BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I21

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004247800.1|  PREDICTED: uncharacterized protein LOC101247...    189   2e-52   Solanum lycopersicum
ref|XP_010326801.1|  PREDICTED: uncharacterized protein LOC101247...    188   2e-52   
ref|XP_006340898.1|  PREDICTED: uncharacterized protein LOC102585544    187   7e-52   Solanum tuberosum [potatoes]
ref|XP_009784169.1|  PREDICTED: uncharacterized protein LOC104232...    177   3e-48   Nicotiana sylvestris
ref|XP_006340899.1|  PREDICTED: uncharacterized protein LOC102586101    174   3e-47   Solanum tuberosum [potatoes]
emb|CDO99377.1|  unnamed protein product                                172   2e-46   Coffea canephora [robusta coffee]
ref|XP_009605709.1|  PREDICTED: uncharacterized protein LOC104100...    170   5e-46   Nicotiana tomentosiformis
ref|XP_009605708.1|  PREDICTED: uncharacterized protein LOC104100...    170   1e-45   Nicotiana tomentosiformis
ref|XP_011091375.1|  PREDICTED: uncharacterized protein LOC105171...    156   1e-40   Sesamum indicum [beniseed]
ref|XP_010111571.1|  Multiple C2 and transmembrane domain-contain...    141   3e-38   
ref|XP_006378312.1|  hypothetical protein POPTR_0010s07320g             137   9e-37   
ref|XP_011041478.1|  PREDICTED: uncharacterized protein LOC105137440    142   1e-35   Populus euphratica
ref|XP_007034560.1|  Triglyceride lipases,triglyceride lipases is...    139   2e-35   
ref|XP_007034559.1|  Triglyceride lipases,triglyceride lipases is...    140   3e-35   
ref|XP_007034558.1|  Triglyceride lipases,triglyceride lipases is...    140   5e-35   
gb|KCW60152.1|  hypothetical protein EUGRSUZ_H02878                     132   1e-34   Eucalyptus grandis [rose gum]
ref|XP_010265031.1|  PREDICTED: uncharacterized protein LOC104602867    139   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_007145362.1|  hypothetical protein PHAVU_007G2328000g            129   3e-34   Phaseolus vulgaris [French bean]
emb|CDY47362.1|  BnaCnng14990D                                          134   5e-33   Brassica napus [oilseed rape]
ref|XP_010023780.1|  PREDICTED: uncharacterized protein LOC104414...    133   1e-32   Eucalyptus grandis [rose gum]
ref|XP_008460598.1|  PREDICTED: uncharacterized protein LOC103499...    131   4e-32   
ref|XP_009139618.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    131   6e-32   
ref|XP_008460597.1|  PREDICTED: uncharacterized protein LOC103499...    131   6e-32   Cucumis melo [Oriental melon]
ref|XP_008391285.1|  PREDICTED: uncharacterized protein LOC103453525    131   9e-32   
ref|XP_010645210.1|  PREDICTED: uncharacterized protein LOC100249...    130   1e-31   
ref|XP_010645211.1|  PREDICTED: uncharacterized protein LOC100249...    130   1e-31   Vitis vinifera
ref|XP_010645209.1|  PREDICTED: uncharacterized protein LOC100249...    130   1e-31   Vitis vinifera
ref|XP_009350112.1|  PREDICTED: uncharacterized protein LOC103941626    130   1e-31   
ref|XP_010527178.1|  PREDICTED: uncharacterized protein LOC104804...    130   2e-31   Tarenaya hassleriana [spider flower]
ref|XP_006493996.1|  PREDICTED: uncharacterized protein LOC102627249    130   2e-31   Citrus sinensis [apfelsine]
gb|KFK36238.1|  hypothetical protein AALP_AA4G096300                    129   3e-31   Arabis alpina [alpine rockcress]
emb|CDY01137.1|  BnaA04g06820D                                          129   3e-31   
ref|XP_006605749.1|  PREDICTED: uncharacterized protein LOC100777...    129   5e-31   Glycine max [soybeans]
ref|XP_006605750.1|  PREDICTED: uncharacterized protein LOC100777...    129   5e-31   
gb|KDP33361.1|  hypothetical protein JCGZ_12910                         129   5e-31   Jatropha curcas
ref|XP_011462434.1|  PREDICTED: uncharacterized protein LOC101295...    129   6e-31   Fragaria vesca subsp. vesca
ref|XP_004497785.1|  PREDICTED: uncharacterized protein LOC101502015    129   6e-31   
ref|XP_009343399.1|  PREDICTED: uncharacterized protein LOC103935...    128   6e-31   Pyrus x bretschneideri [bai li]
gb|KHG01947.1|  putative feruloyl esterase A                            128   9e-31   Gossypium arboreum [tree cotton]
ref|XP_006420413.1|  hypothetical protein CICLE_v10004289mg             128   9e-31   Citrus clementina [clementine]
gb|KHN23579.1|  hypothetical protein glysoja_043863                     119   2e-30   Glycine soja [wild soybean]
gb|KJB28235.1|  hypothetical protein B456_005G036200                    126   4e-30   Gossypium raimondii
gb|KHN14015.1|  Putative feruloyl esterase A                            126   5e-30   Glycine soja [wild soybean]
gb|AES60457.2|  triacylglycerol lipase, putative                        126   5e-30   Medicago truncatula
gb|KGN49702.1|  hypothetical protein Csa_5G077210                       123   7e-30   Cucumis sativus [cucumbers]
ref|XP_003590206.1|  hypothetical protein MTR_1g045930                  125   7e-30   
gb|KDO55741.1|  hypothetical protein CISIN_1g039195mg                   118   1e-29   Citrus sinensis [apfelsine]
ref|XP_006283081.1|  hypothetical protein CARUB_v10004094mg             125   1e-29   
ref|XP_009390021.1|  PREDICTED: uncharacterized protein LOC103976...    122   7e-29   
ref|XP_009390013.1|  PREDICTED: uncharacterized protein LOC103976...    122   7e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS61954.1|  hypothetical protein M569_12842                         112   7e-29   Genlisea aurea
ref|XP_010435249.1|  PREDICTED: uncharacterized protein LOC104719...    121   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010666968.1|  PREDICTED: uncharacterized protein LOC104884071    121   2e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002311707.1|  hypothetical protein POPTR_0008s17430g             113   5e-28   
ref|XP_010918961.1|  PREDICTED: uncharacterized protein LOC105043202    120   7e-28   
ref|XP_006589064.1|  PREDICTED: uncharacterized protein LOC100789...    119   1e-27   Glycine max [soybeans]
ref|XP_006589063.1|  PREDICTED: uncharacterized protein LOC100789...    119   2e-27   Glycine max [soybeans]
ref|XP_010450193.1|  PREDICTED: uncharacterized protein LOC104732...    119   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010450194.1|  PREDICTED: uncharacterized protein LOC104732...    118   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006652497.1|  PREDICTED: uncharacterized protein LOC102701164    118   2e-27   
ref|XP_004976177.1|  PREDICTED: uncharacterized protein LOC101766...    118   3e-27   Setaria italica
ref|XP_004976178.1|  PREDICTED: uncharacterized protein LOC101766...    118   3e-27   
ref|XP_002446773.1|  hypothetical protein SORBIDRAFT_06g022160          118   3e-27   
gb|EEC77614.1|  hypothetical protein OsI_16594                          118   3e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001053276.1|  Os04g0509100                                       118   4e-27   
ref|XP_008663380.1|  PREDICTED: uncharacterized protein LOC103641...    117   7e-27   Zea mays [maize]
gb|AFW58815.1|  hypothetical protein ZEAMMB73_298032                    116   7e-27   
ref|XP_008663379.1|  PREDICTED: uncharacterized protein LOC103641...    116   1e-26   Zea mays [maize]
ref|XP_008663378.1|  PREDICTED: uncharacterized protein LOC103641...    116   1e-26   Zea mays [maize]
ref|XP_006830588.1|  hypothetical protein AMTR_s00120p00025450          113   1e-25   
dbj|BAJ91052.1|  predicted protein                                      105   9e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001782810.1|  predicted protein                                  103   3e-22   
ref|XP_010240119.1|  PREDICTED: uncharacterized protein LOC100834...    102   7e-22   
ref|XP_010240118.1|  PREDICTED: uncharacterized protein LOC100834...    102   9e-22   
ref|XP_003580112.1|  PREDICTED: uncharacterized protein LOC100834...    102   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_002974656.1|  hypothetical protein SELMODRAFT_415006           92.4    3e-18   
ref|XP_011029717.1|  PREDICTED: uncharacterized protein LOC105129384  85.1    1e-17   Populus euphratica
ref|XP_002963368.1|  hypothetical protein SELMODRAFT_405179           89.0    4e-17   
gb|EEE61315.1|  hypothetical protein OsJ_15419                        81.3    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009784178.1|  PREDICTED: uncharacterized protein LOC104232...  75.1    2e-12   Nicotiana sylvestris
ref|XP_007225276.1|  hypothetical protein PRUPE_ppa001457mg           73.6    6e-12   
gb|EYU22285.1|  hypothetical protein MIMGU_mgv1a001923mg              72.0    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_002518194.1|  triacylglycerol lipase, putative                 71.6    3e-11   
ref|XP_005774725.1|  hypothetical protein EMIHUDRAFT_463707           59.7    3e-07   Emiliania huxleyi CCMP1516
ref|XP_002504916.1|  predicted protein                                58.9    4e-07   Micromonas commoda
ref|XP_002870378.1|  lipase class 3 family protein                    58.2    7e-07   
gb|EWM23354.1|  triacylglycerol lipase                                55.5    5e-06   Nannochloropsis gaditana
ref|XP_005537825.1|  similar to triacylglycerol lipase                55.1    7e-06   Cyanidioschyzon merolae strain 10D
ref|XP_008775136.1|  PREDICTED: uncharacterized protein LOC103695549  54.7    9e-06   
ref|XP_002296243.1|  predicted protein                                53.5    2e-05   Thalassiosira pseudonana CCMP1335
emb|CAB41113.1|  putative protein                                     53.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142337.1|  PREDICTED: uncharacterized protein LOC101204368  53.1    3e-05   
gb|EJK50906.1|  hypothetical protein THAOC_29977                      51.6    1e-04   Thalassiosira oceanica



>ref|XP_004247800.1| PREDICTED: uncharacterized protein LOC101247860 isoform X1 [Solanum 
lycopersicum]
Length=863

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 115/146 (79%), Gaps = 8/146 (5%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKAS----  244
            MA L TH Q   FPI SSPR  HF+NP ++SFS+KL F +K+ G++  S F  K S    
Sbjct  1    MATLQTHLQ---FPICSSPRLFHFKNPNSVSFSKKLFFSRKVNGLFSYSKFGAKDSFFCC  57

Query  245  SKASSDVESLSTVEEEKE-SERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQT  421
            S+ S ++  LS+ ++EKE SERPPFDINLAVILAGFAFEAYT+PP+NVGK EVDAANC+T
Sbjct  58   SQTSGEILPLSSAQKEKETSERPPFDINLAVILAGFAFEAYTSPPDNVGKLEVDAANCKT  117

Query  422  TFLSESFVREIYDGQLFVKLKKGIDL  499
             FLSESFVREIYDGQLF+KLKKG++L
Sbjct  118  IFLSESFVREIYDGQLFIKLKKGLNL  143



>ref|XP_010326801.1| PREDICTED: uncharacterized protein LOC101247860 isoform X2 [Solanum 
lycopersicum]
Length=854

