BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I22

Length=488
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABB40579.2|  1-aminocyclopropane-1-carboxylate synthase              216   2e-64   Ipomoea nil [qian niu]
ref|XP_009590053.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    187   2e-53   Nicotiana tomentosiformis
gb|AAR99393.1|  ACC synthase ACS3b                                      187   2e-53   Nicotiana attenuata
ref|XP_009771943.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    187   2e-53   Nicotiana sylvestris
emb|CAA06288.1|  1-cyclopropane-1-carboxylate synthase                  187   2e-53   Nicotiana tabacum [American tobacco]
ref|XP_009590054.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    187   2e-53   
gb|AAR99392.1|  ACC synthase ACS3a                                      186   3e-53   Nicotiana attenuata
ref|XP_009757887.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    186   8e-53   Nicotiana sylvestris
gb|AAC83147.1|  1-aminocyclopropane-1-carboxylate synthase              184   2e-52   Nicotiana glutinosa
ref|NP_001275367.1|  1-aminocyclopropane-1-carboxylate synthase         184   3e-52   Solanum tuberosum [potatoes]
ref|XP_009776307.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    184   5e-52   Nicotiana sylvestris
gb|AAR99391.1|  ACC synthase ACS2                                       183   6e-52   Nicotiana attenuata
ref|XP_006360739.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    183   7e-52   Solanum tuberosum [potatoes]
emb|CAA67118.1|  ACC synthase                                           182   1e-51   Nicotiana tabacum [American tobacco]
ref|XP_011080907.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    182   1e-51   Sesamum indicum [beniseed]
ref|XP_009626021.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    182   1e-51   Nicotiana tomentosiformis
gb|ABW97851.1|  ACS5                                                    182   2e-51   Nicotiana tabacum [American tobacco]
dbj|BAG30909.1|  ACC synthase                                           182   2e-51   Capsicum chinense [bonnet pepper]
dbj|BAA25916.1|  1-aminocyclopropane-1-carboxylate synthase             181   5e-51   Solanum lycopersicum
ref|NP_001234164.1|  1-aminocyclopropane-1-carboxylate synthase         181   5e-51   
dbj|BAA34923.1|  1-aminocyclopropane-1-carboxylate synthase             181   5e-51   Solanum lycopersicum
ref|NP_001266271.1|  1-aminocyclopropane-1-carboxylate synthase-like    181   5e-51   
ref|XP_009791163.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    181   7e-51   Nicotiana sylvestris
ref|XP_006343931.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    180   7e-51   Solanum tuberosum [potatoes]
ref|XP_009626433.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    180   8e-51   Nicotiana tomentosiformis
ref|XP_010089045.1|  1-aminocyclopropane-1-carboxylate synthase         179   1e-50   Morus notabilis
emb|CDP12072.1|  unnamed protein product                                179   2e-50   Coffea canephora [robusta coffee]
ref|XP_011073274.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    179   2e-50   Sesamum indicum [beniseed]
gb|AAF97614.1|U18056_1  1-amino-cyclopropane-1-carboxylate synthase     178   4e-50   Solanum lycopersicum
ref|NP_001233922.1|  1-aminocyclopropane-1-carboxylate synthase         178   5e-50   
ref|XP_006343930.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    178   5e-50   Solanum tuberosum [potatoes]
gb|ACT54524.2|  1-aminocyclopropane-1-carboxylate synthase              177   1e-49   Eriobotrya japonica [loquat]
ref|NP_001280870.1|  1-aminocyclopropane-1-carboxylate synthase         177   1e-49   Malus domestica [apple tree]
ref|XP_009343873.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    177   1e-49   Pyrus x bretschneideri [bai li]
ref|XP_009363394.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    177   1e-49   Pyrus x bretschneideri [bai li]
gb|AFM93771.1|  ACC synthetase                                          177   1e-49   Boehmeria nivea [Chinese silk-plant]
gb|AAF97615.1|U18057_1  1-amino-cyclopropane-1-carboxylate synthase     177   1e-49   Solanum lycopersicum
gb|EYU23426.1|  hypothetical protein MIMGU_mgv1a010964mg                172   2e-49   Erythranthe guttata [common monkey flower]
gb|AAC15777.1|  ACC synthase                                            177   2e-49   Nicotiana glutinosa
ref|XP_004252649.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    176   2e-49   Solanum lycopersicum
gb|KDP25384.1|  hypothetical protein JCGZ_20540                         176   2e-49   Jatropha curcas
gb|AAC98809.1|  ACC synthase                                            176   3e-49   Carica papaya [mamon]
dbj|BAF44097.1|  1-aminocyclopropane-1-carboxylate synthase             176   3e-49   Pyrus x bretschneideri [bai li]
dbj|BAJ65574.1|  1-aminocyclopropane-1-carboxylate synthase             176   5e-49   Pyrus pyrifolia var. culta [Asian pear]
gb|ACX71871.1|  ACC synthase 1                                          175   7e-49   Lithospermum erythrorhizon
gb|ACT54523.3|  1-aminocyclopropane-1-carboxylate synthase              174   2e-48   Eriobotrya japonica [loquat]
ref|XP_008238953.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    174   2e-48   Prunus mume [ume]
ref|NP_001280768.1|  1-aminocyclopropane-1-carboxylate synthase-like    174   2e-48   Malus domestica [apple tree]
gb|EYU23427.1|  hypothetical protein MIMGU_mgv1a005590mg                173   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_007210019.1|  hypothetical protein PRUPE_ppa016458mg             173   3e-48   Prunus persica
ref|NP_001275873.1|  1-aminocyclopropane-1-carboxylate synthase 1...    173   3e-48   
ref|XP_007051710.1|  1-aminocyclopropane-1-carboxylate synthase         173   5e-48   
emb|CAA72191.1|  1-aminocyclopropane-1-carboxylate synthase             173   5e-48   Carica papaya [mamon]
emb|CAB60831.1|  ACC synthase                                           172   5e-48   Citrus sinensis [apfelsine]
ref|XP_006444953.1|  hypothetical protein CICLE_v10019970mg             172   6e-48   Citrus clementina [clementine]
gb|AGF95121.1|  1-aminocyclopropane-1-carboxylate synthase              167   7e-48   Prunus persica
dbj|BAJ10407.1|  1-aminocyclopropane-1-carboxylate synthase             164   7e-48   Dianthus longicalyx
gb|ACU15501.1|  unknown                                                 165   9e-48   Glycine max [soybeans]
dbj|BAJ10413.1|  1-aminocyclopropane-1-carboxylate synthase             163   1e-47   Dianthus longicalyx
gb|AAM21682.1|AF500119_1  1-aminocyclopropane-1-carboxylate synth...    171   2e-47   Persea americana
ref|XP_004492797.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    171   2e-47   Cicer arietinum [garbanzo]
gb|AAB70885.1|  1-aminocyclopropane-1-carboxylate synthase              171   3e-47   Pelargonium x hortorum [bedding geranium]
gb|KJB41416.1|  hypothetical protein B456_007G103200                    171   3e-47   Gossypium raimondii
dbj|BAB89350.1|  1-aminocyclopropane-1-carboxylate synthase             171   3e-47   Diospyros kaki [Japanese persimmon]
gb|KJB49434.1|  hypothetical protein B456_008G119600                    171   3e-47   Gossypium raimondii
gb|AES80302.2|  1-aminocyclopropane-1-carboxylate synthase              170   4e-47   Medicago truncatula
gb|AAM80888.1|  1-aminocyclopropane-1-carboxylate synthase              170   4e-47   Betula pendula [white birch]
ref|XP_002509858.1|  acc synthase, putative                             170   5e-47   Ricinus communis
gb|AAL66205.1|AF386523_1  1-aminocyclopropane 1-carboxylate synth...    170   6e-47   Pyrus communis
emb|CAA79478.1|  1-aminocyclopropane-1-carboxylate synthase             170   6e-47   Petunia x hybrida [garden petunia]
gb|AAF22109.1|AF119411_1  1-aminocyclopropane-1-carboxylate synth...    170   7e-47   Lupinus albus
ref|XP_003624084.1|  1-aminocyclopropane-1-carboxylate synthase         170   8e-47   
ref|XP_009386742.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    169   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003622479.1|  1-aminocyclopropane-1-carboxylate synthase         169   1e-46   
ref|XP_009786813.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    169   2e-46   Nicotiana sylvestris
gb|KCW44816.1|  hypothetical protein EUGRSUZ_L016172                    164   2e-46   Eucalyptus grandis [rose gum]
gb|ABK97620.1|  1-aminocyclopropane-1-carboxylic acid synthase          169   2e-46   Durio zibethinus [durian]
gb|KCW77477.1|  hypothetical protein EUGRSUZ_D01815                     170   2e-46   Eucalyptus grandis [rose gum]
ref|XP_009398061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    168   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAX99362.1|  1-aminocyclopropane-1-carboxylate synthase              168   3e-46   Prunus persica
ref|XP_007219056.1|  hypothetical protein PRUPE_ppa004774mg             168   3e-46   Prunus persica
gb|AJF36210.1|  1-aminocyclopropane-1-carboxylate synthase 3            167   4e-46   Trifolium repens [creeping white clover]
ref|XP_002304518.2|  1-aminocyclopropane-1-carboxylate synthase f...    167   5e-46   
ref|XP_008805580.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    159   5e-46   
gb|ABW03086.1|  1-aminocyclopropane 1-carboxylate synthase 5            167   5e-46   Prunus salicina [Japanese plum]
ref|XP_002278489.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    167   5e-46   Vitis vinifera
ref|XP_002298013.1|  1-aminocyclopropane-1-carboxylate synthase f...    167   6e-46   
ref|XP_003552421.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    167   6e-46   Glycine max [soybeans]
gb|ABM66813.1|  ACC synthase                                            167   6e-46   Gossypium hirsutum [American cotton]
dbj|BAG30910.1|  ACC synthase                                           167   7e-46   Capsicum chinense [bonnet pepper]
ref|XP_010676415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    167   7e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009591161.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    167   7e-46   Nicotiana tomentosiformis
gb|KDP28564.1|  hypothetical protein JCGZ_14335                         167   7e-46   Jatropha curcas
gb|AAR99390.1|  ACC synthase ACS1                                       167   8e-46   Nicotiana attenuata
gb|KHN29314.1|  1-aminocyclopropane-1-carboxylate synthase CMW33        166   1e-45   Glycine soja [wild soybean]
ref|XP_003534540.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    166   1e-45   Glycine max [soybeans]
dbj|BAA94599.1|  1-aminocyclopropane-1-carboxylate synthase             166   1e-45   Populus euphratica
ref|XP_004298832.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    166   2e-45   Fragaria vesca subsp. vesca
dbj|BAB33423.1|  ACC synthase                                           166   2e-45   Pisum sativum [garden pea]
gb|ACN78835.1|  1-aminocyclopropane-1-carboxylate synthase              166   2e-45   Paeonia suffruticosa [moutan peony]
gb|AFK42980.1|  unknown                                                 159   2e-45   Medicago truncatula
dbj|BAJ10410.1|  1-aminocyclopropane-1-carboxylate synthase             166   2e-45   Dianthus longicalyx
dbj|BAK19926.1|  1-aminocyclopropane-1-carboxylate synthase             166   2e-45   Dianthus petraeus
dbj|BAA96743.1|  1-aminocyclopropane-1-carboxylate synthase             166   2e-45   Prunus persica
gb|ABC69166.2|  1-aminocyclopropane-1-carboxylate synthase              166   2e-45   Paeonia suffruticosa [moutan peony]
dbj|BAJ10416.1|  1-aminocyclopropane-1-carboxylate synthase             166   2e-45   Dianthus longicalyx
dbj|BAJ10406.1|  1-aminocyclopropane-1-carboxylate synthase             166   2e-45   Dianthus longicalyx
gb|AAQ14268.1|AF248737_1  1-aminocyclopropane-1-carboxylate synthase    166   2e-45   Momordica charantia [balsam pear]
dbj|BAK19930.1|  1-aminocyclopropane-1-carboxylate synthase             166   2e-45   Dianthus chinensis [China pink]
dbj|BAK09604.1|  1-aminocyclopropane-1-carboxylate synthase             166   2e-45   Dianthus caryophyllus [carnation]
ref|XP_010092578.1|  1-aminocyclopropane-1-carboxylate synthase 1       166   2e-45   Morus notabilis
sp|P27486.1|1A1C_DIACA  RecName: Full=1-aminocyclopropane-1-carbo...    166   2e-45   Dianthus caryophyllus [carnation]
dbj|BAJ10420.1|  1-aminocyclopropane-1-carboxylate synthase             166   2e-45   Dianthus longicalyx
dbj|BAJ10405.1|  1-aminocyclopropane-1-carboxylate synthase             166   2e-45   Dianthus caryophyllus [carnation]
ref|NP_001280199.1|  1-aminocyclopropane-1-carboxylate synthase 1       166   2e-45   Prunus mume [ume]
dbj|BAJ10403.1|  1-aminocyclopropane-1-carboxylate synthase             166   2e-45   Dianthus caryophyllus [carnation]
emb|CAA79477.1|  1-aminocyclopropane 1-carboxylate synthase             166   2e-45   Dianthus caryophyllus [carnation]
dbj|BAJ10412.1|  1-aminocyclopropane-1-carboxylate synthase             166   3e-45   Dianthus longicalyx
dbj|BAK19928.1|  1-aminocyclopropane-1-carboxylate synthase             166   3e-45   Dianthus petraeus
dbj|BAJ10414.1|  1-aminocyclopropane-1-carboxylate synthase             166   3e-45   Dianthus longicalyx
dbj|BAK19925.1|  1-aminocyclopropane-1-carboxylate synthase             166   3e-45   Dianthus petraeus
ref|XP_011029354.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    165   3e-45   Populus euphratica
sp|Q07262.1|1A1C_TOBAC  RecName: Full=1-aminocyclopropane-1-carbo...    165   3e-45   Nicotiana tabacum [American tobacco]
ref|XP_004306735.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    165   3e-45   Fragaria vesca subsp. vesca
sp|Q9MB95.1|1A11_PRUMU  RecName: Full=1-aminocyclopropane-1-carbo...    165   3e-45   Prunus mume [ume]
ref|XP_010053217.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    165   3e-45   Eucalyptus grandis [rose gum]
ref|XP_010919415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    165   4e-45   Elaeis guineensis
dbj|BAK19923.1|  1-aminocyclopropane-1-carboxylate synthase             166   4e-45   Dianthus petraeus
ref|XP_007135134.1|  hypothetical protein PHAVU_010G103900g             165   4e-45   Phaseolus vulgaris [French bean]
ref|XP_004160953.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    165   4e-45   
ref|XP_010055081.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    165   4e-45   Eucalyptus grandis [rose gum]
ref|XP_008779569.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    165   5e-45   Phoenix dactylifera
ref|NP_001267589.1|  1-aminocyclopropane-1-carboxylate synthase-like    165   5e-45   Cucumis sativus [cucumbers]
gb|ACK43795.1|  1-aminocyclopropane-1-carboxylate synthase              165   5e-45   Momordica charantia [balsam pear]
dbj|BAK19927.1|  1-aminocyclopropane-1-carboxylate synthase             165   6e-45   Dianthus petraeus
gb|ABW03085.1|  1-aminocyclopropane 1-carboxylate synthase 4            164   6e-45   Prunus salicina [Japanese plum]
ref|XP_008452008.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    164   6e-45   Cucumis melo [Oriental melon]
dbj|BAA93713.1|  1-aminocyclopropane-1-carboxylate synthase             164   7e-45   Cucumis melo [Oriental melon]
dbj|BAB18464.1|  1-aminocyclopropane-1-carboxylate synthase             164   7e-45   Cucumis melo [Oriental melon]
gb|AAC83146.1|  1-aminocyclopropane-1-carboxylate synthase              164   7e-45   Nicotiana glutinosa
ref|XP_009624213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    164   8e-45   
ref|XP_002511916.1|  acc synthase, putative                             164   1e-44   Ricinus communis
gb|AFT92042.2|  1-aminocyclopropane-1-carboxylate synthase              164   1e-44   Paeonia lactiflora [common garden peony]
ref|XP_002276774.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    164   1e-44   Vitis vinifera
emb|CAN69483.1|  hypothetical protein VITISV_035777                     164   1e-44   Vitis vinifera
gb|AAB96658.1|  1-aminocyclopropane-1-carboxylate synthase              164   1e-44   Rumex palustris
gb|AAP14019.1|AF380836_1  putative ACC synthase 1                       164   1e-44   Lactuca sativa [cultivated lettuce]
dbj|BAK19924.1|  1-aminocyclopropane-1-carboxylate synthase             164   1e-44   Dianthus petraeus
ref|XP_011022618.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    163   2e-44   Populus euphratica
dbj|BAF33503.1|  ACC synthase                                           163   2e-44   Orobanche minor
ref|XP_009366577.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    155   2e-44   Pyrus x bretschneideri [bai li]
ref|NP_192867.1|  1-aminocyclopropane-1-carboxylate synthase 6          163   3e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KHN16788.1|  1-aminocyclopropane-1-carboxylate synthase              162   3e-44   Glycine soja [wild soybean]
ref|XP_003538294.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    162   3e-44   Glycine max [soybeans]
ref|NP_001236141.1|  1-aminocyclopropane-1-carboxylate synthase         162   3e-44   
gb|ABO76785.1|  1-aminocyclopropane-1-carboxylate synthase              162   3e-44   Citrullus colocynthis x Citrullus lanatus var. lanatus
gb|AER35096.1|  1-aminocyclopropane-1-carboxylate synthase              162   4e-44   Gossypium hirsutum [American cotton]
gb|AAL35745.1|  1-aminocyclopropanecarboxylic acid synthase             162   4e-44   Medicago truncatula
gb|KEH21137.1|  1-aminocyclopropane-1-carboxylate synthase              162   5e-44   Medicago truncatula
emb|CAA51227.1|  1-aminocyclopropane-1-carboxylate synthase             162   5e-44   Brassica juncea [brown mustard]
gb|KHG06607.1|  1-aminocyclopropane-1-carboxylate synthase              162   6e-44   Gossypium arboreum [tree cotton]
ref|XP_002872570.1|  1-aminocyclopropane-1-carboxylic acid (acc) ...    162   6e-44   Arabidopsis lyrata subsp. lyrata
gb|AAA33111.1|  1-aminocyclopropane-1-carboxylate synthase              162   6e-44   Cucurbita pepo
emb|CAN77934.1|  hypothetical protein VITISV_021265                     161   6e-44   Vitis vinifera
gb|ABM88785.1|  1-aminocyclopropane-1-carboxylate synthase              162   6e-44   Camellia sinensis [black tea]
sp|P23279.1|1A11_CUCPE  RecName: Full=1-aminocyclopropane-1-carbo...    162   6e-44   Cucurbita pepo
ref|XP_010455533.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    162   7e-44   Camelina sativa [gold-of-pleasure]
gb|KJB24304.1|  hypothetical protein B456_004G137900                    161   7e-44   Gossypium raimondii
ref|XP_006339629.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    161   8e-44   Solanum tuberosum [potatoes]
ref|XP_007160107.1|  hypothetical protein PHAVU_002G293000g             161   9e-44   Phaseolus vulgaris [French bean]
ref|XP_009108182.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    161   9e-44   Brassica rapa
ref|XP_006598931.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    161   9e-44   Glycine max [soybeans]
ref|NP_001236858.1|  1-aminocyclopropane-1-carboxylate synthase         161   1e-43   Glycine max [soybeans]
ref|XP_010669851.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    161   1e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010053215.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    160   1e-43   
gb|ACZ54911.3|  1-aminocyclopropane-1-carboxylic acid synthase          161   1e-43   Narcissus tazetta subsp. chinensis
ref|XP_010435116.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    161   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_008777259.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    152   2e-43   
gb|AAC49153.1|  1-aminocyclopropane 1-carboxylate synthase              160   2e-43   Pelargonium x hortorum [bedding geranium]
ref|XP_006396926.1|  hypothetical protein EUTSA_v10028605mg             161   2e-43   Eutrema salsugineum [saltwater cress]
ref|XP_004510689.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    160   2e-43   Cicer arietinum [garbanzo]
ref|XP_010053214.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    160   2e-43   Eucalyptus grandis [rose gum]
gb|KJB39618.1|  hypothetical protein B456_007G024400                    160   2e-43   Gossypium raimondii
sp|P23599.1|1A11_CUCMA  RecName: Full=1-aminocyclopropane-1-carbo...    160   2e-43   Cucurbita maxima [Boston marrow]
ref|XP_010053213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    160   2e-43   
gb|ABQ51839.1|  1-aminocyclopropane-1-carboxylate synthase              160   2e-43   Pelargonium x hortorum [bedding geranium]
ref|XP_006287590.1|  hypothetical protein CARUB_v10000800mg             160   2e-43   Capsella rubella
gb|KHG14845.1|  1-aminocyclopropane-1-carboxylate synthase              160   2e-43   Gossypium arboreum [tree cotton]
ref|XP_010556574.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    160   3e-43   Tarenaya hassleriana [spider flower]
emb|CDP10864.1|  unnamed protein product                                159   3e-43   Coffea canephora [robusta coffee]
gb|AJF36208.1|  1-aminocyclopropane-1-carboxylate synthase 1            160   3e-43   Trifolium repens [creeping white clover]
ref|XP_010544767.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    160   3e-43   Tarenaya hassleriana [spider flower]
ref|XP_010544766.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    160   3e-43   Tarenaya hassleriana [spider flower]
ref|XP_010422075.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    160   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010053212.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    160   3e-43   Eucalyptus grandis [rose gum]
gb|ABB70229.1|  1-aminocyclopropane-1-carboxylate synthase              159   4e-43   Glycine max [soybeans]
emb|CDY65356.1|  BnaC08g49010D                                          159   4e-43   Brassica napus [oilseed rape]
ref|XP_002878386.1|  predicted protein                                  159   4e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_006418427.1|  hypothetical protein EUTSA_v10007457mg             160   4e-43   Eutrema salsugineum [saltwater cress]
gb|ACX69843.1|  ACC synthase                                            159   5e-43   Rubus idaeus [European raspberry]
emb|CAA57724.1|  1-aminocyclopropane-1-carboxylate synthase             159   5e-43   Brassica oleracea
gb|AAQ14266.1|AF248735_1  1-aminocyclopropane-1-carboxylate synthase    159   5e-43   Momordica charantia [balsam pear]
gb|AAD22099.2|  1-aminocyclopropane-1-carboxylate synthase              159   6e-43   Musa acuminata AAA Group [Cavendish banana]
gb|EYU32170.1|  hypothetical protein MIMGU_mgv1a025862mg                159   6e-43   Erythranthe guttata [common monkey flower]
gb|KFK31896.1|  hypothetical protein AALP_AA6G173200                    159   6e-43   Arabis alpina [alpine rockcress]
emb|CDY13251.1|  BnaC09g24050D                                          159   6e-43   Brassica napus [oilseed rape]
ref|XP_007040349.1|  1-aminocyclopropane-1-carboxylate synthase i...    159   7e-43   
gb|KHM99945.1|  1-aminocyclopropane-1-carboxylate synthase              159   7e-43   Glycine soja [wild soybean]
ref|XP_009116817.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    159   7e-43   Brassica rapa
ref|XP_011023276.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    159   7e-43   Populus euphratica
emb|CDY11360.1|  BnaA09g39260D                                          159   7e-43   Brassica napus [oilseed rape]
ref|XP_010457119.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    159   9e-43   Camelina sativa [gold-of-pleasure]
gb|KDO76335.1|  hypothetical protein CISIN_1g011570mg                   159   9e-43   Citrus sinensis [apfelsine]
ref|XP_009119698.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    159   9e-43   Brassica rapa
ref|NP_001275831.1|  1-aminocyclopropane-1-carboxylate synthase-like    159   9e-43   Citrus sinensis [apfelsine]
emb|CAA77688.1|  1-aminocyclopropane 1-carboxylate synthase             158   1e-42   Vigna radiata var. radiata [golden gram]
ref|XP_010279043.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    158   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_003529924.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    159   1e-42   
ref|NP_191710.1|  1-aminocyclopropane-1-carboxylate synthase            158   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008362641.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    158   2e-42   
ref|XP_010040891.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    158   2e-42   Eucalyptus grandis [rose gum]
gb|AAA81580.1|  1-aminocyclopropane-1-carboxylate synthase              157   2e-42   Solanum lycopersicum
sp|P18485.2|1A12_SOLLC  RecName: Full=1-aminocyclopropane-1-carbo...    157   2e-42   Solanum lycopersicum
emb|CAA41856.1|  1-aminocyclopropane 1-carboxylate synthase             157   2e-42   Solanum lycopersicum
ref|NP_001234178.1|  1-aminocyclopropane-1-carboxylate synthase 2       157   2e-42   
ref|XP_008345341.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    158   2e-42   
