D EVM++YE+WLV+HGK+ N     EKD+RFEIFKDNLR+
Sbjct  16   DMSIISYDEKHGVSTTGGRSDAEVMSIYEAWLVKHGKAQNQNSLVEKDRRFEIFKDNLRF  75

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            ID+ N +++ +Y+LGL RFADLTN+EYRS YLGAK + +    + ++ +RY  +VG  LP
Sbjct  76   IDDHN-KKNLSYRLGLTRFADLTNDEYRSKYLGAKMEKK---GERRTSQRYEARVGDELP  131

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +SIDWR+KGAVAEVKDQGSCGSCWAFSTI
Sbjct  132  ESIDWRKKGAVAEVKDQGSCGSCWAFSTI  160



>gb|KHN04480.1| Cysteine proteinase RD21a [Glycine soja]
Length=360

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD  H  K   ++DEEVM++YE WLV+HGK YN +  EK+KRF+IFKDNL +I+
Sbjct  19   DMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHGKVYNAVE-EKEKRFQIFKDNLNFIE  77

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+  +R YK+GLNRF+DL+NEEYRS YLG K D RR +A+    RRY+P+V  +LP+S
Sbjct  78   EHNAV-NRTYKVGLNRFSDLSNEEYRSKYLGTKIDPRRMMARPS--RRYSPRVADNLPES  134

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAV  VK+Q  C  CWAFS I
Sbjct  135  VDWRKEGAVVRVKNQSECEGCWAFSAI  161



>ref|XP_009358749.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
 ref|XP_009348984.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
Length=456

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 112/148 (76%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            D+SII Y+++H     S  T+ E  ALYESWL++HGK+YN LG EK++RFEIFKDNLR+I
Sbjct  14   DLSIIDYNDKHGMTAPSDPTETEAKALYESWLIKHGKNYNALG-EKERRFEIFKDNLRFI  72

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DE N  + R  K+GLNRFADLTNEEYRS YLGAK D   R++ ++   RY  + G  LP+
Sbjct  73   DEHNI-QSRTSKVGLNRFADLTNEEYRSVYLGAKVDRGSRLSGSRKSDRYIFRAGDELPE  131

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR KGAVA VKDQG CGSCWAFST+
Sbjct  132  SVDWRAKGAVAAVKDQGQCGSCWAFSTV  159



>ref|XP_010028205.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW54899.1| hypothetical protein EUGRSUZ_I00879 [Eucalyptus grandis]
Length=364

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 108/132 (82%), Gaps = 3/132 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            RTDEEVM +YE WL +HGK+YNGLG E+++RFEIF+DNLR++DE N+  +R+Y LG+NRF
Sbjct  25   RTDEEVMGMYELWLAKHGKAYNGLG-ERERRFEIFRDNLRFVDEHNAL-NRSYTLGMNRF  82

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKT-KSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQG  519
            ADLTNEEYR+ YLG ++D  RR+AK  ++  RYAP+    LP ++DWR +GAV +VKDQG
Sbjct  83   ADLTNEEYRAVYLGTRSDPVRRVAKAARASGRYAPRPDDMLPAAVDWRTRGAVNKVKDQG  142

Query  520  SCGSCWAFSTIV  555
            +CGSCWAFSTI 
Sbjct  143  ACGSCWAFSTIA  154



>ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
 gb|EEE87091.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
Length=477

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 112/147 (76%), Gaps = 2/147 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII Y+ +H  +   RT+ E + LYE WLV++GK+YN LG EK++RFEIFKDNL+++D
Sbjct  24   DMSIIDYNLKH-GQVPERTEAETLRLYEMWLVKYGKAYNALG-EKERRFEIFKDNLKFVD  81

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            + NS  + +YKLGLN+FADL+NEEYR+ YLG + D +RR+       RY  K G  LP+S
Sbjct  82   QHNSVGNPSYKLGLNKFADLSNEEYRAAYLGTRMDGKRRLLGGPKSARYLFKDGDDLPES  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKGAVA VKDQG CGSCWAFST+
Sbjct  142  VDWREKGAVAPVKDQGQCGSCWAFSTV  168



>ref|XP_010691718.1| PREDICTED: cysteine proteinase RD21a-like [Beta vulgaris subsp. 
vulgaris]
Length=471

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YD++H    +S  R+++EVM LYESWLV+H K+YN LG EK+KRF+IFKDNL++
Sbjct  30   DMSIISYDQDHHTNIVSSSRSEDEVMNLYESWLVKHRKNYNALG-EKEKRFQIFKDNLKF  88

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            ID+ NS + +++KLGLN+FADLTN+E+RS Y G K        K KSD RY  + G  LP
Sbjct  89   IDQHNSDDQQSFKLGLNKFADLTNDEFRSKYFGRKKKDSLLKMKVKSD-RYLFREGDQLP  147

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
             S+DWREKGAV+ +KDQG CGSCWAFSTI 
Sbjct  148  KSVDWREKGAVSHIKDQGQCGSCWAFSTIA  177



>gb|AEZ65082.1| cysteine protease [Carica papaya]
Length=471

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 111/149 (74%), Gaps = 5/149 (3%)
 Frame = +1

Query  115  MSIITYD-EEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            MSII YD    P +   RT+  +M +YE WLV+HGK+YN +G EK++RFEIFKDNLR++D
Sbjct  26   MSIIDYDLPADPLQSTERTEAHMMKMYEHWLVKHGKNYNAIG-EKERRFEIFKDNLRFVD  84

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGG--SLP  465
            EQNS   R YKLGL +FADLTNEEYR+ YLGAK + + ++ +T+  +RY  K G    LP
Sbjct  85   EQNSVPGRTYKLGLTKFADLTNEEYRAMYLGAKMEKKEKL-RTERSQRYLHKAGNDDDLP  143

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
              +DWREKGAV EVKDQG CGSCWAFST+
Sbjct  144  SHVDWREKGAVTEVKDQGQCGSCWAFSTV  172



>gb|KHN30007.1| Cysteine proteinase RD21a [Glycine soja]
Length=366

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = +1

Query  166  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  345
            TD EVM +YE WLV+H K YNGL  EKDKRF++FKDNL +I E N+ ++  YKLGLN+FA
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLR-EKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNQFA  90

Query  346  DLTNEEYRSTYLGAKTDARRRIAKTKSD-RRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            D+TNEEYR  Y G K+DA+RR+ KTKS   RYA   G  LP  +DWR KGAVA +KDQGS
Sbjct  91   DMTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDQLPVHVDWRVKGAVAPIKDQGS  150

Query  523  CGSCWAFSTI  552
            CGSCWAFST+
Sbjct  151  CGSCWAFSTV  160



>gb|ACB87490.1| mucunain [Mucuna pruriens]
Length=422

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = +1

Query  181  MALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFADLTNE  360
            M+LYE WLV+HGK+YN LG EKDKRF+IFKDNLR+ID+ N+ ++R YKLGLNRFADLTNE
Sbjct  1    MSLYEQWLVKHGKAYNALG-EKDKRFDIFKDNLRFIDDHNA-DNRTYKLGLNRFADLTNE  58

Query  361  EYRSTYLGAKTDARRRIAKTKSD-RRYAPKVGGSLPDSIDWREKGAVAEVKDQGSCGSCW  537
            EYR+ YLG + D  RR  KTK+   RYAP+VG +LP+S+DWR + AV  VKDQG+CGSCW
Sbjct  59   EYRARYLGTRIDPNRRFVKTKTQSNRYAPRVGDNLPESVDWRNESAVLPVKDQGNCGSCW  118

Query  538  AFSTI  552
            AFSTI
Sbjct  119  AFSTI  123



>ref|XP_006393620.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
 gb|ESQ30906.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
Length=459

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 113/147 (77%), Gaps = 5/147 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE H      R+D EV  LYE+WLV+HGK  N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDESHHTVSGGRSDAEVKRLYETWLVKHGKVQNSLV-EKDRRFEIFKDNLRFID  81

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            + N++ + +Y+LGL +FADLTN+EYRS YLGAK    R   + ++  RY  +VG +LP+S
Sbjct  82   DHNAK-NLSYRLGLTKFADLTNDEYRSIYLGAKMQKNR---ERRASTRYEARVGDALPES  137

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAV EVKDQGSCGSCWAFSTI
Sbjct  138  VDWRKEGAVVEVKDQGSCGSCWAFSTI  164



>ref|XP_002283263.1| PREDICTED: cysteine proteinase COT44 [Vitis vinifera]
Length=374

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 107/131 (82%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R++EEVM +Y+ W+ +HGK+YNGLG EK+KRFEIFKDNL++IDE N+ ++R YK+GLNRF
Sbjct  37   RSEEEVMGMYQWWMAKHGKAYNGLG-EKEKRFEIFKDNLKFIDEHNA-QNRTYKVGLNRF  94

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSIDWREKGAVAEVKDQG  519
            ADLTNEEYR+ YLG ++D +RR AK K +  RYA   G  LP+S+DWRE GAV  VKDQ 
Sbjct  95   ADLTNEEYRAIYLGTRSDPKRRFAKLKNASPRYAVMPGEVLPESVDWRETGAVNPVKDQR  154

Query  520  SCGSCWAFSTI  552
            SCGSCWAFST+
Sbjct  155  SCGSCWAFSTV  165



>ref|XP_004234718.1| PREDICTED: cysteine proteinase COT44-like [Solanum lycopersicum]
Length=379

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +1

Query  166  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  345
            TDEEV  +YE WL EHGK YNGLG E+ KRFEIFKDNLR+I+E N+ +++ Y LGLNRFA
Sbjct  34   TDEEVKRIYEIWLAEHGKIYNGLG-EQGKRFEIFKDNLRFIEEHNNSKNQTYVLGLNRFA  92

Query  346  DLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            DLTNEEYR+ +LG K+DARRR+ ++K +   Y  +   S+P S+DWR+KGAVA +KDQG+
Sbjct  93   DLTNEEYRTIFLGTKSDARRRLVESKNASHHYDFRASDSVPKSVDWRKKGAVAPIKDQGT  152

Query  523  CGSCWAFSTI  552
            CGSCWAFST+
Sbjct  153  CGSCWAFSTV  162



>ref|XP_003547817.1| PREDICTED: cysteine proteinase RD21a [Glycine max]
Length=366

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = +1

Query  166  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  345
            TD EVM +YE WLV+H K YNGL  EKDKRF++FKDNL +I E N+ ++  YKLGLN+FA
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLR-EKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNQFA  90

Query  346  DLTNEEYRSTYLGAKTDARRRIAKTKSD-RRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            D+TNEEYR  Y G K+DA+RR+ KTKS   RYA   G  LP  +DWR KGAVA +KDQGS
Sbjct  91   DMTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDRLPVHVDWRVKGAVAPIKDQGS  150

Query  523  CGSCWAFSTI  552
            CGSCWAFST+
Sbjct  151  CGSCWAFSTV  160



>gb|KEH31479.1| papain family cysteine protease [Medicago truncatula]
Length=359

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 103/132 (78%), Gaps = 4/132 (3%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R++EEVM +YE WLV+H K YNGLG EKD+RFEIFKDNL +IDE N+ ++  YK+GLN+F
Sbjct  26   RSNEEVMTMYEEWLVKHHKVYNGLG-EKDQRFEIFKDNLGFIDEHNA-QNYTYKVGLNKF  83