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 115/146 (79%), Gaps = 8/146 (5%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKAS----  244
            MA L TH Q   FPI SSPR  HF+NP ++SFS+KL F +K+ G++  S F  K S    
Sbjct  1    MATLQTHLQ---FPICSSPRLFHFKNPNSVSFSKKLFFSRKVNGLFSYSKFGAKDSFFCC  57

Query  245  SKASSDVESLSTVEEEKE-SERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQT  421
            S+ S ++  LS+ ++EKE SERPPFDINLAVILAGFAFEAYT+PP+NVGK EVDAANC+T
Sbjct  58   SQTSGEILPLSSAQKEKETSERPPFDINLAVILAGFAFEAYTSPPDNVGKLEVDAANCKT  117

Query  422  TFLSESFVREIYDGQLFVKLKKGIDL  499
             FLSESFVREIYDGQLF+KLKKG++L
Sbjct  118  IFLSESFVREIYDGQLFIKLKKGLNL  143



>ref|XP_006340898.1| PREDICTED: uncharacterized protein LOC102585544 [Solanum tuberosum]
Length=863

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 8/146 (5%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKAS----  244
            MA L TH   L+FPISSSPR  HF+NP ++SFS++L F +K+ G++  S F  K S    
Sbjct  1    MATLQTH---LHFPISSSPRLFHFKNPNSVSFSKRLFFSRKLNGLFSYSKFGAKDSFFCC  57

Query  245  SKASSDVESLSTVEEEKES-ERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQT  421
             +AS ++  LS+ ++EKE+ ERPPFDINLAVILAGFAFEAYT+PP+NVGK EVDAANC+T
Sbjct  58   CQASGELLPLSSAQKEKETNERPPFDINLAVILAGFAFEAYTSPPDNVGKLEVDAANCKT  117

Query  422  TFLSESFVREIYDGQLFVKLKKGIDL  499
             FLSESFVREIYDGQLFVKLKKG++L
Sbjct  118  IFLSESFVREIYDGQLFVKLKKGLNL  143



>ref|XP_009784169.1| PREDICTED: uncharacterized protein LOC104232615 isoform X1 [Nicotiana 
sylvestris]
Length=861

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 107/142 (75%), Gaps = 9/142 (6%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVK----AS  244
            MA L TH   L+FPISSSPR L F+NP ++SFS+KL F KKI G      F  K     +
Sbjct  1    MATLQTH---LHFPISSSPRLLLFKNPNSVSFSKKLFFSKKINGFLNYPKFGAKELFCCN  57

Query  245  SKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTT  424
             +AS ++   S+ E  KE+ERPPFDINLAVILAGFAFEAY +PP+NVGKREVDAANC+T 
Sbjct  58   CQASGEIIPFSSAE--KENERPPFDINLAVILAGFAFEAYASPPDNVGKREVDAANCKTI  115

Query  425  FLSESFVREIYDGQLFVKLKKG  490
             LSESFVREIYDGQLF+KLKKG
Sbjct  116  LLSESFVREIYDGQLFIKLKKG  137



>ref|XP_006340899.1| PREDICTED: uncharacterized protein LOC102586101 [Solanum tuberosum]
Length=860

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 116/161 (72%), Gaps = 23/161 (14%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKAS----  244
            MA L TH   L+FPISSSPR  HF+NP ++SFS++L F +K+ G++  + F  K S    
Sbjct  1    MATLQTH---LHFPISSSPRLFHFKNPNSVSFSKRLFFSRKLNGLFSYAEFGAKDSFFCC  57

Query  245  SKASSDVESLSTVEEEKES-ERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQT  421
             +AS ++  LS+ ++EKE+ ERPPFDINLA ILAGFAFEAYT+PP+NVGK EVDAANC+T
Sbjct  58   CQASGEILPLSSAQKEKETNERPPFDINLAFILAGFAFEAYTSPPDNVGKLEVDAANCKT  117

Query  422  TFLSE---------------SFVREIYDGQLFVKLKKGIDL  499
             FLSE               SFVREIYDGQLFVKLKKG++L
Sbjct  118  IFLSEQYVRLPKTRFMHVQLSFVREIYDGQLFVKLKKGLNL  158



>emb|CDO99377.1| unnamed protein product [Coffea canephora]
Length=883

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 112/153 (73%), Gaps = 12/153 (8%)
 Frame = +2

Query  77   MAALPTHCQYLNFPIS-SSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKAS---  244
            MA L  H  +L+   +   P+ LHF+NP +LS++RKLLF K+I+G   +S F+ K+    
Sbjct  1    MAGLQLHLYFLHSAHTPKGPKLLHFKNPVSLSYARKLLFHKRISGFLDSSYFRAKSVNGP  60

Query  245  ------SKASSDVESLSTVEEEKESE--RPPFDINLAVILAGFAFEAYTTPPENVGKREV  400
                  SK +++ E++   E+E ESE  RPPFDINLAVILAGFAFEAY TPPEN+GKREV
Sbjct  61   HLLCCFSKGNAENETVLAKEQESESENERPPFDINLAVILAGFAFEAYYTPPENIGKREV  120

Query  401  DAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            D A CQT FLS+SF+REIYDGQLF+KLKKGI+L
Sbjct  121  DGAKCQTVFLSKSFMREIYDGQLFIKLKKGINL  153



>ref|XP_009605709.1| PREDICTED: uncharacterized protein LOC104100231 isoform X2 [Nicotiana 
tomentosiformis]
Length=735

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 105/142 (74%), Gaps = 9/142 (6%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVK----AS  244
            MA L  H   L+FPI SSPR L F+NP ++SFS+KL F K+I G      F  K     +
Sbjct  1    MATLQPH---LHFPIFSSPRLLLFKNPNSVSFSKKLFFSKRINGFLNYPKFGAKELLCCN  57

Query  245  SKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTT  424
             +AS ++   S+ E  KE+ERPPFDINLAVILAGFAFEAYT  P+NVGKREVDAANC+T 
Sbjct  58   CQASGEIIPFSSAE--KENERPPFDINLAVILAGFAFEAYTNLPDNVGKREVDAANCKTI  115

Query  425  FLSESFVREIYDGQLFVKLKKG  490
            FLSESFVREIYDGQLF+KLKKG
Sbjct  116  FLSESFVREIYDGQLFIKLKKG  137



>ref|XP_009605708.1| PREDICTED: uncharacterized protein LOC104100231 isoform X1 [Nicotiana 
tomentosiformis]
Length=864

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 105/142 (74%), Gaps = 9/142 (6%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVK----AS  244
            MA L  H   L+FPI SSPR L F+NP ++SFS+KL F K+I G      F  K     +
Sbjct  1    MATLQPH---LHFPIFSSPRLLLFKNPNSVSFSKKLFFSKRINGFLNYPKFGAKELLCCN  57

Query  245  SKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTT  424
             +AS ++   S+ E  KE+ERPPFDINLAVILAGFAFEAYT  P+NVGKREVDAANC+T 
Sbjct  58   CQASGEIIPFSSAE--KENERPPFDINLAVILAGFAFEAYTNLPDNVGKREVDAANCKTI  115

Query  425  FLSESFVREIYDGQLFVKLKKG  490
            FLSESFVREIYDGQLF+KLKKG
Sbjct  116  FLSESFVREIYDGQLFIKLKKG  137



>ref|XP_011091375.1| PREDICTED: uncharacterized protein LOC105171832 isoform X1 [Sesamum 
indicum]
Length=839

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 107/147 (73%), Gaps = 10/147 (7%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPTALSFSRKLLF------PKKITGVWRNS-SFQV  235
            MA L +H  +L  P++S P+ +HF+NP + SFS+KLL        KK  GV R+  +   
Sbjct  1    MATLQSHLHFL--PLNS-PKLIHFKNPHSCSFSKKLLLSKNLFSAKKFHGVLRSRFTSYC  57

Query  236  KASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANC  415
            KAS+ +SS  E   +V  E  +ERPPFDINLAVILAGFAFEAYTTPPE VG+RE+DAA C
Sbjct  58   KASASSSSSAEIEKSVSTESGNERPPFDINLAVILAGFAFEAYTTPPEKVGQREMDAAKC  117

Query  416  QTTFLSESFVREIYDGQLFVKLKKGID  496
            QT FLSESF+REIYDGQLFVKLKKG +
Sbjct  118  QTVFLSESFLREIYDGQLFVKLKKGFN  144



>ref|XP_010111571.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
 gb|EXC31278.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
Length=207

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 103/151 (68%), Gaps = 19/151 (13%)
 Frame = +2

Query  80   AALPTH--CQYLNFPISSSPRFLHFRNPTALSFSRKL---------LFPKKITGVWRNSS  226
            ++LPTH   Q+L+   S SPR  + R      FSR+           F + + G   +  
Sbjct  3    SSLPTHYALQFLSCFSSVSPRLCYLRR---REFSRRFPASEKVAVFTFRENLRG--EDKV  57

Query  227  FQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDA  406
            + V    KAS++V+ +S V+E   SERPPFDINLAV+LAGFAFEAYT+P EN+G+REVDA
Sbjct  58   YSVYCLCKASAEVDRISIVDE---SERPPFDINLAVVLAGFAFEAYTSPAENIGRREVDA  114

Query  407  ANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            A+C+T +LSESFVREIYDGQ+FVKLK+G DL
Sbjct  115  ADCKTVYLSESFVREIYDGQVFVKLKEGFDL  145



>ref|XP_006378312.1| hypothetical protein POPTR_0010s07320g [Populus trichocarpa]
 gb|ERP56109.1| hypothetical protein POPTR_0010s07320g [Populus trichocarpa]
Length=205

 Score =   137 bits (344),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 97/143 (68%), Gaps = 8/143 (6%)
 Frame = +2

Query  95   HCQYLNF-PISSSPRFLHFRNPTALSFS---RKLLFPKKI---TGVWRNSSFQVKASSKA  253
            H  Y  F P S   R L+F    + SFS   R L   KK    TG    SS  +KA++  
Sbjct  9    HTFYHRFTPTSHMSRNLNFYRRFSSSFSWKARVLTLKKKHYRGTGHGVFSSSIIKANNTN  68

Query  254  SSDVESLSTVEE-EKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFL  430
            + ++  +S  EE E E ERPPFDINLAV+LAGFAFEAYT+ PENVGKREVDAA+C+T +L
Sbjct  69   NKEIGEVSVQEEKENEMERPPFDINLAVVLAGFAFEAYTSLPENVGKREVDAADCKTVYL  128

Query  431  SESFVREIYDGQLFVKLKKGIDL  499
            SESFVREIYDGQLF+KL KG DL
Sbjct  129  SESFVREIYDGQLFIKLTKGFDL  151



>ref|XP_011041478.1| PREDICTED: uncharacterized protein LOC105137440 [Populus euphratica]
Length=867

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 100/143 (70%), Gaps = 8/143 (6%)
 Frame = +2

Query  95   HCQYLNF-PISSSPRFLHFRNPTALSFS---RKLLFPKKI---TGVWRNSSFQVKASSKA  253
            H  Y  F P S   R L+F    + SFS   R L   KK    TG    SS  +KA++  
Sbjct  11   HAFYHRFTPTSHMSRNLNFYRRFSSSFSWKARVLTLKKKHYRGTGHGVFSSSIIKANNTN  70

Query  254  SSDVESLSTVEE-EKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFL  430
            +++++ +S  EE E E ERPPFDINLAV+LAGFAFEAYT+ PENVGKRE+DAA+C+T +L
Sbjct  71   NTEIDEVSVQEEKENEMERPPFDINLAVVLAGFAFEAYTSLPENVGKREIDAADCKTVYL  130