ref|XP_008364813.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    158   2e-42   Malus domestica [apple tree]
gb|AEY82446.1|  1-aminocyclopropane-1-carboxylate synthase              157   2e-42   Momordica charantia [balsam pear]
ref|XP_010041705.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    156   3e-42   
ref|XP_009341128.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    149   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_006829176.1|  hypothetical protein AMTR_s00001p00270760          157   3e-42   
ref|XP_002892062.1|  1-amino-cyclopropane-1-carboxylate synthase 2      157   3e-42   Arabidopsis lyrata subsp. lyrata
gb|KFK42535.1|  hypothetical protein AALP_AA1G007100                    157   3e-42   Arabis alpina [alpine rockcress]
ref|XP_011092964.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    157   4e-42   Sesamum indicum [beniseed]
dbj|BAA84945.1|  ACC synthase                                           157   4e-42   Musa acuminata AAA Group [Cavendish banana]
ref|XP_006402473.1|  hypothetical protein EUTSA_v10005927mg             157   4e-42   Eutrema salsugineum [saltwater cress]
ref|XP_004503673.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    157   4e-42   
gb|ACV30003.1|  ACC synthase family protein                             157   5e-42   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010512497.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    157   5e-42   
gb|AAU09672.1|  ACC synthase                                            157   5e-42   Musa acuminata AAA Group [Cavendish banana]
gb|AAC31571.1|  1-aminocyclopropane-1-carboxylate synthase              157   5e-42   Musa acuminata AAA Group [Cavendish banana]
gb|ACV33064.1|  1-aminocyclopropane-1-carboxylate synthase              157   5e-42   Musa acuminata AAA Group [Cavendish banana]
ref|XP_006345579.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    157   5e-42   Solanum tuberosum [potatoes]
emb|CAE53271.1|  1-aminocyclopropane-1-carboxylate synthase             156   5e-42   Musa acuminata [banana]
gb|AAO91942.1|  1-aminocyclopropane-1-carboxylate synthase              156   5e-42   Musa acuminata AAA Group [Cavendish banana]
gb|AEM65195.1|  ACC synthase                                            155   6e-42   Garcinia mangostana [mangosteen]
ref|XP_009397633.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    156   6e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010469085.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    156   6e-42   Camelina sativa [gold-of-pleasure]
emb|CAD44267.2|  putative aminocyclopropane carboxylic acid synthase    156   6e-42   Musa AAB Group [French plantain]
emb|CAB76930.1|  ACC synthase                                           155   6e-42   Citrus sinensis [apfelsine]
emb|CDY15174.1|  BnaC05g00530D                                          156   6e-42   Brassica napus [oilseed rape]
gb|AAA97516.1|  1-aminocyclopropane-1-carboxylate synthase              156   7e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010474747.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    156   7e-42   Camelina sativa [gold-of-pleasure]
ref|NP_171655.1|  1-aminocyclopropane-1-carboxylate synthase 2          156   7e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KJB19084.1|  hypothetical protein B456_003G085900                    156   7e-42   Gossypium raimondii
gb|KCW44152.1|  hypothetical protein EUGRSUZ_L024351                    146   7e-42   Eucalyptus grandis [rose gum]
gb|AFO63004.1|  ACC synthase                                            156   9e-42   Hordeum vulgare [barley]
dbj|BAK19929.1|  1-aminocyclopropane-1-carboxylate synthase             156   9e-42   Dianthus petraeus
emb|CAJ34918.1|  1-aminocyclopropane-1-carboxylate synthase             156   9e-42   Carica papaya [mamon]
dbj|BAJ95898.1|  predicted protein                                      156   9e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAA33112.1|  1-aminocyclopropane-1-carboxylate synthase              156   1e-41   Cucurbita pepo
sp|Q00379.1|1A12_CUCPE  RecName: Full=1-aminocyclopropane-1-carbo...    156   1e-41   Cucurbita pepo
gb|ACD87813.1|  putative ACC synthase                                   156   1e-41   Vicia faba [broad bean]
gb|ABQ51840.1|  1-aminocyclopropane-1-carboxylate synthase              155   1e-41   Pelargonium x hortorum [bedding geranium]
emb|CAA75749.1|  1-aminocyclopropane-1-carboxylate synthase             155   1e-41   Musa acuminata AAA Group [Cavendish banana]
gb|KHG05668.1|  1-aminocyclopropane-1-carboxylate synthase              155   1e-41   Gossypium arboreum [tree cotton]
ref|XP_010413389.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    155   1e-41   Camelina sativa [gold-of-pleasure]
pdb|1IAX|A  Chain A, Crystal Structure Of Acc Synthase Complexed ...    154   1e-41   Solanum lycopersicum
ref|XP_009366562.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    155   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_009624194.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    155   2e-41   Nicotiana tomentosiformis
emb|CAA44397.1|  1-aminocyclopropane 1-carboxylate synthase             155   2e-41   Solanum lycopersicum
gb|KFK35337.1|  hypothetical protein AALP_AA5G271900                    155   2e-41   Arabis alpina [alpine rockcress]
gb|AAD28181.1|AF109927_1  1-aminocyclopropane-1-carboxylate synthase    155   2e-41   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010559100.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    155   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_010541198.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    155   3e-41   Tarenaya hassleriana [spider flower]
gb|KHG22476.1|  1-aminocyclopropane-1-carboxylate synthase              154   3e-41   Gossypium arboreum [tree cotton]
gb|ABJ99502.1|  1-aminocyclopropane-1-carboxylate synthase              154   3e-41   Gossypium hirsutum [American cotton]
gb|ABC75833.1|  1-aminocyclopropane-1-carboxylate synthase              154   3e-41   Gossypium hirsutum [American cotton]
gb|AAD04199.1|  1-aminocyclopropane-1-carboxylate synthase              154   3e-41   Pisum sativum [garden pea]
gb|AAL66200.1|AF386518_1  1-aminocyclopropane 1-carboxylate synth...    154   3e-41   
ref|XP_007139782.1|  hypothetical protein PHAVU_008G058400g             154   6e-41   
dbj|BAB47124.1|  ACC synthase                                           154   6e-41   
ref|XP_010480237.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    154   6e-41   
ref|NP_001233875.1|  1-aminocyclopropane 1-carboxylate synthase         153   7e-41   
ref|XP_004976571.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    153   7e-41   
dbj|BAA93712.1|  1-aminocyclopropane-1-carboxylate synthase             154   7e-41   
gb|ABA01475.2|  1-aminocyclopropane-1-carboxylate synthase              153   9e-41   
ref|NP_001234280.1|  1-aminocyclopropane-1-carboxylate synthase 4       153   9e-41   
gb|ABO76787.1|  1-aminocyclopropane-1-carboxylate synthase              153   9e-41   
gb|KJB52195.1|  hypothetical protein B456_008G250100                    153   9e-41   
dbj|BAF36561.1|  ACC synthase                                           152   1e-40   
ref|XP_002302608.2|  1-aminocyclopropane-1-carboxylate synthase f...    153   1e-40   
dbj|BAA33374.1|  ACC synthase                                           152   2e-40   
gb|KGN45694.1|  hypothetical protein Csa_6G006800                       152   2e-40   
dbj|BAA94600.1|  1-aminocyclopropane-1-carboxylate synthase             152   2e-40   
emb|CAH56693.1|  1-aminocyclopropane-1-carboxylate synthase             152   3e-40   
gb|ACM48506.3|  1-aminocyclopropane-carboxylate synthase                151   4e-40   
emb|CAH56694.1|  1-aminocyclopropane-1-carboxylate synthase             151   4e-40   
ref|XP_007040350.1|  1-aminocyclopropane-1-carboxylate synthase i...    150   5e-40   
ref|XP_008669001.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    150   7e-40   
ref|XP_010261352.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    150   1e-39   
dbj|BAA78333.1|  1-aminocyclopropane-1-carboxylic acid synthase         150   2e-39   
gb|EMS62632.1|  1-aminocyclopropane-1-carboxylate synthase              149   2e-39   
dbj|BAB89349.1|  1-aminocyclopropane-1-carboxylate synthase             149   2e-39   
gb|EMT04664.1|  1-aminocyclopropane-1-carboxylate synthase              149   2e-39   
ref|XP_004159772.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    149   2e-39   
ref|NP_001284464.1|  1-aminocyclopropane-1-carboxylate synthase 1       149   3e-39   
ref|XP_002448372.1|  hypothetical protein SORBIDRAFT_06g026160          149   3e-39   
gb|ACN31344.1|  unknown                                                 149   4e-39   
ref|XP_006292599.1|  hypothetical protein CARUB_v10018840mg             148   5e-39   
gb|AAC49154.1|  1-aminocyclopropane 1-carboxylate synthase              147   6e-39   
gb|AAA86471.1|  1-aminocyclopropane 1-carboxylate synthase              147   6e-39   
ref|XP_006652680.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    148   7e-39   
gb|AAR25559.1|  acc synthase                                            148   8e-39   
gb|AAA81581.1|  1-aminocyclopropane-1-carboxylate synthase              139   2e-38   
gb|ABM60749.1|  ACC synthase                                            147   3e-38   
ref|XP_006345624.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    146   3e-38   
gb|ABM60753.1|  truncated ACC synthase                                  145   4e-38   
ref|NP_001289261.1|  1-aminocyclopropane-1-carboxylate synthase 1       145   8e-38   
ref|NP_001146401.1|  1-aminocyclopropane-1-carboxylate synthase7        145   1e-37   
gb|ABM60750.1|  ACC synthase                                            144   2e-37   
gb|ADZ96243.1|  ACC synthase 1                                          144   2e-37   
gb|AAM21683.1|AF500120_1  1-aminocyclopropane-1-carboxylate synth...    144   2e-37   
gb|AAF88004.1|  contains similarity to aminocyclopropanecarboxyla...    137   5e-37   
ref|XP_003580370.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    142   1e-36   
ref|NP_001053637.1|  Os04g0578000                                       142   1e-36   
gb|EAZ31725.1|  hypothetical protein OsJ_15874                          142   1e-36   
emb|CAH66732.1|  H0404F02.8                                             142   1e-36   
gb|AAB18416.1|  ACC synthase                                            141   2e-36   
ref|XP_011069496.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    134   2e-36   
gb|AAG12246.1|AF184077_1  ACC synthase                                  140   3e-36   
gb|AAC63850.1|  ACC synthase                                            139   1e-35   
ref|XP_011091525.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    135   2e-34   
gb|AAA86470.1|  1-aminocyclopropane 1-carboxylate synthase              132   2e-33   
gb|AAK54497.1|  ACC synthase                                            124   2e-33   
emb|CAL50573.1|  putative 1-aminocyclopropane-1-carboxylate synth...    125   4e-33   
gb|AAC49922.1|  ACC synthase                                            130   1e-32   
emb|CAA47174.1|  1-aminocyclopropane 1-carboxylate synthase             129   3e-32   
gb|ABM60747.1|  ACC synthase                                            128   1e-31   
gb|AAL35386.1|  ACC synthase                                            126   2e-31   
ref|XP_010547570.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    127   2e-31   
gb|AAK38751.1|  1-aminocyclopropane 1-carboxylate synthase              118   3e-31   
gb|AGP76383.1|  1-aminocyclopropane-1-carboxylate synthase 1            120   3e-31   
ref|XP_010426493.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    126   5e-31   
ref|XP_009150670.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    125   1e-30   
ref|NP_190539.1|  1-aminocyclopropane-1-carboxylate synthase 9          125   1e-30   
ref|XP_002866689.1|  hypothetical protein ARALYDRAFT_332796             125   1e-30   
ref|XP_006293030.1|  hypothetical protein CARUB_v10019310mg             125   1e-30   
ref|XP_006404112.1|  hypothetical protein EUTSA_v10011085mg             124   2e-30   
ref|XP_010518692.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    124   2e-30   
gb|AAC41663.1|  1-aminocyclopropane-1-carboxylate synthase              124   2e-30   
gb|AGP76381.1|  1-aminocyclopropane-1-carboxylate synthase 1            118   2e-30   
ref|XP_010484425.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    124   2e-30   
ref|XP_002877694.1|  hypothetical protein ARALYDRAFT_348080             124   2e-30   
ref|XP_010444599.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    124   2e-30   
ref|XP_011017064.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    121   2e-30   
gb|AGP76382.1|  1-aminocyclopropane-1-carboxylate synthase 1            118   3e-30   
ref|XP_002463950.1|  hypothetical protein SORBIDRAFT_01g009450          124   3e-30   
emb|CDY23035.1|  BnaC07g31520D                                          124   3e-30   
ref|XP_009136516.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    124   3e-30   
ref|XP_010503635.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    124   3e-30   
ref|NP_201381.1|  1-aminocyclopropane-1-carboxylate synthase 5          124   3e-30   
ref|XP_009149709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    124   3e-30   
emb|CDY08163.1|  BnaA06g15630D                                          124   3e-30   
ref|XP_006280412.1|  hypothetical protein CARUB_v10026345mg             124   3e-30   
gb|KFK28459.1|  hypothetical protein AALP_AA8G517100                    124   4e-30   
ref|XP_006393985.1|  hypothetical protein EUTSA_v10004145mg             123   4e-30   
gb|AGP76375.1|  1-aminocyclopropane-1-carboxylate synthase 1            117   4e-30   
gb|AGP76371.1|  1-aminocyclopropane-1-carboxylate synthase 1            117   5e-30   
gb|AGP76374.1|  1-aminocyclopropane-1-carboxylate synthase 1            117   5e-30   
ref|XP_009130528.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    123   5e-30   
emb|CDY05953.1|  BnaC08g21300D                                          123   5e-30   
ref|XP_010915315.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    122   9e-30   
gb|AGP76380.1|  1-aminocyclopropane-1-carboxylate synthase 1            116   1e-29   
ref|XP_011017063.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    121   2e-29   
ref|XP_010515330.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    121   2e-29   
ref|XP_010679692.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    121   2e-29   
gb|AFO63003.1|  ACC synthase                                            121   2e-29   
gb|AAA33887.1|  1-aminocyclopropane-1-carboxylate synthase              121   2e-29   
gb|AAA33888.1|  1-aminocyclopropane-1-carboxylate synthase              121   2e-29   
ref|NP_001051142.1|  Os03g0727600                                       121   2e-29   
emb|CDX81296.1|  BnaC09g07070D                                          121   3e-29   
gb|EYU36404.1|  hypothetical protein MIMGU_mgv1a020853mg                120   3e-29   
sp|Q00257.1|1A12_CUCMA  RecName: Full=1-aminocyclopropane-1-carbo...    121   3e-29   
ref|XP_004503531.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   4e-29   
gb|KJB18074.1|  hypothetical protein B456_003G033000                    120   5e-29   
emb|CDY72652.1|  BnaCnng78650D                                          116   5e-29   
ref|XP_009778720.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   8e-29   
ref|XP_009771829.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   8e-29   
ref|XP_010050459.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   9e-29   
ref|XP_009629400.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   9e-29   
ref|XP_004981903.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   1e-28   
emb|CDP02644.1|  unnamed protein product                                119   1e-28   
ref|XP_009112200.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   1e-28   
ref|XP_003560343.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   1e-28   
emb|CDY18674.1|  BnaA09g07210D                                          119   1e-28   
gb|AAV44081.1|  putative 1-aminocyclopropane-1-carboxylate synthase     119   1e-28   
pdb|1M7Y|A  Chain A, Crystal Structure Of Apple Acc Synthase In C...    119   2e-28   
gb|AAD53173.1|  1-aminocyclopropane-1-carboxylic acid synthase ACS1     118   2e-28   
gb|EEE54037.1|  hypothetical protein OsJ_00716                          117   2e-28   
gb|EEE59855.1|  hypothetical protein OsJ_12432                          116   2e-28   
dbj|BAA35057.1|  1-aminocyclopropane-1-carboxylate synthase             119   2e-28   
ref|NP_001289205.1|  1-aminocyclopropane-1-carboxylate synthase         119   2e-28   
ref|XP_009589682.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   2e-28   
pdb|1B8G|A  Chain A, 1-aminocyclopropane-1-carboxylate Synthase         118   2e-28   
gb|AAA53297.1|  1-aminocyclopropane 1-carboxylate synthase              111   2e-28   
sp|P37821.2|1A1C_MALDO  RecName: Full=1-aminocyclopropane-1-carbo...    118   2e-28   
ref|XP_006650530.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    119   2e-28   
dbj|BAF44094.1|  1-aminocyclopropane-1-carboxylate synthase             118   2e-28   
ref|XP_008342238.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    118   3e-28   
dbj|BAA76389.1|  1-aminocyclopropane-1-carboxylic acid synthase         118   3e-28   
gb|EMT19835.1|  1-aminocyclopropane-1-carboxylate synthase 1            118   3e-28   
ref|XP_004288284.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   3e-28   
ref|XP_009395244.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    120   3e-28   
ref|NP_001137094.1|  uncharacterized protein LOC100217270               118   3e-28   
ref|XP_009362620.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   3e-28   
emb|CDY66472.1|  BnaC03g76570D                                          117   3e-28   
gb|ACN25592.1|  unknown                                                 118   3e-28   
gb|AAF22112.1|AF119414_1  1-aminocyclopropane-1-carboxylate synth...    118   3e-28   
ref|XP_004502555.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    118   4e-28   
ref|XP_010536854.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   4e-28   
ref|XP_009393981.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   4e-28   
gb|EAY97524.1|  hypothetical protein OsI_19452                          118   4e-28   
dbj|BAB47123.1|  ACC synthase                                           117   4e-28   
emb|CAA60591.1|  1-aminocyclopropane-1-carboxylate synthase             117   5e-28   
ref|XP_009142057.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   5e-28   
ref|XP_009389451.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   5e-28   
ref|XP_009630061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   5e-28   
gb|AAR38501.1|  1-aminocyclopropane-1-carboxylate synthase 1b           117   5e-28   
gb|AAQ13435.1|  1-aminocyclopropane-1-carboxylate synthase              117   6e-28   
gb|ABA03056.1|  ACC synthase                                            117   6e-28   
ref|XP_011031331.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   6e-28   
ref|XP_006413217.1|  hypothetical protein EUTSA_v10027427mg             117   6e-28   
ref|NP_001284463.1|  1-aminocyclopropane-1-carboxylate synthase C...    117   6e-28   
ref|XP_003620879.1|  1-aminocyclopropane-1-carboxylate synthase         117   6e-28   
emb|CDX92755.1|  BnaC07g40130D                                          117   7e-28   
ref|XP_010273757.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   7e-28   
ref|XP_009109390.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   8e-28   
ref|XP_002514161.1|  acc synthase, putative                             117   8e-28   
ref|XP_002869623.1|  1-amino-cyclopropane-1-carboxylate synthase 7      117   8e-28   
emb|CDY71142.1|  BnaCnng71530D                                          117   8e-28   
ref|XP_006837379.1|  hypothetical protein AMTR_s00111p00124560          117   8e-28   
gb|AAD41083.1|AF151961_1  1-aminocyclopropane-1-carboxylic acid s...    117   9e-28   
ref|XP_010438788.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   9e-28   
ref|XP_006285008.1|  hypothetical protein CARUB_v10006315mg             117   9e-28   
gb|AFV50548.1|  1-aminocyclopropane-1-carboxylate synthase              114   9e-28   
dbj|BAE94691.1|  1-aminocyclopropane-1-carboxylic acid synthase 3b      117   9e-28   
dbj|BAA33376.1|  ACC synthase                                           117   9e-28   
gb|AAA78274.1|  1-aminocyclopropane-1-carboxylic acid synthase          117   9e-28   
ref|XP_008387653.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   9e-28   
ref|NP_194350.1|  1-aminocyclopropane-1-carboxylate synthase 7          117   9e-28   
ref|NP_001042279.1|  Os01g0192900                                       117   9e-28   
gb|EAY72868.1|  hypothetical protein OsI_00740                          117   9e-28   
ref|XP_006363796.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   9e-28   
ref|XP_010448309.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-27   
ref|XP_004143413.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-27   
ref|XP_010446626.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    117   1e-27   
gb|EEE63240.1|  hypothetical protein OsJ_18050                          116   1e-27   
gb|AFI49625.1|  1-aminocyclopropane-1- carboxylate synthase             117   1e-27   
emb|CDX89355.1|  BnaA01g15380D                                          116   1e-27   
emb|CDX94359.1|  BnaC01g18250D                                          116   1e-27   
gb|AGG19162.1|  ACC synthase                                            116   1e-27   
emb|CAA81748.1|  1-aminocyclopropane-1-carboxylate synthase             116   1e-27   
ref|XP_010433537.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    116   1e-27   
gb|KFK32789.1|  hypothetical protein AALP_AA6G288500                    116   1e-27   
gb|AFV50549.1|  1-aminocyclopropane-1-carboxylate synthase              114   1e-27   
ref|XP_004513132.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    116   1e-27   
gb|AJF36209.1|  1-aminocyclopropane-1-carboxylate synthase 2            116   1e-27   
ref|XP_006362080.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    116   2e-27   
ref|XP_006411853.1|  hypothetical protein EUTSA_v10027155mg             116   2e-27   
ref|XP_006404746.1|  hypothetical protein EUTSA_v10000582mg             116   2e-27   
dbj|BAB89348.1|  1-aminocyclopropane-1-carboxylate synthase             116   2e-27   
ref|XP_009339376.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    116   2e-27   
ref|XP_002868965.1|  1-amino-cyclopropane-1-carboxylate synthase 8      116   2e-27   
gb|AGE15420.1|  1-aminocyclopropane-1-carboxylate synthase              116   2e-27   
emb|CAA65647.1|  1-aminocyclopropane-1-carboxylate synthase             115   2e-27   
gb|KEH35860.1|  1-aminocyclopropane-1-carboxylate synthase              116   2e-27   
gb|KFK30387.1|  hypothetical protein AALP_AA7G254400                    115   2e-27   
emb|CAA65776.1|  1-aminocyclopropane-1-carboxylic acid synthase         115   2e-27   
ref|XP_009140397.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   2e-27   
emb|CDY25639.1|  BnaA04g13310D                                          115   2e-27   
ref|XP_006853996.1|  hypothetical protein AMTR_s00036p00235090          115   3e-27   
ref|XP_007201928.1|  hypothetical protein PRUPE_ppa022214mg             115   3e-27   
gb|KDP33744.1|  hypothetical protein JCGZ_07315                         115   3e-27   
ref|XP_009133375.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   3e-27   
ref|XP_004509049.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   3e-27   
ref|XP_008445556.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   3e-27   
emb|CDX75675.1|  BnaA01g00270D                                          115   3e-27   
gb|KEH31540.1|  1-aminocyclopropane-1-carboxylate synthase              115   3e-27   
ref|XP_009137583.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   4e-27   
gb|KJB40313.1|  hypothetical protein B456_007G057000                    115   4e-27   
ref|XP_002310878.1|  1-aminocyclopropane-1-carboxylic acid syntha...    115   4e-27   
gb|EYU41365.1|  hypothetical protein MIMGU_mgv1a025183mg                115   4e-27   
ref|XP_009789938.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   4e-27   
ref|XP_006282592.1|  hypothetical protein CARUB_v10004734mg             115   5e-27   
gb|AFV50545.1|  1-aminocyclopropane-1-carboxylate synthase              112   5e-27   
ref|XP_004137286.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   5e-27   
ref|XP_006364400.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   5e-27   
ref|XP_004292781.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    115   5e-27   
gb|EYU44527.1|  hypothetical protein MIMGU_mgv1a019082mg                115   5e-27   