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTK--SDRRYAPKVGGSLPDSIDWREKGAVAEVKDQ  516
            AD+TNEEYR+ YLG K DA+R + K K  +  RYA   G  LP  +DWR KGAVA +KDQ
Sbjct  84   ADMTNEEYRNMYLGTKNDAKRNVMKIKITTGHRYAFNSGDRLPVHVDWRSKGAVAHIKDQ  143

Query  517  GSCGSCWAFSTI  552
            GSCGSCWAFSTI
Sbjct  144  GSCGSCWAFSTI  155



>ref|XP_009390984.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 110/150 (73%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDEEH  KGL R+ EE+  +YE WL++HG++YN L GE ++RFEIFKDNLR+ID
Sbjct  23   DMSIISYDEEHGVKGLERSKEEMRRMYEGWLIKHGRTYNAL-GEMERRFEIFKDNLRFID  81

Query  292  EQNSREDRA---YKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
              N+  D     Y+LGLNRFADLTNEEYR+ ++G +     R  +  SD RY    G  L
Sbjct  82   AHNAEADAGLHRYRLGLNRFADLTNEEYRAGFIGTRPRGAARRNRVPSD-RYRLGDGEEL  140

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+S+DWR KGAVA VKDQG CGSCWAFST+
Sbjct  141  PESVDWRAKGAVAAVKDQGYCGSCWAFSTV  170



>ref|XP_006403303.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
 gb|ESQ44756.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
Length=457

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 117/149 (79%), Gaps = 8/149 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK-SYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YDE+H    ++ R++ EV  +YE W+ +HGK + NGL GE D RFEIFKDNLR+
Sbjct  22   DMSIISYDEKHHISAVNGRSEAEVAKIYEEWMAKHGKKTQNGLLGE-DHRFEIFKDNLRF  80

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE N++ + +YKLGL RFADLTN+EYRS YLGAK   ++ + KT    RY P+VG +LP
Sbjct  81   IDEHNTK-NLSYKLGLTRFADLTNDEYRSIYLGAK--PKKSVLKTSD--RYLPRVGDALP  135

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            DS+DWR++GAVA VKDQGSCGSCWAFSTI
Sbjct  136  DSVDWRKEGAVAAVKDQGSCGSCWAFSTI  164



>ref|XP_007205396.1| hypothetical protein PRUPE_ppa007467mg [Prunus persica]
 gb|EMJ06595.1| hypothetical protein PRUPE_ppa007467mg [Prunus persica]
Length=366

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 110/132 (83%), Gaps = 3/132 (2%)
 Frame = +1

Query  160  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  339
            SR++ EV  +Y+ WLV+H K+YNG+G E+D+RFEIFKDNLR+IDE NS +DR YK+GLN 
Sbjct  28   SRSEAEVKQIYQEWLVKHQKTYNGIG-EEDRRFEIFKDNLRFIDEHNS-QDRPYKVGLNA  85

Query  340  FADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSIDWREKGAVAEVKDQ  516
            FADLTN+EYR+ +LG ++D +RR+ K K S +RYA +VG +LP+S+DWR KGAV  +K+Q
Sbjct  86   FADLTNQEYRAKFLGTRSDPKRRVMKAKNSSQRYAFRVGEALPESVDWRVKGAVNPIKNQ  145

Query  517  GSCGSCWAFSTI  552
            G+CGSCWAFST+
Sbjct  146  GNCGSCWAFSTV  157



>gb|KHG18408.1| Cysteinease RD21a -like protein [Gossypium arboreum]
 gb|KHG29615.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=367

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 109/132 (83%), Gaps = 3/132 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R+D+EVM+LY++WL++HGK YNG+G E++ RF+IFKDNL++ID+ NS+ +  YKLGLN+F
Sbjct  30   RSDDEVMSLYQAWLIKHGKQYNGIG-EEENRFDIFKDNLKFIDQHNSK-NTTYKLGLNKF  87

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDWREKGAVAEVKDQG  519
            ADLTN+EYRS +LG K+D +RR+ K+K+  +RYA + G  LP+S DWR+ GAV  VKDQG
Sbjct  88   ADLTNQEYRSMFLGTKSDPKRRVMKSKNPSQRYASRAGDRLPESFDWRDHGAVTPVKDQG  147

Query  520  SCGSCWAFSTIV  555
             CGSCWAFSTI 
Sbjct  148  RCGSCWAFSTIA  159



>dbj|BAG16371.1| cysteine protease [Brassica oleracea var. italica]
Length=441

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 114/147 (78%), Gaps = 7/147 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H     SR+D EV  LYE WLV+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  17   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLT-EKDRRFEIFKDNLRFID  74

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N + + +Y+LGL +FADLTN+EYRS YLG+    R +   TKS  RY  +VG ++P+S
Sbjct  75   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLGS----RLKRKATKSSLRYEVRVGDAIPES  129

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAVAEVKDQGSCGSCWAFSTI
Sbjct  130  VDWRKEGAVAEVKDQGSCGSCWAFSTI  156



>ref|NP_001242660.1| uncharacterized protein LOC100807362 precursor [Glycine max]
 gb|ACU18666.1| unknown [Glycine max]
Length=367

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 111/147 (76%), Gaps = 4/147 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD  H  K   ++DEEVM++YE WLV+HGK YN +  EK+KRF+IFKDNL +I+
Sbjct  26   DMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHGKVYNAVE-EKEKRFQIFKDNLNFIE  84

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+  +R YK+GLNRF+DL+NEEYRS YLG K D  R +A+    RRY+P+V  +LP+S
Sbjct  85   EHNAV-NRTYKVGLNRFSDLSNEEYRSKYLGTKIDPSRMMARPS--RRYSPRVADNLPES  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAV  VK+Q  C  CWAFS I
Sbjct  142  VDWRKEGAVVRVKNQSECEGCWAFSAI  168



>emb|CDY17093.1| BnaC06g00260D [Brassica napus]
Length=457

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 114/147 (78%), Gaps = 7/147 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H     SR+D EV  LYE WLV+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N + + +Y+LGL +FADLTN+EYRS YLG+    R +   TKS  RY  +VG ++P+S
Sbjct  81   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLGS----RLKRKATKSSLRYEVRVGDAIPES  135

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAVAEVKDQGSCGSCWAFSTI
Sbjct  136  VDWRKEGAVAEVKDQGSCGSCWAFSTI  162



>ref|XP_009398671.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 110/151 (73%), Gaps = 4/151 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSI++Y+EEH  +GL R+++E+  +YE WL  HG++YN LG EK+ RFE+FKDNL ++D
Sbjct  26   DMSIVSYNEEHGVRGLERSEDEMRRIYEGWLARHGRAYNALG-EKEARFEVFKDNLHFVD  84

Query  292  EQNSREDRA---YKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
              N+  D     ++LGLNRFADLTNEE+R+ YLGAK     R ++  +DR      G  L
Sbjct  85   GHNAAADAGRQRFRLGLNRFADLTNEEFRALYLGAKGRGVARRSRVAADRYRYEGAGDVL  144

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            PDS+DWR KGAVA VK+QGSCGSCWAFST+ 
Sbjct  145  PDSVDWRAKGAVAAVKNQGSCGSCWAFSTVA  175



>ref|XP_006307278.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella]
 gb|EOA40176.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella]
Length=509

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 114/150 (76%), Gaps = 8/150 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  282
            DMSII+YDE H       R+D EV ++YE+WLVEHGK  + N L GEKD RFEIFKDNLR
Sbjct  70   DMSIISYDETHGVSSTGGRSDAEVRSIYEAWLVEHGKVENKNTLLGEKD-RFEIFKDNLR  128

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
            +ID+ N++ +  YKLGL RFADLTN+EYRS YLGAKT  +   ++ +S  RY   VG  L
Sbjct  129  FIDDHNAK-NLGYKLGLTRFADLTNDEYRSMYLGAKTHKK---SERRSSLRYKASVGDEL  184

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+SIDWR+KGAVAE+KDQGSCGSCWAFS I
Sbjct  185  PESIDWRKKGAVAEIKDQGSCGSCWAFSAI  214



>gb|AAL60580.1|AF454958_1 senescence-associated cysteine protease [Brassica oleracea]
Length=485

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 114/147 (78%), Gaps = 7/147 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H     SR+D EV  LYE WLV+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N + + +Y+LGL +FADLTN+EYRS YLG+    R +   TKS  RY  +VG ++P+S
Sbjct  81   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLGS----RLKRKATKSSLRYEVRVGDAIPES  135

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAVAEVKDQGSCGSCWAFSTI
Sbjct  136  VDWRKEGAVAEVKDQGSCGSCWAFSTI  162



>ref|XP_002298740.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
 gb|EEE83545.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
Length=479

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 110/147 (75%), Gaps = 2/147 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII Y+ +H  +   RT+ E   +YE WLV+HG++YN LG EK++RFEIFKDNL++ID
Sbjct  24   DMSIIDYNIKH-GQVPERTEAETRRIYEMWLVKHGRAYNALG-EKERRFEIFKDNLKFID  81

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS  + +YKLGLN+FADL+N+EYRS YLG + D + R+       RY  K G  LP++
Sbjct  82   EHNSVGNPSYKLGLNKFADLSNDEYRSVYLGTRMDGKGRLLGGPKSERYLFKEGDDLPET  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKGAVA VKDQG CGSCWAFST+
Sbjct  142  VDWREKGAVAPVKDQGQCGSCWAFSTV  168



>gb|ABQ10198.1| actinidin Act4b [Actinidia eriantha]
Length=379

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 111/148 (75%), Gaps = 9/148 (6%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            D SIITY +    K   RT++EVMA++ESWLVE+GKSYN LG EK++RFEIFKDNLR++D
Sbjct  26   DASIITYAK----KWEQRTNDEVMAMFESWLVEYGKSYNALG-EKERRFEIFKDNLRFVD  80

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N+  +R+YK+GLN+F+DLT EEY S YLG K D R     T    RY P+VG  LP+S
Sbjct  81   EHNADVNRSYKVGLNQFSDLTLEEYSSIYLGTKFDMRM----TNVSDRYEPRVGDQLPNS  136

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            IDWR+KGAV  VK+QG+CGSCW F+ I 
Sbjct  137  IDWRKKGAVLGVKNQGNCGSCWTFAPIA  164



>gb|AFK47737.1| unknown [Medicago truncatula]
Length=359

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 102/132 (77%), Gaps = 4/132 (3%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R++EEVM +YE WLV+H K YNGLG EKD+RFEIFKDNL +IDE N+ ++  YK+GLN+F
Sbjct  26   RSNEEVMTMYEEWLVKHHKVYNGLG-EKDQRFEIFKDNLGFIDEHNA-QNYTYKVGLNKF  83

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTK--SDRRYAPKVGGSLPDSIDWREKGAVAEVKDQ  516
            AD TNEEYR+ YLG K DA+R + K K  +  RYA   G  LP  +DWR KGAVA +KDQ
Sbjct  84   ADTTNEEYRNMYLGTKNDAKRNVMKIKITTGHRYAFNSGDRLPVHVDWRSKGAVAHIKDQ  143