Query  431  SESFVREIYDGQLFVKLKKGIDL  499
            SESFVREIYDGQLF+KLKKG DL
Sbjct  131  SESFVREIYDGQLFIKLKKGFDL  153



>ref|XP_007034560.1| Triglyceride lipases,triglyceride lipases isoform 3 [Theobroma 
cacao]
 gb|EOY05486.1| Triglyceride lipases,triglyceride lipases isoform 3 [Theobroma 
cacao]
Length=622

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 95/132 (72%), Gaps = 9/132 (7%)
 Frame = +2

Query  110  NFPISSSPRF---LHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKASSKASSDVESLST  280
            N+ +   PRF    + +    LS SR  +  +   GV   S F     SK ++++E +S+
Sbjct  22   NYHLKVVPRFSRQFYGKKVRFLSTSRGNVIVRGRDGVLSISCF-----SKTNAEIEKVSS  76

Query  281  VEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYD  460
             EE+K+ ERPP DINLAVILAGFAFEAYT+PPEN+G+RE+DAA+C+T +LSESFVREIYD
Sbjct  77   -EEKKDEERPPLDINLAVILAGFAFEAYTSPPENIGRREIDAADCKTVYLSESFVREIYD  135

Query  461  GQLFVKLKKGID  496
            GQLF+KLKKG D
Sbjct  136  GQLFIKLKKGFD  147



>ref|XP_007034559.1| Triglyceride lipases,triglyceride lipases isoform 2 [Theobroma 
cacao]
 gb|EOY05485.1| Triglyceride lipases,triglyceride lipases isoform 2 [Theobroma 
cacao]
Length=684

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 95/133 (71%), Gaps = 9/133 (7%)
 Frame = +2

Query  110  NFPISSSPRF---LHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKASSKASSDVESLST  280
            N+ +   PRF    + +    LS SR  +  +   GV   S F     SK ++++E +S+
Sbjct  22   NYHLKVVPRFSRQFYGKKVRFLSTSRGNVIVRGRDGVLSISCF-----SKTNAEIEKVSS  76

Query  281  VEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYD  460
             EE+K+ ERPP DINLAVILAGFAFEAYT+PPEN+G+RE+DAA+C+T +LSESFVREIYD
Sbjct  77   -EEKKDEERPPLDINLAVILAGFAFEAYTSPPENIGRREIDAADCKTVYLSESFVREIYD  135

Query  461  GQLFVKLKKGIDL  499
            GQLF+KLKKG D 
Sbjct  136  GQLFIKLKKGFDF  148



>ref|XP_007034558.1| Triglyceride lipases,triglyceride lipases isoform 1 [Theobroma 
cacao]
 gb|EOY05484.1| Triglyceride lipases,triglyceride lipases isoform 1 [Theobroma 
cacao]
Length=901

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 95/132 (72%), Gaps = 9/132 (7%)
 Frame = +2

Query  110  NFPISSSPRF---LHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKASSKASSDVESLST  280
            N+ +   PRF    + +    LS SR  +  +   GV   S F     SK ++++E +S+
Sbjct  22   NYHLKVVPRFSRQFYGKKVRFLSTSRGNVIVRGRDGVLSISCF-----SKTNAEIEKVSS  76

Query  281  VEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYD  460
             EE+K+ ERPP DINLAVILAGFAFEAYT+PPEN+G+RE+DAA+C+T +LSESFVREIYD
Sbjct  77   -EEKKDEERPPLDINLAVILAGFAFEAYTSPPENIGRREIDAADCKTVYLSESFVREIYD  135

Query  461  GQLFVKLKKGID  496
            GQLF+KLKKG D
Sbjct  136  GQLFIKLKKGFD  147



>gb|KCW60152.1| hypothetical protein EUGRSUZ_H02878 [Eucalyptus grandis]
Length=233

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 99/153 (65%), Gaps = 15/153 (10%)
 Frame = +2

Query  77   MAALPTHCQYLNF-----PISSSPRFLHF-----RNPTALSFSRKLLFPK--KITGVWRN  220
            MA+L  H   L F     P+S   R L       R P A SF+R++  P+  +  G    
Sbjct  1    MASLQAHQLNLQFHRRFSPLSPKRRALRRVLGLSRRPPA-SFARRIRAPELPESRGGRDG  59

Query  221  SSFQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREV  400
                 +   +ASS    ++ VE  +E+ER PFD+NLAVILAGFAFEAYTTPP+N+G+REV
Sbjct  60   GRSSFERCCQASS--AEVAKVEVSEENERRPFDLNLAVILAGFAFEAYTTPPQNIGRREV  117

Query  401  DAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            DAA C+T FLSESFVREIYDGQLFVKLKKGI L
Sbjct  118  DAAGCKTVFLSESFVREIYDGQLFVKLKKGIKL  150



>ref|XP_010265031.1| PREDICTED: uncharacterized protein LOC104602867 [Nelumbo nucifera]
Length=1193

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 98/154 (64%), Gaps = 17/154 (11%)
 Frame = +2

Query  77   MAALPTH---CQYLNFPISSSPRFLH-FRNPTALSFSRKLLFPKKITGVW---------R  217
            MAAL  +    Q  +   S SP+ L   +NP A     K+ F  +  G +         R
Sbjct  1    MAALRNYRNPVQVFHCFCSPSPKLLRKLQNP-AFGLRTKMFFFTEFPGKFSVLKSSLSSR  59

Query  218  NSSFQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKRE  397
            N    V    K SS++E   TV  E+ +ERPPFDINLAV+LAGFAFEAYTTPPENVGKRE
Sbjct  60   NGKNSVCCLCKPSSEIE---TVXIEQGTERPPFDINLAVVLAGFAFEAYTTPPENVGKRE  116

Query  398  VDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            VDAANCQT FLS SF+RE+YDGQLF+KLK G+ L
Sbjct  117  VDAANCQTVFLSNSFLREVYDGQLFIKLKNGVSL  150



>ref|XP_007145362.1| hypothetical protein PHAVU_007G2328000g, partial [Phaseolus vulgaris]
 gb|ESW17356.1| hypothetical protein PHAVU_007G2328000g, partial [Phaseolus vulgaris]
Length=165

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 87/129 (67%), Gaps = 11/129 (9%)
 Frame = +2

Query  128  SPRFLHFRNPT-ALSFSRKLLFPKKI---TGVWRNSS-FQVKASSKASSDVESLSTVEEE  292
            SP  L  R P  + +FSR   FP K+   +  WR      +  SSK  S +  ++  E +
Sbjct  14   SPTLLPPRRPIFSRTFSR---FPAKLHVFSASWRRRRVLSICCSSKTGSQLRQVAVPEND  70

Query  293  KESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLF  472
               +RPPFDINLAVILAGFAFEAY+TPPEN+GKREVDAA C+T +LSE FV EIYDGQLF
Sbjct  71   ---DRPPFDINLAVILAGFAFEAYSTPPENIGKREVDAAGCKTVYLSEEFVHEIYDGQLF  127

Query  473  VKLKKGIDL  499
            +KLKKG + 
Sbjct  128  IKLKKGFNF  136



>emb|CDY47362.1| BnaCnng14990D [Brassica napus]
Length=846

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = +2

Query  77   MAALPTHC----QYLNFPISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKAS  244
            M +L  HC    Q+       +PR  HF     +SF   L+   K       +SF   A 
Sbjct  1    MNSLQLHCCLPPQHRRCSTIFTPRTYHFLGK--ISFRESLITKAKA------NSFSCCAQ  52

Query  245  SKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTT  424
            S+ +      +++ E +E ERPPFDINLAVILAGFAFE+Y TPPEN+GKREV+AA C+T 
Sbjct  53   SETTKQSSLETSLSENQEPERPPFDINLAVILAGFAFESYATPPENIGKREVNAAGCKTL  112

Query  425  FLSESFVREIYDGQLFVKLKKGID  496
            FLSESFVR++YDGQLF+KLK+G D
Sbjct  113  FLSESFVRQVYDGQLFIKLKRGFD  136



>ref|XP_010023780.1| PREDICTED: uncharacterized protein LOC104414394 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023781.1| PREDICTED: uncharacterized protein LOC104414394 isoform X1 [Eucalyptus 
grandis]
Length=869

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 99/153 (65%), Gaps = 15/153 (10%)
 Frame = +2

Query  77   MAALPTHCQYLNF-----PISSSPRFLH-----FRNPTALSFSRKLLFPK--KITGVWRN  220
            MA+L  H   L F     P+S   R L       R P A SF+R++  P+  +  G    
Sbjct  1    MASLQAHQLNLQFHRRFSPLSPKRRALRRVLGLSRRPPA-SFARRIRAPELPESRGGRDG  59

Query  221  SSFQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREV  400
                 +   +ASS    ++ VE  +E+ER PFD+NLAVILAGFAFEAYTTPP+N+G+REV
Sbjct  60   GRSSFERCCQASS--AEVAKVEVSEENERRPFDLNLAVILAGFAFEAYTTPPQNIGRREV  117

Query  401  DAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            DAA C+T FLSESFVREIYDGQLFVKLKKGI L
Sbjct  118  DAAGCKTVFLSESFVREIYDGQLFVKLKKGIKL  150



>ref|XP_008460598.1| PREDICTED: uncharacterized protein LOC103499378 isoform X2 [Cucumis 
melo]
Length=726

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 87/126 (69%), Gaps = 19/126 (15%)
 Frame = +2

Query  122  SSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKASSKASSDVESLSTVEEEKES  301
            S+ PR L FR    +S+  +L       GV   SSF+   SS       SL     ++++
Sbjct  36   SAKPRVLTFR----VSYKSRL-------GV---SSFRCFCSSGTELQNASL-----QQQT  76

Query  302  ERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKL  481
            ER PFDINLAVILAGFAFEAYT+PPEN GKREVDAA C T +LSESFVREIYDGQLF+KL
Sbjct  77   ERRPFDINLAVILAGFAFEAYTSPPENFGKREVDAAGCTTVYLSESFVREIYDGQLFIKL  136

Query  482  KKGIDL  499
            KKGIDL
Sbjct  137  KKGIDL  142



>ref|XP_009139618.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103863624 
[Brassica rapa]
Length=842

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 91/143 (64%), Gaps = 9/143 (6%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFR-NPTALSFSRKLLFPKKITGVWRNSSFQVKASSKA  253
            M++L  HC      +    R LH R  P    F  K+ F +        SSF   A S+ 
Sbjct  1    MSSLQLHC-----CLPPQHRRLHLRFTPRTCPFLGKISFRESFITKANASSFTCFAQSET  55

Query  254  S--SDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTF  427
            +  S +E  S + E  E ERPPFDINLAVILAGFAFE+Y TPPENVGKREV+AA C T +
Sbjct  56   TKQSSLEETS-LSENHEPERPPFDINLAVILAGFAFESYATPPENVGKREVNAAGCNTLY  114

Query  428  LSESFVREIYDGQLFVKLKKGID  496
            LSESFVR++YDGQLF+KLK+G D
Sbjct  115  LSESFVRQVYDGQLFIKLKRGFD  137



>ref|XP_008460597.1| PREDICTED: uncharacterized protein LOC103499378 isoform X1 [Cucumis 
melo]
Length=842

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 87/126 (69%), Gaps = 19/126 (15%)
 Frame = +2

Query  122  SSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKASSKASSDVESLSTVEEEKES  301
            S+ PR L FR    +S+  +L       GV   SSF+   SS       SL     ++++
Sbjct  36   SAKPRVLTFR----VSYKSRL-------GV---SSFRCFCSSGTELQNASL-----QQQT  76

