BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I20

Length=411
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771504.1|  PREDICTED: probable serine/threonine-protein...    104   3e-24   Nicotiana sylvestris
ref|XP_009771502.1|  PREDICTED: probable serine/threonine-protein...    104   3e-24   Nicotiana sylvestris
ref|XP_009606854.1|  PREDICTED: probable serine/threonine-protein...    106   4e-24   Nicotiana tomentosiformis
ref|XP_009618839.1|  PREDICTED: probable serine/threonine-protein...    106   4e-24   Nicotiana tomentosiformis
ref|XP_009777631.1|  PREDICTED: probable serine/threonine-protein...    105   1e-23   Nicotiana sylvestris
ref|XP_004238413.1|  PREDICTED: probable serine/threonine-protein...    105   1e-23   Solanum lycopersicum
ref|XP_006342111.1|  PREDICTED: probable serine/threonine-protein...    105   1e-23   Solanum tuberosum [potatoes]
emb|CAN74078.1|  hypothetical protein VITISV_000979                     101   2e-22   Vitis vinifera
ref|XP_002285926.1|  PREDICTED: probable serine/threonine-protein...    100   7e-22   Vitis vinifera
emb|CDP07307.1|  unnamed protein product                              99.8    1e-21   Coffea canephora [robusta coffee]
ref|XP_008236113.1|  PREDICTED: probable serine/threonine-protein...  96.7    1e-20   Prunus mume [ume]
gb|EYU38018.1|  hypothetical protein MIMGU_mgv1a004862mg              94.7    3e-20   Erythranthe guttata [common monkey flower]
emb|CAA18746.1|  putative protein                                     94.7    7e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567980.1|  BR-signaling kinase 1                               94.7    8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008360691.1|  PREDICTED: probable serine/threonine-protein...  94.4    1e-19   
ref|XP_010061148.1|  PREDICTED: probable serine/threonine-protein...  94.0    1e-19   Eucalyptus grandis [rose gum]
gb|EYU38017.1|  hypothetical protein MIMGU_mgv1a004862mg              94.0    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_009341554.1|  PREDICTED: probable serine/threonine-protein...  93.2    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_007199796.1|  hypothetical protein PRUPE_ppa004587mg           93.2    2e-19   Prunus persica
ref|XP_007199795.1|  hypothetical protein PRUPE_ppa004587mg           92.8    3e-19   
ref|XP_010266119.1|  PREDICTED: probable serine/threonine-protein...  93.2    3e-19   Nelumbo nucifera [Indian lotus]
ref|XP_007017989.1|  BR-signaling kinase 1                            92.4    6e-19   Theobroma cacao [chocolate]
ref|XP_007041655.1|  BR-signaling kinase 1 isoform 1                  91.7    9e-19   
gb|KJB15932.1|  hypothetical protein B456_002G205100                  91.7    1e-18   Gossypium raimondii
emb|CDX69121.1|  BnaC01g03320D                                        90.9    2e-18   
ref|XP_011088682.1|  PREDICTED: probable serine/threonine-protein...  90.5    2e-18   Sesamum indicum [beniseed]
ref|XP_007041656.1|  BR-signaling kinase 1 isoform 2                  90.1    2e-18   
ref|XP_010094592.1|  putative serine/threonine-protein kinase         90.5    3e-18   Morus notabilis
ref|XP_009350608.1|  PREDICTED: probable serine/threonine-protein...  89.7    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_010646185.1|  PREDICTED: probable serine/threonine-protein...  89.7    4e-18   Vitis vinifera
gb|EYU17508.1|  hypothetical protein MIMGU_mgv11b014057mg             84.7    4e-18   Erythranthe guttata [common monkey flower]
ref|XP_008382473.1|  PREDICTED: probable serine/threonine-protein...  89.4    6e-18   Malus domestica [apple tree]
gb|KHG14731.1|  hypothetical protein F383_06315                       89.4    7e-18   Gossypium arboreum [tree cotton]
gb|KJB57984.1|  hypothetical protein B456_009G188600                  89.4    7e-18   Gossypium raimondii
gb|KHG04837.1|  hypothetical protein F383_29489                       88.6    1e-17   Gossypium arboreum [tree cotton]