>gb|ABB40579.2| 1-aminocyclopropane-1-carboxylate synthase [Ipomoea nil]
Length=488

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 105/109 (96%), Gaps = 1/109 (1%)
 Frame = +2

Query  164  MDLKTMKH-TEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLC  340
            MDLK+M+  T++LSKIATN+GHGENSAYFDGWKAYDN+PFHPKHNPQGVIQMGLAENQLC
Sbjct  1    MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  60

Query  341  FDLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            FDLIK WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFR AVARFME
Sbjct  61   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFME  109



>ref|XP_009590053.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            ++  ++LSKIATN+GHGENSAYFDGWKAY+NDPFH  +NP GVIQMGLAENQLCFDLI++
Sbjct  8    VQKQQLLSKIATNDGHGENSAYFDGWKAYENDPFHLSNNPNGVIQMGLAENQLCFDLIQE  67

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            WV+NNPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFME
Sbjct  68   WVVNNPKASICTTEGAEDFKDIAIFQDYHGLPEFRQAVARFME  110



>gb|AAR99393.1| ACC synthase ACS3b [Nicotiana attenuata]
Length=485

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+GHGENSAYFDGWKAY+NDPFH  +NP GVIQMGLAENQLCFDLI++WV+N
Sbjct  12   QLLSKIATNDGHGENSAYFDGWKAYENDPFHLSNNPNGVIQMGLAENQLCFDLIQEWVVN  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFME
Sbjct  72   NPKASICTTEGAEDFKDIAIFQDYHGLPEFRQAVARFME  110



>ref|XP_009771943.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=484

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+GHGENSAYFDGWKAY+NDPFH  +NP GVIQMGLAENQLCFDLI++WV+N
Sbjct  11   QLLSKIATNDGHGENSAYFDGWKAYENDPFHLSNNPNGVIQMGLAENQLCFDLIQEWVVN  70

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFME
Sbjct  71   NPKASICTTEGAEDFKDIAIFQDYHGLPEFRQAVARFME  109



>emb|CAA06288.1| 1-cyclopropane-1-carboxylate synthase [Nicotiana tabacum]
 emb|CAB65314.1| 1-aminocyclopropane-1-carboxylate synthase [Nicotiana tabacum]
 gb|ABW97849.1| ACS2 [Nicotiana tabacum]
Length=484

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            ++  ++LSKIATN+GHGENSAYFDGWKAY+NDPFH  +NP GVIQMGLAENQLCFDLI++
Sbjct  8    VQKQQLLSKIATNDGHGENSAYFDGWKAYENDPFHLSNNPNGVIQMGLAENQLCFDLIQE  67

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            WV+NNPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFME
Sbjct  68   WVVNNPKASICTTEGAEDFKDIAIFQDYHGLPEFRQAVARFME  110



>ref|XP_009590054.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            ++  ++LSKIATN+GHGENSAYFDGWKAY+NDPFH  +NP GVIQMGLAENQLCFDLI++
Sbjct  8    VQKQQLLSKIATNDGHGENSAYFDGWKAYENDPFHLSNNPNGVIQMGLAENQLCFDLIQE  67

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            WV+NNPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFME
Sbjct  68   WVVNNPKASICTTEGAEDFKDIAIFQDYHGLPEFRQAVARFME  110



>gb|AAR99392.1| ACC synthase ACS3a [Nicotiana attenuata]
Length=484

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            ++  ++LSKIATN+GHGENSAYFDGWKAY+NDPFH  +NP GVIQMGLAENQLCFDLI++
Sbjct  8    VQKQQLLSKIATNDGHGENSAYFDGWKAYENDPFHLTNNPNGVIQMGLAENQLCFDLIQE  67

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            WV+NNPKASICT +GAE+F+DIAI+QDYHGLPEFR AVARFME
Sbjct  68   WVVNNPKASICTTEGAEDFRDIAIFQDYHGLPEFRQAVARFME  110



>ref|XP_009757887.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=483

 Score =   186 bits (471),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            E+LSK+ATN+GHGENSAYFDGWKAY+ DPFHP  N  GVIQMGLAENQLCFDLI++WV+N
Sbjct  10   ELLSKVATNDGHGENSAYFDGWKAYEIDPFHPTQNSDGVIQMGLAENQLCFDLIQEWVVN  69

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NPKASICT +G+E+FKDIAIYQDYHGLPEFR AVARFME
Sbjct  70   NPKASICTGEGSEDFKDIAIYQDYHGLPEFRIAVARFME  108



>gb|AAC83147.1| 1-aminocyclopropane-1-carboxylate synthase [Nicotiana glutinosa]
Length=484

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+GHGENSAYFDGWKAY+NDPFH  +NP GVIQMGLAENQLCFDLI++WV+N
Sbjct  12   QLLSKIATNDGHGENSAYFDGWKAYENDPFHLINNPNGVIQMGLAENQLCFDLIQEWVVN  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NPKASICT +GAE FKDIAI+QDYHGLPEFR AVARFME
Sbjct  72   NPKASICTIEGAENFKDIAIFQDYHGLPEFRQAVARFME  110



>ref|NP_001275367.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum tuberosum]
 dbj|BAB16433.1| ACC synthase [Solanum tuberosum]
Length=486

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+GHGENSAYFDGWKAY+NDPFHP  NP GVIQMGLAENQLCFDLI++W++N
Sbjct  11   KLLSKIATNDGHGENSAYFDGWKAYENDPFHPTQNPHGVIQMGLAENQLCFDLIQEWIVN  70

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NPKASICT +G ++F+DIAI+QDYHGLPEFR AVARFME
Sbjct  71   NPKASICTYEGVQDFQDIAIFQDYHGLPEFRKAVARFME  109



>ref|XP_009776307.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=484

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            ++  ++LSKIATN+GHGENSAYFDGWKAY+ DPFH  +NP GVIQMGLAENQLCFDLI++
Sbjct  8    VQKQQLLSKIATNDGHGENSAYFDGWKAYEIDPFHLTNNPNGVIQMGLAENQLCFDLIQE  67

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            WV+NNPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFME
Sbjct  68   WVVNNPKASICTIEGAEDFKDIAIFQDYHGLPEFRQAVARFME  110



>gb|AAR99391.1| ACC synthase ACS2 [Nicotiana attenuata]
Length=483

 Score =   183 bits (465),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            E+LSK+ATNNGHGENSAYFDGWKAY+ DPFH   N  GVIQMGLAENQLCFDLI++WV+N
Sbjct  10   ELLSKVATNNGHGENSAYFDGWKAYEIDPFHLTQNFDGVIQMGLAENQLCFDLIQEWVVN  69

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NPKASICT +G+E+FKDIAIYQDYHGLPEFR AVARFME
Sbjct  70   NPKASICTAEGSEDFKDIAIYQDYHGLPEFRSAVARFME  108



>ref|XP_006360739.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
tuberosum]
Length=485

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  HTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWV  364
            + E+LSK+ATNNGHGENSAYFDGWKAY+ DPFHP  NP GVIQMGLAENQLCFDLI++WV
Sbjct  8    NNELLSKVATNNGHGENSAYFDGWKAYEIDPFHPTQNPNGVIQMGLAENQLCFDLIQEWV  67

Query  365  LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            +NN K+SICT  G EEFK+IAIYQDYHGLPEFR AVARFME
Sbjct  68   VNNQKSSICTAGGCEEFKEIAIYQDYHGLPEFRRAVARFME  108



>emb|CAA67118.1| ACC synthase [Nicotiana tabacum]
Length=483

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            E+LSK+ATNNGHGENSAYFDGWKAY+ DPFHP  N  GVIQMGLAENQLCFDLI++WV+ 
Sbjct  10   ELLSKVATNNGHGENSAYFDGWKAYEIDPFHPTQNSDGVIQMGLAENQLCFDLIQEWVVK  69

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPKASICT +G+++FKDIAIYQDYHGLPEFR AVARFM
Sbjct  70   NPKASICTAEGSQDFKDIAIYQDYHGLPEFRSAVARFM  107



>ref|XP_011080907.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Sesamum 
indicum]
Length=485

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  TMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIK  355
            TM   ++LS+IATN+GHGENSA+FDGWKAYD+DP+HP  NP GVIQMGLAENQL FDL++
Sbjct  2    TMNQVQLLSQIATNDGHGENSAFFDGWKAYDSDPYHPTRNPSGVIQMGLAENQLSFDLVQ  61

Query  356  KWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            +WV NNPKASICT +G+  FKDIAIYQDYHGLPEFR AVARFME
Sbjct  62   EWVRNNPKASICTAEGSNGFKDIAIYQDYHGLPEFRNAVARFME  105



>ref|XP_009626021.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=483

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            E+LSK+ATNNGHGENSAYFDGWKAY+ DPFHP  N  GVIQMGLAENQLCFDLI++WV+ 
Sbjct  10   ELLSKVATNNGHGENSAYFDGWKAYEIDPFHPTQNSDGVIQMGLAENQLCFDLIQEWVVK  69

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPKASICT +G+++FKDIAIYQDYHGLPEFR AVARFM
Sbjct  70   NPKASICTAEGSQDFKDIAIYQDYHGLPEFRSAVARFM  107



>gb|ABW97851.1| ACS5 [Nicotiana tabacum]
Length=474

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            E+LSK+ATNNGHGENSAYFDGWKAY+ DPFHP  N  GVIQMGLAENQLCFDLI++WV+ 
Sbjct  1    ELLSKVATNNGHGENSAYFDGWKAYEIDPFHPTQNSDGVIQMGLAENQLCFDLIQEWVVK  60

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPKASICT +G+++FKDIAIYQDYHGLPEFR AVARFM
Sbjct  61   NPKASICTAEGSQDFKDIAIYQDYHGLPEFRSAVARFM  98



>dbj|BAG30909.1| ACC synthase [Capsicum chinense]
Length=485

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+GHGENSAYFDGWKAY NDPFH   NP GVIQMGLAENQLCFDLI++WV+N
Sbjct  12   QLLSKIATNDGHGENSAYFDGWKAYANDPFHLTDNPNGVIQMGLAENQLCFDLIQEWVVN  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NPKASICT +GAE+F++IAI+QDYHGLPEFR AVARFME
Sbjct  72   NPKASICTAEGAEDFQEIAIFQDYHGLPEFRQAVARFME  110



>dbj|BAA25916.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            ++SKIATN+GHGENSAYFDGWKAY+NDPFHP  NP GVIQMGLAENQLCFDLI++W++NN
Sbjct  3    LISKIATNDGHGENSAYFDGWKAYENDPFHPTQNPNGVIQMGLAENQLCFDLIQEWIVNN  62

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            PKASICT +G ++F+D AI+QDYHGLPEFR AVARFME
Sbjct  63   PKASICTYEGVQDFQDTAIFQDYHGLPEFRKAVARFME  100



>ref|NP_001234164.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
 gb|AAK72433.1|AF179249_1 1-aminocyclopropane-1-carboxylate synthase 6 [Solanum lycopersicum]
 gb|AAQ17610.1|AF167428_1 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            ++SKIATN+GHGENSAYFDGWKAY+NDPFHP  NP GVIQMGLAENQLCFDLI++W++NN
Sbjct  3    LISKIATNDGHGENSAYFDGWKAYENDPFHPTQNPNGVIQMGLAENQLCFDLIQEWIVNN  62

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            PKASICT +G ++F+D AI+QDYHGLPEFR AVARFME
Sbjct  63   PKASICTYEGVQDFQDTAIFQDYHGLPEFRKAVARFME  100



>dbj|BAA34923.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            ++SKIATN+GHGENSAYFDGWKAY+NDPFHP  NP GVIQMGLAENQLCFDLI++W++NN
Sbjct  3    LISKIATNDGHGENSAYFDGWKAYENDPFHPTQNPNGVIQMGLAENQLCFDLIQEWIVNN  62

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            PKASICT +G ++F+D AI+QDYHGLPEFR AVARFME
Sbjct  63   PKASICTYEGVQDFQDTAIFQDYHGLPEFRKAVARFME  100



>ref|NP_001266271.1| 1-aminocyclopropane-1-carboxylate synthase-like [Solanum lycopersicum]
 gb|AAB17279.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=483

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K  +  ++LSKIATN+GHGENS YFDGWKAY N+PFHP  NP GVIQMGLAENQLCFDLI
Sbjct  6    KNNQKQQLLSKIATNDGHGENSPYFDGWKAYANNPFHPTDNPTGVIQMGLAENQLCFDLI  65

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            ++W++NNPKASICT +GAE F+DIAI+QDYHGLPEFR AVARFME
Sbjct  66   QEWMVNNPKASICTVEGAENFQDIAIFQDYHGLPEFRQAVARFME  110



>ref|XP_009791163.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=486

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIAT++GHGENSAYFDGWKAY+NDPFH   NP GVIQMGLAENQLCFDLI++WV+N
Sbjct  9    KLLSKIATSDGHGENSAYFDGWKAYENDPFHLIKNPNGVIQMGLAENQLCFDLIQEWVVN  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NPKASICT +GA++FKDIAI+QDYHGLPEFR AV+RFME
Sbjct  69   NPKASICTAEGAQDFKDIAIFQDYHGLPEFRKAVSRFME  107



>ref|XP_006343931.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
tuberosum]
Length=484

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+GHGENS YFDGWKAY NDPFH   NP GVIQMGLAENQLCFDLI++WV+N
Sbjct  13   QLLSKIATNDGHGENSPYFDGWKAYANDPFHLTDNPNGVIQMGLAENQLCFDLIQEWVVN  72

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NPKASICT +GAE F+DIAI+QDYHGLPEFR AVARFME
Sbjct  73   NPKASICTAEGAENFQDIAIFQDYHGLPEFRQAVARFME  111



>ref|XP_009626433.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=486

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIAT++GHGENSAYFDGWKAY+NDPFH   NP GVIQMGLAENQLCFDLI++WV+N
Sbjct  9    KLLSKIATSDGHGENSAYFDGWKAYENDPFHLTQNPNGVIQMGLAENQLCFDLIQEWVVN  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP ASICT +GA++FKDIAI+QDYHGLPEFR AV+RFME
Sbjct  69   NPNASICTAEGAQDFKDIAIFQDYHGLPEFRKAVSRFME  107



>ref|XP_010089045.1| 1-aminocyclopropane-1-carboxylate synthase [Morus notabilis]
 gb|EXB37292.1| 1-aminocyclopropane-1-carboxylate synthase [Morus notabilis]
Length=486

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  TMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIK  355
            T+   ++LSKIAT +GHGENS YFDGWKAYDNDPFHP +N  GVIQMGLAENQLCFDL++
Sbjct  4    TVSSKQLLSKIATGDGHGENSPYFDGWKAYDNDPFHPTNNSNGVIQMGLAENQLCFDLVQ  63

Query  356  KWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             W+L+NP+ASICTP+G +EF+DIAI+QDYHGLPEFR AVA+FM
Sbjct  64   DWILDNPRASICTPEGVDEFRDIAIFQDYHGLPEFREAVAKFM  106



>emb|CDP12072.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  182  KHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKW  361
            +  ++LSK+ATN+GHGENS YFDGWKAYD+DP+HP  NP GVIQMGLAENQLCFDLI++W
Sbjct  8    EQQQLLSKMATNDGHGENSPYFDGWKAYDSDPYHPTRNPNGVIQMGLAENQLCFDLIEEW  67

Query  362  VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            VLNNP+ASICT +GA +F ++AIYQDYHGLPEFR AVARFME
Sbjct  68   VLNNPEASICTAEGANKFMEVAIYQDYHGLPEFRNAVARFME  109



>ref|XP_011073274.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Sesamum 
indicum]
Length=481

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            MD        +LSKIATN+GHGENSAYFDGWKAYD DP+HP  NP GVIQMGLAENQL F
Sbjct  1    MDHMLRNEENLLSKIATNDGHGENSAYFDGWKAYDADPYHPTKNPNGVIQMGLAENQLAF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL+++WV NNPKASICT +G ++FKDIAIYQDYHGLPEFR AVARFM
Sbjct  61   DLVQEWVRNNPKASICTAEGVDDFKDIAIYQDYHGLPEFRNAVARFM  107



>gb|AAF97614.1|U18056_1 1-amino-cyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K  +  ++LSKIATN+GHGENS YFDGWKAY N+PFH   NP GVIQMGLAENQLCFDLI
Sbjct  6    KNNQKQQLLSKIATNDGHGENSPYFDGWKAYANNPFHLTDNPTGVIQMGLAENQLCFDLI  65

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            ++WV+NNPKASICT +GAE F+DIAI+QDYHGLPEFR AVARFME
Sbjct  66   QEWVVNNPKASICTVEGAENFQDIAIFQDYHGLPEFRQAVARFME  110



>ref|NP_001233922.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
 gb|AAB17278.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K  +  ++LSKIATN+GHGENS YFDGWKAY N+PFH   NP GVIQMGLAENQLCFDLI
Sbjct  6    KNNQKQQLLSKIATNDGHGENSPYFDGWKAYANNPFHLTDNPTGVIQMGLAENQLCFDLI  65

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            ++WV+NNPKASICT +GAE F+DIAI+QDYHGLPEFR AVARFME
Sbjct  66   QEWVVNNPKASICTVEGAENFQDIAIFQDYHGLPEFRQAVARFME  110



>ref|XP_006343930.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
tuberosum]
Length=485

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+GHGENS YFDGWKAY NDPFH   NP GVIQMGLAENQLCFDLI++WV+N
Sbjct  12   QLLSKIATNDGHGENSPYFDGWKAYANDPFHLTDNPNGVIQMGLAENQLCFDLIQEWVVN  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NPKASICT +GAE F+DIAI+QDYHGLPEFR AVA+FME
Sbjct  72   NPKASICTVEGAENFQDIAIFQDYHGLPEFRQAVAKFME  110



>gb|ACT54524.2| 1-aminocyclopropane-1-carboxylate synthase [Eriobotrya japonica]
 gb|ACZ63266.1| 1-aminocyclopropane-1-carboxylate synthase [Eriobotrya japonica]
Length=487

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSKIAT NGHGENS YFDGWKAYD+DPFHP  NP GVIQMGLAENQ+CF
Sbjct  1    MGFTLSNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENQMCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+LNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  61   DLIQEWILNNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFM  107



>ref|NP_001280870.1| 1-aminocyclopropane-1-carboxylate synthase [Malus domestica]
 dbj|BAA92351.1| 1-aminocyclopropane-1-carboxylate synthase [Malus domestica]
Length=487

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSKIAT NGHGENS YFDGWKAYD+DPFHP  NP GVIQMGLAENQ+CF
Sbjct  1    MGFTLSNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENQMCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+LNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  61   DLIQEWILNNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFM  107



>ref|XP_009343873.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Pyrus 
x bretschneideri]
Length=487

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSKIAT NGHGENS YFDGWKAYD+DPFHP  NP GVIQMGLAENQ+CF
Sbjct  1    MGFTLSNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENQMCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+LNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  61   DLIQEWILNNPEASICTEAGVNEFKDIAIFQDYHGLPEFRNAVANFM  107



>ref|XP_009363394.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Pyrus 
x bretschneideri]
Length=487

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSKIAT NGHGENS YFDGWKAYD+DPFHP  NP GVIQMGLAENQ+CF
Sbjct  1    MGFTLSNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENQMCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+LNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  61   DLIQEWILNNPEASICTEAGVNEFKDIAIFQDYHGLPEFRNAVANFM  107



>gb|AFM93771.1| ACC synthetase [Boehmeria nivea]
Length=489

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M +K ++  ++LSKIAT NGHGENS YFDGWKAYD+DPFH  +NP GVIQMGLAENQL F
Sbjct  1    MGIKRIQQKQLLSKIATGNGHGENSPYFDGWKAYDSDPFHSANNPNGVIQMGLAENQLSF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DL+K W+L NP+ASICTP+G  EF+ IA+YQDYHGLPEFR A+A+FME
Sbjct  61   DLVKDWILKNPEASICTPEGVNEFRGIALYQDYHGLPEFREAIAKFME  108



>gb|AAF97615.1|U18057_1 1-amino-cyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=483

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K  +  ++LSKIATN+GHGENS YFDGWKAY N+PFH   NP GVIQMGLAENQLCFDLI
Sbjct  6    KNNQKQQLLSKIATNDGHGENSPYFDGWKAYANNPFHLTDNPTGVIQMGLAENQLCFDLI  65

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            ++W++NNPKASICT +GAE F+DIAI+QDYHGLPEFR AVARFME
Sbjct  66   QEWMVNNPKASICTVEGAENFQDIAIFQDYHGLPEFRQAVARFME  110



>gb|EYU23426.1| hypothetical protein MIMGU_mgv1a010964mg [Erythranthe guttata]
Length=296

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 2/103 (2%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            M++T  LSKIATN+GHGENSA+FDGWKAYD+DP+HP  NP GVIQMGLAENQL FDL+++
Sbjct  1    MEYT--LSKIATNDGHGENSAFFDGWKAYDSDPYHPTKNPNGVIQMGLAENQLSFDLVQE  58

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            WV  NPKASICT +G ++FK+IAI+QDYHGLPEFR AVARFME
Sbjct  59   WVKKNPKASICTNEGVDDFKEIAIFQDYHGLPEFRNAVARFME  101



>gb|AAC15777.1| ACC synthase [Nicotiana glutinosa]
Length=482

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIAT++GHGENSAYFDGWKAY+NDPFH   NP GVIQMGLAENQLCFDLI++WV+N
Sbjct  9    KLLSKIATSDGHGENSAYFDGWKAYENDPFHLTQNPNGVIQMGLAENQLCFDLIQEWVVN  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NPKASICT +GA++F DIAI+QDYHGL EFR AV+RFME
Sbjct  69   NPKASICTAEGAQDFNDIAIFQDYHGLREFRKAVSRFME  107