Query  302  ERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKL  481
            ER PFDINLAVILAGFAFEAYT+PPEN GKREVDAA C T +LSESFVREIYDGQLF+KL
Sbjct  77   ERRPFDINLAVILAGFAFEAYTSPPENFGKREVDAAGCTTVYLSESFVREIYDGQLFIKL  136

Query  482  KKGIDL  499
            KKGIDL
Sbjct  137  KKGIDL  142



>ref|XP_008391285.1| PREDICTED: uncharacterized protein LOC103453525 [Malus domestica]
Length=862

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 102/152 (67%), Gaps = 14/152 (9%)
 Frame = +2

Query  77   MAALPTHCQYLNFP---ISS--SPRFLHFRNPT-ALSFSRKL-----LFPKKITGVWRNS  223
            MA+L TH  +L      +SS  +P+  + R P  +L F   L     +F  +  G  ++ 
Sbjct  1    MASLQTHHYHLQLHSRCVSSLTAPKLCNLRFPNLSLRFPASLPGKVRVFTLRGNGRGKDG  60

Query  224  SFQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVD  403
             +      +A +++E    V+ E+ SERPPFDINLAV+LAGFAFEAY++PP+NVG+ EVD
Sbjct  61   IYSFCCVCRAGAEIEK---VDGEEGSERPPFDINLAVVLAGFAFEAYSSPPDNVGRHEVD  117

Query  404  AANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            AA+C+T +LSESF+REIYDG+L VKLKKG++L
Sbjct  118  AADCKTVYLSESFIREIYDGELSVKLKKGLEL  149



>ref|XP_010645210.1| PREDICTED: uncharacterized protein LOC100249309 isoform X2 [Vitis 
vinifera]
Length=842

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 74/83 (89%), Gaps = 3/83 (4%)
 Frame = +2

Query  248  KASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTF  427
            K++SDV+S+S    + E +RPPFDINLAV+LAGFAFEAY++PPENVG+REVDAA+C T F
Sbjct  58   KSNSDVQSVSG---QDELQRPPFDINLAVVLAGFAFEAYSSPPENVGRREVDAADCTTVF  114

Query  428  LSESFVREIYDGQLFVKLKKGID  496
            LSESFVRE+YDGQL +KLKKG+D
Sbjct  115  LSESFVRELYDGQLVIKLKKGLD  137



>ref|XP_010645211.1| PREDICTED: uncharacterized protein LOC100249309 isoform X3 [Vitis 
vinifera]
Length=827

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 74/83 (89%), Gaps = 3/83 (4%)
 Frame = +2

Query  248  KASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTF  427
            K++SDV+S+S    + E +RPPFDINLAV+LAGFAFEAY++PPENVG+REVDAA+C T F
Sbjct  58   KSNSDVQSVSG---QDELQRPPFDINLAVVLAGFAFEAYSSPPENVGRREVDAADCTTVF  114

Query  428  LSESFVREIYDGQLFVKLKKGID  496
            LSESFVRE+YDGQL +KLKKG+D
Sbjct  115  LSESFVRELYDGQLVIKLKKGLD  137



>ref|XP_010645209.1| PREDICTED: uncharacterized protein LOC100249309 isoform X1 [Vitis 
vinifera]
Length=869

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 92/136 (68%), Gaps = 10/136 (7%)
 Frame = +2

Query  101  QYLNFPISSSP---RFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQ-VKASSKASSDVE  268
            Q+ N P    P   R  H   PT L+   K      I+  W+   F  +    K++SDV+
Sbjct  8    QFRNCPSPPPPKLHRSHHLHAPT-LALRSKSRLLSSIS--WKLRVFSSIYCLCKSNSDVQ  64

Query  269  SLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVR  448
            S+S    + E +RPPFDINLAV+LAGFAFEAY++PPENVG+REVDAA+C T FLSESFVR
Sbjct  65   SVSG---QDELQRPPFDINLAVVLAGFAFEAYSSPPENVGRREVDAADCTTVFLSESFVR  121

Query  449  EIYDGQLFVKLKKGID  496
            E+YDGQL +KLKKG+D
Sbjct  122  ELYDGQLVIKLKKGLD  137



>ref|XP_009350112.1| PREDICTED: uncharacterized protein LOC103941626 [Pyrus x bretschneideri]
Length=872

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 102/152 (67%), Gaps = 14/152 (9%)
 Frame = +2

Query  77   MAALPTHCQYLNFP---ISS--SPRFLHFRNPT-ALSFSRKL-----LFPKKITGVWRNS  223
            MA+L TH  +L      +SS  +P+  + R P  +L F   L     +F  +  G  ++ 
Sbjct  1    MASLQTHHYHLQLHRRCVSSLTAPKLRNLRFPNLSLRFPASLPGKVRVFTLRGNGRGKDG  60

Query  224  SFQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVD  403
             +      +A +++E    V+ E+ SERPPFDINLAV+LAGFAFEAY++PP+NVG+ EVD
Sbjct  61   IYSFCCVCRAGAEIEK---VDGEEGSERPPFDINLAVVLAGFAFEAYSSPPDNVGRHEVD  117

Query  404  AANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            AA+C+T +LSESF+REIYDG+L VKLKKG++L
Sbjct  118  AADCKTVYLSESFIREIYDGELSVKLKKGLEL  149



>ref|XP_010527178.1| PREDICTED: uncharacterized protein LOC104804568 isoform X1 [Tarenaya 
hassleriana]
Length=867

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 3/85 (4%)
 Frame = +2

Query  251  ASSDVESLSTVEEEK---ESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQT  421
            A +D + L    EE+   + ERPPFDINLAVILAGFAFEAYTTPPEN+GKREVDAA C+T
Sbjct  63   AGTDAQDLVVGGEEEGAVKEERPPFDINLAVILAGFAFEAYTTPPENIGKREVDAAGCKT  122

Query  422  TFLSESFVREIYDGQLFVKLKKGID  496
             +LSESFVREIYDGQLF+KLKKG +
Sbjct  123  VYLSESFVREIYDGQLFIKLKKGFN  147



>ref|XP_006493996.1| PREDICTED: uncharacterized protein LOC102627249 [Citrus sinensis]
Length=866

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 95/152 (63%), Gaps = 16/152 (11%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPTALSFSRK-------LLFP----KKITGVWRNS  223
            MA+L  H   L F  S  P    F     L+F +K       L+FP     K  G   + 
Sbjct  1    MASLQDHSMKLQFCSSYLPSLPRFHQLQCLNFPQKPFSGKVKLVFPCPESYKTKG---DK  57

Query  224  SFQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVD  403
             + V    K + D E +  VE++++ ERPPFDINLAVILAGFAFEAY TP E+VG++EVD
Sbjct  58   VYSVCCFCK-TKDAE-IDKVEDKEQDERPPFDINLAVILAGFAFEAYITPSESVGRKEVD  115

Query  404  AANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            AA C+  +LSESFVREIYDGQLF+KLKKG +L
Sbjct  116  AAGCKIVYLSESFVREIYDGQLFIKLKKGFNL  147



>gb|KFK36238.1| hypothetical protein AALP_AA4G096300 [Arabis alpina]
Length=834

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 87/125 (70%), Gaps = 7/125 (6%)
 Frame = +2

Query  131  PRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKASSKAS---SDVESLSTVEEEKES  301
            P+  H R  T  + SR   FP KI       SF+++++  +    S  E+     ++++ 
Sbjct  15   PKHHHLRYSTIFT-SRNRHFPWKINS---RQSFRIRSNPSSFVCFSQSETKELGFDDEKL  70

Query  302  ERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKL  481
            ERPPFDINLAVILAGFAFEAY TPPEN+GKREV+AA C T +LSESFVREIYDGQLF+KL
Sbjct  71   ERPPFDINLAVILAGFAFEAYATPPENIGKREVNAAGCNTLYLSESFVREIYDGQLFIKL  130

Query  482  KKGID  496
            K+G D
Sbjct  131  KRGFD  135



>emb|CDY01137.1| BnaA04g06820D [Brassica napus]
Length=845

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 90/143 (63%), Gaps = 9/143 (6%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFR-NPTALSFSRKLLFPKKITGVWRNSSFQVKASSKA  253
            M +L  HC      +    R LH R  P    F  K+ F +        SSF   A S+ 
Sbjct  1    MNSLQLHC-----CLPPQHRRLHLRFTPRTCHFLGKISFRESFLTKANASSFTCFAQSET  55

Query  254  SSDVESL--STVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTF  427
            +    SL  +++ E  E ERPPFDINLAVILAGFAFE+Y TPPENVGKREV+AA C T +
Sbjct  56   TKQ-PSLEETSLSENHEPERPPFDINLAVILAGFAFESYATPPENVGKREVNAAGCNTLY  114

Query  428  LSESFVREIYDGQLFVKLKKGID  496
            LSESFVR++YDGQLF+KLK+G D
Sbjct  115  LSESFVRQVYDGQLFIKLKRGFD  137



>ref|XP_006605749.1| PREDICTED: uncharacterized protein LOC100777995 isoform X1 [Glycine 
max]
Length=864

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 81/119 (68%), Gaps = 11/119 (9%)
 Frame = +2

Query  167  SFSRKLLFPKKITGVWRNSSFQVKA--------SSKASSDVESLSTVEEEKESERPPFDI  322
            +FSR   FP +  G  R  S   +         SSK  S ++ ++  E++   +RPPFDI
Sbjct  22   TFSRAFPFPPRFPGKLRAFSLARRGRVLSICCGSSKTGSQLQRVAVPEDD---DRPPFDI  78

Query  323  NLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            NLAVILAGFAFEAYTTPPEN+G+REVDA  C+T +LSE FV EIYDGQLF+KLKKG D 
Sbjct  79   NLAVILAGFAFEAYTTPPENMGRREVDAGGCKTVYLSEEFVHEIYDGQLFIKLKKGFDF  137



>ref|XP_006605750.1| PREDICTED: uncharacterized protein LOC100777995 isoform X2 [Glycine 
max]
Length=822

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 81/119 (68%), Gaps = 11/119 (9%)
 Frame = +2

Query  167  SFSRKLLFPKKITGVWRNSSFQVKA--------SSKASSDVESLSTVEEEKESERPPFDI  322
            +FSR   FP +  G  R  S   +         SSK  S ++ ++  E++   +RPPFDI
Sbjct  22   TFSRAFPFPPRFPGKLRAFSLARRGRVLSICCGSSKTGSQLQRVAVPEDD---DRPPFDI  78

Query  323  NLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            NLAVILAGFAFEAYTTPPEN+G+REVDA  C+T +LSE FV EIYDGQLF+KLKKG D 
Sbjct  79   NLAVILAGFAFEAYTTPPENMGRREVDAGGCKTVYLSEEFVHEIYDGQLFIKLKKGFDF  137



>gb|KDP33361.1| hypothetical protein JCGZ_12910 [Jatropha curcas]
Length=853

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 97/149 (65%), Gaps = 15/149 (10%)
 Frame = +2

Query  77   MAALPTHCQYLN--FPISSSPRFLHFRNPTALSFSRKLLF------PKKITGVWRNSSFQ  232
            MA+L  + Q+     P S   R L F      S SRK++        +   G++ NS F 
Sbjct  1    MASLQANPQFYCRLSPPSVRNRNLTFYRRFPASISRKVMVFTLRDGRRNRDGIYSNSCF-  59