Query  517  GSCGSCWAFSTI  552
            GSCGSCWAFSTI
Sbjct  144  GSCGSCWAFSTI  155



>dbj|BAD95392.1| cysteine proteinase RD21A [Arabidopsis thaliana]
Length=433

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 8/150 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  282
            DMSII+YDE+H       R++ EVM++YE+WLV+HGK  S N L  EKD+RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLV-EKDRRFEIFKDNLR  81

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
            ++DE N + + +Y+LGL RFADLTN+EYRS YLGAK + +    + ++  RY  +VG  L
Sbjct  82   FVDEHNEK-NLSYRLGLTRFADLTNDEYRSKYLGAKMEKK---GERRTSLRYEARVGDEL  137

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+SIDWR+KGAVAEVKDQG CGSCWAFSTI
Sbjct  138  PESIDWRKKGAVAEVKDQGGCGSCWAFSTI  167



>ref|XP_004231872.1| PREDICTED: zingipain-2-like [Solanum lycopersicum]
Length=363

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +1

Query  187  LYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFADLTNEEY  366
            LYE WL EHGK YN LG EK+KRFEIFKDNLR+I+E N+ E+R +K+GLN+FADLTN+EY
Sbjct  35   LYEKWLAEHGKIYNALG-EKEKRFEIFKDNLRFIEEYNASENRTFKVGLNQFADLTNDEY  93

Query  367  RSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGSCGSCWAF  543
            R+ YLG K+DARRR+ K+K + +RYA      LP S+DWR+KGAVA +K+QGSCGSCWAF
Sbjct  94   RAVYLGTKSDARRRLVKSKNTSQRYASPPNELLPHSVDWRKKGAVAPIKNQGSCGSCWAF  153

Query  544  STI  552
            ST+
Sbjct  154  STV  156



>ref|XP_011000142.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=479

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 109/147 (74%), Gaps = 2/147 (1%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII Y+ +H  +   RT+ E   +YE WLV+HG++YN LG EK++RFEIFKDNL++ID
Sbjct  24   DMSIIDYNIKH-GQIPERTEAETRRIYEMWLVKHGRAYNALG-EKERRFEIFKDNLKFID  81

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E NS  + +YKLGLN FADL+N+EYRS YLG + D +RR+       RY  K G  LP++
Sbjct  82   EHNSVGNPSYKLGLNMFADLSNDEYRSVYLGTRMDRKRRLLSGPKSERYLFKEGDDLPET  141

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKGAV  VKDQG CGSCWAFST+
Sbjct  142  VDWREKGAVTPVKDQGQCGSCWAFSTV  168



>ref|NP_564497.1| cysteine proteinase RD21a [Arabidopsis thaliana]
 sp|P43297.1|RD21A_ARATH RecName: Full=Cysteine proteinase RD21a; Short=RD21; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50628.1|AC083835_13 cysteine protease, putative [Arabidopsis thaliana]
 dbj|BAA02374.1| thiol protease [Arabidopsis thaliana]
 gb|AAL59952.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AAM91715.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AEE32135.1| cysteine proteinase RD21a [Arabidopsis thaliana]
Length=462

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 8/150 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  282
            DMSII+YDE+H       R++ EVM++YE+WLV+HGK  S N L  EKD+RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLV-EKDRRFEIFKDNLR  81

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
            ++DE N + + +Y+LGL RFADLTN+EYRS YLGAK + +    + ++  RY  +VG  L
Sbjct  82   FVDEHNEK-NLSYRLGLTRFADLTNDEYRSKYLGAKMEKK---GERRTSLRYEARVGDEL  137

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+SIDWR+KGAVAEVKDQG CGSCWAFSTI
Sbjct  138  PESIDWRKKGAVAEVKDQGGCGSCWAFSTI  167



>gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
 gb|AAL87383.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
Length=462

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 8/150 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  282
            DMSII+YDE+H       R++ EVM++YE+WLV+HGK  S N L  EKD+RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLV-EKDRRFEIFKDNLR  81

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
            ++DE N + + +Y+LGL RFADLTN+EYRS YLGAK + +    + ++  RY  +VG  L
Sbjct  82   FVDEHNEK-NLSYRLGLTRFADLTNDEYRSKYLGAKMEKK---GERRTSLRYEARVGDEL  137

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+SIDWR+KGAVAEVKDQG CGSCWAFSTI
Sbjct  138  PESIDWRKKGAVAEVKDQGGCGSCWAFSTI  167



>ref|XP_011008779.1| PREDICTED: cysteine proteinase COT44 [Populus euphratica]
Length=368

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 117/151 (77%), Gaps = 5/151 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSI+T ++       S  R+D+EVM++Y+ WL +HGK++N LG E+ +RFEIFK+NLR+
Sbjct  20   DMSILTSNDNQLNHDRSSWRSDDEVMSMYKWWLAKHGKTHNRLG-EEAERFEIFKNNLRF  78

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  462
            IDE NS ++  YK+GL +FADLTNEEYR+ +LG ++DA+RR+ K+KS   RYA K G  L
Sbjct  79   IDEHNS-QNHTYKVGLTKFADLTNEEYRAMFLGTRSDAKRRLMKSKSPSERYAFKPGDKL  137

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            P+S+DWR KGAV  +KDQGSCGSCWAFST+ 
Sbjct  138  PESVDWRAKGAVNPIKDQGSCGSCWAFSTVA  168



>dbj|BAG16377.1| cysteine protease [Brassica rapa var. perviridis]
Length=431

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 114/147 (78%), Gaps = 7/147 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H     SR+D EV  LYE W+V+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  17   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLT-EKDRRFEIFKDNLRFID  74

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N + + +Y+LGL +FADLTN+EYRS YLG+    R +   TK+  RY  +VG ++P+S
Sbjct  75   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLGS----RLKRKATKTSLRYEARVGDAIPES  129

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAVAEVKDQGSCGSCWAFSTI
Sbjct  130  VDWRKEGAVAEVKDQGSCGSCWAFSTI  156



>gb|KHN12823.1| Cysteine proteinase RD21a [Glycine soja]
Length=366

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = +1

Query  157  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLN  336
            ++ TD EVMA+YE WLV+H K YN LG +KDKRF++FKDNL +I E N+  +  YKLGLN
Sbjct  27   INYTDNEVMAMYEEWLVKHQKVYNELG-KKDKRFQVFKDNLGFIQEHNNNLNNTYKLGLN  85

Query  337  RFADLTNEEYRSTYLGAKTDARRRIAKTKSD-RRYAPKVGGSLPDSIDWREKGAVAEVKD  513
            +FAD+TNEEYR+ YLG K++A+RR+ KTKS   RYA      LP  +DWR KGAVA +KD
Sbjct  86   KFADMTNEEYRAMYLGTKSNAKRRLMKTKSTGHRYAFSARDRLPVHVDWRMKGAVAPIKD  145

Query  514  QGSCGSCWAFSTI  552
            QGSCGSCWAFST+
Sbjct  146  QGSCGSCWAFSTV  158



>ref|XP_009123448.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Brassica rapa]
Length=461

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 114/147 (78%), Gaps = 7/147 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H     SR+D EV  LYE W+V+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N + + +Y+LGL +FADLTN+EYRS YLG+    R +   TK+  RY  +VG ++P+S
Sbjct  81   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLGS----RLKRKATKTSLRYEARVGDAIPES  135

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAVAEVKDQGSCGSCWAFSTI
Sbjct  136  VDWRKEGAVAEVKDQGSCGSCWAFSTI  162



>ref|NP_001242584.1| uncharacterized protein LOC100804015 precursor [Glycine max]
 gb|ACU20623.1| unknown [Glycine max]
Length=366

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 102/133 (77%), Gaps = 2/133 (2%)
 Frame = +1

Query  157  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLN  336
            ++ TD EVMA+YE WLV H K YN LG +KDKRF++FKDNL +I E N+  +  YKLGLN
Sbjct  27   INYTDNEVMAMYEEWLVRHQKGYNELG-KKDKRFQVFKDNLGFIQEHNNNLNNTYKLGLN  85

Query  337  RFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDWREKGAVAEVKD  513
            +FAD+TNEEYR+ YLG K++A+RR+ KTKS   RYA      LP  +DWR KGAVA +KD
Sbjct  86   KFADMTNEEYRAMYLGTKSNAKRRLMKTKSTGHRYAFSARDRLPVHVDWRMKGAVAPIKD  145

Query  514  QGSCGSCWAFSTI  552
            QGSCGSCWAFST+
Sbjct  146  QGSCGSCWAFSTV  158



>ref|XP_004136967.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
 gb|KGN43904.1| Cysteine protease [Cucumis sativus]
Length=479

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R DEEV ALYESWLV HGK+YN +G EK++RFEIFKDNLR+IDE N RE R YK+GL RF
Sbjct  53   RPDEEVAALYESWLVHHGKAYNAIG-EKERRFEIFKDNLRFIDEHN-RESRTYKVGLTRF  110

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADLTNEEYR+ +LG +   + R++  KS R YA  +G  LPD +DWR+KGAVA VKDQG 
Sbjct  111  ADLTNEEYRARFLGGRFSRKPRLSAAKSGR-YAAALGDDLPDDVDWRKKGAVATVKDQGQ  169

Query  523  CGSCWAFSTIV  555
            CGSCWAFS++ 
Sbjct  170  CGSCWAFSSVA  180



>emb|CDY06760.1| BnaA10g05390D [Brassica napus]
Length=457

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 114/147 (78%), Gaps = 7/147 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YD+ H     SR+D EV  LYE W+V+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E N + + +Y+LGL +FADLTN+EYRS YLG+    R +   TK+  RY  +VG ++P+S
Sbjct  81   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLGS----RLKRKATKTSLRYEARVGDAIPES  135

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWR++GAVAEVKDQGSCGSCWAFSTI
Sbjct  136  VDWRKEGAVAEVKDQGSCGSCWAFSTI  162



>ref|XP_008454976.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cucumis 
melo]
Length=480

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            RTDEEV ALYESWLV HGK+YN LG EK++RFEIFKDNL +IDE N RE R YK+GL RF
Sbjct  54   RTDEEVAALYESWLVHHGKAYNALG-EKERRFEIFKDNLMFIDEHN-RESRTYKVGLTRF  111

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADLTNEEYR+ +LG +   +  ++  KS R YA  +G  LPD +DWR+KGAVA VKDQG 
Sbjct  112  ADLTNEEYRARFLGGRFSRKPSLSAAKSGR-YAAALGDDLPDDVDWRKKGAVANVKDQGQ  170

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  171  CGSCWAFSTVA  181



>ref|XP_006339859.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=361

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 111/148 (75%), Gaps = 14/148 (9%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII Y  +   +G+         +YE WL EHGK YN LG E +KRFEIFKDNLR+I+
Sbjct  22   DMSIIDYKNK---EGI---------IYEKWLAEHGKVYNALG-ENEKRFEIFKDNLRFIE  68

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  468
            E N+ E+R YK+GLN+FADLTN EYR+ YLG ++DARRR+ K+K + +RYA +    LP 
Sbjct  69   EYNNSENRTYKVGLNQFADLTNVEYRAMYLGTRSDARRRLVKSKNTSQRYASRPNELLPQ  128