>ref|XP_004252649.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
lycopersicum]
Length=473

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +2

Query  170  LKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDL  349
            +  + + E+LSK+ATNNGHGENSAYFDGWKAY+ DPFHP  NP GVIQMGLAENQLCFDL
Sbjct  4    ISNINNIELLSKVATNNGHGENSAYFDGWKAYEIDPFHPTKNPNGVIQMGLAENQLCFDL  63

Query  350  IKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            I++WV+NN K+SICT  G EEFK+IAIYQDYHGLPEFR  VA FM
Sbjct  64   IQEWVVNNQKSSICTAGGCEEFKEIAIYQDYHGLPEFRRGVASFM  108



>gb|KDP25384.1| hypothetical protein JCGZ_20540 [Jatropha curcas]
Length=484

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIAT NGHGE+S YFDGWKAYD+DP+H   NP GVIQMGLAENQLCFDL+++W+ N
Sbjct  8    QLLSKIATGNGHGEDSPYFDGWKAYDSDPYHRTKNPNGVIQMGLAENQLCFDLVQEWIKN  67

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPKASICTP+GAEEFKDIAI+QDYHGL EFR AVA+FM
Sbjct  68   NPKASICTPEGAEEFKDIAIFQDYHGLSEFRTAVAKFM  105



>gb|AAC98809.1| ACC synthase [Carica papaya]
Length=487

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            +++ E+LSKIAT+NGHGE+S YFDGWKAYD+DPFHP  NP+GVIQMGLAENQLCF+LI +
Sbjct  5    LRNQELLSKIATSNGHGEDSPYFDGWKAYDSDPFHPTQNPEGVIQMGLAENQLCFNLIHE  64

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            W+L NP+ASICT QGA EF+DIAI+QDYHGL EFR AVA+FM
Sbjct  65   WLLKNPEASICTAQGAAEFRDIAIFQDYHGLAEFREAVAKFM  106



>dbj|BAF44097.1| 1-aminocyclopropane-1-carboxylate synthase [Pyrus x bretschneideri]
Length=453

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIAT NGHGENS YFDGWKAYD+DPFHP  NP GVIQMGLAEN++CFDLI++WVLN
Sbjct  10   QLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENEMCFDLIQEWVLN  69

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  70   NPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFM  107



>dbj|BAJ65574.1| 1-aminocyclopropane-1-carboxylate synthase [Pyrus pyrifolia var. 
culta]
Length=487

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIAT NGHGENS YFDGWKAYD+DPFHP  NP GVIQMGLAEN++CFDLI++WVLN
Sbjct  10   QLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENEMCFDLIQEWVLN  69

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  70   NPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFM  107



>gb|ACX71871.1| ACC synthase 1 [Lithospermum erythrorhizon]
Length=480

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  182  KHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKW  361
            K  ++LS+IATN+GHGENS YFDGWKAYD+DP+HP +NP GVIQMGLAENQL FDLI++W
Sbjct  6    KQHQLLSRIATNDGHGENSPYFDGWKAYDSDPYHPTNNPNGVIQMGLAENQLSFDLIQEW  65

Query  362  VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            V+ NP ASICT +G  +FKDIAI+QDYHGLP+FR AVARFME
Sbjct  66   VVKNPTASICTAEGVSDFKDIAIFQDYHGLPKFRQAVARFME  107



>gb|ACT54523.3| 1-aminocyclopropane-1-carboxylate synthase [Eriobotrya japonica]
Length=487

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSKIAT NGHGENS YFDGWKAYD+DPFHP  NP GVIQMGLAEN++CF
Sbjct  1    MGFTLSNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENEMCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++WVL NP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  61   DLIQEWVLTNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFM  107



>ref|XP_008238953.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Prunus 
mume]
Length=483

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSK+AT NGHGENS YFDGWKAYD++PFHP  NP GVIQMGLAEN+LCF
Sbjct  1    MGFTVSNQQQLLSKMATGNGHGENSPYFDGWKAYDSNPFHPTKNPNGVIQMGLAENELCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++WVLNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  61   DLIEEWVLNNPEASICTVAGVNEFKDIAIFQDYHGLPEFRNAVANFM  107



>ref|NP_001280768.1| 1-aminocyclopropane-1-carboxylate synthase-like [Malus domestica]
 dbj|BAA92350.1| 1-aminocyclopropane-1-carboxylate synthase [Malus domestica]
Length=487

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSKIAT+NGHGENS YFDGWKAYD+DPFHP  NP GVIQMGLAEN++CF
Sbjct  1    MGFTLSNQQQLLSKIATSNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENEMCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++WVLNNP+ASICT  G  EFKDIAI+QDYHGLP FR AVA FM
Sbjct  61   DLIQEWVLNNPEASICTAAGVNEFKDIAIFQDYHGLPVFRNAVANFM  107



>gb|EYU23427.1| hypothetical protein MIMGU_mgv1a005590mg [Erythranthe guttata]
Length=478

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
             LSKIATN+GHGENSA+FDGWKAYD+DP+HP  NP GVIQMGLAENQL FDL+++WV  N
Sbjct  4    TLSKIATNDGHGENSAFFDGWKAYDSDPYHPTKNPNGVIQMGLAENQLSFDLVQEWVKKN  63

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            PKASICT +G ++FK+IAI+QDYHGLPEFR AVARFME
Sbjct  64   PKASICTNEGVDDFKEIAIFQDYHGLPEFRNAVARFME  101



>ref|XP_007210019.1| hypothetical protein PRUPE_ppa016458mg [Prunus persica]
 gb|EMJ11218.1| hypothetical protein PRUPE_ppa016458mg [Prunus persica]
Length=483

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSK+AT NGHGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQLCF
Sbjct  1    MGFTVSNQQQLLSKMATGNGHGENSPYFDGWKAYDSNPFHPTKNPNGVIQMGLAENQLCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++WVL NP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  61   DLIEEWVLKNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFM  107



>ref|NP_001275873.1| 1-aminocyclopropane-1-carboxylate synthase 1-like [Citrus sinensis]
 emb|CAA09477.1| ACC synthase [Citrus sinensis]
Length=459

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIATNNGHGE+SAYFDGWKA+D +PFHP  NP GVIQ+GLAENQLCFDLIK W+  N
Sbjct  3    ILSKIATNNGHGEDSAYFDGWKAFDRNPFHPTQNPGGVIQLGLAENQLCFDLIKDWITKN  62

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P ASICT +G E FKDIAI+QDYHGLPEFR AVA+FM
Sbjct  63   PYASICTAEGVEVFKDIAIFQDYHGLPEFRQAVAKFM  99



>ref|XP_007051710.1| 1-aminocyclopropane-1-carboxylate synthase [Theobroma cacao]
 gb|EOX95867.1| 1-aminocyclopropane-1-carboxylate synthase [Theobroma cacao]
Length=483

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            +T K  ++LS++ATN+ HGENS YFDGWKAYD +PFHP  NP GVIQMGLAENQLCFDLI
Sbjct  3    RTRKKGQLLSRMATNDRHGENSPYFDGWKAYDENPFHPSQNPDGVIQMGLAENQLCFDLI  62

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            KKW+L NP ASICT +G ++ K+IAIYQDYHGL EFR AVA+FME
Sbjct  63   KKWILENPDASICTAEGVDKLKNIAIYQDYHGLKEFREAVAKFME  107



>emb|CAA72191.1| 1-aminocyclopropane-1-carboxylate synthase [Carica papaya]
Length=488

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            +++ E+LSKIAT+NGHGE+S YFDGWKAYD+DPFHP  NP+GVIQMGLAENQLCF+LI +
Sbjct  5    LRNQELLSKIATSNGHGEDSPYFDGWKAYDSDPFHPTQNPEGVIQMGLAENQLCFNLIHE  64

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            W+L NP+ASIC   GA EF+DIAI+QDYHGLPEFR AVA FM
Sbjct  65   WLLKNPEASICYSTGAAEFRDIAIFQDYHGLPEFREAVAEFM  106



>emb|CAB60831.1| ACC synthase [Citrus sinensis]
Length=477

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIATNNGHGE+SAYFDGWKA+D +PFHP  NP GVIQ+GLAENQLCFDLIK W+  N
Sbjct  3    ILSKIATNNGHGEDSAYFDGWKAFDRNPFHPTQNPGGVIQLGLAENQLCFDLIKDWITKN  62

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P ASICT +G E FKDIAI+QDYHGLPEFR AVA+FM
Sbjct  63   PYASICTAEGVEVFKDIAIFQDYHGLPEFRQAVAKFM  99



>ref|XP_006444953.1| hypothetical protein CICLE_v10019970mg [Citrus clementina]
 ref|XP_006491186.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Citrus sinensis]
 gb|ESR58193.1| hypothetical protein CICLE_v10019970mg [Citrus clementina]
 gb|KDO86308.1| hypothetical protein CISIN_1g011801mg [Citrus sinensis]
Length=477

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIATNNGHGE+SAYFDGWKA+D +PFHP  NP GVIQ+GLAENQLCFDLIK W+  N
Sbjct  3    ILSKIATNNGHGEDSAYFDGWKAFDRNPFHPTQNPGGVIQLGLAENQLCFDLIKDWITKN  62

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P ASICT +G E FKDIAI+QDYHGLPEFR AVA+FM
Sbjct  63   PYASICTAEGVEVFKDIAIFQDYHGLPEFRQAVAKFM  99



>gb|AGF95121.1| 1-aminocyclopropane-1-carboxylate synthase, partial [Prunus persica]
Length=272

 Score =   167 bits (423),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIAT+ GHGENS YFDGWKAYD +PFHP  NP+GVIQMGLAENQL FDLI+ W+  N
Sbjct  12   LLSKIATSEGHGENSPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLSFDLIEDWIKKN  71

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICTP+G EEFK++AI+QDYHG PEFR AVA FM
Sbjct  72   PKASICTPEGVEEFKNVAIFQDYHGFPEFRKAVAMFM  108



>dbj|BAJ10407.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
 dbj|BAJ10409.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
 dbj|BAJ10411.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
 dbj|BAJ10417.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=155

 Score =   164 bits (414),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>gb|ACU15501.1| unknown [Glycine max]
Length=193

 Score =   165 bits (417),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+ HGENS YFDGWKAYD++PFHP  NPQGVIQMGLAENQLCFD+I++W+ N
Sbjct  9    QLLSKIATNDKHGENSPYFDGWKAYDSNPFHPTKNPQGVIQMGLAENQLCFDMIQEWIRN  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPKASICT +G  +FK IA +QDYHGLPEFR AVA FM
Sbjct  69   NPKASICTAEGVNQFKYIANFQDYHGLPEFRNAVANFM  106



>dbj|BAJ10413.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=155

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>gb|AAM21682.1|AF500119_1 1-aminocyclopropane-1-carboxylate synthase 1 [Persea americana]
Length=489

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSK+ATN+GHGE S  FDGWKAYDNDP+HP  NPQGVIQMGLAENQLCFDLI++W+  N
Sbjct  11   LLSKMATNDGHGEKSRIFDGWKAYDNDPYHPTTNPQGVIQMGLAENQLCFDLIEEWIKKN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            PK SICT +GA EFKDIA+YQDYHGLP FR A+A+FME
Sbjct  71   PKWSICTAEGASEFKDIALYQDYHGLPAFRSAIAKFME  108



>ref|XP_004492797.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Cicer arietinum]
Length=483

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  ++  H ++LSKIATNN HGENS YFDGWKAY+++PFHP  NPQGVIQMGLAENQLCF
Sbjct  1    MSFESKSH-QLLSKIATNNKHGENSPYFDGWKAYESNPFHPTKNPQGVIQMGLAENQLCF  59

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+ NNPKASICTP+G  +F+ IA +QDYHGLPEFR AVA FM
Sbjct  60   DLIEEWIRNNPKASICTPEGVNQFRHIANFQDYHGLPEFRNAVANFM  106



>gb|AAB70885.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
 gb|ABQ51844.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
Length=489

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
             T     +LSK+AT +GHGENS YFDGWKAYDN+PFH   NPQGVIQMGLAENQL F+LI
Sbjct  6    STTNQRTLLSKMATGDGHGENSPYFDGWKAYDNNPFHLTQNPQGVIQMGLAENQLSFELI  65

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            ++WVLNNP+ASICT QG +EFKD AI+QDYHGLPEFR AVA FM
Sbjct  66   EQWVLNNPQASICTAQGLQEFKDTAIFQDYHGLPEFRYAVANFM  109



>gb|KJB41416.1| hypothetical protein B456_007G103200 [Gossypium raimondii]
Length=493

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  TMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIK  355
            T K+ ++LS+IATN+ HGENS YFDGWKAYD++PFHP HNP GVIQMGLAEN LCFDLI+
Sbjct  4    TRKNRQLLSRIATNDRHGENSPYFDGWKAYDSNPFHPIHNPDGVIQMGLAENPLCFDLIE  63

Query  356  KWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            KW+  NP ASICT +G ++FKDIAIYQDYHGL EFR AVA+FM
Sbjct  64   KWIRENPDASICTAEGLDKFKDIAIYQDYHGLREFREAVAKFM  106



>dbj|BAB89350.1| 1-aminocyclopropane-1-carboxylate synthase [Diospyros kaki]
Length=486

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIAT+ GHGENS+YFDGWKAYD+DP+HP  NP GVIQMGLAENQLCFDLI++WV+NN
Sbjct  12   LLSKIATDGGHGENSSYFDGWKAYDSDPYHPTGNPDGVIQMGLAENQLCFDLIEEWVVNN  71

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICT +GA +F D AI+QDYHGLPEFR  VA FM
Sbjct  72   PKASICTAEGAGDFMDTAIFQDYHGLPEFREGVANFM  108



>gb|KJB49434.1| hypothetical protein B456_008G119600 [Gossypium raimondii]
Length=484

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M++K    +++LSKIATN+ H ENS YFDGWKAYDN+PFHP  NP GVIQMGLAEN+LCF
Sbjct  1    MEIKRKNKSQLLSKIATNDRHRENSPYFDGWKAYDNNPFHPTQNPNGVIQMGLAENKLCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLIKKW++ NP ASICT  G ++FKD+AI+QDYHGL EFR A+A+FM
Sbjct  61   DLIKKWIMENPDASICTAGGVDKFKDVAIFQDYHGLKEFREAIAKFM  107



>gb|AES80302.2| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=484

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L+   H ++LSKIATN+ HGENS YFDGWKAY+++PFHP  NPQGVIQMGLAENQLCF
Sbjct  1    MSLENKNH-QLLSKIATNDKHGENSPYFDGWKAYESNPFHPTKNPQGVIQMGLAENQLCF  59

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+ NNPKASICTP+G  EF+ IA +QDYHGLPEFR AVA FM
Sbjct  60   DLIEEWIRNNPKASICTPEGVNEFRHIANFQDYHGLPEFRNAVANFM  106



>gb|AAM80888.1| 1-aminocyclopropane-1-carboxylate synthase [Betula pendula]
Length=485

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIAT NGHGENS YFDGWKA++++PFHP  NPQGVIQMGLAENQLCFDL+++W+L N
Sbjct  11   LLSKIATGNGHGENSPYFDGWKAFESNPFHPTKNPQGVIQMGLAENQLCFDLVQEWILKN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P+ASICTP+G  +F +IA++QDYHGLPEFR AVA+FM
Sbjct  71   PQASICTPEGVYDFSEIAVFQDYHGLPEFRNAVAKFM  107



>ref|XP_002509858.1| acc synthase, putative [Ricinus communis]
 gb|EEF51245.1| acc synthase, putative [Ricinus communis]
 gb|AGB96761.1| 1-aminocyclopropane-1-carboxylate synthase [Ricinus communis]
Length=480

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +2

Query  185  HTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWV  364
            + ++LSKIA  +GHGENS YFDGWKAYD+DPFHP  NP GVIQMGLAENQL FD++++W+
Sbjct  6    NNQLLSKIAIGDGHGENSPYFDGWKAYDSDPFHPIDNPNGVIQMGLAENQLSFDVVQEWL  65

Query  365  LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             NNPKASICTP+GA+EFK++AI+QDYHGLPEFR AVA FM
Sbjct  66   KNNPKASICTPEGADEFKNVAIFQDYHGLPEFRNAVANFM  105



>gb|AAL66205.1|AF386523_1 1-aminocyclopropane 1-carboxylate synthase 5 [Pyrus communis]
Length=487

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSK+AT +GHGENS YFDGWKAYD+DPFHP  NP GVIQMGL EN++CF
Sbjct  1    MGFTLSNQQQLLSKMATGDGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLRENEMCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++WVLNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AV  FM
Sbjct  61   DLIQEWVLNNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVTNFM  107



>emb|CAA79478.1| 1-aminocyclopropane-1-carboxylate synthase [Petunia x hybrida]
 gb|AAB06724.1| 1-aminocyclopropane-1-carboxylate synthase [Petunia x hybrida]
Length=490

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  ++ K+  VLSK+ATN  HGENS YFDGWKAYDNDPFHP  NP GVIQMGLAENQLCF
Sbjct  1    MGFESEKNNSVLSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI+ W+  NPKASICT +G + F+ IA +QDYHGLPEFR A+A+FME
Sbjct  61   DLIEDWIKRNPKASICTTEGIKSFRGIANFQDYHGLPEFRRAIAKFME  108



>gb|AAF22109.1|AF119411_1 1-aminocyclopropane-1-carboxylate synthase 1 [Lupinus albus]
Length=487

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            MDL + K  ++LSKIATN+ HGENS YFDGWKAYDN+PFHP  NP GVIQMGLAENQLCF
Sbjct  1    MDLGS-KTNQLLSKIATNDKHGENSPYFDGWKAYDNNPFHPSKNPNGVIQMGLAENQLCF  59

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+ NNPKASICT +G  +F+DIA +QDYHGLPEFR A+A FM
Sbjct  60   DLIEEWIKNNPKASICTLEGVHKFRDIANFQDYHGLPEFRNALANFM  106



>ref|XP_003624084.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=533

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L+   H ++LSKIATN+ HGENS YFDGWKAY+++PFHP  NPQGVIQMGLAENQLCF
Sbjct  1    MSLENKNH-QLLSKIATNDKHGENSPYFDGWKAYESNPFHPTKNPQGVIQMGLAENQLCF  59

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+ NNPKASICTP+G  EF+ IA +QDYHGLPEFR AVA FM
Sbjct  60   DLIEEWIRNNPKASICTPEGVNEFRHIANFQDYHGLPEFRNAVANFM  106



>ref|XP_009386742.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Musa 
acuminata subsp. malaccensis]
Length=487

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            VLS IAT++GHGENS+YFDGWKAYDNDPFHP  NPQGVIQMGLAENQLC DL+++W+  N
Sbjct  13   VLSSIATSDGHGENSSYFDGWKAYDNDPFHPIDNPQGVIQMGLAENQLCLDLMQQWIKQN  72

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P+ASICT +G  EFKD+A +QDYHGLP+FR A+ARFM
Sbjct  73   PQASICTGEGVSEFKDVANFQDYHGLPDFRKAIARFM  109



>ref|XP_003622479.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
 gb|KEH18801.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=480

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+ HGENS YFDGWKAY+ +PFHP+ NPQGVIQMGLAENQLCFDLI++W+ N
Sbjct  9    QLLSKIATNDQHGENSPYFDGWKAYEKNPFHPRKNPQGVIQMGLAENQLCFDLIEEWIKN  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPKASICTP+G  +F+DIA +QDYHGLPEF  A+A+FM
Sbjct  69   NPKASICTPEGVCKFRDIANFQDYHGLPEFTSAMAKFM  106



>ref|XP_009786813.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Nicotiana 
sylvestris]
Length=491

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K++ +LSK+ATN  HGENS YFDGWKAYDNDPFHP  NP GVIQMGLAENQLCF
Sbjct  1    MGFENEKNSSILSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI++W+  NP ASICT +G + F+ IA +QDYHGLPEFR A+A+FME
Sbjct  61   DLIEEWIKRNPNASICTTEGIKSFRAIANFQDYHGLPEFRSAIAKFME  108



>gb|KCW44816.1| hypothetical protein EUGRSUZ_L016172, partial [Eucalyptus grandis]
Length=290

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 108/156 (69%), Gaps = 10/156 (6%)
 Frame = +2

Query  17   STTYSLSISPKT*TYTYCHFSIYNYIRRRKTHHFLSFQNPSLNITSYHHMDLKTMKHTEV  196
            STT S S  P   ++ + H S Y +I  R        +NP+ ++ S   M   +     +
Sbjct  97   STTISCSF-PANSSFVFVHLSCY-FISYR-------VKNPT-SLFSLKTMGYVSSNTKPL  146

Query  197  LSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNP  376
            LS+ ATN GH EN  YFDGWKAYD +PFHP  NP GVIQMGLAE+QLCFDL+++W+++NP
Sbjct  147  LSRKATNEGHAENCPYFDGWKAYDKNPFHPSQNPDGVIQMGLAEHQLCFDLVQEWLVSNP  206

Query  377  KASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +ASICT +G ++F+DIA++QDYHGLP FR AVA+FM
Sbjct  207  EASICTKEGVDKFRDIALFQDYHGLPAFRNAVAKFM  242



>gb|ABK97620.1| 1-aminocyclopropane-1-carboxylic acid synthase [Durio zibethinus]
Length=490

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  TMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIK  355
            T K+ ++LS+ ATN+GHGENS YFDGWKAYD+DP+H   NP GVIQMGLAENQLCFDLIK
Sbjct  4    TRKNKQLLSRKATNDGHGENSPYFDGWKAYDSDPYHRSQNPNGVIQMGLAENQLCFDLIK  63

Query  356  KWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            KW+L NP ASICT +G ++FKDIAIYQDYHGL EF  A+A+FM
Sbjct  64   KWILENPDASICTAEGVDKFKDIAIYQDYHGLKEFIEALAKFM  106



>gb|KCW77477.1| hypothetical protein EUGRSUZ_D01815 [Eucalyptus grandis]
Length=564

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 110/158 (70%), Gaps = 14/158 (9%)
 Frame = +2

Query  17   STTYSLSISPKT*TYTYCHFSIYNYIRRRKTHHFLSFQ--NPSLNITSYHHMDLKTMKHT  190
            STT S S  P   ++ + H S Y          F+S+Q  NP+ ++ S   M   +    
Sbjct  40   STTISCSF-PANSSFVFVHLSCY----------FISYQVKNPT-SLFSLKTMSYVSSNRK  87

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
             +LS+ ATN+GH EN  YFDGWKAYD DPFHP  NP GVIQMGLAE+QLCFDL+++W+++
Sbjct  88   PLLSRKATNDGHAENCPYFDGWKAYDKDPFHPTQNPSGVIQMGLAEHQLCFDLVQEWLVS  147

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASICT +G ++F+DIA++QDYHGLP FR AVA+FM
Sbjct  148  NPEASICTKEGVDKFRDIALFQDYHGLPAFRNAVAKFM  185



>ref|XP_009398061.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            E+LS++AT +GHGEN++YFDGWKAYDNDPFHP HNP GVIQMGLAENQLC DL++ W+  
Sbjct  7    EILSRVATGDGHGENTSYFDGWKAYDNDPFHPIHNPNGVIQMGLAENQLCLDLMRDWIRK  66