Query  233  VKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAAN  412
                    ++V +   V  E+E+ERPPFDINLAVILAGFAFEAYT+PPE +G+REVDAA 
Sbjct  60   ------CKANVTATENVSVEEENERPPFDINLAVILAGFAFEAYTSPPEKIGRREVDAAG  113

Query  413  CQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            C+T +LSE+FVREIYDGQLF+KLKKGIDL
Sbjct  114  CKTVYLSETFVREIYDGQLFIKLKKGIDL  142



>ref|XP_011462434.1| PREDICTED: uncharacterized protein LOC101295618 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=862

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 2/84 (2%)
 Frame = +2

Query  248  KASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTF  427
            KA  +++ +S   +++ SERPPFDINLAVILAGFAFEAY++PP NVG+REVDAA+C+T +
Sbjct  68   KAGLEIDKVSA--DDEGSERPPFDINLAVILAGFAFEAYSSPPVNVGRREVDAADCKTVY  125

Query  428  LSESFVREIYDGQLFVKLKKGIDL  499
            LSESFVREIYDGQL VKLKKGIDL
Sbjct  126  LSESFVREIYDGQLTVKLKKGIDL  149



>ref|XP_004497785.1| PREDICTED: uncharacterized protein LOC101502015 [Cicer arietinum]
Length=852

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 71/92 (77%), Gaps = 3/92 (3%)
 Frame = +2

Query  215  RNSSFQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKR  394
            R   F +  SSK  S +E ++    EK  ERPPFDINLAVILAGFAFEAYT PPEN+G+R
Sbjct  47   RKQIFSICNSSKTDSQIEKVAI---EKNDERPPFDINLAVILAGFAFEAYTGPPENLGRR  103

Query  395  EVDAANCQTTFLSESFVREIYDGQLFVKLKKG  490
            EVDAA C+T +LSE F RE+YDGQLF+KLKKG
Sbjct  104  EVDAAGCKTVYLSEEFFREVYDGQLFIKLKKG  135



>ref|XP_009343399.1| PREDICTED: uncharacterized protein LOC103935364 isoform X1 [Pyrus 
x bretschneideri]
Length=872

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 99/152 (65%), Gaps = 14/152 (9%)
 Frame = +2

Query  77   MAALPTHCQYLNF-----PISSSPRFLHFRNPT-ALSFSRKL-----LFPKKITGVWRNS  223
            MA+L TH  +L          ++P+  + R P  +L F   L     +F  +  G  ++ 
Sbjct  1    MASLQTHHYHLQLHRRCVSFLTAPKLRNLRFPNLSLRFPASLPGKVRVFTLRGNGRGKDG  60

Query  224  SFQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVD  403
             +      +A +++E    V+ E+ SERPPFDINLAV+LAGFAFEAY++PP NVG+ EVD
Sbjct  61   IYSFCCVCRAGAEIEK---VDGEEGSERPPFDINLAVVLAGFAFEAYSSPPGNVGRHEVD  117

Query  404  AANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            AA+C+T +LSESF+REIYDG+L VKLKKG++L
Sbjct  118  AADCKTVYLSESFIREIYDGELSVKLKKGLEL  149



>gb|KHG01947.1| putative feruloyl esterase A [Gossypium arboreum]
Length=811

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 81/102 (79%), Gaps = 3/102 (3%)
 Frame = +2

Query  197  KITGVWRNSSFQVKASSKASSDVESLSTVEEEKESE-RPPFDINLAVILAGFAFEAYTTP  373
            KI G  R     V   SK  +++E +S+ ++E+E E RPPFDINLAVILAGFAFEAYTTP
Sbjct  52   KIRG--RFGGLSVSCFSKMDAEIEKVSSEQKEEEEEERPPFDINLAVILAGFAFEAYTTP  109

Query  374  PENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            PEN+G+RE+DAA+C+T +LS SFVREIYDGQLF+KLKKG D 
Sbjct  110  PENIGRREIDAADCKTVYLSGSFVREIYDGQLFIKLKKGFDF  151



>ref|XP_006420413.1| hypothetical protein CICLE_v10004289mg [Citrus clementina]
 gb|ESR33653.1| hypothetical protein CICLE_v10004289mg [Citrus clementina]
Length=866

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 94/152 (62%), Gaps = 16/152 (11%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPTALSFSRK-------LLFP----KKITGVWRNS  223
            MA+L  H   L    S  P    F     L+F +K       L+FP     K  G   + 
Sbjct  1    MASLQDHSMKLQVCPSYLPSLPRFHQLQCLNFPQKPFSGKVKLVFPCPESYKTKG---DK  57

Query  224  SFQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVD  403
             + V    K + D E +  VE++++ ERPPFDINLAVILAGFAFEAYTTP E+VG++EVD
Sbjct  58   VYSVCCFCK-TKDAE-IDKVEDKEQDERPPFDINLAVILAGFAFEAYTTPSESVGRKEVD  115

Query  404  AANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            AA C+  +LSESFVREIYDGQLF+KLKKG  L
Sbjct  116  AAGCKIVYLSESFVREIYDGQLFIKLKKGFHL  147



>gb|KHN23579.1| hypothetical protein glysoja_043863 [Glycine soja]
Length=165

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 79/123 (64%), Gaps = 13/123 (11%)
 Frame = +2

Query  155  PTALSFSRKLLFPKKITGVWRNSSFQVK--------ASSKASSDVESLSTVEEEKESERP  310
            P    FSR   FP +  G  R  S   +         SSK  S ++ +   E++   +R 
Sbjct  19   PLPPRFSRT--FPPRFPGKLRAFSLARRRRVLSIRCCSSKTGSQLQRVPVPEDD---DRH  73

Query  311  PFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKG  490
            PFDINLAVILAGFAFEAYTTPPEN+G+ EVDA  C+T +LSE FVREIYDGQLF+KLKKG
Sbjct  74   PFDINLAVILAGFAFEAYTTPPENMGRHEVDAGGCKTVYLSEEFVREIYDGQLFIKLKKG  133

Query  491  IDL  499
             + 
Sbjct  134  FNF  136



>gb|KJB28235.1| hypothetical protein B456_005G036200 [Gossypium raimondii]
Length=772

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 81/101 (80%), Gaps = 2/101 (2%)
 Frame = +2

Query  197  KITGVWRNSSFQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPP  376
            KI G  R     V   SK  +++E +S+ E+E+E ERPPFDINLAVILAGFAFEAYTTPP
Sbjct  52   KIRG--RFGGLSVSCFSKMDAEIEKVSSEEKEEEEERPPFDINLAVILAGFAFEAYTTPP  109

Query  377  ENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            EN+G+RE+DAA+C+T +LS SFVREIYDGQLF+KLKKG D 
Sbjct  110  ENIGRREIDAADCKTVYLSGSFVREIYDGQLFIKLKKGFDF  150



>gb|KHN14015.1| Putative feruloyl esterase A [Glycine soja]
Length=871

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 11/119 (9%)
 Frame = +2

Query  167  SFSRKLLFPKKITGVWRNSSFQVKA--------SSKASSDVESLSTVEEEKESERPPFDI  322
            +FSR   FP +  G  R  S   +         S K  S ++ ++  E++   +RPPFDI
Sbjct  22   TFSRAFPFPPRFPGKLRAFSLARRGRVLSICCGSPKNGSQLQRVAVPEDD---DRPPFDI  78

Query  323  NLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            NLAVILAGFAFEAYTTPPEN+G+REVDA  C+T +LSE FV EIYDGQLF+KLKKG D 
Sbjct  79   NLAVILAGFAFEAYTTPPENMGRREVDAGGCKTVYLSEEFVHEIYDGQLFIKLKKGFDF  137



>gb|AES60457.2| triacylglycerol lipase, putative [Medicago truncatula]
Length=853

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 86/135 (64%), Gaps = 9/135 (7%)
 Frame = +2

Query  101  QYLNFPISSSPRFLHFRNPTALSFSRKLLF---PKKITGVWR--NSSFQVKASSKASSDV  265
            Q+   P S+ P+F     P   +F    LF   P +  G  R     F +  SSK  S +
Sbjct  6    QFRYSPNSTRPQFSR-TFPPQYNFPANFLFLSLPTRFNGRRRRRKQGFSICCSSKTDSQI  64

Query  266  ESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFV  445
            E  S    EK  ERPPFDINLAVILAGFAFEAYTTPPEN+G+REVDAA  +T +LSE F 
Sbjct  65   EKSSN---EKNDERPPFDINLAVILAGFAFEAYTTPPENLGRREVDAAGTKTIYLSEEFF  121

Query  446  REIYDGQLFVKLKKG  490
            REIYDGQ+F+KLKKG
Sbjct  122  REIYDGQIFIKLKKG  136



>gb|KGN49702.1| hypothetical protein Csa_5G077210 [Cucumis sativus]
Length=451

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 86/125 (69%), Gaps = 12/125 (10%)
 Frame = +2

Query  128  SPRFLHFR-NPTALSFSRKLLFPKKITGVWRNSSFQVKASSKASSDVESLSTVEEEKESE  304
            SPR  HF   P  L+F  ++ +  ++ GV   SSF+   SS       SL     ++ +E
Sbjct  29   SPRRPHFSAKPRVLTF--RVTYKCRL-GV---SSFRCFCSSGTELQNASL-----QQRTE  77

Query  305  RPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLK  484
              PFDINLAVILAGFAFEAYT+PPEN GKRE+DAA C T +LSESFVRE YDGQLF+KLK
Sbjct  78   PRPFDINLAVILAGFAFEAYTSPPENFGKRELDAAGCTTVYLSESFVRETYDGQLFIKLK  137

Query  485  KGIDL  499
            KGIDL
Sbjct  138  KGIDL  142



>ref|XP_003590206.1| hypothetical protein MTR_1g045930 [Medicago truncatula]
Length=1019

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 86/135 (64%), Gaps = 9/135 (7%)
 Frame = +2

Query  101  QYLNFPISSSPRFLHFRNPTALSFSRKLLF---PKKITGVWR--NSSFQVKASSKASSDV  265
            Q+   P S+ P+F     P   +F    LF   P +  G  R     F +  SSK  S +
Sbjct  6    QFRYSPNSTRPQFSR-TFPPQYNFPANFLFLSLPTRFNGRRRRRKQGFSICCSSKTDSQI  64

Query  266  ESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFV  445
            E  S    EK  ERPPFDINLAVILAGFAFEAYTTPPEN+G+REVDAA  +T +LSE F 
Sbjct  65   EKSSN---EKNDERPPFDINLAVILAGFAFEAYTTPPENLGRREVDAAGTKTIYLSEEFF  121

Query  446  REIYDGQLFVKLKKG  490
            REIYDGQ+F+KLKKG
Sbjct  122  REIYDGQIFIKLKKG  136



>gb|KDO55741.1| hypothetical protein CISIN_1g039195mg [Citrus sinensis]
Length=195

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +2

Query  272  LSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVRE  451
            +  +E++++ ERPPFDINLAVILAGFAFEAYTTPPE+VG++EVD A C+T +LSESF  E
Sbjct  78   IDKIEDKEQDERPPFDINLAVILAGFAFEAYTTPPESVGRKEVDVAGCKTVYLSESFAHE  137

Query  452  IYDGQLFVKLKKGIDL  499
            +YDGQLF+KL+K  +L
Sbjct  138  MYDGQLFIKLEKCFNL  153



>ref|XP_006283081.1| hypothetical protein CARUB_v10004094mg [Capsella rubella]
 gb|EOA15979.1| hypothetical protein CARUB_v10004094mg [Capsella rubella]
Length=915