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR++GAVA +K+QGSCGSCWAFST+
Sbjct  129  SVDWRKRGAVAPIKNQGSCGSCWAFSTV  156



>ref|XP_010500237.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=462

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 114/150 (76%), Gaps = 8/150 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  282
            DMSII+YDE+H     S R+D EV ++YE WLV+HGK  + N L GEKD RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSSSSGRSDAEVRSMYEEWLVKHGKVQNQNSLLGEKD-RFEIFKDNLR  81

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
            +ID+ N + + +Y+LGL RFADLTN+EYRS YLGAKT  +    + ++  RY  +VG  L
Sbjct  82   FIDDHNEK-NLSYRLGLTRFADLTNDEYRSMYLGAKTHKK---GERRTSHRYKARVGDEL  137

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+ +DWR+KGAVAEVKDQGSCGSCWAFS I
Sbjct  138  PELVDWRKKGAVAEVKDQGSCGSCWAFSAI  167



>ref|NP_001150196.1| cysteine protease 1 precursor [Zea mays]
 gb|ACF84983.1| unknown [Zea mays]
 gb|ACF86484.1| unknown [Zea mays]
 gb|ACG38208.1| cysteine protease 1 precursor [Zea mays]
 gb|AFW59827.1| cysteine protease 1 [Zea mays]
Length=470

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 109/150 (73%), Gaps = 5/150 (3%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLG---GEKDKRFEIFKDNLRY  285
            MSIITY+EEH A+GL RT+ EV A+Y+ WL EHG++YN LG   GE+D+RF +F DNLR+
Sbjct  32   MSIITYNEEHGARGLERTEPEVRAMYDLWLAEHGRAYNALGEGEGERDRRFLVFWDNLRF  91

Query  286  IDEQNSRED-RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
            +D  N R   R ++LG+N+FADLTN+E+R+ YLGA   A RR A      R+       L
Sbjct  92   VDAHNERAGARGFRLGMNQFADLTNDEFRAAYLGAMVPAARRGAVVGERYRH-DGAAEEL  150

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+S+DWREKGAVA VK+QG CGSCWAFS +
Sbjct  151  PESVDWREKGAVAPVKNQGQCGSCWAFSAV  180



>ref|XP_010461511.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=462

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 114/152 (75%), Gaps = 12/152 (8%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  282
            DMSII+YDE+H     S R+D EV ++YE WLV+HGK  + N L GEKD RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSSSSGRSDAEVRSMYEEWLVKHGKVQNQNSLLGEKD-RFEIFKDNLR  81

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR--RRIAKTKSDRRYAPKVGG  456
            +ID+ N + +  Y+LGL RFADLTN+EYRS YLGAKT  +  RRI+      RY  +VG 
Sbjct  82   FIDDHNEK-NLGYRLGLTRFADLTNDEYRSMYLGAKTHKKGERRIS-----HRYKARVGD  135

Query  457  SLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             LP+ +DWR+KGAVAEVKDQGSCGSCWAFS I
Sbjct  136  ELPELVDWRKKGAVAEVKDQGSCGSCWAFSAI  167



>ref|XP_009396268.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 112/151 (74%), Gaps = 6/151 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+YDE+H  +GL R+DEEV  +Y++W+  HG++YN LG E+++RFE+FKDNLR++D
Sbjct  26   DMSIISYDEKHGVRGLERSDEEVRRMYDAWMAAHGRAYNALG-ERERRFEVFKDNLRFVD  84

Query  292  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTD-ARRRIAKTKSDRRYAPKVGGS  459
              N+      R ++LGLNRFADLTNEEYR+ YLG + + A  R  +  SDR Y       
Sbjct  85   AHNAAAGAGVRGFRLGLNRFADLTNEEYRAVYLGTRANRATARRVRVASDR-YRYNASEE  143

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            L + +DWRE+GAVA VKDQGSCGSCWAFSTI
Sbjct  144  LSEFVDWREQGAVAAVKDQGSCGSCWAFSTI  174



>dbj|BAD16614.1| cysteine proteinase [Dianthus caryophyllus]
Length=459

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 116/149 (78%), Gaps = 12/149 (8%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            D+SII        +  +R D+E+ +LYE+WLV+HGK+YNGLG EK  RF IFKDNLR++D
Sbjct  24   DLSIID-------RAFNRPDDEIASLYETWLVKHGKNYNGLG-EKQLRFNIFKDNLRFVD  75

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAK--TDARRRIAKTKSDRRYAPKVGGSLP  465
            E+NS E+ ++KLGLNRFADLTNEEYRS YLG +  + A  R  ++KSDR YA + G +LP
Sbjct  76   ERNS-ENLSFKLGLNRFADLTNEEYRSVYLGTRPRSVAVARSGRSKSDR-YAFRAGDTLP  133

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +S+DWR+KGAVA +KDQGSCGSCWAFS I
Sbjct  134  ESVDWRKKGAVAGIKDQGSCGSCWAFSAI  162



>ref|XP_008238897.1| PREDICTED: cysteine proteinase COT44 [Prunus mume]
Length=366

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 109/132 (83%), Gaps = 3/132 (2%)
 Frame = +1

Query  160  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  339
            SR++ EV  +Y+ WLV+H K+YNG+G E+D+RFEIFKDNLR+IDE N+ +DR YK+GLN 
Sbjct  28   SRSEAEVKQIYQEWLVKHQKTYNGIG-EEDRRFEIFKDNLRFIDEHNA-QDRPYKVGLNA  85

Query  340  FADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDWREKGAVAEVKDQ  516
            FADLTN+EYR+ +LG ++D +RR+ K K+  +RYA + G +LP+S+DWR KGAV  +K+Q
Sbjct  86   FADLTNQEYRAKFLGTRSDPKRRLMKAKNPSQRYAFRAGEALPESVDWRVKGAVNPIKNQ  145

Query  517  GSCGSCWAFSTI  552
            G+CGSCWAFST+
Sbjct  146  GNCGSCWAFSTV  157



>gb|AAL14614.1|AF417109_1 cysteine proteinase precursor [Vasconcellea cundinamarcensis]
Length=179

 Score =   169 bits (427),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSI++YD++H  K   RTD+EVMA+YE+WLV+HGK YN L GEK+KRF+IFKDNLR+ID
Sbjct  51   DMSIVSYDQKHADKSSWRTDDEVMAMYEAWLVKHGKVYNAL-GEKEKRFDIFKDNLRFID  109

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPD  468
            E NS ++  Y+LGLNRFADLTNEEYRSTYLG K  A R   K      RYAP+ G +LPD
Sbjct  110  EHNS-QNLTYRLGLNRFADLTNEEYRSTYLGVKPGATRAARKVSGKSHRYAPRDGDALPD  168

Query  469  SIDWREKGAV  498
            S DWR KGAV
Sbjct  169  SFDWRTKGAV  178



>gb|ABQ10191.1| actinidin Act1c [Actinidia eriantha]
Length=368

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 102/130 (78%), Gaps = 5/130 (4%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            RT++EV A+YESWL++HGKSYN LG E+++RFEIFK+ LR+IDE N+   R+YK+GLN+F
Sbjct  29   RTNDEVKAMYESWLIKHGKSYNSLG-ERERRFEIFKETLRFIDEHNADTSRSYKVGLNQF  87

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADLTNEE+RSTYLG      R   KTK   RY P+VG  LPD +DWR +GAV ++K+QG 
Sbjct  88   ADLTNEEFRSTYLGFT----RGSNKTKVSNRYEPRVGQVLPDYVDWRSEGAVVDIKNQGQ  143

Query  523  CGSCWAFSTI  552
            CGSCWAFS I
Sbjct  144  CGSCWAFSAI  153



>ref|NP_001150266.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG38442.1| cysteine protease 1 precursor [Zea mays]
Length=462

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  294
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN LG E+D+RF +F DNLR++D 
Sbjct  24   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNALG-ERDRRFRVFWDNLRFVDA  82

Query  295  QNSRE-DRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
             N R  +  ++LG+N+FADLTN+E+R+ YLGA+  A RR      +R         LP+S
Sbjct  83   HNERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPAARRRGTAVGERYRHGGGAEELPES  142

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKGAVA VK+QG CGSCWAFS +
Sbjct  143  VDWREKGAVAPVKNQGQCGSCWAFSAV  169



>gb|ACR34204.1| unknown [Zea mays]
Length=465

 Score =   176 bits (445),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  294
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN LG E+D+RF +F DNLR++D 
Sbjct  27   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNALG-ERDRRFRVFWDNLRFVDA  85

Query  295  QNSRE-DRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
             N R  +  ++LG+N+FADLTN+E+R+ YLGA+  A RR      +R         LP+S
Sbjct  86   HNERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPASRRRGTAVGERYRHGGGAEELPES  145

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKGAVA VK+QG CGSCWAFS +
Sbjct  146  VDWREKGAVAPVKNQGQCGSCWAFSAV  172



>ref|XP_008668054.1| PREDICTED: cysteine protease 1 isoform X1 [Zea mays]
Length=457

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  294
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN LG E+D+RF +F DNLR++D 
Sbjct  27   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNALG-ERDRRFRVFWDNLRFVDA  85

Query  295  QNSRE-DRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
             N R  +  ++LG+N+FADLTN+E+R+ YLGA+  A RR      +R         LP+S
Sbjct  86   HNERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPASRRRGTAVGERYRHGGGAEELPES  145

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKGAVA VK+QG CGSCWAFS +
Sbjct  146  VDWREKGAVAPVKNQGQCGSCWAFSAV  172



>ref|XP_010688590.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Beta 
vulgaris subsp. vulgaris]
Length=463

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  160  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  339
            SRTD EVMALYESWL++HGK+YN LG EK++R E+FKDNL +ID+ NS +++ +KLGLN+
Sbjct  38   SRTDAEVMALYESWLMKHGKNYNALG-EKERRLEVFKDNLWFIDQHNSDQNQTFKLGLNQ  96

Query  340  FADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQG  519
            FADLTNEE+RS Y+G +   R R        RY  K G SLP SIDWREKGAV  VKDQG
Sbjct  97   FADLTNEEFRSKYVGTRRRDRNRRLARSKSDRYGFKEGDSLPPSIDWREKGAVVPVKDQG  156

Query  520  SCGSCWAFSTIV  555
            SCGSCWAFSTI 
Sbjct  157  SCGSCWAFSTIA  168



>ref|XP_008452589.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cucumis 
melo]
Length=495

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 99/130 (76%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            RTDEEVMALY+ W   HGK +N LG E + RF IFKDNL+YIDE N+ ++  Y+LGLN F
Sbjct  68   RTDEEVMALYDQWRANHGKLHNNLGAEPENRFHIFKDNLKYIDEINA-QNLPYRLGLNVF  126

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADLTNEEYRS YLG +  A  R  + ++  RY P++G  LPDSIDWR KGAVA VKDQGS
Sbjct  127  ADLTNEEYRSRYLGGRFAAGSR--RNRTSNRYLPRLGDELPDSIDWRAKGAVAPVKDQGS  184

Query  523  CGSCWAFSTI  552
            CGSCWAFST+
Sbjct  185  CGSCWAFSTV  194



>ref|XP_010028191.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW54882.1| hypothetical protein EUGRSUZ_I00844 [Eucalyptus grandis]
Length=370