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EF+ IA +QDYHGLP+FR A+A+FME
Sbjct  67   NPQASICTKEGVSEFEAIANFQDYHGLPDFRKAIAKFME  105



>gb|AAX99362.1| 1-aminocyclopropane-1-carboxylate synthase [Prunus persica]
Length=492

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIAT+ GHGENS YFDGWKAYD +PFHP  NP+GVIQMGLAENQL FDLI+ W+  N
Sbjct  12   LLSKIATSEGHGENSPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLSFDLIEDWIKKN  71

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICTP+G EEFK++AI+QDYHG PEFR AVA FM
Sbjct  72   PKASICTPEGVEEFKNVAIFQDYHGFPEFRKAVAMFM  108



>ref|XP_007219056.1| hypothetical protein PRUPE_ppa004774mg [Prunus persica]
 gb|EMJ20255.1| hypothetical protein PRUPE_ppa004774mg [Prunus persica]
Length=492

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIAT+ GHGENS YFDGWKAYD +PFHP  NP+GVIQMGLAENQL FDLI+ W+  N
Sbjct  12   LLSKIATSEGHGENSPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLSFDLIEDWIKKN  71

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICTP+G EEFK++AI+QDYHG PEFR AVA FM
Sbjct  72   PKASICTPEGVEEFKNVAIFQDYHGFPEFRKAVAMFM  108



>gb|AJF36210.1| 1-aminocyclopropane-1-carboxylate synthase 3 [Trifolium repens]
Length=484

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L+   H ++LSKIATN+ HGENS YFDGWKAY+++PFHP  NPQGVIQMGLAENQLCF
Sbjct  1    MSLENKNH-QLLSKIATNDKHGENSPYFDGWKAYESNPFHPTKNPQGVIQMGLAENQLCF  59

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI+ W+ NNPKASICT +G  EF++IA +QDYHGLPEFR AVA FM
Sbjct  60   DLIEDWIRNNPKASICTLEGVNEFRNIANFQDYHGLPEFRNAVANFM  106



>ref|XP_002304518.2| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
 gb|EEE79497.2| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
Length=480

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS IA++NGHGE+S YF+GWKAYD++P HP  NP GVIQMGLAENQLCFDLI+ W+ NN
Sbjct  9    LLSSIASSNGHGEDSPYFEGWKAYDSNPHHPTENPNGVIQMGLAENQLCFDLIQDWLKNN  68

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            PKASICTP+G  EF+++AI+QDYHGLPEFR AVA+FME
Sbjct  69   PKASICTPEGVNEFREVAIFQDYHGLPEFRNAVAKFME  106



>ref|XP_008805580.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Phoenix 
dactylifera]
Length=161

 Score =   159 bits (403),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  170  LKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDL  349
            L    +  +LSK+ATN+GHGENS+YFDGWKAYD DPFHP  NP+GVIQMGLAENQLC DL
Sbjct  6    LPRAPNYSLLSKMATNDGHGENSSYFDGWKAYDRDPFHPTDNPKGVIQMGLAENQLCLDL  65

Query  350  IKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            +++W+  N +ASICT  G  EF+ IA +QDYHGLPEFR A+A+FME
Sbjct  66   MQEWIKKNQRASICTAAGVPEFQAIANFQDYHGLPEFREAIAKFME  111



>gb|ABW03086.1| 1-aminocyclopropane 1-carboxylate synthase 5 [Prunus salicina]
Length=483

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSK+AT NGH ENS YFDGWKAYD++PFHP  NP GVIQMGLAENQ+CF
Sbjct  1    MGFTVSNQQQLLSKMATGNGHSENSPYFDGWKAYDSNPFHPTKNPNGVIQMGLAENQVCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++WVL NP+ASIC   G  EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  61   DLIEEWVLKNPEASICPAAGVNEFKDIAIFQDYHGLPEFRNAVANFM  107



>ref|XP_002278489.2| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Vitis 
vinifera]
 emb|CBI34388.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIAT+NGHGENS YFDGWKAYD+DP+HP  NP GVIQMGLAENQL FD+I++W+L 
Sbjct  9    QLLSKIATDNGHGENSPYFDGWKAYDSDPYHPIENPGGVIQMGLAENQLSFDIIEEWLLK  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPKASICT +G  EF+D+AI+QDYHGL EFR AVA+FM
Sbjct  69   NPKASICTVEGMSEFRDVAIFQDYHGLKEFRNAVAKFM  106



>ref|XP_002298013.1| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
 gb|EEE82818.1| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
Length=481

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  HTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWV  364
            ++ +LS+IA++NGHGE+S YFDGWKAYD DP HP  NP GVIQMGLAENQLCFDLI+ W+
Sbjct  6    NSHLLSRIASSNGHGEDSPYFDGWKAYDTDPHHPTDNPNGVIQMGLAENQLCFDLIQDWL  65

Query  365  LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
              NPKASIC+P+G  EF++IAI+QDYHGLPEFR AVA FME
Sbjct  66   KKNPKASICSPEGLNEFREIAIFQDYHGLPEFRNAVANFME  106



>ref|XP_003552421.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Glycine max]
 gb|KHN40434.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=480

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+ HGENS YFDGWKAYD++PFHP  NPQGVIQMGLAENQLCFDLI++W+ N
Sbjct  9    QLLSKIATNDKHGENSPYFDGWKAYDSNPFHPTKNPQGVIQMGLAENQLCFDLIQEWIRN  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPKASICT +G  +FK IA +QDYHGLPEFR AVA FM
Sbjct  69   NPKASICTAEGVNQFKYIANFQDYHGLPEFRNAVANFM  106



>gb|ABM66813.1| ACC synthase [Gossypium hirsutum]
Length=493

 Score =   167 bits (424),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 74/103 (72%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +2

Query  176  TMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIK  355
            T K+ ++LS+IATN+ HGENS YFDGWKAYD+ PFHP HNP GVIQMGLAEN L FDLI+
Sbjct  4    TRKNRQLLSRIATNDRHGENSPYFDGWKAYDSSPFHPIHNPDGVIQMGLAENPLSFDLIE  63

Query  356  KWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            KW+  NP ASICT +G ++FK IAIYQDYHGL EFR AVA+FM
Sbjct  64   KWIRENPDASICTAEGLDKFKHIAIYQDYHGLREFREAVAKFM  106



>dbj|BAG30910.1| ACC synthase [Capsicum chinense]
Length=486

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K+  +LSK+ATN  HGENS YFDGWKAYDNDPFHP  NP GVIQMGLAENQLCF
Sbjct  1    MGFECAKNNAILSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI++W+  NPKASIC+ +G + FK IA +QDYHGLPEFR A+A+FME
Sbjct  61   DLIEEWIKRNPKASICSNEGIKSFKAIANFQDYHGLPEFRRAIAKFME  108



>ref|XP_010676415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Beta vulgaris 
subsp. vulgaris]
Length=485

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            E+LS+IA  NGHGE SAYF GWKAY+NDPFHP +NP GVIQMGLAENQL FD++K WV+ 
Sbjct  4    ELLSRIAAGNGHGEESAYFHGWKAYENDPFHPVNNPSGVIQMGLAENQLSFDMVKDWVVK  63

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP ASICT +G + FKDIAI+QDYHGLP FR AVARFME
Sbjct  64   NPAASICTVEGVDHFKDIAIFQDYHGLPAFRNAVARFME  102



>ref|XP_009591161.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Nicotiana 
tomentosiformis]
Length=489

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K+  +LSK+ATN  HGENS YFDGWKAYDNDPFHP  NP GVIQMGLAENQLCF
Sbjct  1    MGFENEKNNSILSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI++W+  NP ASICT +G + F+ IA +QDYHGLPEFR A+A+FME
Sbjct  61   DLIEEWIKRNPNASICTTEGIKSFRAIANFQDYHGLPEFRRAIAKFME  108



>gb|KDP28564.1| hypothetical protein JCGZ_14335 [Jatropha curcas]
Length=485

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            M ++++LS+IATN GHGENS YFDGWKAYD +PFHP  NP+GVIQMGLAENQLCFDL++ 
Sbjct  1    MVNSQLLSRIATNEGHGENSPYFDGWKAYDGNPFHPVDNPEGVIQMGLAENQLCFDLVRD  60

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            W+  NP+ASICT +G   FKDIA +QDYHGLPEFR A+A+FM
Sbjct  61   WIKQNPEASICTAEGVAMFKDIANFQDYHGLPEFRQAIAKFM  102



>gb|AAR99390.1| ACC synthase ACS1 [Nicotiana attenuata]
Length=490

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K+  +LSK+ATN  HGENS YFDGWKAYDNDPFHP  NP GVIQMGLAENQLCF
Sbjct  1    MGFENEKNNSILSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI++W+  NP ASICT +G + F+ IA +QDYHGLPEFR A+A+FME
Sbjct  61   DLIEEWIKRNPNASICTTEGIKSFRAIANFQDYHGLPEFRRAIAKFME  108



>gb|KHN29314.1| 1-aminocyclopropane-1-carboxylate synthase CMW33 [Glycine soja]
Length=485

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+ HGENS YFDGWKAYD++PFHP  NPQGVIQMGLAENQLCFD+I++W+ N
Sbjct  9    QLLSKIATNDKHGENSPYFDGWKAYDSNPFHPTKNPQGVIQMGLAENQLCFDMIQEWIRN  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPKASICT +G  +FK IA +QDYHGLPEFR AVA FM
Sbjct  69   NPKASICTAEGVNQFKYIANFQDYHGLPEFRNAVANFM  106



>ref|XP_003534540.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1 [Glycine 
max]
Length=485

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+ HGENS YFDGWKAYD++PFHP  NPQGVIQMGLAENQLCFD+I++W+ N
Sbjct  9    QLLSKIATNDKHGENSPYFDGWKAYDSNPFHPTKNPQGVIQMGLAENQLCFDMIQEWIRN  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPKASICT +G  +FK IA +QDYHGLPEFR AVA FM
Sbjct  69   NPKASICTAEGVNQFKYIANFQDYHGLPEFRNAVANFM  106



>dbj|BAA94599.1| 1-aminocyclopropane-1-carboxylate synthase [Populus euphratica]
Length=481

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  HTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWV  364
            ++ +LS+IA+++GHGE+S YFDGWKAYD+DP HP  NP GVIQMGLAENQLCFDLI+ W+
Sbjct  6    NSHLLSRIASSDGHGEDSPYFDGWKAYDSDPHHPTDNPNGVIQMGLAENQLCFDLIQDWL  65

Query  365  LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
              NPKASIC+P+G  EF++IAI+QDYHGLPEFR AVA FME
Sbjct  66   KKNPKASICSPEGLNEFREIAIFQDYHGLPEFRNAVANFME  106



>ref|XP_004298832.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSKIAT  G  EN+ YFDGWKA+D+DP+HP  NPQGVIQMGLAENQL F
Sbjct  1    MGFTLSNQQQLLSKIATGTGDSENTPYFDGWKAFDSDPYHPTTNPQGVIQMGLAENQLSF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++WVL NP+ASICT QGA+EFKD AI+QDYHGLPEFR AVA FM
Sbjct  61   DLIQEWVLKNPEASICTAQGAKEFKDTAIFQDYHGLPEFRNAVANFM  107



>dbj|BAB33423.1| ACC synthase [Pisum sativum]
Length=477

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATNN HGENS YFDGWKAY+++PFHP  NPQGVIQMGLAENQLCFDLI++W+ N
Sbjct  9    KLLSKIATNNKHGENSPYFDGWKAYESNPFHPTKNPQGVIQMGLAENQLCFDLIEEWIKN  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPKASICTP+G  +F+ IA +QDYHGLPEF+ AVA  M
Sbjct  69   NPKASICTPEGVNQFRHIANFQDYHGLPEFKNAVANLM  106



>gb|ACN78835.1| 1-aminocyclopropane-1-carboxylate synthase [Paeonia suffruticosa]
Length=492

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  170  LKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDL  349
            + T +  ++LSK+AT NGHGE+S YFDGWKAYD++PFH  +NP GVIQMGLAEN L FD+
Sbjct  4    MSTDQQKQLLSKMATGNGHGEDSPYFDGWKAYDSNPFHLNNNPNGVIQMGLAENLLSFDV  63

Query  350  IKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            I++WVLNNPKASICTP+G  EF+D AI+QDYHG PEFR AVA+FM
Sbjct  64   IQEWVLNNPKASICTPEGINEFRDTAIFQDYHGFPEFRNAVAKFM  108



>gb|AFK42980.1| unknown [Medicago truncatula]
Length=219

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L +M   ++LSKIAT +GHGE S+YFDGWKAYD +PFHP  NPQGVIQMGLAE+QL  
Sbjct  1    MGLVSMDQPQLLSKIATGDGHGETSSYFDGWKAYDKNPFHPTKNPQGVIQMGLAESQLTA  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL++ W+++NP+ASICT +G   FK++A +QDYHGLPEFR AVA+FM
Sbjct  61   DLVQNWIMSNPEASICTLEGVHNFKEMANFQDYHGLPEFRNAVAKFM  107



>dbj|BAJ10410.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=501

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  2    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  61

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  62   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  105



>dbj|BAK19926.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus petraeus]
Length=506

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>dbj|BAA96743.1| 1-aminocyclopropane-1-carboxylate synthase [Prunus persica]
Length=492

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIAT+ GHGEN  YFDGWKAYD +PFHP  NP+GVIQMGLAENQL FDLI+ W+  N
Sbjct  12   LLSKIATSEGHGENPPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLSFDLIEDWIKKN  71

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICTP+G EEFK++AI+QDYHG PEFR AVA FM
Sbjct  72   PKASICTPEGVEEFKNVAIFQDYHGFPEFRKAVAMFM  108



>gb|ABC69166.2| 1-aminocyclopropane-1-carboxylate synthase [Paeonia suffruticosa]
Length=492

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  170  LKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDL  349
            + T +  ++LSK+AT NGHGE+S YFDGWKAYD++PFH  +NP GVIQMGLAEN L FD+
Sbjct  4    MSTDQQKQLLSKMATGNGHGEDSPYFDGWKAYDSNPFHLNNNPNGVIQMGLAENLLSFDV  63

Query  350  IKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            I++WVLNNPKASICTP+G  EF+D AI+QDYHG PEFR AVA+FM
Sbjct  64   IQEWVLNNPKASICTPEGINEFRDTAIFQDYHGFPEFRNAVAKFM  108



>dbj|BAJ10416.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=500

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  2    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  61

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  62   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  105



>dbj|BAJ10406.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
 dbj|BAJ10408.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=501

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  2    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  61

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  62   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  105



>gb|AAQ14268.1|AF248737_1 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=484

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSK+AT NGHGE+S YFDGWKAYD+DPFHP  NP+GVIQMGLAENQL F  ++KW+ N
Sbjct  11   KLLSKLATGNGHGEDSPYFDGWKAYDSDPFHPTLNPRGVIQMGLAENQLSFGFVEKWMRN  70

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASICT +G +EFKD+AI+QDYHGLPEFR AVA FM
Sbjct  71   NPQASICTAEGIDEFKDVAIFQDYHGLPEFRNAVANFM  108



>dbj|BAK19930.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus chinensis]
Length=502

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>dbj|BAK09604.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus caryophyllus]
Length=518

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>ref|XP_010092578.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Morus notabilis]
 gb|EXB51626.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Morus notabilis]
Length=496

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  182  KHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKW  361
            ++ ++LSKIATN+GHGEN+ YFDGWKAYD DPFH   NP GVIQMGLAENQLCFDLI+ W
Sbjct  7    ENRQLLSKIATNDGHGENTPYFDGWKAYDRDPFHLTKNPSGVIQMGLAENQLCFDLIEDW  66

Query  362  VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +  NP ASICT +G ++FKD+AI+QDYHG PEFR A+A+FM
Sbjct  67   IRKNPIASICTAEGVKDFKDVAIFQDYHGFPEFRKAIAKFM  107



>sp|P27486.1|1A1C_DIACA RecName: Full=1-aminocyclopropane-1-carboxylate synthase; Short=ACC 
synthase; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Dianthus caryophyllus]
 gb|AAA33275.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus caryophyllus]
Length=517

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>dbj|BAJ10420.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
 dbj|BAJ10421.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=504

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>dbj|BAJ10405.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus caryophyllus]
 dbj|BAJ10419.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus caryophyllus]
Length=512

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>ref|NP_001280199.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Prunus mume]
 dbj|BAH66892.1| 1-aminocyclopropane-1-carboxylate synthase [Prunus mume]
Length=492

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIAT+ GHGENS YFDGWKAYD +PFHP  NP+GVIQMGLAENQL FD I+ W+  N
Sbjct  12   LLSKIATSEGHGENSPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLSFDSIEDWIKKN  71

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICTP+G EEFK++AI+QDYHG PEFR AVA FM
Sbjct  72   PKASICTPEGVEEFKNVAIFQDYHGFPEFRKAVAMFM  108



>dbj|BAJ10403.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus caryophyllus]
Length=515

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  2    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  61

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  62   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  105



>emb|CAA79477.1| 1-aminocyclopropane 1-carboxylate synthase [Dianthus caryophyllus]
 dbj|BAJ10418.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus caryophyllus]
 dbj|BAK09605.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus caryophyllus]
Length=518

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>dbj|BAJ10412.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=500

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  2    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  61

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  62   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  105



>dbj|BAK19928.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus petraeus]
Length=502

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSIKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>dbj|BAJ10414.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=501

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  2    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  61

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  62   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  105



>dbj|BAK19925.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus petraeus]
Length=507

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>ref|XP_011029354.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Populus 
euphratica]
Length=481

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  HTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWV  364
            ++ +LS+IA++NGHGE+S YFDGWKAYD DP HP  NP GVIQMGLAENQLCFDLI+ W+
Sbjct  6    NSHLLSRIASSNGHGEDSPYFDGWKAYDTDPHHPTDNPNGVIQMGLAENQLCFDLIQDWL  65

Query  365  LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
              NPKASIC+P+G  EF++ AI+QDYHGLPEFR AVA FME
Sbjct  66   KKNPKASICSPEGLNEFRETAIFQDYHGLPEFRNAVANFME  106



>sp|Q07262.1|1A1C_TOBAC RecName: Full=1-aminocyclopropane-1-carboxylate synthase; Short=ACC 
synthase; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Nicotiana tabacum]
 emb|CAA46797.1| 1-aminocyclopropane 1-carboxylate synthase [Nicotiana tabacum]
 prf||1909369A aminocyclopropane carboxylate synthase
Length=491

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K++ +LSK+ATN   GENS YFDGWKAYDNDPFHP  NP GVIQMGLAENQLCF
Sbjct  1    MGFENEKNSSILSKLATNEELGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI++W+  NP ASICT +G + F+ IA +QDYHGLPEFR A+A+FME
Sbjct  61   DLIEEWIKRNPNASICTTEGIKSFRAIANFQDYHGLPEFRSAIAKFME  108



>ref|XP_004306735.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Fragaria vesca subsp. vesca]
Length=493

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            M    +LSKIATN+GHGEN AYFDGWKAYD +PFHP  NP+GVIQMGLAENQL FD+I++
Sbjct  1    MASNSLLSKIATNDGHGENLAYFDGWKAYDRNPFHPTQNPEGVIQMGLAENQLSFDVIQE  60

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            W++ NPKASICTP+G  EFK++A +QDYHG P+FR A+A FM 
Sbjct  61   WIMKNPKASICTPEGLAEFKNVANFQDYHGFPDFRKAIANFMS  103



>sp|Q9MB95.1|1A11_PRUMU RecName: Full=1-aminocyclopropane-1-carboxylate synthase 1; Short=ACC 
synthase 1; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Prunus mume]
 dbj|BAA90549.1| ACC synthase [Prunus mume]
Length=492

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIAT+ GHGENS YFDGWKAYD +PFHP  NP+GVIQMGLAENQL FD I+ W+  N
Sbjct  12   LLSKIATSEGHGENSPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLSFDSIEDWIKKN  71

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICTP+G EEFK++AI+QDYHG PEFR AVA FM
Sbjct  72   PKASICTPEGVEEFKNVAIFQDYHGFPEFRKAVAMFM  108



>ref|XP_010053217.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
 gb|KCW77478.1| hypothetical protein EUGRSUZ_D01817 [Eucalyptus grandis]
Length=486

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+ ATN+GH ENS YFDGWKAYD+DPFHP  NP GVIQMGLAE+QLCF+L++KW+ NN
Sbjct  11   LLSQKATNDGHAENSPYFDGWKAYDSDPFHPTQNPSGVIQMGLAEHQLCFNLVQKWLENN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P+ASICT +G ++F+DIAI+QDYHGLPEFR AVA+FM
Sbjct  71   PEASICTKEGVDKFRDIAIFQDYHGLPEFRNAVAKFM  107



>ref|XP_010919415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Elaeis 
guineensis]
Length=492

 Score =   165 bits (418),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            ++L+   ++ +LSK+AT++GHGENS+YFDGWKAYD DPFHP  NP+GVIQ+GLAENQLC 
Sbjct  5    VELRREPNSPLLSKMATSDGHGENSSYFDGWKAYDCDPFHPTSNPEGVIQLGLAENQLCL  64

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            D I++W+ NNPKASICT  G  EFK+IA +QDYHGL  FR AVA+FM
Sbjct  65   DPIQEWIKNNPKASICTEVGVSEFKNIANFQDYHGLRVFREAVAKFM  111



>dbj|BAK19923.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus petraeus]
Length=506

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  173  KTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLI  352
            K +   E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+
Sbjct  5    KGVYDREILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLV  64

Query  353  KKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             +W+L NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  65   TEWLLKNPQASICTNEGVNKFMDIAIFQDYHGLPEFRGAVAKFM  108



>ref|XP_007135134.1| hypothetical protein PHAVU_010G103900g [Phaseolus vulgaris]
 gb|ESW07128.1| hypothetical protein PHAVU_010G103900g [Phaseolus vulgaris]
Length=478

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            MDL   K   +LSKIATN+ HGENS YFDGWKAY+ +PFHP  NPQGVIQMGLAENQLCF
Sbjct  1    MDLGR-KSQHLLSKIATNDKHGENSPYFDGWKAYERNPFHPTKNPQGVIQMGLAENQLCF  59

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+LNNPKASICTP+G  +F++IA +QDYHGL EFR  +A +M
Sbjct  60   DLIEEWILNNPKASICTPEGVHQFRNIANFQDYHGLKEFRNGIANWM  106



>ref|XP_004160953.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Cucumis 
sativus]
 gb|KGN53353.1| hypothetical protein Csa_4G049610 [Cucumis sativus]
Length=489

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            +VLSK+A  NGHGE+S+YFDGWKAYD+DPFHP  NP+GVIQMGLAENQL F+ ++KW+ N
Sbjct  14   KVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAENQLSFEFVEKWMKN  73

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASIC+ +G +EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  74   NPRASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFM  111



>ref|XP_010055081.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
Length=486

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M+  +++   +LS IA N GHGE+S YFDGWKAYD +PFHP  NP GVIQMGLAENQL F
Sbjct  1    MEPASVRKHSLLSMIARNGGHGEHSPYFDGWKAYDRNPFHPTQNPDGVIQMGLAENQLSF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+ NNP ASICTP G  +FKD+AI+QDYHGLPEFR A+A+FM
Sbjct  61   DLIEEWIKNNPTASICTPDGVGKFKDVAIFQDYHGLPEFRQAIAKFM  107