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 91/155 (59%), Gaps = 33/155 (21%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPT----------ALSFSRKLLFPKKITGVWRNSS  226
            M +L  HC             LHF  P             S SR   FP KI+      S
Sbjct  37   MTSLQLHCS------------LHFLRPKHRLRYSPPIFCTSRSRTCHFPGKIS---FRES  81

Query  227  FQVKASSK-----ASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGK  391
            F+V+  SK     A S+ + +   E++   ERP FDINLAVILAGFAFEAY +PPENVGK
Sbjct  82   FRVREKSKSFRCFAQSETKEVRLSEKD---ERPTFDINLAVILAGFAFEAYASPPENVGK  138

Query  392  REVDAANCQTTFLSESFVREIYDGQLFVKLKKGID  496
            REV+AA C T +LSESFVRE+YDGQLF+KLK+G +
Sbjct  139  REVNAAGCNTLYLSESFVREVYDGQLFIKLKRGFE  173



>ref|XP_009390021.1| PREDICTED: uncharacterized protein LOC103976508 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=855

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 84/114 (74%), Gaps = 8/114 (7%)
 Frame = +2

Query  155  PTALSFSRKLLFPKKITGVWRNSSFQVKASSKASSDVESLSTVEEEKESERPPFDINLAV  334
            P A++F +K  F + I    R  S    A+++ SS     +++EE    ERPPFD+NLAV
Sbjct  37   PGAVAFRKKARFLRSI----RTPS-GGHAATRCSSAQHGGNSIEE---VERPPFDLNLAV  88

Query  335  ILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGID  496
            +LAGFAFEAYT+PP++VG RE+DAA+CQT FLSE F+RE+YDGQL +KLKKG+D
Sbjct  89   VLAGFAFEAYTSPPKDVGWREIDAADCQTVFLSEQFLREVYDGQLRIKLKKGVD  142



>ref|XP_009390013.1| PREDICTED: uncharacterized protein LOC103976508 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=856

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 84/114 (74%), Gaps = 8/114 (7%)
 Frame = +2

Query  155  PTALSFSRKLLFPKKITGVWRNSSFQVKASSKASSDVESLSTVEEEKESERPPFDINLAV  334
            P A++F +K  F + I    R  S    A+++ SS     +++EE    ERPPFD+NLAV
Sbjct  37   PGAVAFRKKARFLRSI----RTPS-GGHAATRCSSAQHGGNSIEE---VERPPFDLNLAV  88

Query  335  ILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGID  496
            +LAGFAFEAYT+PP++VG RE+DAA+CQT FLSE F+RE+YDGQL +KLKKG+D
Sbjct  89   VLAGFAFEAYTSPPKDVGWREIDAADCQTVFLSEQFLREVYDGQLRIKLKKGVD  142



>gb|EPS61954.1| hypothetical protein M569_12842, partial [Genlisea aurea]
Length=82

 Score =   112 bits (281),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +2

Query  278  TVEEEKESERPPFDINLAVILAGFAFEAYTTPP-ENVGKREVDAANCQTTFLSESFVREI  454
            +V  +  + R PFDINLAVILAGFAFEAY+TP  ENVGKRE+DAA CQTT LSE F+REI
Sbjct  2    SVATDGGNTRSPFDINLAVILAGFAFEAYSTPAVENVGKREIDAAKCQTTLLSEPFLREI  61

Query  455  YDGQLFVKLKKGIDL  499
            YDGQLFVKLK+G +L
Sbjct  62   YDGQLFVKLKRGFEL  76



>ref|XP_010435249.1| PREDICTED: uncharacterized protein LOC104719103 isoform X1 [Camelina 
sativa]
Length=878

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 91/149 (61%), Gaps = 23/149 (15%)
 Frame = +2

Query  77   MAALPTHC--------QYLNF-PISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSF  229
            M +L  HC          L + P + +PR  H   P   SF        K+      +SF
Sbjct  2    MTSLQLHCSVHFLLPKHRLRYSPPTFTPRTCHL--PGKFSFRESFRVRDKV------NSF  53

Query  230  QVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAA  409
            +  A S+   +V SL+    EKE ERP FDINLAVILAGFAFEAY +PPE +GKREV+AA
Sbjct  54   RCFAQSETKKEV-SLA----EKE-ERPSFDINLAVILAGFAFEAYASPPEKIGKREVNAA  107

Query  410  NCQTTFLSESFVREIYDGQLFVKLKKGID  496
             C T +LSESFVRE+YDGQLF+KLK+G D
Sbjct  108  GCNTLYLSESFVREVYDGQLFIKLKRGFD  136



>ref|XP_010666968.1| PREDICTED: uncharacterized protein LOC104884071 [Beta vulgaris 
subsp. vulgaris]
Length=856

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  293  KESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLF  472
            +E +RP FDINLAVILAGFAFEAYTTPP+NVG+RE DAA+C T +LSESFVREIYDGQLF
Sbjct  78   EEIDRPSFDINLAVILAGFAFEAYTTPPDNVGRRETDAADCMTVYLSESFVREIYDGQLF  137

Query  473  VKLKKG  490
            +KLKKG
Sbjct  138  IKLKKG  143



>ref|XP_002311707.1| hypothetical protein POPTR_0008s17430g [Populus trichocarpa]
 gb|EEE89074.1| hypothetical protein POPTR_0008s17430g [Populus trichocarpa]
Length=158

 Score =   113 bits (282),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 91/143 (64%), Gaps = 8/143 (6%)
 Frame = +2

Query  89   PTHCQYLNF-PISSSPRFLHFRNPTALSFS---RKLLFPKKITGVWRNSSFQVKASSKAS  256
            P++  Y  F P S   R L+F      SFS   R L +     GV  +S+  +  +S A+
Sbjct  7    PSNAFYHRFTPTSYKHRNLNFYRRFPSSFSGRFRVLTYRGSGHGVCSSSTSSISKASNAN  66

Query  257  SDVESLSTVEEEKES--ERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFL  430
            +       V++EKE+  ERPPFDINLAV LAGFAFEAYT+ P+NVGK E DAA C+T +L
Sbjct  67   NTETEKVAVQQEKENGNERPPFDINLAVALAGFAFEAYTSSPKNVGKWEADAAGCKTVYL  126

Query  431  SESFVREIYDGQLFVKLKKGIDL  499
            SE  +REIYDGQLF+KLKKG D 
Sbjct  127  SE--LREIYDGQLFIKLKKGFDF  147



>ref|XP_010918961.1| PREDICTED: uncharacterized protein LOC105043202 [Elaeis guineensis]
Length=900

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = +2

Query  116  PISSSPRFLHFRNPTALSFSR--KLLFPKKITGVWRNSSFQVKASSKASSDVESLSTVEE  289
            P SS P F   + P +   +R   L  PKK+  +       V          E L +  E
Sbjct  23   PTSSRPSF-RLKKPVSTWDARAFSLDIPKKVRALRSRGRASVGGGGP-----EVLRSGSE  76

Query  290  EKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQL  469
            E++  RPPFDINLAV+LAGFAFEAYT+PP++VG RE+DAA+CQT FLS+ F+RE+YDGQL
Sbjct  77   EEQ--RPPFDINLAVVLAGFAFEAYTSPPKDVGWREIDAADCQTVFLSKQFLREVYDGQL  134

Query  470  FVKLKKGID  496
            ++KLKKG D
Sbjct  135  YIKLKKGED  143



>ref|XP_006589064.1| PREDICTED: uncharacterized protein LOC100789825 isoform X2 [Glycine 
max]
Length=821

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +2

Query  242  SSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQT  421
            SSK  S ++ +   E++   +R PFDINLAVILAGFAFEAYTTPPEN+G+ EVDA  C+T
Sbjct  54   SSKTGSQLQRVPVPEDD---DRHPFDINLAVILAGFAFEAYTTPPENMGRHEVDAGGCKT  110

Query  422  TFLSESFVREIYDGQLFVKLKKGIDL  499
             +LSE FVREIYDGQLF+KLKKG + 
Sbjct  111  VYLSEEFVREIYDGQLFIKLKKGFNF  136



>ref|XP_006589063.1| PREDICTED: uncharacterized protein LOC100789825 isoform X1 [Glycine 
max]
Length=863

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = +2

Query  242  SSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQT  421
            SSK  S ++ +   E++   +R PFDINLAVILAGFAFEAYTTPPEN+G+ EVDA  C+T
Sbjct  54   SSKTGSQLQRVPVPEDD---DRHPFDINLAVILAGFAFEAYTTPPENMGRHEVDAGGCKT  110

Query  422  TFLSESFVREIYDGQLFVKLKKGIDL  499
             +LSE FVREIYDGQLF+KLKKG + 
Sbjct  111  VYLSEEFVREIYDGQLFIKLKKGFNF  136



>ref|XP_010450193.1| PREDICTED: uncharacterized protein LOC104732360 isoform X1 [Camelina 
sativa]
Length=872

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 89/149 (60%), Gaps = 26/149 (17%)
 Frame = +2

Query  77   MAALPTHCQYLNF---------PISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSF  229
            M +L  HC   +          P   +PR  H   P   SF        ++ G  + +SF
Sbjct  1    MTSLQLHCSVHSLRPKHRLRYSPPIFTPRACHL--PGKFSF--------RVRGA-KANSF  49

Query  230  QVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAA  409
            +  A S+   +V   S  E+E   ERP FDINLAVILAGFAFEAY +PPE +GKREV+AA
Sbjct  50   RCFAQSETKKEV---SFAEKE---ERPSFDINLAVILAGFAFEAYASPPEKIGKREVNAA  103

Query  410  NCQTTFLSESFVREIYDGQLFVKLKKGID  496
             C T +LSESFVRE+YDGQLF+KLK+G D
Sbjct  104  GCNTLYLSESFVREVYDGQLFIKLKRGFD  132



>ref|XP_010450194.1| PREDICTED: uncharacterized protein LOC104732360 isoform X2 [Camelina 
sativa]
Length=871

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 89/149 (60%), Gaps = 26/149 (17%)
 Frame = +2

Query  77   MAALPTHCQYLNF---------PISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSF  229
            M +L  HC   +          P   +PR  H   P   SF        ++ G  + +SF
Sbjct  1    MTSLQLHCSVHSLRPKHRLRYSPPIFTPRACHL--PGKFSF--------RVRGA-KANSF  49

Query  230  QVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAA  409
            +  A S+   +V   S  E+E   ERP FDINLAVILAGFAFEAY +PPE +GKREV+AA
Sbjct  50   RCFAQSETKKEV---SFAEKE---ERPSFDINLAVILAGFAFEAYASPPEKIGKREVNAA  103

Query  410  NCQTTFLSESFVREIYDGQLFVKLKKGID  496
             C T +LSESFVRE+YDGQLF+KLK+G D
Sbjct  104  GCNTLYLSESFVREVYDGQLFIKLKRGFD  132



>ref|XP_006652497.1| PREDICTED: uncharacterized protein LOC102701164 [Oryza brachyantha]
Length=865

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  305  RPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLK  484
            RPPFD+NLAV+LAGFAFEAYT+PPE+VG RE+DAA CQT FLS+SF+RE+YDGQL V+LK
Sbjct  78   RPPFDLNLAVVLAGFAFEAYTSPPEDVGWREIDAAECQTVFLSDSFLREVYDGQLVVRLK  137

Query  485  KGIDL  499
            KG++L
Sbjct  138  KGVNL  142



>ref|XP_004976177.1| PREDICTED: uncharacterized protein LOC101766573 isoform X1 [Setaria 
italica]
Length=871