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 106/134 (79%), Gaps = 5/134 (4%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            RTDEEVM +YE WL +HGK+YNGLG E+++RFEIF+DNLR++DE  +  +R+Y LG+NRF
Sbjct  29   RTDEEVMGMYELWLAKHGKAYNGLG-ERERRFEIFRDNLRFVDEHTAL-NRSYALGMNRF  86

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYA--PKVGGSLPDSIDWREKGAVAEVKD  513
            ADLTNEEYR+ YLG ++D  RR+AK + +  RYA  P     LP ++DWR KGAV +VKD
Sbjct  87   ADLTNEEYRAIYLGTRSDPMRRVAKARRASDRYASRPCDDSMLPAAVDWRTKGAVNKVKD  146

Query  514  QGSCGSCWAFSTIV  555
            QG+CGSCWAFSTI 
Sbjct  147  QGACGSCWAFSTIA  160



>dbj|BAH20463.1| cysteine protease [Spinacia oleracea]
Length=473

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 114/157 (73%), Gaps = 13/157 (8%)
 Frame = +1

Query  112  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  282
            DMSII+YD  H   P+   SR+D+EVM +YESWLV+H K+YN LG EK+KRF IFKDNL 
Sbjct  26   DMSIISYDHNHNLLPSS--SRSDDEVMRIYESWLVQHRKNYNALG-EKEKRFAIFKDNLE  82

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLG------AKTDARRRIAKTKSDRRYAP  444
            +ID+ NS + + +K+GLN+FADLTNEE+RS YLG      +        +K KSD RY  
Sbjct  83   FIDQHNSDDSQTFKVGLNKFADLTNEEFRSVYLGRKKSSSSSPLLSSAKSKVKSD-RYLF  141

Query  445  KVGGSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            K G  LP+++DWR+ GAVA+VKDQG CGSCWAFSTI 
Sbjct  142  KEGDELPEAVDWRKNGAVAKVKDQGQCGSCWAFSTIA  178



>ref|XP_006595983.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=250

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII++D  H  +   RTD+EVM+++E WLV+H K YN LG EK+KRF+IFK+NLR+ID
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNALG-EKEKRFQIFKNNLRFID  77

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E+NS  +R YKLGLN FADLTN EYR+ YL    D  R    T     Y P+VG ++P S
Sbjct  78   ERNSL-NRTYKLGLNVFADLTNAEYRAMYLRTWDDGPRLDLDTPPRNHYVPRVGDTIPKS  136

Query  472  IDWREKGAVAEVKDQG-SCGSCWAFSTI  552
            +DWR++GAV  VK+QG +C SCWAF+ +
Sbjct  137  VDWRKEGAVTPVKNQGATCNSCWAFTAV  164



>emb|CDY17044.1| BnaA08g04080D [Brassica napus]
Length=459

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 112/148 (76%), Gaps = 7/148 (5%)
 Frame = +1

Query  112  DMSIITYDEEH-PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII+YD+ H      SR+D EV  LYE WLV+HGK  N L  EKD+RFEIFKDNLR+I
Sbjct  23   DMSIISYDKNHRTVSAGSRSDAEVSKLYEEWLVKHGKVQNSLT-EKDRRFEIFKDNLRFI  81

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            D+ N + + +Y+LGL +FADLTN+EYRS Y+G+    R +   T++  RY  +VG +LP+
Sbjct  82   DDHNGK-NLSYRLGLTKFADLTNDEYRSMYVGS----RLKRKSTRTSLRYESRVGDALPE  136

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR++GAVAEVKDQGSCGSCWAFS I
Sbjct  137  SVDWRKEGAVAEVKDQGSCGSCWAFSAI  164



>tpg|DAA35450.1| TPA: cysteine protease 1 [Zea mays]
Length=522

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  294
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN LG E+D+RF +F DNLR++D 
Sbjct  84   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNALG-ERDRRFRVFWDNLRFVDA  142

Query  295  QNSRE-DRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
             N R  +  ++LG+N+FADLTN+E+R+ YLGA+  A RR      +R         LP+S
Sbjct  143  HNERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPASRRRGTAVGERYRHGGGAEELPES  202

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DWREKGAVA VK+QG CGSCWAFS +
Sbjct  203  VDWREKGAVAPVKNQGQCGSCWAFSAV  229



>ref|XP_009367558.1| PREDICTED: cysteine proteinase COT44-like [Pyrus x bretschneideri]
Length=366

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 112/144 (78%), Gaps = 4/144 (3%)
 Frame = +1

Query  124  ITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  303
             T  +  P  G SR++ +V A+Y+ WLV+H K+YNG+G E+++RFEIFKDNL++IDE N+
Sbjct  17   FTLSQASPIVG-SRSEADVRAIYQEWLVKHQKTYNGIG-EEERRFEIFKDNLKFIDEHNA  74

Query  304  REDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  480
              DR YK+GLN FADLTN+EYR+ +LG ++D +RR+ K K+   RYA + G +LP+S+DW
Sbjct  75   L-DRPYKVGLNAFADLTNQEYRAKFLGTRSDPKRRVMKAKNPSLRYAFRAGETLPESVDW  133

Query  481  REKGAVAEVKDQGSCGSCWAFSTI  552
            R KGAV  +K+QGSCGSCWAFST+
Sbjct  134  RVKGAVNPIKNQGSCGSCWAFSTV  157



>emb|CDY63586.1| BnaCnng42340D [Brassica napus]
Length=459

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 112/148 (76%), Gaps = 7/148 (5%)
 Frame = +1

Query  112  DMSIITYDE-EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII+YD+  H     SR+D EV  LYE WLV+HGK  N L  EKD+RFEIFKDNLR+I
Sbjct  23   DMSIISYDKNHHTISAGSRSDAEVYKLYEEWLVKHGKVQNSLT-EKDRRFEIFKDNLRFI  81

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            D+ N + + +Y+LGL +FADLTN+EYRS Y+G+    R +   T++  RY  +VG +LP+
Sbjct  82   DDHNGK-NLSYRLGLTKFADLTNDEYRSMYVGS----RLKRKSTRTSLRYEARVGDALPE  136

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR++GAVAEVKDQGSCGSCWAFS I
Sbjct  137  SVDWRKEGAVAEVKDQGSCGSCWAFSAI  164



>ref|XP_004304028.1| PREDICTED: cysteine proteinase RD21a-like [Fragaria vesca subsp. 
vesca]
Length=476

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 111/148 (75%), Gaps = 4/148 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII YD +H    +  RT+ EV A+YESWLV+H K+YN LG E ++RFEIF DNLR++
Sbjct  32   DMSIIDYDNKHHMGVVPERTEAEVKAMYESWLVKHRKAYNALG-EMERRFEIFMDNLRFV  90

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            DE N + +R+YK+GLNRFAD+TN EYRS +LG K D   R+   +S R Y  +VG  LP 
Sbjct  91   DEHN-KVNRSYKVGLNRFADMTNLEYRSKFLGMKKDRSARLLGGESGR-YMYQVGDKLPA  148

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWR +GAVAEVKDQG CGSCWAFST+
Sbjct  149  SVDWRAEGAVAEVKDQGQCGSCWAFSTV  176



>gb|ABQ10192.1| actinidin Act2a [Actinidia deliciosa]
Length=378

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 100/132 (76%), Gaps = 6/132 (5%)
 Frame = +1

Query  157  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLN  336
            + RT+++VMA+YESWLVEHGKSYN L  EK+ RFEIFK+NLR ID+ N+  +R+Y LGLN
Sbjct  31   VQRTNDQVMAMYESWLVEHGKSYNSLD-EKEMRFEIFKENLRIIDDHNADANRSYSLGLN  89

Query  337  RFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQ  516
            RFADLT+EEYRSTYLG K     R  KT    +Y PKVG +LPD +DWR  GAV  VK+Q
Sbjct  90   RFADLTDEEYRSTYLGLK-----RGPKTDVSNQYMPKVGDALPDYVDWRTVGAVVGVKNQ  144

Query  517  GSCGSCWAFSTI  552
            G C SCWAFS +
Sbjct  145  GLCSSCWAFSAV  156



>ref|XP_008338342.1| PREDICTED: cysteine proteinase COT44-like [Malus domestica]
Length=366

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 108/132 (82%), Gaps = 3/132 (2%)
 Frame = +1

Query  160  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  339
            SR++ +V A+Y+ WLV+H K+YNG+G E+++RFEIFKDN+++IDE N+ +DR YK+GLN 
Sbjct  28   SRSEADVKAIYQEWLVKHQKTYNGIG-EEERRFEIFKDNMKFIDEHNA-QDRPYKVGLNA  85

Query  340  FADLTNEEYRSTYLGAKTDARRRIAKTKSDR-RYAPKVGGSLPDSIDWREKGAVAEVKDQ  516
            FADLTN+EYR+ +LG ++D +RR+ K K    RYA + G +LP+S+DWR KGAV  +K+Q
Sbjct  86   FADLTNQEYRAKFLGTRSDPKRRVMKAKKPSLRYAFRAGETLPESVDWRVKGAVNPIKNQ  145

Query  517  GSCGSCWAFSTI  552
            GSCGSCWAFST+
Sbjct  146  GSCGSCWAFSTV  157



>ref|XP_010093524.1| Germination-specific cysteine protease 1 [Morus notabilis]
 gb|EXB54190.1| Germination-specific cysteine protease 1 [Morus notabilis]
Length=361

 Score =   171 bits (432),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 105/147 (71%), Gaps = 2/147 (1%)
 Frame = +1

Query  115  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  294
            M I+ +    P     R+D EV  +Y  W+  HG+++NGLG E++ RFEIFKDNLR++DE
Sbjct  7    MIILCFALSLPPLTSGRSDAEVREMYVKWMATHGRAHNGLG-EEETRFEIFKDNLRFVDE  65

Query  295  QNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDS  471
             N+ + R YK+G+NRFAD+TNEEYR   LG ++DA+R + K KS  RRYA +    LP++
Sbjct  66   HNAVQKRTYKVGMNRFADMTNEEYRREMLGTRSDAKRIVMKAKSPSRRYASRAADQLPET  125

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +DW+  GAV  VKDQGSCGSCWAFSTI
Sbjct  126  VDWKLNGAVNPVKDQGSCGSCWAFSTI  152



>gb|ACU18172.1| unknown [Glycine max]
Length=355

 Score =   170 bits (431),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 108/148 (73%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII++D  H  +   RTD+EVM+++E WLV+H K YN LG EK+KRF+IFK+NLR+ID
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNALG-EKEKRFQIFKNNLRFID  77

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E+NS  +R YKLGLN FADLTN EYR+ YL    D  R    T    RY P+VG ++P S
Sbjct  78   ERNSL-NRTYKLGLNVFADLTNAEYRAMYLRTWDDGPRLDLDTPPRNRYVPRVGDTIPKS  136

Query  472  IDWREKGAVAEVKDQG-SCGSCWAFSTI  552
            +DWR++GAV  VK+QG +C SCWAF+ +
Sbjct  137  VDWRKEGAVTPVKNQGATCNSCWAFTAV  164



>ref|XP_010107858.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXC17258.1| Cysteine proteinase RD21a [Morus notabilis]
Length=476