>ref|XP_008779569.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Phoenix 
dactylifera]
Length=483

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSK+ATN+GHGENS+YFDGWKAYD+DPFHP  NP+GVIQMGLAENQLC DL+++W+  N
Sbjct  14   LLSKMATNDGHGENSSYFDGWKAYDSDPFHPIDNPEGVIQMGLAENQLCLDLMQEWIKKN  73

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICT  G  EFK IA +QDYHGLPEFR A+A+FM
Sbjct  74   PKASICTEAGVPEFKAIANFQDYHGLPEFREAIAKFM  110



>ref|NP_001267589.1| 1-aminocyclopropane-1-carboxylate synthase-like [Cucumis sativus]
 dbj|BAA33375.1| ACC synthase [Cucumis sativus]
 dbj|BAA93715.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
Length=489

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            +VLSK+A  NGHGE+S+YFDGWKAYD+DPFHP  NP+GVIQMGLAENQL F+ ++KW+ N
Sbjct  14   KVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAENQLSFEFVEKWMKN  73

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASIC+ +G +EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  74   NPRASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFM  111



>gb|ACK43795.1| 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=484

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++L+K+AT NGHGE+S YFDGWKAYD+DPFHP  NP+GVIQMGLAENQL F  ++KW+ N
Sbjct  11   KLLAKLATGNGHGEDSPYFDGWKAYDSDPFHPTLNPRGVIQMGLAENQLSFGFVEKWMRN  70

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASICT +G +EFKD+AI+QDYHGLPEFR AVA FM
Sbjct  71   NPQASICTAEGIDEFKDVAIFQDYHGLPEFRNAVANFM  108



>dbj|BAK19927.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus petraeus]
Length=502

 Score =   165 bits (417),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            E+LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+ +W+L 
Sbjct  11   EILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLVTEWLLK  70

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASICT +G  +F D AI+QDYHGLPEFR AVA+FM
Sbjct  71   NPQASICTNEGVNKFMD-AIFQDYHGLPEFRSAVAKFM  107



>gb|ABW03085.1| 1-aminocyclopropane 1-carboxylate synthase 4 [Prunus salicina]
Length=492

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIAT+ GHGENS YFDGWKAYD +PFH   NP+GVIQMGLAENQL FDLI+ W+  N
Sbjct  12   LLSKIATSEGHGENSPYFDGWKAYDRNPFHSTKNPEGVIQMGLAENQLSFDLIEAWIKKN  71

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICTP+G EEF+++AI+QDYHG PEFR AVA FM
Sbjct  72   PKASICTPEGVEEFRNVAIFQDYHGFPEFRKAVAMFM  108



>ref|XP_008452008.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Cucumis 
melo]
Length=490

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            +VLSK+A  NGHGE+S+YFDGWKAYD+DPFHP  NP+GVIQMGLAENQL F+ ++KW+ N
Sbjct  14   KVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAENQLSFEFVEKWMKN  73

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASIC+ +G +EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  74   NPQASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFM  111



>dbj|BAA93713.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
Length=490

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            +VLSK+A  NGHGE+S+YFDGWKAYD+DPFHP  NP+GVIQMGLAENQL F+ ++KW+ N
Sbjct  14   KVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAENQLSFEFVEKWMKN  73

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASIC+ +G +EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  74   NPQASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFM  111



>dbj|BAB18464.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
Length=490

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            +VLSK+A  NGHGE+S+YFDGWKAYD+DPFHP  NP+GVIQMGLAENQL F+ ++KW+ N
Sbjct  14   KVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAENQLSFEFVEKWMKN  73

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASIC+ +G +EFKDIAI+QDYHGLPEFR AVA FM
Sbjct  74   NPQASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFM  111



>gb|AAC83146.1| 1-aminocyclopropane-1-carboxylate synthase [Nicotiana glutinosa]
Length=489

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K+  +LSK+ATN  HGENS YFDGWKAYDNDPFHP  NP GVIQMGLAENQLCF
Sbjct  1    MGFENEKNNSILSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI++W+  NP ASICT +G + F+ IA +QDYHGL EFR A+A+FME
Sbjct  61   DLIEEWIKRNPNASICTTEGIKSFRAIANFQDYHGLTEFRRAIAKFME  108



>ref|XP_009624213.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=487

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  HTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWV  364
            ++ VLSK+ATN  HGENS YFDGWKAYDNDPFH   NP GVIQMGLAENQLCFDLI++W+
Sbjct  9    NSVVLSKLATNEEHGENSPYFDGWKAYDNDPFHLVKNPNGVIQMGLAENQLCFDLIEEWI  68

Query  365  LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            + NPKASICT +G + F+ IA +QDYHGLPEFR A+A+FME
Sbjct  69   MRNPKASICTTEGIKYFRTIANFQDYHGLPEFRKAIAKFME  109



>ref|XP_002511916.1| acc synthase, putative [Ricinus communis]
 gb|EEF50585.1| acc synthase, putative [Ricinus communis]
Length=482

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            M   ++LS+IATN GHGENSAYFDGWKAYD +PFHP  NP GVIQMGLAENQL FDLI+ 
Sbjct  1    MPRDQLLSRIATNEGHGENSAYFDGWKAYDRNPFHPIDNPDGVIQMGLAENQLSFDLIRD  60

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            W+  NP+ASIC  +GA +FKD+A +QDYHGLPEFR A+A+FM
Sbjct  61   WIKRNPEASICNLEGASKFKDVANFQDYHGLPEFRQAIAKFM  102



>gb|AFT92042.2| 1-aminocyclopropane-1-carboxylate synthase [Paeonia lactiflora]
Length=492

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  170  LKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDL  349
            + T +  ++LSK+AT NGHGE+S YFDGWKAYD++PFH  +NP GVIQMGL EN L FD+
Sbjct  4    MSTDQQKQLLSKMATGNGHGEDSPYFDGWKAYDSNPFHLNNNPNGVIQMGLVENLLSFDV  63

Query  350  IKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            I++WVLNNPKASICTP+G  EF+D AI+QDYHG PEFR A+A+FM
Sbjct  64   IQEWVLNNPKASICTPEGINEFRDTAIFQDYHGFPEFRNAIAKFM  108



>ref|XP_002276774.2| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Vitis vinifera]
Length=474

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  197  LSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNP  376
            LSKIATN+ HGENS YFDGWKAYD +PFHP  NP GVIQMGLAENQL F+L+++W+L NP
Sbjct  3    LSKIATNDMHGENSLYFDGWKAYDENPFHPTKNPNGVIQMGLAENQLSFNLMEEWILKNP  62

Query  377  KASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            KASICTP+G  +FKD+AI+QDYHGL +FR AVA+FM
Sbjct  63   KASICTPEGISQFKDVAIFQDYHGLTQFRNAVAKFM  98



>emb|CAN69483.1| hypothetical protein VITISV_035777 [Vitis vinifera]
Length=481

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  197  LSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNP  376
            LSKIATN+ HGENS YFDGWKAYD +PFHP  NP GVIQMGLAENQL F+L+++W+L NP
Sbjct  3    LSKIATNDMHGENSLYFDGWKAYDENPFHPTKNPNGVIQMGLAENQLSFNLMEEWILKNP  62

Query  377  KASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            KASICTP+G  +FKD+AI+QDYHGL +FR AVA+FM
Sbjct  63   KASICTPEGISQFKDVAIFQDYHGLTQFRNAVAKFM  98



>gb|AAB96658.1| 1-aminocyclopropane-1-carboxylate synthase [Rumex palustris]
Length=489

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  170  LKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDL  349
            +  ++   +LSKIA+ +GHGE SAYFDGWKAYD DPFH   NP GVIQMGLAENQLC DL
Sbjct  1    MAEIQANNLLSKIASGDGHGEESAYFDGWKAYDKDPFHSSKNPLGVIQMGLAENQLCVDL  60

Query  350  IKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            ++ WV+ NP ASICTP G + FK++A +QDYHGLPEFR AVARFME
Sbjct  61   VQDWVVKNPSASICTPGGVDGFKEMANFQDYHGLPEFRNAVARFME  106



>gb|AAP14019.1|AF380836_1 putative ACC synthase 1 [Lactuca sativa]
Length=484

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M++      + LSKIATN+GHGENS YFDGWKAYD +P+HP++NP GVI MGLAENQLCF
Sbjct  1    MEVALNNSQKFLSKIATNDGHGENSPYFDGWKAYDTNPYHPQNNPTGVIHMGLAENQLCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+  +P+ASICTP+G  +F++IAI+QDYHGLP+FR A+A FM
Sbjct  61   DLIQEWIEKHPEASICTPEGGFDFREIAIFQDYHGLPKFRMAIANFM  107



>dbj|BAK19924.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus petraeus]
Length=506

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIATN+GHGEN  YFDGWKAYD DP+H   N  GVIQMGLAENQLCFDL+ +W+L N
Sbjct  12   ILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLVTEWLLKN  71

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM
Sbjct  72   PQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFM  108



>ref|XP_011022618.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Populus 
euphratica]
Length=480

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+IA+ NGHGE+S YF+GWKAYD++P H   NP GVIQMGLAENQLCFDLI+ W+ NN
Sbjct  9    LLSRIASGNGHGEDSPYFEGWKAYDSNPHHLTENPNGVIQMGLAENQLCFDLIQDWLKNN  68

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            PKASICTP+G  EF+++A++QDYHGLPEFR AVA+FME
Sbjct  69   PKASICTPEGVNEFREVALFQDYHGLPEFRNAVAKFME  106



>dbj|BAF33503.1| ACC synthase [Orobanche minor]
Length=497

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATNN HGENS YFDGWKAYDN+PFH   NP GVIQMGLAENQL  +L++KW  N
Sbjct  13   QLLSKIATNNEHGENSPYFDGWKAYDNNPFHTTKNPNGVIQMGLAENQLSSELVEKWTKN  72

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NPK+SIC+P+G + FKD+AI+QDYHGLPEFR AVA+FM
Sbjct  73   NPKSSICSPEGIDAFKDMAIFQDYHGLPEFRNAVAKFM  110



>ref|XP_009366577.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like, 
partial [Pyrus x bretschneideri]
Length=155

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M     K++ +LSKIATN  HGENS YF+GWKAYD +PFHP  NP+GVIQMGLAENQL F
Sbjct  1    MASSASKNSLLLSKIATNEKHGENSPYFNGWKAYDQNPFHPTENPEGVIQMGLAENQLSF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL+++W+  NPKAS CT +G E+F+ +A +QDYHG PEFR A+A FM
Sbjct  61   DLVEEWIRKNPKASFCTAEGVEKFRSVANFQDYHGFPEFRQAMATFM  107



>ref|NP_192867.1| 1-aminocyclopropane-1-carboxylate synthase 6 [Arabidopsis thaliana]
 sp|Q9SAR0.2|1A16_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase 6; Short=ACC 
synthase 6; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
6 [Arabidopsis thaliana]
 gb|AAK27237.1|AF361097_1 ACC synthase ACS6 [Arabidopsis thaliana]
 gb|AAL16124.1|AF428292_1 AT4g11280/F8L21_70 [Arabidopsis thaliana]
 emb|CAB51412.1| ACC synthase (AtACS-6) [Arabidopsis thaliana]
 emb|CAB81229.1| ACC synthase (AtACS-6) [Arabidopsis thaliana]
 gb|AAN18056.1| At4g11280/F8L21_70 [Arabidopsis thaliana]
 gb|AEE82992.1| 1-aminocyclopropane-1-carboxylate synthase 6 [Arabidopsis thaliana]
Length=495

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIA+ +GHGENS+YFDGWKAY+ +PFHP   P GVIQMGLAENQLC DL++KWVL +
Sbjct  14   LLSKIASGDGHGENSSYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRKWVLKH  73

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FME
Sbjct  74   PEASICTSEGVNQFSDIAIFQDYHGLPEFRQAVAKFME  111



>gb|KHN16788.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=484

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L     T++LSK+A  +GHGE S YFDGWKAYD +PFHPK NP GVIQMGLAENQL  
Sbjct  1    MGLMAANQTQLLSKMAIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTS  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL++ W+LNNP+ASICTP+G  +F+ IA +QDYHGLPEFR AVA+FM
Sbjct  61   DLVEDWILNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFM  107



>ref|XP_003538294.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Glycine 
max]
Length=480

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M+L ++   ++LSKIAT +GHGENS YFDGWKAY++DPFHP  NP GVIQMGLAENQL  
Sbjct  1    MELMSVNEPQLLSKIATGDGHGENSPYFDGWKAYEDDPFHPIKNPNGVIQMGLAENQLAS  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL++ W+ N P+ASICTP+G  +FK IA +QDYHGLP+FR AVA+FM
Sbjct  61   DLVQNWLTNKPRASICTPEGVRDFKAIANFQDYHGLPKFRKAVAKFM  107



>ref|NP_001236141.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
 gb|ABB70230.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
Length=484

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L     T++LSK+A  +GHGE S YFDGWKAYD +PFHPK NP GVIQMGLAENQL  
Sbjct  1    MGLMAANQTQLLSKMAIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTS  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL++ W+LNNP+ASICTP+G  +F+ IA +QDYHGLPEFR AVA+FM
Sbjct  61   DLVEDWILNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFM  107



>gb|ABO76785.1| 1-aminocyclopropane-1-carboxylate synthase [Citrullus colocynthis 
x Citrullus lanatus var. lanatus]
Length=486

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSK+A  NGHGE+S YFDGWKAYD+DPFHP  NP+GVIQMGLAENQL F+ ++KW+ N
Sbjct  11   KLLSKLAKGNGHGEDSPYFDGWKAYDSDPFHPTMNPRGVIQMGLAENQLSFEFVEKWMKN  70

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASICT +G  EFKD+AI+QDYHGLPEFR AVA FM
Sbjct  71   NPQASICTLEGVYEFKDVAIFQDYHGLPEFRKAVANFM  108



>gb|AER35096.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
Length=456

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  197  LSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNP  376
            +SKIAT NGHGENS YFDGWKAY+ +PFHP   P+GVIQMGLAENQLCF+LIK W++ +P
Sbjct  4    MSKIATGNGHGENSPYFDGWKAYETNPFHPTERPEGVIQMGLAENQLCFNLIKNWLIKHP  63

Query  377  KASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +AS+CTPQG  +FK+ A++QDYHG+PEFR AVA+FM
Sbjct  64   EASLCTPQGVNKFKETALFQDYHGMPEFRQAVAKFM  99



>gb|AAL35745.1| 1-aminocyclopropanecarboxylic acid synthase [Medicago truncatula]
Length=487

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L +M   ++LSKIAT +GHGE S+YFDGWKAYD +PFHP  NPQGVIQMGLAENQL  
Sbjct  1    MGLVSMDQPQLLSKIATGDGHGETSSYFDGWKAYDKNPFHPTKNPQGVIQMGLAENQLTA  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL++ W+++NP+ASICT +G   FK++A +QDYHGLPEFR AVA+FM
Sbjct  61   DLVQNWIMSNPEASICTLEGVHNFKEMANFQDYHGLPEFRNAVAKFM  107



>gb|KEH21137.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=487

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L +M   ++LSKIAT +GHGE S+YFDGWKAYD +PFHP  NPQGVIQMGLAENQL  
Sbjct  1    MGLVSMDQPQLLSKIATGDGHGETSSYFDGWKAYDKNPFHPTKNPQGVIQMGLAENQLTA  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL++ W+++NP+ASICT +G   FK++A +QDYHGLPEFR AVA+FM
Sbjct  61   DLVQNWIMSNPEASICTLEGVHNFKEMANFQDYHGLPEFRNAVAKFM  107



>emb|CAA51227.1| 1-aminocyclopropane-1-carboxylate synthase [Brassica juncea]
Length=497

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS++A  +GHGENSAYFDGWKAY+ +PFHP + P GVIQMGLAENQLC DL++KWVL +
Sbjct  13   LLSRMAAGDGHGENSAYFDGWKAYEENPFHPINRPDGVIQMGLAENQLCGDLMRKWVLEH  72

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FME
Sbjct  73   PEASICTAEGVNQFSDIAIFQDYHGLPEFRQAVAKFME  110



>gb|KHG06607.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium arboreum]
Length=478

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  197  LSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNP  376
            +SKIAT NGHGENS YFDGWKAY+ +PFHP   P+GVIQMGLAENQLCF+LIK W++ +P
Sbjct  4    MSKIATGNGHGENSPYFDGWKAYETNPFHPTERPEGVIQMGLAENQLCFNLIKNWLIKHP  63

Query  377  KASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +AS+CTPQG  +FK+ A++QDYHG+PEFR AVA+FM
Sbjct  64   EASLCTPQGVNKFKETALFQDYHGMPEFRQAVAKFM  99



>ref|XP_002872570.1| 1-aminocyclopropane-1-carboxylic acid (acc) synthase 6 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48829.1| 1-aminocyclopropane-1-carboxylic acid (acc) synthase 6 [Arabidopsis 
lyrata subsp. lyrata]
Length=495

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+IA+ +GHGENS+YFDGWKAY+ +PFHP   P GVIQMGLAENQLC DL++KWVL +
Sbjct  14   LLSRIASGDGHGENSSYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRKWVLKH  73

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G   F DIAI+QDYHGLPEFR AVA+FME
Sbjct  74   PEASICTSEGVNRFSDIAIFQDYHGLPEFRQAVAKFME  111



>gb|AAA33111.1| 1-aminocyclopropane-1-carboxylate synthase [Cucurbita pepo]
Length=493

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 89/110 (81%), Gaps = 3/110 (3%)
 Frame = +2

Query  155  YHHMDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQ  334
            +H +D    ++  +LSKIA ++GHGENS YFDGWKAYDNDPFHP++NP GVIQMGLAENQ
Sbjct  3    FHQID---ERNQALLSKIALDDGHGENSPYFDGWKAYDNDPFHPENNPLGVIQMGLAENQ  59

Query  335  LCFDLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            L FD+I  W+  +P+ASICTP+G E FK IA +QDYHGLPEFR A+A FM
Sbjct  60   LSFDMIVDWIRKHPEASICTPEGLERFKSIANFQDYHGLPEFRNAIANFM  109



>emb|CAN77934.1| hypothetical protein VITISV_021265 [Vitis vinifera]
Length=456

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  206  IATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNPKAS  385
            IAT+NGHGENS YFDGWKAYD+DP+HP  NP GVIQMGLAENQL FD+I++W+L NPKAS
Sbjct  1    IATDNGHGENSPYFDGWKAYDSDPYHPIENPGGVIQMGLAENQLSFDIIEEWLLKNPKAS  60

Query  386  ICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            ICT +G  EF+D+AI+QDYHGL EFR AVA+FM
Sbjct  61   ICTVEGMSEFRDVAIFQDYHGLKEFRNAVAKFM  93



>gb|ABM88785.1| 1-aminocyclopropane-1-carboxylate synthase [Camellia sinensis]
Length=477

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K   +LSK ATN  HGENS YFDGWKAYDNDPFHP  NP G+ +  L +N+LCF
Sbjct  1    MGFENAKTNSILSKFATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGLSRWVLQKNELCF  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLIK+WV+NNPKASICT +GA E K+IAIYQDYHGLPEFR  VA+FM
Sbjct  61   DLIKEWVVNNPKASICTAEGANELKNIAIYQDYHGLPEFRKGVAKFM  107



>sp|P23279.1|1A11_CUCPE RecName: Full=1-aminocyclopropane-1-carboxylate synthase 1; Short=ACC 
synthase 1; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Cucurbita pepo]
 gb|AAA33113.1| 1-aminocyclopropane-1-carboxylate synthase [Cucurbita pepo]
Length=493

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 89/110 (81%), Gaps = 3/110 (3%)
 Frame = +2

Query  155  YHHMDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQ  334
            +H +D    ++  +LSKIA ++GHGENS YFDGWKAYDNDPFHP++NP GVIQMGLAENQ
Sbjct  3    FHQID---ERNQALLSKIALDDGHGENSPYFDGWKAYDNDPFHPENNPLGVIQMGLAENQ  59

Query  335  LCFDLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            L FD+I  W+  +P+ASICTP+G E FK IA +QDYHGLPEFR A+A FM
Sbjct  60   LSFDMIVDWIRKHPEASICTPEGLERFKSIANFQDYHGLPEFRNAIANFM  109



>ref|XP_010455533.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6-like 
[Camelina sativa]
 ref|XP_010455534.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6-like 
[Camelina sativa]
Length=495

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+IA+ +GHGENS+YFDGWKAY+ +PFHP   P GVIQMGLAENQLC DL+++WV+ +
Sbjct  14   LLSRIASGDGHGENSSYFDGWKAYEANPFHPIDRPDGVIQMGLAENQLCGDLMRQWVIEH  73

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT QG  +F DIAIYQDYHGLPEFR AVA+FME
Sbjct  74   PEASICTEQGVNQFSDIAIYQDYHGLPEFRQAVAKFME  111



>gb|KJB24304.1| hypothetical protein B456_004G137900 [Gossypium raimondii]
Length=481

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  197  LSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNP  376
            +SKIAT NGHGENS YFDGWKAY+ +PFHP   P+GVIQMGLAENQLCF+LIK W++ +P
Sbjct  4    MSKIATGNGHGENSPYFDGWKAYETNPFHPTERPEGVIQMGLAENQLCFNLIKNWLIKHP  63

Query  377  KASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +AS+CTPQG  +FK+ A++QDYHG+PEFR AVA+FM
Sbjct  64   EASLCTPQGVNKFKETALFQDYHGMPEFRQAVAKFM  99



>ref|XP_006339629.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2 [Solanum 
tuberosum]
Length=486

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K   +LSK+AT+  HGENS YFDGWKAYD+DPFHP  NP GVIQMGLAENQLC 
Sbjct  1    MGFEIAKTNSILSKLATSEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCL  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI+ W+  NPKASIC+ +G + FK IA +QDYHGLPEFR A+A+FME
Sbjct  61   DLIEDWIKRNPKASICSNEGIKSFKAIANFQDYHGLPEFRRAIAKFME  108



>ref|XP_007160107.1| hypothetical protein PHAVU_002G293000g [Phaseolus vulgaris]
 gb|ESW32101.1| hypothetical protein PHAVU_002G293000g [Phaseolus vulgaris]
Length=484

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M LK M  T++LSK+A  +GHGE+S YFDGWKAYD +PFHP  NP GVIQMGLAENQL  
Sbjct  1    MGLKAMDKTQLLSKMAMGDGHGESSPYFDGWKAYDENPFHPTDNPNGVIQMGLAENQLTS  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL++ W+LNNP+ASICTP+G  +F+ IA +QDYHGL EFR AVA+FM
Sbjct  61   DLVEDWILNNPEASICTPEGIIDFRAIANFQDYHGLAEFRNAVAKFM  107



>ref|XP_009108182.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6 [Brassica 
rapa]
 emb|CDX86796.1| BnaA09g21860D [Brassica napus]
Length=488

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS++A  +GHGENSAYFDGWKAY+ +PFHP   P GVIQMGLAENQLC DL++KWVL +
Sbjct  13   LLSRMAAGDGHGENSAYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRKWVLEH  72