ref|XP_009108623.1|  PREDICTED: probable serine/threonine-protein...  88.6    1e-17   Brassica rapa
gb|KDO85050.1|  hypothetical protein CISIN_1g009750mg                 87.0    1e-17   Citrus sinensis [apfelsine]
gb|KJB29674.1|  hypothetical protein B456_005G113100                  87.4    1e-17   Gossypium raimondii
gb|KDP24732.1|  hypothetical protein JCGZ_25333                       88.2    1e-17   Jatropha curcas
ref|XP_009108622.1|  PREDICTED: probable serine/threonine-protein...  88.2    1e-17   Brassica rapa
emb|CDX75483.1|  BnaA01g02190D                                        88.2    1e-17   
gb|KJB57985.1|  hypothetical protein B456_009G188600                  87.4    1e-17   Gossypium raimondii
emb|CDX76321.1|  BnaA08g10790D                                        88.2    1e-17   
gb|KJB29673.1|  hypothetical protein B456_005G113100                  87.0    2e-17   Gossypium raimondii
ref|XP_002306223.1|  kinase family protein                            87.8    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_004290043.1|  PREDICTED: probable serine/threonine-protein...  87.8    2e-17   Fragaria vesca subsp. vesca
ref|XP_009104299.1|  PREDICTED: probable serine/threonine-protein...  87.8    2e-17   Brassica rapa
ref|XP_011075006.1|  PREDICTED: probable serine/threonine-protein...  87.8    2e-17   
gb|KDO85049.1|  hypothetical protein CISIN_1g009750mg                 87.8    2e-17   Citrus sinensis [apfelsine]
ref|XP_006435324.1|  hypothetical protein CICLE_v10000906mg           87.8    2e-17   Citrus clementina [clementine]
gb|KJB29672.1|  hypothetical protein B456_005G113100                  87.8    2e-17   Gossypium raimondii
ref|XP_008448319.1|  PREDICTED: probable serine/threonine-protein...  87.4    3e-17   
gb|AFN88212.1|  putative serine/threonine-protein kinase              86.3    3e-17   Phaseolus vulgaris [French bean]
ref|XP_011101028.1|  PREDICTED: probable serine/threonine-protein...  87.4    3e-17   Sesamum indicum [beniseed]
ref|XP_008448317.1|  PREDICTED: probable serine/threonine-protein...  87.4    3e-17   Cucumis melo [Oriental melon]
ref|XP_010242854.1|  PREDICTED: probable serine/threonine-protein...  87.4    3e-17   Nelumbo nucifera [Indian lotus]
gb|KHG00998.1|  hypothetical protein F383_22564                       87.4    3e-17   Gossypium arboreum [tree cotton]
ref|XP_004291229.1|  PREDICTED: probable serine/threonine-protein...  87.4    3e-17   Fragaria vesca subsp. vesca
ref|XP_008448316.1|  PREDICTED: probable serine/threonine-protein...  87.4    4e-17   Cucumis melo [Oriental melon]
ref|XP_008448315.1|  PREDICTED: probable serine/threonine-protein...  87.4    4e-17   Cucumis melo [Oriental melon]
ref|XP_009401888.1|  PREDICTED: probable serine/threonine-protein...  86.7    4e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU17513.1|  hypothetical protein MIMGU_mgv1a005152mg              87.0    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_002525749.1|  receptor protein kinase, putative                87.0    4e-17   Ricinus communis
ref|XP_003519690.1|  PREDICTED: probable serine/threonine-protein...  87.0    4e-17   Glycine max [soybeans]
ref|XP_006575761.1|  PREDICTED: probable serine/threonine-protein...  87.0    4e-17   Glycine max [soybeans]
gb|KFK30163.1|  hypothetical protein AALP_AA7G225300                  87.0    5e-17   Arabis alpina [alpine rockcress]
ref|XP_006412130.1|  hypothetical protein EUTSA_v10024929mg           87.0    5e-17   Eutrema salsugineum [saltwater cress]
ref|XP_010446962.1|  PREDICTED: probable serine/threonine-protein...  87.0    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002867085.1|  hypothetical protein ARALYDRAFT_328224           87.0    5e-17   
ref|XP_006284955.1|  hypothetical protein CARUB_v10006257mg           86.7    5e-17   Capsella rubella
ref|XP_009401887.1|  PREDICTED: probable serine/threonine-protein...  86.7    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011046295.1|  PREDICTED: probable serine/threonine-protein...  86.7    5e-17   Populus euphratica