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  281  VEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYD  460
            V EE    RPPFD+NLAV+LAGFAFEAYT+PP +VG RE DAA+CQT FLS+ F+RE+YD
Sbjct  76   VAEEDGPRRPPFDLNLAVVLAGFAFEAYTSPPADVGWRETDAADCQTVFLSDVFLREVYD  135

Query  461  GQLFVKLKKGIDL  499
            GQL VKLKKGI+L
Sbjct  136  GQLVVKLKKGINL  148



>ref|XP_004976178.1| PREDICTED: uncharacterized protein LOC101766573 isoform X2 [Setaria 
italica]
Length=867

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  281  VEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYD  460
            V EE    RPPFD+NLAV+LAGFAFEAYT+PP +VG RE DAA+CQT FLS+ F+RE+YD
Sbjct  76   VAEEDGPRRPPFDLNLAVVLAGFAFEAYTSPPADVGWRETDAADCQTVFLSDVFLREVYD  135

Query  461  GQLFVKLKKGIDL  499
            GQL VKLKKGI+L
Sbjct  136  GQLVVKLKKGINL  148



>ref|XP_002446773.1| hypothetical protein SORBIDRAFT_06g022160 [Sorghum bicolor]
 gb|EES11101.1| hypothetical protein SORBIDRAFT_06g022160 [Sorghum bicolor]
Length=895

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  281  VEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYD  460
            V EE    RPPFDINLAV+LAGFAFEAYT+PP +VG RE DAA+CQT FLS+ F+RE+YD
Sbjct  81   VAEEDGPRRPPFDINLAVVLAGFAFEAYTSPPADVGWRETDAADCQTVFLSDVFLREVYD  140

Query  461  GQLFVKLKKGIDL  499
            GQL V+LKKGI+L
Sbjct  141  GQLVVRLKKGINL  153



>gb|EEC77614.1| hypothetical protein OsI_16594 [Oryza sativa Indica Group]
Length=889

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  305  RPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLK  484
            RPPFD+NLAV+LAGFAFEAYT+PPE+VG RE+DAA CQT FLS+SF+RE+YDGQL V+LK
Sbjct  75   RPPFDLNLAVVLAGFAFEAYTSPPEDVGWREIDAAECQTVFLSDSFLREVYDGQLVVRLK  134

Query  485  KGIDL  499
            KG++L
Sbjct  135  KGVNL  139



>ref|NP_001053276.1| Os04g0509100 [Oryza sativa Japonica Group]
 emb|CAE03360.1| OSJNBb0065L13.3 [Oryza sativa Japonica Group]
 dbj|BAF15190.1| Os04g0509100 [Oryza sativa Japonica Group]
Length=888

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  305  RPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLK  484
            RPPFD+NLAV+LAGFAFEAYT+PPE+VG RE+DAA CQT FLS+SF+RE+YDGQL V+LK
Sbjct  87   RPPFDLNLAVVLAGFAFEAYTSPPEDVGWREIDAAECQTVFLSDSFLREVYDGQLVVRLK  146

Query  485  KGIDL  499
            KG++L
Sbjct  147  KGVNL  151



>ref|XP_008663380.1| PREDICTED: uncharacterized protein LOC103641836 isoform X3 [Zea 
mays]
Length=724

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 72/101 (71%), Gaps = 12/101 (12%)
 Frame = +2

Query  233  VKASSKASSDVESLSTVEEEKES------------ERPPFDINLAVILAGFAFEAYTTPP  376
            ++A  + S DV   S V+ + ES             RPPFDINLAV+LAGFAFEAYT+PP
Sbjct  53   LRARCRISCDVSQPSAVQPDSESSGEGLVAQDDGPRRPPFDINLAVVLAGFAFEAYTSPP  112

Query  377  ENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
             +VG RE DAA+CQT FLS+ F+RE+YDG+L V+LKKGI+L
Sbjct  113  ADVGWRETDAADCQTVFLSDVFLREVYDGRLVVRLKKGINL  153



>gb|AFW58815.1| hypothetical protein ZEAMMB73_298032 [Zea mays]
Length=697

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 72/101 (71%), Gaps = 12/101 (12%)
 Frame = +2

Query  233  VKASSKASSDVESLSTVEEEKES------------ERPPFDINLAVILAGFAFEAYTTPP  376
            ++A  + S DV   S V+ + ES             RPPFDINLAV+LAGFAFEAYT+PP
Sbjct  53   LRARCRISCDVSQPSAVQPDSESSGEGLVAQDDGPRRPPFDINLAVVLAGFAFEAYTSPP  112

Query  377  ENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
             +VG RE DAA+CQT FLS+ F+RE+YDG+L V+LKKGI+L
Sbjct  113  ADVGWRETDAADCQTVFLSDVFLREVYDGRLVVRLKKGINL  153



>ref|XP_008663379.1| PREDICTED: uncharacterized protein LOC103641836 isoform X2 [Zea 
mays]
Length=866

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 72/101 (71%), Gaps = 12/101 (12%)
 Frame = +2

Query  233  VKASSKASSDVESLSTVEEEKES------------ERPPFDINLAVILAGFAFEAYTTPP  376
            ++A  + S DV   S V+ + ES             RPPFDINLAV+LAGFAFEAYT+PP
Sbjct  53   LRARCRISCDVSQPSAVQPDSESSGEGLVAQDDGPRRPPFDINLAVVLAGFAFEAYTSPP  112

Query  377  ENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
             +VG RE DAA+CQT FLS+ F+RE+YDG+L V+LKKGI+L
Sbjct  113  ADVGWRETDAADCQTVFLSDVFLREVYDGRLVVRLKKGINL  153



>ref|XP_008663378.1| PREDICTED: uncharacterized protein LOC103641836 isoform X1 [Zea 
mays]
Length=881

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 72/101 (71%), Gaps = 12/101 (12%)
 Frame = +2

Query  233  VKASSKASSDVESLSTVEEEKES------------ERPPFDINLAVILAGFAFEAYTTPP  376
            ++A  + S DV   S V+ + ES             RPPFDINLAV+LAGFAFEAYT+PP
Sbjct  53   LRARCRISCDVSQPSAVQPDSESSGEGLVAQDDGPRRPPFDINLAVVLAGFAFEAYTSPP  112

Query  377  ENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
             +VG RE DAA+CQT FLS+ F+RE+YDG+L V+LKKGI+L
Sbjct  113  ADVGWRETDAADCQTVFLSDVFLREVYDGRLVVRLKKGINL  153



>ref|XP_006830588.1| hypothetical protein AMTR_s00120p00025450 [Amborella trichopoda]
 gb|ERM98004.1| hypothetical protein AMTR_s00120p00025450 [Amborella trichopoda]
Length=894

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 4/87 (5%)
 Frame = +2

Query  236  KASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANC  415
            +A ++AS    S+ST+E  K+ + P FD+NLAV+LAGFAFEAYTTPPENVG R VD A+C
Sbjct  70   RAHAEASE--SSVSTLE--KDGDSPSFDLNLAVVLAGFAFEAYTTPPENVGIRAVDPADC  125

Query  416  QTTFLSESFVREIYDGQLFVKLKKGID  496
            QT FLSE F+ E+YDGQL +KLKKG D
Sbjct  126  QTVFLSEQFLCEVYDGQLLIKLKKGFD  152



>dbj|BAJ91052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=859

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 4/95 (4%)
 Frame = +2

Query  215  RNSSFQVKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKR  394
            R +  QVK    + +D  S+     ++E   P FD+NLAV+LAGFAFEAY+TPP + G R
Sbjct  47   RCAGGQVKPGPGSPADDGSVG----DEEQPHPQFDLNLAVVLAGFAFEAYSTPPADAGWR  102

Query  395  EVDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
            E DAA CQT FLS+ F+RE+YDGQL V+LKKG +L
Sbjct  103  ETDAAECQTVFLSDVFLREVYDGQLVVRLKKGNNL  137



>ref|XP_001782810.1| predicted protein [Physcomitrella patens]
 gb|EDQ52387.1| predicted protein [Physcomitrella patens]
Length=909

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  302  ERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKL  481
            +RPPF+++LAV+LAGFAFEAY TP ENVG +E DA +C+TTFL++ F+RE+YDGQ+FV L
Sbjct  132  DRPPFNLDLAVVLAGFAFEAYNTPAENVGVQEKDAGDCETTFLAQHFLREVYDGQVFVNL  191

Query  482  KKGI  493
            KKG+
Sbjct  192  KKGM  195



>ref|XP_010240119.1| PREDICTED: uncharacterized protein LOC100834372 isoform X3 [Brachypodium 
distachyon]
 ref|XP_010240120.1| PREDICTED: uncharacterized protein LOC100834372 isoform X3 [Brachypodium 
distachyon]
Length=642

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  290  EKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQL  469
            E++  RP FD+NLAV+LAGFAFEAY++PP + G RE DAA CQT FLS  F+ E+YDGQL
Sbjct  80   EEDRPRPQFDLNLAVVLAGFAFEAYSSPPVDAGWRETDAAECQTVFLSNVFLHEVYDGQL  139

Query  470  FVKLKKGIDL  499
             V+LKKG  L
Sbjct  140  VVRLKKGTSL  149



>ref|XP_010240118.1| PREDICTED: uncharacterized protein LOC100834372 isoform X2 [Brachypodium 
distachyon]
Length=658

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  290  EKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQL  469
            E++  RP FD+NLAV+LAGFAFEAY++PP + G RE DAA CQT FLS  F+ E+YDGQL
Sbjct  80   EEDRPRPQFDLNLAVVLAGFAFEAYSSPPVDAGWRETDAAECQTVFLSNVFLHEVYDGQL  139

Query  470  FVKLKKGIDL  499
             V+LKKG  L
Sbjct  140  VVRLKKGTSL  149



>ref|XP_003580112.1| PREDICTED: uncharacterized protein LOC100834372 isoform X1 [Brachypodium 
distachyon]
Length=879

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  290  EKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQL  469
            E++  RP FD+NLAV+LAGFAFEAY++PP + G RE DAA CQT FLS  F+ E+YDGQL
Sbjct  80   EEDRPRPQFDLNLAVVLAGFAFEAYSSPPVDAGWRETDAAECQTVFLSNVFLHEVYDGQL  139

Query  470  FVKLKKGIDL  499
             V+LKKG  L
Sbjct  140  VVRLKKGTSL  149



>ref|XP_002974656.1| hypothetical protein SELMODRAFT_415006 [Selaginella moellendorffii]
 gb|EFJ24176.1| hypothetical protein SELMODRAFT_415006 [Selaginella moellendorffii]
Length=713

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +2

Query  296  ESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFV  475
            E +R  F+++LAV+LAGFAFE+Y +PP NVG RE D  +C+TT++S+  +RE+Y GQL V
Sbjct  108  EDDRAKFNLDLAVMLAGFAFESYNSPPPNVGIRETDGQSCETTYMSDGLMRELYHGQLTV  167

Query  476  KLKKGIDL  499
            KL+KG+ L
Sbjct  168  KLEKGVSL  175



>ref|XP_011029717.1| PREDICTED: uncharacterized protein LOC105129384 [Populus euphratica]
Length=134

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  284  EEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSE  436
            E+E ++ERPPFDINLAV+LAGFAFEAYT+PP+NVGK E DAA C+   LSE
Sbjct  30   EKENDNERPPFDINLAVVLAGFAFEAYTSPPKNVGKWEADAAGCKIVHLSE  80



>ref|XP_002963368.1| hypothetical protein SELMODRAFT_405179 [Selaginella moellendorffii]
 gb|EFJ35239.1| hypothetical protein SELMODRAFT_405179 [Selaginella moellendorffii]
Length=736