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 109/148 (74%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHP-AKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            DMSII YD +H       R++ E+ A+YESWLV H K+YN L  EK++RFEIFKDNLR++
Sbjct  30   DMSIIDYDAKHGIVVPTERSETEMRAMYESWLVIHAKAYNALR-EKERRFEIFKDNLRFV  88

Query  289  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
            D  N+  +R +KLGLNRFADLTN+EYR+ +LG K D    +  ++   RYA + G  LP+
Sbjct  89   DAHNA-ANRTFKLGLNRFADLTNDEYRAGFLGVKIDRIGTLFGSRKSDRYAFRAGDELPE  147

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            SIDWR+KGAVA VKDQG CGSCWAFSTI
Sbjct  148  SIDWRDKGAVAPVKDQGQCGSCWAFSTI  175



>gb|AHY28813.1| cysteine protease, partial [Pinus elliottii]
Length=182

 Score =   165 bits (418),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R D+ +M LYE WL EH K+YNGL  EK KRF +FKDN  YI E N + +R+YKLGLN+F
Sbjct  33   REDDAIMELYELWLAEHKKAYNGLD-EKQKRFTVFKDNFLYIHEHN-QGNRSYKLGLNQF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADL++EE+++TYLGAK D ++R+ ++ S R Y    G  LP SIDWREKGAVA VKDQG+
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPR-YQYSDGEDLPKSIDWREKGAVAPVKDQGA  149

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  150  CGSCWAFSTVA  160



>gb|KJB58558.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=452

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 106/138 (77%), Gaps = 6/138 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  285
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLG-EKERRFKIFKDNLRF  81

Query  286  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
            IDE N  E  ++K+GLNRFADLTN+EYR+ YLG K  +      +K   RYAP+VG  LP
Sbjct  82   IDEHNVDESHSFKVGLNRFADLTNDEYRAMYLGTKKSSN---KVSKKSNRYAPRVGEELP  138

Query  466  DSIDWREKGAVAEVKDQG  519
             SIDWREKGAV  VKDQG
Sbjct  139  ASIDWREKGAVVPVKDQG  156



>ref|XP_004169515.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
Length=459

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            RTD+EVMALY+ W  +HGK +N LG E + RF IFKDNL++IDE N+ ++  Y+LGLN F
Sbjct  32   RTDDEVMALYDQWRAKHGKLHNNLGAEPENRFHIFKDNLKFIDEINA-QNLPYRLGLNVF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADLTNEEYRS YLG K  +  R  + ++  RY P++G  LPDSIDWR KGAVA VKDQGS
Sbjct  91   ADLTNEEYRSRYLGGKFASGSR--RNRTSNRYLPRLGDDLPDSIDWRAKGAVAPVKDQGS  148

Query  523  CGSCWAFSTI  552
            CGSCWAFST+
Sbjct  149  CGSCWAFSTV  158



>dbj|BAC75927.1| cysteine protease-5 [Helianthus annuus]
Length=365

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 98/134 (73%), Gaps = 4/134 (3%)
 Frame = +1

Query  160  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  339
            +RTDEEV   YE WL  HGK+YN LG EK+ RF IF DNL++IDE N   +R+YK+GLN+
Sbjct  26   TRTDEEVRNTYELWLARHGKTYNALG-EKESRFRIFADNLKFIDEHNLSGNRSYKVGLNQ  84

Query  340  FADLTNEEYRSTYLGAKTDARRRIAKTKS---DRRYAPKVGGSLPDSIDWREKGAVAEVK  510
            FADLTNEEYRS YLG K D  RRIAK +     RRYA +     P  +DWRE+GAV+ VK
Sbjct  85   FADLTNEEYRSMYLGTKVDPYRRIAKMQRGEISRRYAVQENEMFPAKVDWRERGAVSPVK  144

Query  511  DQGSCGSCWAFSTI  552
            +QG CGSCWAFST+
Sbjct  145  NQGGCGSCWAFSTV  158



>gb|ABQ10196.1| actinidin Act3a [Actinidia eriantha]
Length=380

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 102/130 (78%), Gaps = 6/130 (5%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            RT++EVMALYESWLV++GKSYN LG E++ R EIFK+NLR+IDE N+  +R+Y +GLN+F
Sbjct  33   RTNDEVMALYESWLVKYGKSYNSLG-EREMRIEIFKENLRFIDEHNADPNRSYTVGLNQF  91

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADLT+EEYRSTYLG K+       K+K   RY P+VG  LPD +DWR  GAV +VK+QG 
Sbjct  92   ADLTDEEYRSTYLGFKSS-----LKSKVSNRYMPQVGEVLPDYVDWRTTGAVVDVKNQGL  146

Query  523  CGSCWAFSTI  552
            C SCWAF+TI
Sbjct  147  CSSCWAFATI  156



>gb|KGN55227.1| hypothetical protein Csa_4G641600 [Cucumis sativus]
Length=459

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            RTD+EVMALY+ W  +HGK +N LG E + RF IFKDNL++IDE N+ ++  Y+LGLN F
Sbjct  32   RTDDEVMALYDQWRAKHGKLHNNLGAEPENRFHIFKDNLKFIDEINA-QNLPYRLGLNVF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADLTNEEYRS YLG K  +  R  + ++  RY P++G  LPDSIDWR KGAVA VKDQGS
Sbjct  91   ADLTNEEYRSRYLGGKFASGSR--RNRTSNRYLPRLGDDLPDSIDWRAKGAVAPVKDQGS  148

Query  523  CGSCWAFSTI  552
            CGSCWAFST+
Sbjct  149  CGSCWAFSTV  158



>ref|XP_006422960.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
 gb|ESR36200.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
Length=479

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 110/151 (73%), Gaps = 6/151 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII Y+  H   G + ++  +  +YE WLV+HGK+YN LG EK++RFEIFKDNL++++
Sbjct  27   DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNALG-EKERRFEIFKDNLKFVN  85

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRI----AKTKSDRRYAPKVGGS  459
            E N+   R YK+GLN+FADLTN+E+R+ YLGAK + ++ +       KS  RY  K G +
Sbjct  86   EHNAVA-RTYKVGLNKFADLTNDEFRNMYLGAKMERKKALRAGNGNAKSSDRYVYKHGDA  144

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            LP+S+DWR KGAV  VKDQG CGSCWAFST+
Sbjct  145  LPESVDWRAKGAVGPVKDQGQCGSCWAFSTV  175



>emb|CDY25228.1| BnaC02g30040D [Brassica napus]
Length=460

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 114/153 (75%), Gaps = 13/153 (8%)
 Frame = +1

Query  112  DMSIITYDEE-HPAKGLSRTDEEVMALYESWLVEHGK-----SYNGLGGEKDKRFEIFKD  273
            DMSII+YDE+ H +    R+D EV  +YE W+ +HGK       NGL    D+RFEIFKD
Sbjct  22   DMSIISYDEKRHISAVNGRSDAEVSKIYEEWMEKHGKKKMMTQNNGL--VTDQRFEIFKD  79

Query  274  NLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVG  453
            NLR+IDE N++ + +YKLGL RFADLTN+EYRS YLGAK   ++R+ KT    RY P+VG
Sbjct  80   NLRFIDEHNNK-NLSYKLGLTRFADLTNDEYRSIYLGAK--PKKRVLKTSD--RYEPRVG  134

Query  454  GSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
             +LP S+DWR++GAVA VKDQGSCGSCWAFSTI
Sbjct  135  DALPASVDWRKEGAVAAVKDQGSCGSCWAFSTI  167



>gb|AHY28814.1| cysteine protease, partial [Pinus palustris]
Length=194

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R D+ +M LYE WL EH K+YNGL  EK KRF +FKDN  YI E N + +R+YKLGLN+F
Sbjct  33   REDDAIMELYELWLAEHKKAYNGLD-EKQKRFTVFKDNFLYIHEHN-QGNRSYKLGLNQF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADL++EE+++TYLGAK D ++R+ ++ S R Y    G  LP SIDWREKGAVA VKDQG+
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPR-YQYSNGEDLPKSIDWREKGAVAPVKDQGA  149

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  150  CGSCWAFSTVA  160



>ref|XP_010479116.1| PREDICTED: cysteine proteinase RD21a [Camelina sativa]
Length=462

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 111/150 (74%), Gaps = 8/150 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  282
            DMSII+YDE+H       R++ EV ++YE WLV+HGK  + N L GEKD RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSSSGGRSEAEVRSMYEEWLVKHGKVQNQNSLLGEKD-RFEIFKDNLR  81

Query  283  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
            +ID+ N + +  Y+LGL RFADLTN+EYRS YLGAKT  +    + ++  RY  +VG  L
Sbjct  82   FIDDHNEK-NLGYRLGLTRFADLTNDEYRSMYLGAKTHKK---GERRTSHRYKARVGDEL  137

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+ +DWR+KGAVAEVKDQG CGSCWAFS I
Sbjct  138  PEFVDWRKKGAVAEVKDQGGCGSCWAFSAI  167



>gb|ABQ10197.1| actinidin Act4a [Actinidia eriantha]
Length=385

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 104/130 (80%), Gaps = 5/130 (4%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            RT++EV+A++ESWLVE+GKSYN LG EK++RFEIFKDNLR++DE N+  +R+YK+GLN+F
Sbjct  39   RTNDEVIAMFESWLVEYGKSYNALG-EKERRFEIFKDNLRFVDEHNADVNRSYKVGLNQF  97

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            +DLT+ EY S YLG K + R     T    RY P+VG  LPDS+DWR+KGAV  VK+QG+
Sbjct  98   SDLTDAEYSSIYLGTKFNIRM----TNVSDRYEPRVGDQLPDSVDWRKKGAVLGVKNQGN  153

Query  523  CGSCWAFSTI  552
            CGSCW F++I
Sbjct  154  CGSCWTFASI  163



>ref|XP_004141271.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
Length=458

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            RTD+EVMALY+ W  +HGK +N LG E + RF IFKDNL++IDE N+ ++  Y+LGLN F
Sbjct  32   RTDDEVMALYDQWRAKHGKLHNNLGAEPENRFHIFKDNLKFIDEINA-QNLPYRLGLNVF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADLTNEEYRS YLG K  +  R  + ++  RY P++G  LPDSIDWR KGAVA VKDQGS
Sbjct  91   ADLTNEEYRSRYLGGKFASGSR--RNRTSNRYLPRLGDDLPDSIDWRAKGAVAPVKDQGS  148

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  149  CGSCWAFSTVA  159



>gb|AAW66796.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66798.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66800.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66810.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66816.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66819.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66823.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66825.1| cysteine protease, partial [Pinus taeda]
Length=193

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R D+ +M LYE WL EH K+YNGL  EK KRF +FKDN  YI E N + +R+YKLGLN+F
Sbjct  33   REDDAIMELYELWLAEHKKAYNGLD-EKQKRFTVFKDNFLYIHEHN-QGNRSYKLGLNQF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADL++EE+++TYLGAK D ++R+ ++ S R Y    G  LP SIDWREKGAVA VKDQG+
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPR-YQYSDGEDLPKSIDWREKGAVAPVKDQGA  149