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FME
Sbjct  73   PEASICTAEGVNQFSDIAIFQDYHGLPEFRQAVAKFME  110



>ref|XP_006598931.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Glycine max]
 gb|KHN18815.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=474

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            M   ++LSKIATN+ HGENS YFDGWKAYD +PFHP  NPQGVIQMGLAENQLCFDLI++
Sbjct  1    MVSQQLLSKIATNDKHGENSPYFDGWKAYDRNPFHPTKNPQGVIQMGLAENQLCFDLIEE  60

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            W+ NNP+ASICTP+G  +F++IA +QDYHGL EF   +A FM
Sbjct  61   WIRNNPRASICTPEGVHQFRNIANFQDYHGLREFTNEMANFM  102



>ref|NP_001236858.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
 sp|P31531.1|1A1C_SOYBN RecName: Full=1-aminocyclopropane-1-carboxylate synthase; Short=ACC 
synthase; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Glycine max]
 emb|CAA47474.1| 1-aminocyclopropane 1-carboxylate synthase [Glycine max]
 prf||2019442A aminocyclopropane carboxylate synthase
Length=484

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L  +  T++LSK+   +GHGE S YFDGWKAYD +PFHPK NP GVIQMGLAENQL  
Sbjct  1    MGLMDVDQTQLLSKMVIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTS  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL++ W+LNNP+ASICTP+G  +F+ IA +QDYHGLPEFR AVA+FM
Sbjct  61   DLVEDWILNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFM  107



>ref|XP_010669851.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Beta 
vulgaris subsp. vulgaris]
Length=497

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATNNGHGE+  YFDGWKAYDNDP+H   NP GVIQMGLAENQL FDLIK+W++ 
Sbjct  14   QLLSKIATNNGHGEDVEYFDGWKAYDNDPYHITKNPNGVIQMGLAENQLSFDLIKEWMVQ  73

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASICT +G ++F DIA +QDYHGLPEFR AVA++M
Sbjct  74   NPQASICTNEGVDKFTDIANFQDYHGLPEFRHAVAKYM  111



>ref|XP_010053215.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like isoform 
X2 [Eucalyptus grandis]
Length=458

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+ ATN+GH EN  YFDGWKAYD DPFHP  NP GVIQMGLAE+QLCFDL+++W+++N
Sbjct  11   LLSRKATNDGHAENCPYFDGWKAYDKDPFHPTQNPSGVIQMGLAEHQLCFDLVQEWLVSN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P+ASICT +G ++F+DIA++QDYHGLP FR AVA+FM
Sbjct  71   PEASICTKEGVDKFRDIALFQDYHGLPAFRNAVAKFM  107



>gb|ACZ54911.3| 1-aminocyclopropane-1-carboxylic acid synthase [Narcissus tazetta 
var. chinensis]
Length=490

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN+GHGEN +YFDGWKAY++DPFHP  NP GVIQMGLAENQLC DLI+ W+  
Sbjct  13   QLLSKIATNDGHGENCSYFDGWKAYESDPFHPTRNPNGVIQMGLAENQLCHDLIQDWIKR  72

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EFK IA +QDYHGLP FR  +A+FME
Sbjct  73   NPEASICTAEGVNEFKSIANFQDYHGLPSFRQXLAKFME  111



>ref|XP_010435116.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6 [Camelina 
sativa]
Length=495

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+IA+ +GHGENS+YF+GWKAY+ +PFHP   P GVIQMGLAENQLC DL++KWV+ +
Sbjct  14   LLSRIASGDGHGENSSYFEGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRKWVIEH  73

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT QG  +F DIAI+QDYHGLPEFR AVA+FME
Sbjct  74   PEASICTEQGVNQFSDIAIFQDYHGLPEFRQAVAKFME  111



>ref|XP_008777259.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2-like 
[Phoenix dactylifera]
Length=144

 Score =   152 bits (384),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +2

Query  206  IATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNPKAS  385
            +ATN+GHGE S+YFDGWKAYD+DPFHP  NP+GVIQMGLAENQLC DL+++W+  N KAS
Sbjct  1    MATNDGHGEKSSYFDGWKAYDSDPFHPTENPEGVIQMGLAENQLCLDLMQEWIKENQKAS  60

Query  386  ICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            ICT  G  EFK IA +QDYHGLPEFR A+A+FM
Sbjct  61   ICTEAGVPEFKAIANFQDYHGLPEFREAIAKFM  93



>gb|AAC49153.1| 1-aminocyclopropane 1-carboxylate synthase [Pelargonium x hortorum]
Length=482

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  182  KHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKW  361
            K  ++LSKIATN+GHGENS YFDGWKAYD DPFHP  NP GVIQMGLAENQL  DLI+ W
Sbjct  4    KSKQLLSKIATNDGHGENSPYFDGWKAYDRDPFHPSQNPNGVIQMGLAENQLSSDLIEDW  63

Query  362  VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            V +NP+ASICT +G  +FKD+A +QDYHGL EFR AVA+FM
Sbjct  64   VRSNPEASICTLEGVGKFKDVANFQDYHGLLEFRHAVAKFM  104



>ref|XP_006396926.1| hypothetical protein EUTSA_v10028605mg [Eutrema salsugineum]
 gb|ESQ38379.1| hypothetical protein EUTSA_v10028605mg [Eutrema salsugineum]
Length=493

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+IA  +GHGENS+YFDGWKAY+ +PFHP   P GVIQMGLAENQLC DL++KWVL +
Sbjct  13   LLSRIAAGDGHGENSSYFDGWKAYEENPFHPIERPDGVIQMGLAENQLCGDLMRKWVLEH  72

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G   F DIAI+QDYHGLPEFR AVA+FME
Sbjct  73   PEASICTAEGVNHFSDIAIFQDYHGLPEFRQAVAKFME  110



>ref|XP_004510689.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Cicer arietinum]
Length=480

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L++  + ++LSKIATN+ HGENS YFDGW AY  +PFHP  NPQGVIQMGLAENQLCF
Sbjct  1    MSLRSESY-QLLSKIATNDQHGENSPYFDGWTAYKKNPFHPTTNPQGVIQMGLAENQLCF  59

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL ++W+ NNPKASICTP+G  +F+DIA +QDYHGLPEF  A+A +M
Sbjct  60   DLFEEWMKNNPKASICTPEGVHKFRDIANFQDYHGLPEFTSAMANYM  106



>ref|XP_010053214.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like isoform 
X1 [Eucalyptus grandis]
Length=486

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+ ATN+GH EN  YFDGWKAYD DPFHP  NP GVIQMGLAE+QLCFDL+++W+++N
Sbjct  11   LLSRKATNDGHAENCPYFDGWKAYDKDPFHPTQNPSGVIQMGLAEHQLCFDLVQEWLVSN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P+ASICT +G ++F+DIA++QDYHGLP FR AVA+FM
Sbjct  71   PEASICTKEGVDKFRDIALFQDYHGLPAFRNAVAKFM  107



>gb|KJB39618.1| hypothetical protein B456_007G024400 [Gossypium raimondii]
Length=477

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  197  LSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNP  376
            +SKIAT NGHGENSAYFDGWKAY+ +PFHP   P GVIQMGLAENQLCFD I+KW++ +P
Sbjct  4    ISKIATGNGHGENSAYFDGWKAYETNPFHPTDRPDGVIQMGLAENQLCFDFIEKWLMEHP  63

Query  377  KASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +ASICT +G  +FK+ A++QDYHG+PEFR AVA+FM
Sbjct  64   EASICTAEGVSKFKETALFQDYHGIPEFRQAVAKFM  99



>sp|P23599.1|1A11_CUCMA RecName: Full=1-aminocyclopropane-1-carboxylate synthase CMW33; 
Short=ACC synthase; AltName: Full=S-adenosyl-L-methionine 
methylthioadenosine-lyase [Cucurbita maxima]
 dbj|BAA00838.1| 1-aminocyclopropane-1-carboxylate synthase [Cucurbita maxima]
 prf||1710321A aminocyclopropane carboxylate synthase
 prf||1916421A aminocyclopropane carboxylate synthase:ISOTYPE=wound-induced
Length=493

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 3/110 (3%)
 Frame = +2

Query  155  YHHMDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQ  334
            +H +D    ++  +LSKIA ++GHGENS YFDGWKAYDNDPFHP+ NP GVIQMGLAENQ
Sbjct  3    FHQID---ERNQALLSKIAVDDGHGENSPYFDGWKAYDNDPFHPEDNPLGVIQMGLAENQ  59

Query  335  LCFDLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            L FD+I  W+  +P+ASICTP+G E FK IA +QDYHGLPEFR  +A FM
Sbjct  60   LSFDMIVDWIRKHPEASICTPKGLERFKSIANFQDYHGLPEFRNGIASFM  109



>ref|XP_010053213.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like isoform 
X2 [Eucalyptus grandis]
Length=458

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+ ATN GH EN  YFDGWKAYD DPFHP  NP GVIQMGLAE+QLCFDL+++W+++N
Sbjct  11   LLSRKATNEGHAENCPYFDGWKAYDKDPFHPSQNPDGVIQMGLAEHQLCFDLVQEWLVSN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P+ASICT +G ++F+DIA++QDYHGLP FR AVA+FM
Sbjct  71   PEASICTKKGVDKFRDIALFQDYHGLPAFRNAVAKFM  107



>gb|ABQ51839.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
 gb|ABQ51841.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
Length=482

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  182  KHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKW  361
            K  ++LSKIATN+GHGENS YFDGWKAYD DPFHP  NP GVIQMGLAENQL  DLI+ W
Sbjct  4    KSKQLLSKIATNDGHGENSPYFDGWKAYDRDPFHPSQNPNGVIQMGLAENQLSSDLIEDW  63

Query  362  VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            V +NP+ASICT +G  +FKD+A +QDYHGL EFR AVA+FM
Sbjct  64   VRSNPEASICTLEGVGKFKDVANFQDYHGLLEFRHAVAKFM  104



>ref|XP_006287590.1| hypothetical protein CARUB_v10000800mg [Capsella rubella]
 gb|EOA20488.1| hypothetical protein CARUB_v10000800mg [Capsella rubella]
Length=495

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+IA+ +GHGENS+YFDGWKAY+ +PFHP   P GVIQMGLAENQLC D+++KWVL +
Sbjct  14   LLSRIASGDGHGENSSYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDVMRKWVLKH  73

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT QG   F DIAI+QDYHGLPEFR AVA+FME
Sbjct  74   PEASICTEQGLNGFSDIAIFQDYHGLPEFRQAVAKFME  111



>gb|KHG14845.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium arboreum]
Length=477

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +2

Query  197  LSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNP  376
            +SKIAT NGHGENSAYFDGWKAY+ +PFHP   P GVIQMGLAENQLCFD I+KW++ +P
Sbjct  4    ISKIATGNGHGENSAYFDGWKAYETNPFHPTDRPDGVIQMGLAENQLCFDFIEKWLMEHP  63

Query  377  KASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +ASICT +G  +FK+ A++QDYHG PEFR AVA+FM
Sbjct  64   EASICTAEGVSKFKETALFQDYHGFPEFRQAVAKFM  99



>ref|XP_010556574.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2 [Tarenaya 
hassleriana]
Length=483

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  206  IATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNPKAS  385
            +ATN+ HGENS YFDGWKAYD DPFHP  NP G+IQMGLAENQLCFDLIK W+  NP+AS
Sbjct  1    MATNDNHGENSEYFDGWKAYDKDPFHPNRNPNGIIQMGLAENQLCFDLIKDWIKENPQAS  60

Query  386  ICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            IC P+G  +F D+AI+QDYHGL EFR A+A+FM
Sbjct  61   ICAPEGIHQFSDVAIFQDYHGLKEFRQAIAKFM  93



>emb|CDP10864.1| unnamed protein product [Coffea canephora]
Length=439

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSKIATN  HGENS YFDGWKAYDNDP+HP  NP GVIQMGLAEN L FDL+++W+  
Sbjct  9    QLLSKIATNEQHGENSPYFDGWKAYDNDPYHPTQNPNGVIQMGLAENPLSFDLVEEWIRK  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +P ASICT +G ++F+DIAI+QDYHGL EFR AVARFM
Sbjct  69   HPSASICTSEGVQKFRDIAIFQDYHGLTEFRNAVARFM  106



>gb|AJF36208.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Trifolium repens]
Length=488

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M + +M+  ++LSKIAT +GHGE S+YFDGWKAYD DPFH   NPQGVIQMGLAENQL  
Sbjct  1    MGVMSMEQPQLLSKIATGDGHGETSSYFDGWKAYDKDPFHITKNPQGVIQMGLAENQLTA  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL++ W+++NP+ASICT +G   FK++A +QDYHGLPEFR AVA+FM
Sbjct  61   DLVQNWIMSNPEASICTLEGVHNFKEMANFQDYHGLPEFRNAVAKFM  107



>ref|XP_010544767.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like protein 
1 isoform X2 [Tarenaya hassleriana]
Length=487

 Score =   160 bits (404),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIA  + HGE+S YFDGWKAY++DPFHP  NP GVIQMGLAENQLC DLIK+W+  N
Sbjct  9    LLSKIAGGDQHGEDSPYFDGWKAYEDDPFHPTRNPHGVIQMGLAENQLCSDLIKEWIKVN  68

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P ASICT +G  +F  +A++QDYHGLPEFR A+ARFM
Sbjct  69   PHASICTSEGVHDFSHVAVFQDYHGLPEFRQAIARFM  105



>ref|XP_010544766.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like protein 
1 isoform X1 [Tarenaya hassleriana]
Length=489

 Score =   160 bits (404),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIA  + HGE+S YFDGWKAY++DPFHP  NP GVIQMGLAENQLC DLIK+W+  N
Sbjct  9    LLSKIAGGDQHGEDSPYFDGWKAYEDDPFHPTRNPHGVIQMGLAENQLCSDLIKEWIKVN  68

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P ASICT +G  +F  +A++QDYHGLPEFR A+ARFM
Sbjct  69   PHASICTSEGVHDFSHVAVFQDYHGLPEFRQAIARFM  105



>ref|XP_010422075.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6-like 
[Camelina sativa]
Length=495

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+IA+ +GHGENS+YFDGWKAY+ +PFH    P GVIQMGLAENQLC DL++KWVL +
Sbjct  14   LLSRIASGDGHGENSSYFDGWKAYEENPFHQIDRPDGVIQMGLAENQLCGDLMRKWVLEH  73

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT QG  +F DIAI+QDYHGLPEFR AVA+FME
Sbjct  74   PEASICTEQGVNQFSDIAIFQDYHGLPEFRQAVAKFME  111



>ref|XP_010053212.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW77476.1| hypothetical protein EUGRSUZ_D01814 [Eucalyptus grandis]
Length=486

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+ ATN GH EN  YFDGWKAYD DPFHP  NP GVIQMGLAE+QLCFDL+++W+++N
Sbjct  11   LLSRKATNEGHAENCPYFDGWKAYDKDPFHPSQNPDGVIQMGLAEHQLCFDLVQEWLVSN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P+ASICT +G ++F+DIA++QDYHGLP FR AVA+FM
Sbjct  71   PEASICTKKGVDKFRDIALFQDYHGLPAFRNAVAKFM  107



>gb|ABB70229.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
Length=476

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  170  LKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDL  349
            L  +  T++LSK+   +GHGE S YFDGWKAYD +PFHPK NP GVIQMGLAENQL  DL
Sbjct  2    LMDVDQTQLLSKMVIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTSDL  61

Query  350  IKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            ++ W+LNNP+ASICTP+G  +F+ IA +QDYHGLPEFR AVA+FM
Sbjct  62   VEDWILNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFM  106



>emb|CDY65356.1| BnaC08g49010D [Brassica napus]
Length=473

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSK+A  + HGE+S YF+GWKAYDN+PFHP+HNPQGVIQMGLAENQLC DLIK+W+  N
Sbjct  7    MLSKLAVGDKHGEDSPYFEGWKAYDNNPFHPEHNPQGVIQMGLAENQLCSDLIKEWIKAN  66

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G + F DIA++QDYHGL +FR A+A FME
Sbjct  67   PQASICTAEGIDGFSDIAVFQDYHGLKQFRQAIAAFME  104



>ref|XP_002878386.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54645.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +2

Query  188  TEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVL  367
            +++LSK+A+++ HGE S YFDGWKAYDN+P+HP HNP GVIQMGLAENQLC DLIK+W+ 
Sbjct  2    SQLLSKLASSDKHGEASPYFDGWKAYDNNPYHPTHNPHGVIQMGLAENQLCSDLIKEWIR  61

Query  368  NNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
             NP+ASICT +G + F DIA++QDYHGL +FR A+A FME
Sbjct  62   KNPQASICTAEGIDSFSDIAVFQDYHGLKQFRQAIAAFME  101



>ref|XP_006418427.1| hypothetical protein EUTSA_v10007457mg [Eutrema salsugineum]
 gb|ESQ36780.1| hypothetical protein EUTSA_v10007457mg [Eutrema salsugineum]
Length=495

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+IAT+N HGENS YFDGWKAYD DPFH   NP G+IQMGLAENQLC +LIK W+  N
Sbjct  11   ILSRIATSNQHGENSEYFDGWKAYDKDPFHHSRNPHGIIQMGLAENQLCVELIKDWIKEN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PK SICTP+G  +F DIAI+QDYHGL EFR A+A FM
Sbjct  71   PKVSICTPEGVHQFSDIAIFQDYHGLKEFRQAIAHFM  107



>gb|ACX69843.1| ACC synthase [Rubus idaeus]
Length=491

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  HTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWV  364
            ++ +LSKIATN GHGEN AYFDGWKAYD +PFHP  NP+GVIQMGLAENQL  DLI++W+
Sbjct  4    NSALLSKIATNGGHGENLAYFDGWKAYDRNPFHPTQNPEGVIQMGLAENQLSLDLIEEWI  63

Query  365  LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
              NPKASICT +G EEFK++A +QDY+G P+FR A+A FM 
Sbjct  64   RKNPKASICTAEGVEEFKNVANFQDYYGFPDFRKAIANFMS  104



>emb|CAA57724.1| 1-aminocyclopropane-1-carboxylate synthase [Brassica oleracea]
Length=491

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS++A  +GHGE SAYFDGWKAY+ +PFHP   P GVIQMGLAENQLC DL++KWVL +
Sbjct  13   LLSRMAAGDGHGEKSAYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRKWVLEH  72

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FME
Sbjct  73   PEASICTAEGVNQFSDIAIFQDYHGLPEFRQAVAKFME  110



>gb|AAQ14266.1|AF248735_1 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=484

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSK+AT NGHGE+S YFDGWKAYD+DPFHP  NP+GVI+MG AENQL F  ++KW+ N
Sbjct  11   KLLSKLATGNGHGEDSPYFDGWKAYDSDPFHPTLNPRGVIEMGQAENQLSFGFVEKWMRN  70

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            NP+ASICT +G +EFKD+ I+QDYHGLPEFR AVA FM
Sbjct  71   NPQASICTAEGIDEFKDVDIFQDYHGLPEFRNAVANFM  108



>gb|AAD22099.2| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=485

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            E+LS+IATN+GHGENS+YFDGWKAY+NDPFH   NP GVIQMGLAENQL  DLI+ W+  
Sbjct  12   EILSRIATNDGHGENSSYFDGWKAYENDPFHLTDNPTGVIQMGLAENQLSLDLIQDWMKK  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FME
Sbjct  72   NPQASICTEEGVSEFKAIANFQDYHGLPAFRKAIAQFME  110



>gb|EYU32170.1| hypothetical protein MIMGU_mgv1a025862mg [Erythranthe guttata]
Length=464

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  197  LSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNP  376
            LSKIATN+ HGENS YFDGWKAYDNDPFHP  NP GVIQMGLAENQL  DLI++W+  NP
Sbjct  13   LSKIATNDEHGENSPYFDGWKAYDNDPFHPTLNPNGVIQMGLAENQLSLDLIEEWIKKNP  72

Query  377  KASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
             ASICT +G   FK+IA++QDYHGLPEFR  VA+FM
Sbjct  73   SASICTSEGIHAFKNIALFQDYHGLPEFRNGVAKFM  108



>gb|KFK31896.1| hypothetical protein AALP_AA6G173200 [Arabis alpina]
Length=497

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSK+A+  GHGENS+YFDGWKAY+ +PFHP   P GVIQMGLAENQLC DL++KWVL +
Sbjct  13   LLSKMASGEGHGENSSYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRKWVLEH  72

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G ++F + AI+QDYHGLPEFR AVARFME
Sbjct  73   PEASICTSEGVDQFGNFAIFQDYHGLPEFRQAVARFME  110



>emb|CDY13251.1| BnaC09g24050D [Brassica napus]
Length=491

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS++A  +GHGE SAYFDGWKAY+ +PFHP   P GVIQMGLAENQLC DL++KWVL +
Sbjct  13   LLSRMAAGDGHGEKSAYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRKWVLEH  72

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FME
Sbjct  73   PEASICTAEGVNQFSDIAIFQDYHGLPEFRQAVAKFME  110



>ref|XP_007040349.1| 1-aminocyclopropane-1-carboxylate synthase isoform 1 [Theobroma 
cacao]
 gb|EOY24850.1| 1-aminocyclopropane-1-carboxylate synthase isoform 1 [Theobroma 
cacao]
Length=478

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +2

Query  197  LSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNP  376
            +SKIAT NGHGENS YFDGWKAY+ +PFHP   P GVIQMGLAENQLCFD  +KW++ +P
Sbjct  4    MSKIATGNGHGENSPYFDGWKAYETNPFHPTERPNGVIQMGLAENQLCFDFFQKWLMKHP  63

Query  377  KASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +AS+C+P+G  +FK+ A++QDYHG+PEFR AVA+FM
Sbjct  64   EASLCSPEGVRKFKETALFQDYHGMPEFRKAVAKFM  99



>gb|KHM99945.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=481

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            +  T++LSK+   +GHGE S YFDGWKAYD +PFHPK NP GVIQMGLAENQL  DL++ 
Sbjct  3    VDQTQLLSKMVIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTSDLVED  62

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            W+LNNP+ASICTP+G  +F+ IA +QDYHGLPEFR AVA+FM
Sbjct  63   WILNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFM  104



>ref|XP_009116817.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like protein 
1 [Brassica rapa]
Length=473

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSK+A  + HGE+S YFDGWKAYD +PFHP+HNPQGVIQMGLAENQLC DLIK+W+  N
Sbjct  7    LLSKLAVGDKHGEDSPYFDGWKAYDTNPFHPEHNPQGVIQMGLAENQLCSDLIKEWIKAN  66

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G + F DIA++QDYHGL +FR A+A FME
Sbjct  67   PQASICTAEGIDGFSDIAVFQDYHGLKQFRQAIAAFME  104



>ref|XP_011023276.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Populus euphratica]
Length=486

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +2

Query  182  KHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKW  361
            +  ++LSKIATN+GHGENS YFDGWKAYD +PFHP  NP GVIQMGLAENQL  DLI  W
Sbjct  3    RQHQLLSKIATNDGHGENSPYFDGWKAYDKNPFHPTENPHGVIQMGLAENQLSADLIIDW  62