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  314  FDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGI  493
             D++LAV+LAGFAFE+Y +PP NVG RE D  +C+TT++S+  +RE+Y GQL VKL+KG+
Sbjct  81   LDLDLAVMLAGFAFESYNSPPPNVGIRETDGQSCETTYMSDGLIRELYQGQLTVKLEKGV  140

Query  494  DL  499
            +L
Sbjct  141  NL  142



>gb|EEE61315.1| hypothetical protein OsJ_15419 [Oryza sativa Japonica Group]
Length=894

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 51/83 (61%), Gaps = 18/83 (22%)
 Frame = +2

Query  305  RPPFDINLAVILAGFAFEAYTTPPENVGKR------------------EVDAANCQTTFL  430
            RPPFD+NLAV+LAGFAFEAYT+PP+ +  R                   V+  NC     
Sbjct  75   RPPFDLNLAVVLAGFAFEAYTSPPKYLPSRCGAKLEREWNSERIDMVITVNFVNCTVPMY  134

Query  431  SESFVREIYDGQLFVKLKKGIDL  499
              SF+RE+YDGQL V+LKKG++L
Sbjct  135  CSSFLREVYDGQLVVRLKKGVNL  157



>ref|XP_009784178.1| PREDICTED: uncharacterized protein LOC104232615 isoform X2 [Nicotiana 
sylvestris]
Length=792

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  377  ENVGKREVDAANCQTTFLSESFVREIYDGQLFVKLKKG  490
            +NVGKREVDAANC+T  LSESFVREIYDGQLF+KLKKG
Sbjct  31   DNVGKREVDAANCKTILLSESFVREIYDGQLFIKLKKG  68



>ref|XP_007225276.1| hypothetical protein PRUPE_ppa001457mg [Prunus persica]
 gb|EMJ26475.1| hypothetical protein PRUPE_ppa001457mg [Prunus persica]
Length=823

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 63/108 (58%), Gaps = 11/108 (10%)
 Frame = +2

Query  77   MAALPTHC---QYLNFPISSSPRFLHFRNPTA-----LSFSRKLLFPKKITGVWRNSSFQ  232
            MA+L TH    Q+     S SP+    +NP       +SFS K+    +  G  R+  + 
Sbjct  1    MASLQTHHYNFQFHRCVCSLSPKLHGLQNPKLSLRFPISFSGKVRVTFRGNGKGRDGIYS  60

Query  233  VKASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPP  376
            +    +A S+VE +S    E+ +ERPPFDINLAV+LAGFAFEAY++PP
Sbjct  61   LCCLCRAGSEVEKVSA---EEGNERPPFDINLAVVLAGFAFEAYSSPP  105



>gb|EYU22285.1| hypothetical protein MIMGU_mgv1a001923mg [Erythranthe guttata]
Length=739

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 72/121 (60%), Gaps = 11/121 (9%)
 Frame = +2

Query  77   MAALPTHCQYLNFPISSSPRFLHFRNPTALSFSRKLLFPKKITGVWRNSSFQVKA-----  241
            MAAL +H +++    +   + + F+NP + SFS+K+L  +K+    +++ F +       
Sbjct  1    MAALQSHPKFMP---AKYLKPVQFKNPRSFSFSKKVLLSRKLFSDKKSNGFLLLGPRFSK  57

Query  242  --SSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANC  415
                KAS+++++ S   EE   ERPPFDINLAVILAGFAFEAYTTPP       +   +C
Sbjct  58   YYCCKASAEIDN-SVSVEESVEERPPFDINLAVILAGFAFEAYTTPPGTSDPYVIMQLDC  116

Query  416  Q  418
            Q
Sbjct  117  Q  117



>ref|XP_002518194.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF44327.1| triacylglycerol lipase, putative [Ricinus communis]
Length=810

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 17/103 (17%)
 Frame = +2

Query  119  ISSSPRFLHFRNPTA------LSFSRKLLFPKKITGVWRNSSFQVKASSKASS-------  259
            + ++PRF ++R  ++       SF R   FP + +GV+   +  V +S   ++       
Sbjct  5    LQANPRFYYYRLGSSSSKNRNFSFHRGFQFPVRFSGVFELKTRSVLSSRDGANLIGCFCK  64

Query  260  ----DVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPP  376
                 VE +S  E++ E ERP FDINLAVILAGFAFEAYTTPP
Sbjct  65   VNDGAVEKVSIEEQQNEIERPRFDINLAVILAGFAFEAYTTPP  107



>ref|XP_005774725.1| hypothetical protein EMIHUDRAFT_463707 [Emiliania huxleyi CCMP1516]
 gb|EOD22296.1| hypothetical protein EMIHUDRAFT_463707 [Emiliania huxleyi CCMP1516]
Length=1140

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 37/98 (38%), Positives = 52/98 (53%), Gaps = 4/98 (4%)
 Frame = +2

Query  218  NSSFQVKASSKASSDVESLSTVEEEKES----ERPPFDINLAVILAGFAFEAYTTPPENV  385
            +S+ + +A+ KA +D    S V E +E     +   FD+  A +LAGFAFEAY  P E  
Sbjct  366  SSTQRFEAALKARADSSWPSVVSEYREGCSHLDYHVFDVETATLLAGFAFEAYNEPEEGD  425

Query  386  GKREVDAANCQTTFLSESFVREIYDGQLFVKLKKGIDL  499
             + E  A  C   F+S+ F  E Y G+L V L +  DL
Sbjct  426  ARWERGADGCNVAFMSDGFAAECYAGRLEVTLHEVRDL  463



>ref|XP_002504916.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66174.1| predicted protein [Micromonas sp. RCC299]
Length=690

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 15/128 (12%)
 Frame = +2

Query  119  ISSSPRFLHFRNPTALSFSRKLLFPKKITGVW-RNSSFQVKASSKASSDVESLSTVEEEK  295
            ++++PR L  R   A   +R       + G    N+S Q++++++  + +   S      
Sbjct  13   VNTAPRLLARRGAIARPVARGHAVRASVVGAGGENASGQLESTTRRGTPLPLPSH-----  67

Query  296  ESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFV  475
                  FD++ AV+L GFAFE+Y+TP   V   + D   C T +LS+ FVRE+Y G L V
Sbjct  68   ------FDLDTAVLLGGFAFESYSTPEGGV--VDADVNGCSTAYLSD-FVREVYSGVLEV  118

Query  476  KLKKGIDL  499
             + +G +L
Sbjct  119  TMVRGENL  126



>ref|XP_002870378.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46637.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=783

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 50/90 (56%), Gaps = 21/90 (23%)
 Frame = +2

Query  140  LHFRNPTA-LSFS-----RKLLFPKKITGVWRNSSFQVKASSKA-----SSDVESLSTVE  286
            LHF  P   L +S     R   FP KI       +F++KA   +      SD + +S  E
Sbjct  10   LHFLRPKHRLRYSPIFTPRTFHFPGKI-------NFRIKAKPNSFRCFTQSDAKEVSLAE  62

Query  287  EEKESERPPFDINLAVILAGFAFEAYTTPP  376
            +E   ER PFDINLAVILAGFAFE+Y +PP
Sbjct  63   KE---ERSPFDINLAVILAGFAFESYASPP  89



>gb|EWM23354.1| triacylglycerol lipase [Nannochloropsis gaditana]
Length=1116

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  299  SERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFVREIYDGQLFVK  478
            S+R PF ++ AV++  FAFEAYT PP   G  +      +   L E F+RE Y G+L V+
Sbjct  160  SQRKPFSLSKAVLMGPFAFEAYTDPPRTSGYWQSGRDKNEVAILHEGFLREAYAGKLRVR  219

Query  479  LK  484
            +K
Sbjct  220  VK  221



>ref|XP_005537825.1| similar to triacylglycerol lipase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81789.1| similar to triacylglycerol lipase [Cyanidioschyzon merolae strain 
10D]
Length=778

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +2

Query  239  ASSKASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQ  418
            A   AS  +   S + E     R PFD  LA+++AGF F+AY  P  + GKR     + Q
Sbjct  269  AEMTASIGIAESSYIAEPLRGRRVPFDAQLALLMAGFTFDAYRDPEPHEGKR-CALGDLQ  327

Query  419  TTFLSESFVREIYDGQL  469
            T +LS  FVRE ++G L
Sbjct  328  TVYLSLDFVRECFEGVL  344



>ref|XP_008775136.1| PREDICTED: uncharacterized protein LOC103695549 [Phoenix dactylifera]
Length=805

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  293  KESERPPFDINLAVILAGFAFEAYTTPP  376
            +E++RPPFDINLAV+LAGFAF++YT+PP
Sbjct  76   EEAQRPPFDINLAVVLAGFAFDSYTSPP  103



>ref|XP_002296243.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|ACI64960.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=860

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +2

Query  248  KASSDVESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTF  427
            +A+ + ++ S+    K   +PPF ++ ++ LAG AF+AYT PP N  + E  ++     F
Sbjct  61   QATVNSDTTSSPAPRKTPTQPPFSLSTSLFLAGLAFDAYTEPPPNSSRWERGSSGLNVAF  120

Query  428  LSESFVREIYDGQLFVKLKKGIDL  499
            LS S+ R +Y G + V   +  DL
Sbjct  121  LSTSYTRSLYKGIIEVTPLRASDL  144



>emb|CAB41113.1| putative protein [Arabidopsis thaliana]
 emb|CAB78397.1| putative protein [Arabidopsis thaliana]
Length=805

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 15/73 (21%)
 Frame = +2

Query  173  SRKLLFPKKITGVWRNSSFQVKASSK-----ASSDVESLSTVEEEKESERPPFDINLAVI  337
            +R   FP KIT       F+++A        A S+ + +S  E++   ER PFDINLAVI
Sbjct  27   TRTFNFPGKIT-------FRLRAKPNSLRCFAQSETKEVSLPEKD---ERSPFDINLAVI  76

Query  338  LAGFAFEAYTTPP  376
            LAGFAFE+Y +PP
Sbjct  77   LAGFAFESYASPP  89



>ref|XP_004142337.1| PREDICTED: uncharacterized protein LOC101204368 [Cucumis sativus]
Length=808

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 50/84 (60%), Gaps = 12/84 (14%)
 Frame = +2

Query  128  SPRFLHFR-NPTALSFSRKLLFPKKITGVWRNSSFQVKASSKASSDVESLSTVEEEKESE  304
            SPR  HF   P  L+F  ++ +  ++ GV   SSF+   SS       SL     ++ +E
Sbjct  29   SPRRPHFSAKPRVLTF--RVTYKCRL-GV---SSFRCFCSSGTELQNASL-----QQRTE  77

Query  305  RPPFDINLAVILAGFAFEAYTTPP  376
              PFDINLAVILAGFAFEAYT+PP
Sbjct  78   PRPFDINLAVILAGFAFEAYTSPP  101



>gb|EJK50906.1| hypothetical protein THAOC_29977 [Thalassiosira oceanica]
Length=895

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 0/78 (0%)
 Frame = +2

Query  266  ESLSTVEEEKESERPPFDINLAVILAGFAFEAYTTPPENVGKREVDAANCQTTFLSESFV  445
            E +ST        +PPF +  A+ LAG AF+AY  PP++  + E  +      FLS ++ 
Sbjct  89   EDVSTSRASTTPNQPPFSLPTALFLAGLAFDAYVEPPQDSSRWEKGSTGTNVAFLSTAYT  148

Query  446  REIYDGQLFVKLKKGIDL  499
            R +Y G + V   +  DL
Sbjct  149  RSLYKGIIEVTPIRASDL  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695