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  150  CGSCWAFSTVA  160



>ref|XP_008340386.1| PREDICTED: cysteine proteinase COT44-like [Malus domestica]
Length=366

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 110/144 (76%), Gaps = 4/144 (3%)
 Frame = +1

Query  124  ITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  303
             T  +  P  G SR++ +V A+Y+ WLV+H K+YNG+G E ++RFEIFKDNL++IDE N+
Sbjct  17   FTLSQASPIVG-SRSEADVRAIYQEWLVKHQKTYNGIG-EDERRFEIFKDNLKFIDEHNA  74

Query  304  REDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDR-RYAPKVGGSLPDSIDW  480
              DR YK+GLN FADLTN+EYR+ +LG ++D +RR  K K+   RYA + G +LP+S+DW
Sbjct  75   L-DRPYKVGLNAFADLTNQEYRAKFLGTRSDPKRRXMKAKNPSLRYAFRAGETLPESVDW  133

Query  481  REKGAVAEVKDQGSCGSCWAFSTI  552
            R KGAV  +K+QGSCGSCWAFST+
Sbjct  134  RVKGAVNPIKNQGSCGSCWAFSTV  157



>ref|XP_009400290.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=470

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 109/150 (73%), Gaps = 5/150 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSI+ Y++EH  +GL R++EE+  +YE WL +HG++ N LG + + RF+IFKDNLR++D
Sbjct  24   DMSIVAYNKEHGVRGLERSEEEMRRMYEGWLAKHGRANNALG-QNEMRFDIFKDNLRFVD  82

Query  292  EQNSREDRA---YKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  462
              N+  D     ++LGLNRFADLTNEEYR+ YLG +     R ++   DR Y  + G  L
Sbjct  83   AHNAAADAGRHRFRLGLNRFADLTNEEYRAAYLGTRARGVARRSRVPGDR-YRYEDGEEL  141

Query  463  PDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            P+S+DWR KGAVA VKDQGSCGSCWAFST+
Sbjct  142  PESVDWRAKGAVAAVKDQGSCGSCWAFSTV  171



>ref|XP_006652996.1| PREDICTED: oryzain beta chain-like [Oryza brachyantha]
Length=460

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 107/148 (72%), Gaps = 6/148 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+Y+EEH A+GL RT+ E  A Y+ WL E+G+SYN LG E D+RF +F DNLR++D
Sbjct  26   DMSIISYNEEHGARGLERTEAEARAAYDLWLAENGRSYNALG-EYDRRFRVFWDNLRFVD  84

Query  292  EQNSRE-DRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
              N+R  +  ++LG+NRFADLTNEE+R+ +LG K   R R+A      RY       LP+
Sbjct  85   AHNARAGEHRFRLGMNRFADLTNEEFRAAFLGVKVAERSRVA----GERYRHDGVEELPE  140

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWREKGAVA VK+QG CGSCWAFS +
Sbjct  141  SVDWREKGAVAPVKNQGQCGSCWAFSAV  168



>gb|AEV41117.1| putative oryzain beta chain precursor [Oryza officinalis]
Length=465

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 107/148 (72%), Gaps = 6/148 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+Y+ EH A+GL RT+ E  A Y+ WL E+G+SYN LG E ++RF +F DNLR+ D
Sbjct  28   DMSIISYNAEHGARGLERTEAEARAAYDLWLAENGRSYNALG-EHERRFRVFWDNLRFAD  86

Query  292  EQNSR-EDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
              N+R +D  ++LG+NRFADLTNEE+R+T+LGAK   R R A      RY       LP+
Sbjct  87   AHNARADDHGFRLGMNRFADLTNEEFRATFLGAKVVERSRAAG----ERYRHDGVEELPE  142

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWREKGAVA VK+QG CGSCWAFS +
Sbjct  143  SVDWREKGAVAPVKNQGQCGSCWAFSAV  170



>gb|KDO59789.1| hypothetical protein CISIN_1g012022mg [Citrus sinensis]
Length=472

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 110/151 (73%), Gaps = 6/151 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII Y+  H   G + ++  +  +YE WLV+HGK+YN LG E+++RFEIFKDNL++++
Sbjct  20   DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNALG-EQERRFEIFKDNLKFVN  78

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRI----AKTKSDRRYAPKVGGS  459
            E N+   R YK+GLN+FADLTN+E+R+ YLGAK + ++ +       KS  RY  K G +
Sbjct  79   EHNAVA-RTYKVGLNKFADLTNDEFRNMYLGAKMERKKALRAGNGNAKSSDRYVYKHGDA  137

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            LP+S+DWR KGAV  VKDQG CGSCWAFST+
Sbjct  138  LPESVDWRAKGAVGPVKDQGQCGSCWAFSTV  168



>gb|ABZ69059.1| cysteine protease [Pinus radiata]
 gb|ABZ69060.1| cysteine protease [Pinus radiata]
Length=185

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R D+ +M LYE WL EH K+YNGL  EK KRF +FKDN  YI E N + +R+YKLGLN+F
Sbjct  33   REDDAIMELYELWLAEHKKAYNGLD-EKQKRFTVFKDNFLYIHEHN-QGNRSYKLGLNQF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADL++EE+++TYLGAK D ++R+ ++ S R Y    G  LP SIDWREKGAVA VKDQG+
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPR-YQYSDGEDLPKSIDWREKGAVAPVKDQGA  149

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  150  CGSCWAFSTVA  160



>gb|AIF75886.1| cysteine protease, partial [Pinus massoniana]
Length=188

 Score =   164 bits (415),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 99/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R D+ +M LYE WL EH K+YNGL  EK KRF +FKDN  YI E N + +R+YKLGLN+F
Sbjct  33   REDDAIMELYELWLAEHKKAYNGLD-EKQKRFTVFKDNFLYIHEHN-QGNRSYKLGLNQF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADL++EE+++TYLGAK D ++R+ ++ S R Y    G  LP SIDWREKGAVA VKDQG 
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPR-YQYSDGEDLPKSIDWREKGAVAPVKDQGQ  149

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  150  CGSCWAFSTVA  160



>ref|XP_006487026.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=472

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 110/151 (73%), Gaps = 6/151 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII Y+  H   G + ++  +  +YE WLV+HGK+YN LG E+++RFEIFKDNL++++
Sbjct  20   DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNALG-EQERRFEIFKDNLKFVN  78

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRI----AKTKSDRRYAPKVGGS  459
            E N+   R YK+GLN+FADLTN+E+R+ YLGAK + ++ +       KS  RY  K G +
Sbjct  79   EHNAVA-RTYKVGLNKFADLTNDEFRNMYLGAKMERKKALRAGNGNAKSSDRYVYKHGDA  137

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            LP+S+DWR KGAV  VKDQG CGSCWAFST+
Sbjct  138  LPESVDWRAKGAVGPVKDQGQCGSCWAFSTV  168



>gb|AEV41071.1| putative oryzain beta chain precursor [Oryza minuta]
Length=464

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 107/148 (72%), Gaps = 6/148 (4%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+Y+ EH A+GL RT+ E  A Y+ WL E+G+SYN LG E ++RF +F DNLR+ D
Sbjct  27   DMSIISYNAEHGARGLERTEAEARAAYDLWLAENGRSYNALG-EHERRFRVFWDNLRFAD  85

Query  292  EQNSR-EDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  468
              N+R +D  ++LG+NRFADLTNEE+R+T+LGAK   R R A      RY       LP+
Sbjct  86   AHNARADDHGFRLGMNRFADLTNEEFRATFLGAKVVERSRAAG----ERYRHDGVEELPE  141

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWREKGAVA VK+QG CGSCWAFS +
Sbjct  142  SVDWREKGAVAPVKNQGQCGSCWAFSAV  169



>ref|XP_009372437.1| PREDICTED: cysteine proteinase COT44-like [Pyrus x bretschneideri]
Length=366

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 107/132 (81%), Gaps = 3/132 (2%)
 Frame = +1

Query  160  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  339
            S+++ +V A+Y+ WLV+H K+YNG+G E++ RFEIFKDNL++IDE N+ +DR YK+GLN 
Sbjct  28   SQSEADVRAIYQEWLVKHQKTYNGIG-EEEVRFEIFKDNLKFIDEHNA-QDRPYKVGLNA  85

Query  340  FADLTNEEYRSTYLGAKTDARRRIAKTKSDR-RYAPKVGGSLPDSIDWREKGAVAEVKDQ  516
            FADLTN+EYR+ +LG ++D +RR+ K K    RYA + G +LP+S+DWR KGAV  +K+Q
Sbjct  86   FADLTNQEYRAKFLGTRSDPKRRVMKAKKPSLRYAFRAGETLPESVDWRVKGAVNPIKNQ  145

Query  517  GSCGSCWAFSTI  552
            GSCGSCWAFST+
Sbjct  146  GSCGSCWAFSTV  157



>gb|AIF75887.1| cysteine protease, partial [Pinus massoniana]
 gb|AIF75888.1| cysteine protease, partial [Pinus massoniana]
 gb|AIF75889.1| cysteine protease, partial [Pinus massoniana]
 gb|AIF75891.1| cysteine protease, partial [Pinus hwangshanensis]
 gb|AIF75892.1| cysteine protease, partial [Pinus hwangshanensis]
 gb|AIF75893.1| cysteine protease, partial [Pinus hwangshanensis]
 gb|AIF75894.1| cysteine protease, partial [Pinus hwangshanensis]
 gb|AIF75895.1| cysteine protease, partial [Pinus hwangshanensis]
Length=188

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 99/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R D+ +M LYE WL EH K+YNGL  EK KRF +FKDN  YI E N + +R+YKLGLN+F
Sbjct  33   REDDAIMELYELWLAEHKKAYNGLD-EKQKRFTVFKDNFLYIHEHN-QGNRSYKLGLNQF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADL++EE+++TYLGAK D ++R+ ++ S R Y    G  LP SIDWREKGAVA VKDQG 
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPR-YQYSDGEDLPKSIDWREKGAVAPVKDQGQ  149

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  150  CGSCWAFSTVA  160



>gb|KHN22490.1| Cysteine proteinase RD21a [Glycine soja]
Length=355

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII++D  H  +   RTD+EVM+++E WLV+H K YN LG EK+KRF+IFK+NLR+ID
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNALG-EKEKRFQIFKNNLRFID  77

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            E+NS  +R YKLGLN FADLTN EYR+ YL    D  R    T     Y P+VG ++P S
Sbjct  78   ERNSL-NRTYKLGLNVFADLTNAEYRAMYLRTWDDGPRLDLDTPPRNHYVPRVGDTIPKS  136

Query  472  IDWREKGAVAEVKDQG-SCGSCWAFSTI  552
            +DWR++GAV  VK+QG +C SCWAF+ +
Sbjct  137  VDWRKEGAVTPVKNQGATCNSCWAFTAV  164



>ref|XP_010548429.1| PREDICTED: germination-specific cysteine protease 1 [Tarenaya 
hassleriana]
Length=376

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 113/151 (75%), Gaps = 7/151 (5%)
 Frame = +1

Query  118  SIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  288
            S  ++ ++H   P+ G  RT+EEV ++Y  W  +HGK+YNG+  E+++RF IFKDNL +I
Sbjct  23   STTSFPDDHLRLPSDGHRRTEEEVRSMYILWSAKHGKTYNGID-EQERRFNIFKDNLGFI  81