Query  362  VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            +  +PKASIC P+G   FKDIA +QDYHGLPEFR A+A+FME
Sbjct  63   MKKHPKASICNPEGVHLFKDIANFQDYHGLPEFRQAIAKFME  104



>emb|CDY11360.1| BnaA09g39260D [Brassica napus]
Length=473

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSK+A  + HGE+S YFDGWKAYD +PFHP+HNPQGVIQMGLAENQLC DLIK+W+  N
Sbjct  7    LLSKLAVGDKHGEDSPYFDGWKAYDTNPFHPEHNPQGVIQMGLAENQLCSDLIKEWIKAN  66

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G + F DIA++QDYHGL +FR A+A FME
Sbjct  67   PQASICTAEGIDGFSDIAVFQDYHGLKQFRQAIAAFME  104



>ref|XP_010457119.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2-like 
[Camelina sativa]
Length=497

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L       VLSKIATNN HGENS YFDGWKAYD DPFH  HNP G+IQMGLAENQLC 
Sbjct  1    MGLPGSNSGAVLSKIATNNQHGENSEYFDGWKAYDKDPFHLSHNPHGIIQMGLAENQLCL  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLIK W+  NP+ASICT +G  +F DIA +QDYHGL +FR A+A FM
Sbjct  61   DLIKDWIKENPEASICTLEGVHQFSDIANFQDYHGLKKFRQAIAHFM  107



>gb|KDO76335.1| hypothetical protein CISIN_1g011570mg [Citrus sinensis]
Length=483

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSKIA  NGHGE+S YFDGWKA+++DP+HP  NP GVIQMGLAEN LC 
Sbjct  1    MAFALSNQVQLLSKIAAGNGHGEDSPYFDGWKAFESDPYHPTKNPNGVIQMGLAENLLCH  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +L++ W++NNPKASIC+ +G  EFK IAI+QDYHGLPEFR AVA+FM
Sbjct  61   ELVEDWLMNNPKASICSAEGLNEFKGIAIFQDYHGLPEFRNAVAKFM  107



>ref|XP_009119698.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2 [Brassica 
rapa]
Length=499

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+IATN+ HGENS YFDGWKAYD DPFH   NP G+IQMGLAENQLC DLIK W+  N
Sbjct  14   ILSRIATNDQHGENSEYFDGWKAYDKDPFHLSRNPHGIIQMGLAENQLCLDLIKDWIKEN  73

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKAS+CTP+G  +F DIA +QDYHGL EFR A+A FM
Sbjct  74   PKASVCTPEGVYQFSDIANFQDYHGLNEFRQAIANFM  110



>ref|NP_001275831.1| 1-aminocyclopropane-1-carboxylate synthase-like [Citrus sinensis]
 ref|XP_006439472.1| hypothetical protein CICLE_v10019920mg [Citrus clementina]
 emb|CAB60721.1| ACC synthase [Citrus sinensis]
 emb|CAB60722.1| ACC synthase [Citrus sinensis]
 gb|ESR52712.1| hypothetical protein CICLE_v10019920mg [Citrus clementina]
Length=483

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSKIA  NGHGE+S YFDGWKA+++DP+HP  NP GVIQMGLAEN LC 
Sbjct  1    MAFALSNQVQLLSKIAAGNGHGEDSPYFDGWKAFESDPYHPTKNPNGVIQMGLAENLLCH  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +L++ W++NNPKASIC+ +G  EFK IAI+QDYHGLPEFR AVA+FM
Sbjct  61   ELVEDWLMNNPKASICSAEGLNEFKGIAIFQDYHGLPEFRNAVAKFM  107



>emb|CAA77688.1| 1-aminocyclopropane 1-carboxylate synthase [Vigna radiata var. 
radiata]
Length=484

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  K M  T +LSK+A  +GHGE+S YFDGWKAYD +PFHP  NP GV+QMGLAENQL  
Sbjct  1    MGFKAMDQTPLLSKMAIGDGHGESSPYFDGWKAYDQNPFHPTDNPNGVMQMGLAENQLTS  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL++ W+LNNP+ASICTP+G  +F+ IA +QDYHGL EFR AVA+FM
Sbjct  61   DLVEDWILNNPEASICTPEGINDFRAIANFQDYHGLAEFRNAVAKFM  107



>ref|XP_010279043.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nelumbo 
nucifera]
Length=482

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            VLSKIATN+GH E S YFDGWKAYD DPFHP  NP GVIQMGLAENQLCFDLI+ W+  +
Sbjct  9    VLSKIATNDGHSEESPYFDGWKAYDRDPFHPTQNPNGVIQMGLAENQLCFDLIEDWINRH  68

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P+ASICT QG   FKD AI+QDYHGL  FR AVA FM
Sbjct  69   PEASICTTQGVNGFKDTAIFQDYHGLLSFRKAVANFM  105



>ref|XP_003529924.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Glycine max]
Length=581

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            M++ ++LSKIA N+ HGENS YFDG KAYD +PFHPK NPQGVIQMGLAENQLCFDLI++
Sbjct  108  MQNQQLLSKIANNDKHGENSPYFDGLKAYDRNPFHPKKNPQGVIQMGLAENQLCFDLIEE  167

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            W+ NNPK SICTP+G  +F++IA +QDYHGL EF  A+A FM
Sbjct  168  WIRNNPKTSICTPEGVHQFRNIANFQDYHGLREFTNAMANFM  209



>ref|NP_191710.1| 1-aminocyclopropane-1-carboxylate synthase [Arabidopsis thaliana]
 sp|Q06429.2|1A11_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase-like 
protein 1 [Arabidopsis thaliana]
 gb|AAA96006.1| 1-aminocyclopropane-1-carboxylate synthase-like protein [Arabidopsis 
thaliana]
 gb|AAB60312.1| 1-aminocyclopropane-1-carboxylate synthase-like protein [Arabidopsis 
thaliana]
 emb|CAB71081.1| 1-aminocyclopropane-1-carboxylate synthase-like protein [Arabidopsis 
thaliana]
 gb|AAM91649.1| 1-aminocyclopropane-1-carboxylate synthase ACS1 [Arabidopsis 
thaliana]
 gb|AEE80216.1| 1-aminocyclopropane-1-carboxylate synthase [Arabidopsis thaliana]
 prf||2204225A aminocyclopropanecarboxylate synthase
Length=488

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSK+A ++ HGE S YF GWKAYDN+PFHP HNPQGVIQMGLAENQLC DLIK+W+  
Sbjct  9    QLLSKLALSDKHGEASPYFHGWKAYDNNPFHPTHNPQGVIQMGLAENQLCSDLIKEWIKE  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G + F DIA++QDYHGL +FR A+A FME
Sbjct  69   NPQASICTAEGIDSFSDIAVFQDYHGLKQFRQAIATFME  107



>ref|XP_008362641.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Malus domestica]
Length=491

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIATN  HGENS YFDGWKAYD +PFHP  NP+GVIQMGLAENQL FDL+++W+  N
Sbjct  11   LLSKIATNEKHGENSPYFDGWKAYDQNPFHPTENPEGVIQMGLAENQLSFDLVEEWIRKN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICT +G E+F+++A +QDYHG PEFR A+A FM
Sbjct  71   PKASICTAEGIEKFRNVANFQDYHGFPEFRQAIATFM  107



>ref|XP_010040891.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
Length=486

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+ ATN GH EN  YFDGWKAYD +PFHP  NP GVIQMGLAE+QLCFDL+++W+++N
Sbjct  11   LLSRKATNEGHAENCPYFDGWKAYDKNPFHPSQNPDGVIQMGLAEHQLCFDLVQEWLVSN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            P+ASICT +G ++F+DIA++QDYHGLP FR AVA+FM
Sbjct  71   PEASICTKEGVDKFRDIALFQDYHGLPAFRNAVAKFM  107



>gb|AAA81580.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K   +LSK+ATN  HGENS YFDGWKAYD+DPFHP  NP GVIQMGLAENQLC 
Sbjct  1    MGFEIAKTNSILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCL  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI+ W+  NPK SIC+ +G + FK IA +QDYHGLPEFR A+A+FME
Sbjct  61   DLIEDWIKRNPKGSICS-EGIKSFKAIANFQDYHGLPEFRKAIAKFME  107



>sp|P18485.2|1A12_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate synthase 2; Short=ACC 
synthase 2; AltName: Full=Le-ACS2; Short=ACS-2; AltName: 
Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
2 [Solanum lycopersicum]
 emb|CAA41855.1| 1-aminocyclopropane 1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K   +LSK+ATN  HGENS YFDGWKAYD+DPFHP  NP GVIQMGLAENQLC 
Sbjct  1    MGFEIAKTNSILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCL  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI+ W+  NPK SIC+ +G + FK IA +QDYHGLPEFR A+A+FME
Sbjct  61   DLIEDWIKRNPKGSICS-EGIKSFKAIANFQDYHGLPEFRKAIAKFME  107



>emb|CAA41856.1| 1-aminocyclopropane 1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K   +LSK+ATN  HGENS YFDGWKAYD+DPFHP  NP GVIQMGLAENQLC 
Sbjct  1    MGFEIAKTNSILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCL  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI+ W+  NPK SIC+ +G + FK IA +QDYHGLPEFR A+A+FME
Sbjct  61   DLIEDWIKRNPKGSICS-EGIKSFKAIANFQDYHGLPEFRKAIAKFME  107



>ref|NP_001234178.1| 1-aminocyclopropane-1-carboxylate synthase 2 [Solanum lycopersicum]
 gb|AAP96918.1| ripening-related ACC synthase 2 [Solanum lycopersicum]
Length=485

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M  +  K   +LSK+ATN  HGENS YFDGWKAYD+DPFHP  NP GVIQMGLAENQLC 
Sbjct  1    MGFEIAKTNSILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCL  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            DLI+ W+  NPK SIC+ +G + FK IA +QDYHGLPEFR A+A+FME
Sbjct  61   DLIEDWIKRNPKGSICS-EGIKSFKAIANFQDYHGLPEFRKAIAKFME  107



>ref|XP_008345341.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1 [Malus 
domestica]
Length=495

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIATN  HGENS YFDGWKAYD +PFHP  NP+GVIQMGLAENQL FDL+++W+  N
Sbjct  11   LLSKIATNEKHGENSPYFDGWKAYDQNPFHPTENPEGVIQMGLAENQLSFDLVEEWIRKN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICT +G E+F+++A +QDYHG PEFR A+A FM
Sbjct  71   PKASICTAEGIEKFRNVANFQDYHGFPEFRQAIATFM  107



>ref|XP_008364813.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Malus domestica]
Length=503

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +2

Query  182  KHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKW  361
            +H+ +LSKIATN  HGENS YFDGWKAYD +PFHP  NP+GVIQMGLAENQL  DL+++W
Sbjct  7    EHSLLLSKIATNEQHGENSPYFDGWKAYDQNPFHPTENPEGVIQMGLAENQLSLDLVEEW  66

Query  362  VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +  NPKAS+CT +G E+F+ +A +QDYHG PEFR A+A FM
Sbjct  67   IRKNPKASLCTAEGVEKFRSVANFQDYHGFPEFRQAIATFM  107



>gb|AEY82446.1| 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=495

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIATN+GHGE+S YFDGWKAYDNDPFHP  NP GVIQMGLAENQL  DLI  W+  N
Sbjct  12   LLSKIATNDGHGEDSPYFDGWKAYDNDPFHPDKNPSGVIQMGLAENQLSSDLIVDWIRRN  71

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKAS+CT +G   FKDIA +QDYHGLPEFR  +A FM
Sbjct  72   PKASLCTEEGLGSFKDIANFQDYHGLPEFREGIANFM  108



>ref|XP_010041705.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
Length=432

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS+ ATN+GH ENS YFDGWKAYD+DPFHP  NP GVIQMGLAE+QLCF+L++KW+ NN
Sbjct  11   LLSQKATNDGHAENSPYFDGWKAYDSDPFHPTQNPSGVIQMGLAEHQLCFNLVQKWLENN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFR  463
            P+ASICT +G ++F+DIAI+QDYHGLPEFR
Sbjct  71   PEASICTKEGVDKFRDIAIFQDYHGLPEFR  100



>ref|XP_009341128.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
synthase 1 [Pyrus x bretschneideri]
Length=155

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LSKIATN  HGE+S YFDGWKAYD  PFHP  NP GVI+M LAENQL FDL+++W+  N
Sbjct  11   LLSKIATNEKHGEDSPYFDGWKAYDQKPFHPTENPXGVIRMDLAENQLSFDLVEEWIKKN  70

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            PKASICT +G E+F+++A +QDYHGLPEF+ A+A FM
Sbjct  71   PKASICTAEGIEKFRNVANFQDYHGLPEFKQAIATFM  107



>ref|XP_006829176.1| hypothetical protein AMTR_s00001p00270760 [Amborella trichopoda]
 gb|ERM96592.1| hypothetical protein AMTR_s00001p00270760 [Amborella trichopoda]
Length=480

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +2

Query  179  MKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKK  358
            M +  +LS +ATN+ HGENS YFDGWKAYD++P+HP + P GVIQMGLAENQLCFDLI+ 
Sbjct  1    MCNPHLLSNVATNDAHGENSPYFDGWKAYDDNPYHPINKPHGVIQMGLAENQLCFDLIED  60

Query  359  WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            W+  NP+ASICT QG   FK+IA+YQDYHGLP F  AVA FME
Sbjct  61   WMRRNPQASICTSQGLSNFKEIALYQDYHGLPSFTKAVAEFME  103



>ref|XP_002892062.1| 1-amino-cyclopropane-1-carboxylate synthase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68321.1| 1-amino-cyclopropane-1-carboxylate synthase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=496

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L       +LSKIATN+ HGENS YFDGWKAYD DPFH   NP G+IQMGLAENQLC 
Sbjct  1    MGLPAKNKGAILSKIATNDQHGENSEYFDGWKAYDKDPFHLSRNPHGIIQMGLAENQLCL  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLIK WV+ NP+ASICT +G  +F DIA +QDYHGL +FR A+A FM
Sbjct  61   DLIKDWVMENPEASICTLEGVHQFSDIANFQDYHGLKKFRQAIAHFM  107



>gb|KFK42535.1| hypothetical protein AALP_AA1G007100 [Arabis alpina]
Length=497

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +2

Query  197  LSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNNP  376
            LSKIAT++ HGENS YFDGWKAYD DPFH   NP G+IQMGLAENQLC DLIK W+  NP
Sbjct  12   LSKIATSDQHGENSEYFDGWKAYDKDPFHLSRNPHGIIQMGLAENQLCIDLIKDWIKENP  71

Query  377  KASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            KASICTP+G  +F DIA +QDYHGL EFR A+A FM
Sbjct  72   KASICTPEGIHQFDDIANFQDYHGLKEFRQAIAHFM  107



>ref|XP_011092964.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1 [Sesamum 
indicum]
Length=477

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M+L      ++LSKIA+++ HGENS YFDGWKAYDNDPFHP  NP GVIQMGLAENQL  
Sbjct  1    MELMNSGKRQLLSKIASSDEHGENSPYFDGWKAYDNDPFHPTQNPHGVIQMGLAENQLPV  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DLI++W+  NP ASICT +G   FK  A+YQDYHGLPEFR AVA+ M
Sbjct  61   DLIEEWIKKNPSASICTTEGLHAFKSTALYQDYHGLPEFRHAVAKLM  107



>dbj|BAA84945.1| ACC synthase [Musa acuminata AAA Group]
Length=486

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LS+IATN+GHGENS+YFDGWKAY+ DPFH   NP GVIQMGLAENQL  DLI+ W+  
Sbjct  12   QILSRIATNDGHGENSSYFDGWKAYERDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FME
Sbjct  72   NPQASICTEEGVSEFKAIANFQDYHGLPTFRKAIAQFME  110



>ref|XP_006402473.1| hypothetical protein EUTSA_v10005927mg [Eutrema salsugineum]
 gb|ESQ43926.1| hypothetical protein EUTSA_v10005927mg [Eutrema salsugineum]
Length=482

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  194  VLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLNN  373
            +LS++A  + HGE+S YFDGWKAYDN+PFHP HNPQGVIQMGLAENQLC DLIK+W+  N
Sbjct  7    LLSELAVGDKHGEDSPYFDGWKAYDNNPFHPDHNPQGVIQMGLAENQLCSDLIKEWIKAN  66

Query  374  PKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            P+ASICT +G + F DIA++QDYHGL +FR  +A FME
Sbjct  67   PQASICTAEGIDGFSDIAVFQDYHGLKQFRQGIAAFME  104



>ref|XP_004503673.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Cicer 
arietinum]
Length=487

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M L +M   ++LSKIAT +GHGE+S+YFDGWKAYD DPFH   NP GVIQMGLAENQL  
Sbjct  1    MGLMSMDQPQLLSKIATGDGHGESSSYFDGWKAYDKDPFHLTKNPHGVIQMGLAENQLTA  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            DL++ W+++NP+ASICT +G   FK +A +QDYHGLPEFR AVA+FM
Sbjct  61   DLVQNWIMSNPEASICTLEGVHNFKHMANFQDYHGLPEFRNAVAKFM  107



>gb|ACV30003.1| ACC synthase family protein [Musa acuminata AAA Group]
Length=483

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LS+IATN+GHGENS+YFDGWKAY+ DPFH   NP GVIQMGLAENQL  DLI+ W+  
Sbjct  9    QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FME
Sbjct  69   NPQASICTEEGVSEFKAIANFQDYHGLPTFRKAIAQFME  107



>ref|XP_010512497.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like protein 
1 isoform X1 [Camelina sativa]
Length=490

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +2

Query  188  TEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVL  367
              +LSK+A+ + HGE S YFDGWKAYDN+P+HP HNPQGVIQMGLAENQLC DLIK W+ 
Sbjct  6    ASLLSKLASGDKHGEASPYFDGWKAYDNNPYHPTHNPQGVIQMGLAENQLCSDLIKDWIK  65

Query  368  NNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
             NP ASICT +G + F DIA++QDYHGL  FR A+A FME
Sbjct  66   ENPHASICTAEGVDSFSDIAVFQDYHGLKLFRQAIAAFME  105



>gb|AAU09672.1| ACC synthase [Musa acuminata AAA Group]
Length=486

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LS+IATN+GHGENS+YFDGWKAY+ DPFH   NP GVIQMGLAENQL  DLI+ W+  
Sbjct  12   QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FME
Sbjct  72   NPQASICTEEGVSEFKAIANFQDYHGLPTFRKAIAQFME  110



>gb|AAC31571.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
 gb|AAQ13437.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
 gb|AAR00512.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=486

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LS+IATN+GHGENS+YFDGWKAY+ DPFH   NP GVIQMGLAENQL  DLI+ W+  
Sbjct  12   QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FME
Sbjct  72   NPQASICTEEGVSEFKAIANFQDYHGLPTFRKAIAQFME  110



>gb|ACV33064.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=483

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LS+IATN+GHGENS+YFDGWKAY+ DPFH   NP GVIQMGLAENQL  DLI+ W+  
Sbjct  9    QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  68

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FME
Sbjct  69   NPQASICTEEGVSEFKAIANFQDYHGLPAFRKAIAQFME  107



>ref|XP_006345579.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 4-like 
[Solanum tuberosum]
Length=496

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  167  DLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFD  346
            ++   K + VLSK+A+N  HGE S YFDGWKAYDNDPFHP +NP GVIQMGLAENQL  D
Sbjct  7    EISNYKSSVVLSKLASNEQHGEKSPYFDGWKAYDNDPFHPVNNPNGVIQMGLAENQLSVD  66

Query  347  LIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            LI+ W+  NPKASICT  G E F+ IA +QDYHGLPEF  A+A+FME
Sbjct  67   LIEDWIKRNPKASICTNDGIESFRRIANFQDYHGLPEFTNAIAKFME  113



>emb|CAE53271.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata]
Length=486

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LS+IATN+GHGENS+YFDGWKAY+ DPFH   NP GVIQMGLAENQL  DLI+ W+  
Sbjct  12   QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FME
Sbjct  72   NPQASICTEEGVSEFKAIANFQDYHGLPAFRKAIAQFME  110



>gb|AAO91942.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=486

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LS+IATN+GHGENS+YFDGWKAY+ DPFH   NP GVIQMGLAENQL  DLI+ W+  
Sbjct  12   QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FME
Sbjct  72   NPQASICTEEGVSEFKAIANFQDYHGLPTFRKAIAQFME  110



>gb|AEM65195.1| ACC synthase [Garcinia mangostana]
Length=404

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LSK+AT++GHGENS YFDGWKAYD +PFHP +NP+GVIQMGLAENQLC DLI++W+  
Sbjct  1    QLLSKMATSDGHGENSPYFDGWKAYDRNPFHPTNNPRGVIQMGLAENQLCLDLIEEWIKK  60

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASI T +G   FKDIA +QDYHGL EFR A+A+ ME
Sbjct  61   NPQASIFTVEGVSSFKDIANFQDYHGLLEFRQAIAKLME  99



>ref|XP_009397633.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Musa 
acuminata subsp. malaccensis]
 gb|AAQ13436.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
 gb|AAR00513.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=486

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LS+IATN+GHGENS+YFDGWKAY+ DPFH   NP GVIQMGLAENQL  DLI+ W+  
Sbjct  12   QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FME
Sbjct  72   NPQASICTEEGVSEFKAIANFQDYHGLPAFRKAIAQFME  110



>ref|XP_010469085.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like protein 
1 [Camelina sativa]
Length=490

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +2

Query  188  TEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVL  367
              +LSK+A+ + HGE S YFDGWKAYDN+P+HP HNPQGVIQMGLAENQLC DLIK W+ 
Sbjct  6    ASLLSKLASGDKHGEASPYFDGWKAYDNNPYHPTHNPQGVIQMGLAENQLCSDLIKDWIK  65

Query  368  NNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
             NP ASICT +G + F DIA++QDYHGL  FR A+A FME
Sbjct  66   ENPHASICTAEGVDSFSDIAVFQDYHGLKLFRQAIAAFME  105



>emb|CAD44267.2| putative aminocyclopropane carboxylic acid synthase [Musa AAB 
Group]
Length=485

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  191  EVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCFDLIKKWVLN  370
            ++LS+IATN+GHGENS+YFDGWKAY+ DPFH   NP GVIQMGLAENQL  DLI+ W+  
Sbjct  12   QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  371  NPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFME  487
            NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FME
Sbjct  72   NPQASICTEEGVSEFKAIANFQDYHGLPAFRKAIAQFME  110



>emb|CAB76930.1| ACC synthase [Citrus sinensis]
Length=403

 Score =   155 bits (391),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  164  MDLKTMKHTEVLSKIATNNGHGENSAYFDGWKAYDNDPFHPKHNPQGVIQMGLAENQLCF  343
            M        ++LSKIA  NGHGE+S YFDGWKA+++DP+HP  NP GVIQMGLAEN LC 
Sbjct  1    MAFALSNQEQLLSKIAAGNGHGEDSPYFDGWKAFESDPYHPTKNPNGVIQMGLAENLLCH  60

Query  344  DLIKKWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRCAVARFM  484
            +L++ W++NNPKASIC+ +G  EFK IA +QDYHGLPEFR AVA+FM
Sbjct  61   ELVEDWLMNNPKASICSAEGLNEFKGIANFQDYHGLPEFRNAVAKFM  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960