Query  289  DEQNSREDR--AYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGS  459
            DE N  ++    YKLGL +FADLTNEEYRS YLG K+++ RR+AK K+  RRYA   G  
Sbjct  82   DEHNHNKNTNATYKLGLTKFADLTNEEYRSLYLGMKSESARRVAKAKNVSRRYAAVNGEM  141

Query  460  LPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            LP+++DWR++GAV+ VKDQG+CGSCWAFSTI
Sbjct  142  LPETVDWRQRGAVSPVKDQGTCGSCWAFSTI  172



>gb|AAW66797.1| cysteine protease, partial [Pinus taeda]
Length=192

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R D+ +M LYE WL EH K+YNGL  EK KRF +FKDN  YI E N + +R+YKLGLN+F
Sbjct  32   REDDAIMELYELWLAEHKKAYNGLD-EKQKRFTVFKDNFLYIHEHN-QGNRSYKLGLNQF  89

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADL++EE+++TYLGAK D ++R+ ++ S R Y    G  LP SIDWREKGAVA VKDQG+
Sbjct  90   ADLSHEEFKATYLGAKLDTKKRLLRSPSPR-YQYSDGEDLPKSIDWREKGAVAPVKDQGA  148

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  149  CGSCWAFSTVA  159



>gb|AEV40973.1| putative oryzain beta chain precursor [Oryza punctata]
Length=461

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 108/149 (72%), Gaps = 7/149 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII+Y+ EH A+GL RT+ E  A Y+ WL E+G+SYN LG E+++RF +F DNL+++D
Sbjct  23   DMSIISYNAEHGARGLERTEAEARAAYDLWLAENGRSYNALG-ERERRFRVFWDNLKFVD  81

Query  292  EQNSREDR--AYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  465
              N+R D    ++LG+NRFADLTN+E+RST+LGAK   R R A      RY       LP
Sbjct  82   AHNARADEHGGFRLGMNRFADLTNDEFRSTFLGAKVVERSRAAG----ERYRHDGVEELP  137

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            +S+DWREKGAVA VK+QG CGSCWAFS +
Sbjct  138  ESVDWREKGAVAPVKNQGQCGSCWAFSAV  166



>gb|AAW66794.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66795.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66802.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66803.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66806.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66807.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66808.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66811.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66812.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66813.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66814.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66822.1| cysteine protease, partial [Pinus taeda]
Length=193

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R D+ +M LYE WL EH K+YNGL  EK KRF +FKDN  YI E N + +R+YKLGLN+F
Sbjct  33   REDDAIMELYELWLAEHKKAYNGLD-EKQKRFTVFKDNFLYIHEHN-QGNRSYKLGLNQF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADL++EE+++TYLGAK D ++R+ ++ S R Y    G  LP SIDWREKGAVA VKDQG+
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPR-YQYSDGEDLPKSIDWREKGAVAPVKDQGA  149

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  150  CGSCWAFSTVA  160



>gb|AAW66804.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66805.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66817.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66818.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66820.1| cysteine protease, partial [Pinus taeda]
Length=193

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R D+ +M LYE W+ EH K+YNGL  EK KRF +FKDN  YI E N + +R+YKLGLN+F
Sbjct  33   REDDAIMELYELWVAEHKKAYNGLD-EKQKRFTVFKDNFLYIHEHN-QGNRSYKLGLNQF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADL++EE+++TYLGAK D ++R+ ++ S R Y    G  LP SIDWREKGAVA VKDQG+
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPR-YQYSDGEDLPKSIDWREKGAVAPVKDQGA  149

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  150  CGSCWAFSTVA  160



>gb|KHN08598.1| Cysteine proteinase RD21a [Glycine soja]
Length=435

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 104/149 (70%), Gaps = 14/149 (9%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII YDE H              +YE+WLV+HGK+YN LG EK++RF+IFKDNLR+I+
Sbjct  2    DMSIIDYDESH-----------TRHVYEAWLVKHGKAYNALG-EKERRFKIFKDNLRFIE  49

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKT--KSDRRYAPKVGGSLP  465
            E N   D++YKLGLN+FADLTNEEYR+ +LG +T   +  A    K   RYA + G  LP
Sbjct  50   EHNGAGDKSYKLGLNKFADLTNEEYRAMFLGTRTRGPKNKAAVVAKKTDRYAYRAGEELP  109

Query  466  DSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
              +DWREKGAV  +KDQG CGSCWAFST+
Sbjct  110  AMVDWREKGAVTPIKDQGQCGSCWAFSTV  138



>gb|ABK24233.1| unknown [Picea sitchensis]
Length=463

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 109/148 (74%), Gaps = 7/148 (5%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            D SII YD    +K L R D+ +M LYE WL +H K+YNGLG EK  RF +FKDN  YI 
Sbjct  23   DFSIIGYD----SKDL-REDDAIMELYELWLAQHKKAYNGLG-EKQNRFSVFKDNFLYIH  76

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  471
            + N++ + +YKLGLN+FADL++EE+++TYLGAK D ++R++ + S  RY    G  LP+S
Sbjct  77   QHNNQGNPSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLSNSPS-PRYQYSDGEDLPES  135

Query  472  IDWREKGAVAEVKDQGSCGSCWAFSTIV  555
            IDWREKGAV  VKDQGSCGSCWAFST+ 
Sbjct  136  IDWREKGAVTAVKDQGSCGSCWAFSTVA  163



>gb|ABS83496.1| cysteine protease [Pinus pinaster]
Length=187

 Score =   163 bits (412),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 99/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R D+ +M LYE WL EH K+YNGL  EK KRF +FKDN  YI E N + +R+YKLGLN+F
Sbjct  33   REDDAIMELYELWLAEHKKAYNGLD-EKQKRFTVFKDNFLYIHEHN-QGNRSYKLGLNKF  90

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQGS  522
            ADL++EE+++TYLGAK D ++R+ ++ S R Y    G  LP SIDWR KGAVA VKDQGS
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPR-YQYSDGEDLPKSIDWRVKGAVAPVKDQGS  149

Query  523  CGSCWAFSTIV  555
            CGSCWAFST+ 
Sbjct  150  CGSCWAFSTVA  160



>emb|CAA53377.1| cysteine protease [Vicia sativa]
Length=368

 Score =   168 bits (425),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  163  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  342
            R+++EVM +YE WLV+H K YNGL  EKD+RF+IFKDNL +IDE N+ ++  Y +GLN+F
Sbjct  30   RSNDEVMTMYEEWLVKHQKVYNGLR-EKDQRFQIFKDNLNFIDEHNA-QNYTYIVGLNKF  87

Query  343  ADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSIDWREKGAVAEVKDQG  519
            AD+TNEEYR  YLG ++D +RRI K K +  RYA   G  LP  +DWR KGA+  +KDQG
Sbjct  88   ADMTNEEYRDMYLGTRSDIKRRIMKNKITGHRYAYNSGDRLPVHVDWRLKGAITHIKDQG  147

Query  520  SCGSCWAFSTI  552
            SCGSCWAFSTI
Sbjct  148  SCGSCWAFSTI  158



>gb|ABQ10195.1| actinidin Act2d [Actinidia eriantha]
Length=381

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 100/132 (76%), Gaps = 6/132 (5%)
 Frame = +1

Query  157  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLN  336
            + RT+++VMA+YESWLVE GKSYN L  EK+ RFEIFK+NLR ID+ N+  +R+Y LGLN
Sbjct  33   VQRTNDQVMAMYESWLVEQGKSYNSLD-EKEMRFEIFKENLRIIDDHNADANRSYSLGLN  91

Query  337  RFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDWREKGAVAEVKDQ  516
            RFADLT+EEYRSTYLG K+  + +++      RY PKVG  LP+ +DWR  GAV  VKDQ
Sbjct  92   RFADLTDEEYRSTYLGFKSGPKAKVSN-----RYVPKVGVVLPNYVDWRTVGAVVGVKDQ  146

Query  517  GSCGSCWAFSTI  552
            G C SCWAFS +
Sbjct  147  GLCSSCWAFSAV  158



>dbj|BAD29954.1| cysteine protease [Daucus carota]
Length=474

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 114/153 (75%), Gaps = 11/153 (7%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLS----RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  279
            DMSIITYDE H   GL+    RT +++++LYESWLV+H K+YN LG EK+ RF IFKDN+
Sbjct  33   DMSIITYDETH---GLNSPPLRTHDQLLSLYESWLVKHHKNYNALG-EKETRFGIFKDNV  88

Query  280  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKT--KSDRRYAPKVG  453
             ++D  NS  +++YKLGLN+FADLTN+EYRS YL  K   R R  +   +SD R+  + G
Sbjct  89   GFVDRHNSMRNQSYKLGLNKFADLTNDEYRSLYLSGKMMKRERKNEDGFRSD-RFVFEDG  147

Query  454  GSLPDSIDWREKGAVAEVKDQGSCGSCWAFSTI  552
              LP+S+DWR++GAVA VKDQG CGSCWAFST+
Sbjct  148  DHLPESVDWRDRGAVAPVKDQGQCGSCWAFSTV  180



>ref|XP_004496966.1| PREDICTED: cysteine proteinase RD21a-like isoform X2 [Cicer arietinum]
Length=474

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 110/148 (74%), Gaps = 5/148 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII YD +  A   ++TD  +M +YESWL++HGK YN LG EK+ RFEIFKDNL++I 
Sbjct  27   DMSIIDYDAKLEA---AKTDIHLMKIYESWLLKHGKVYNALG-EKEHRFEIFKDNLQFIQ  82

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKT-DARRRIAKTKSDRRYAPKVGGSLPD  468
              N+ E++++KLGL +FADLTNEEYRS +LG ++ +++  ++ +K   RYA      LP 
Sbjct  83   NHNNMENQSFKLGLTKFADLTNEEYRSMFLGTRSRNSKGLLSGSKKSNRYAFHDTDELPG  142

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWREKGAV  VKDQG CGSCWAFST+
Sbjct  143  SVDWREKGAVTPVKDQGQCGSCWAFSTV  170



>ref|XP_004496965.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Cicer arietinum]
Length=472

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 110/148 (74%), Gaps = 5/148 (3%)
 Frame = +1

Query  112  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  291
            DMSII YD +  A   ++TD  +M +YESWL++HGK YN LG EK+ RFEIFKDNL++I 
Sbjct  27   DMSIIDYDAKLEA---AKTDIHLMKIYESWLLKHGKVYNALG-EKEHRFEIFKDNLQFIQ  82

Query  292  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKT-DARRRIAKTKSDRRYAPKVGGSLPD  468
              N+ E++++KLGL +FADLTNEEYRS +LG ++ +++  ++ +K   RYA      LP 
Sbjct  83   NHNNMENQSFKLGLTKFADLTNEEYRSMFLGTRSRNSKGLLSGSKKSNRYAFHDTDELPG  142

Query  469  SIDWREKGAVAEVKDQGSCGSCWAFSTI  552
            S+DWREKGAV  VKDQG CGSCWAFST+
Sbjct  143  SVDWREKGAVTPVKDQGQCGSCWAFSTV  170



Lambda      K        H        a         alpha
   0.315    0.133    0.392    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800