emb|CDY17529.1|  BnaC03g65340D                                        86.7    5e-17   Brassica napus [oilseed rape]
ref|XP_008377092.1|  PREDICTED: probable serine/threonine-protein...  86.7    6e-17   Malus domestica [apple tree]
ref|XP_011046296.1|  PREDICTED: probable serine/threonine-protein...  86.3    6e-17   Populus euphratica
emb|CDP14516.1|  unnamed protein product                              86.7    6e-17   Coffea canephora [robusta coffee]
ref|XP_010437502.1|  PREDICTED: probable serine/threonine-protein...  86.7    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010432311.1|  PREDICTED: probable serine/threonine-protein...  86.7    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010530944.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  86.3    7e-17   Tarenaya hassleriana [spider flower]
ref|XP_010918220.1|  PREDICTED: probable serine/threonine-protein...  86.3    8e-17   Elaeis guineensis
ref|XP_003618098.1|  Receptor like protein kinase                     86.7    8e-17   
gb|AET01057.2|  LRR receptor-like kinase                              85.9    1e-16   Medicago truncatula
gb|KDP36831.1|  hypothetical protein JCGZ_08122                       85.9    1e-16   Jatropha curcas
ref|XP_008464872.1|  PREDICTED: probable serine/threonine-protein...  85.5    1e-16   Cucumis melo [Oriental melon]
ref|XP_010526870.1|  PREDICTED: probable serine/threonine-protein...  85.1    2e-16   Tarenaya hassleriana [spider flower]
gb|KHG04795.1|  putative inactive receptor-like kinase SSP            84.7    2e-16   Gossypium arboreum [tree cotton]
ref|XP_010690264.1|  PREDICTED: probable serine/threonine-protein...  84.7    3e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003544865.1|  PREDICTED: probable serine/threonine-protein...  84.3    3e-16   Glycine max [soybeans]
ref|XP_010103334.1|  putative serine/threonine-protein kinase         84.7    3e-16   Morus notabilis
ref|XP_009413047.1|  PREDICTED: probable serine/threonine-protein...  84.7    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO68274.1|  hypothetical protein CISIN_1g0105291mg                82.0    3e-16   Citrus sinensis [apfelsine]
ref|XP_010692837.1|  PREDICTED: probable serine/threonine-protein...  84.3    3e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003544864.1|  PREDICTED: probable serine/threonine-protein...  84.3    4e-16   Glycine max [soybeans]
gb|KJB47750.1|  hypothetical protein B456_008G040100                  83.6    4e-16   Gossypium raimondii
ref|XP_009123286.1|  PREDICTED: probable serine/threonine-protein...  80.9    4e-16   Brassica rapa
ref|XP_009334288.1|  PREDICTED: probable serine/threonine-protein...  84.3    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_008375097.1|  PREDICTED: probable serine/threonine-protein...  80.1    5e-16   
ref|XP_004158304.1|  PREDICTED: probable serine/threonine-protein...  81.6    5e-16   
ref|XP_008791986.1|  PREDICTED: probable serine/threonine-protein...  83.6    6e-16   Phoenix dactylifera
ref|XP_010548144.1|  PREDICTED: probable serine/threonine-protein...  83.2    8e-16   Tarenaya hassleriana [spider flower]
gb|AFK46540.1|  unknown                                               83.6    8e-16   Medicago truncatula
ref|XP_011034902.1|  PREDICTED: probable serine/threonine-protein...  83.2    9e-16   Populus euphratica
ref|XP_002300657.1|  hypothetical protein POPTR_0002s01310g           83.2    1e-15   Populus trichocarpa [western balsam poplar]
gb|KJB47748.1|  hypothetical protein B456_008G040100                  83.2    1e-15   Gossypium raimondii
ref|XP_007142560.1|  hypothetical protein PHAVU_008G291100g           83.2    1e-15   Phaseolus vulgaris [French bean]
ref|XP_006855115.1|  hypothetical protein AMTR_s00031p00205960        80.9    1e-15   
ref|XP_006486634.1|  PREDICTED: probable serine/threonine-protein...  82.4    2e-15   Citrus sinensis [apfelsine]
ref|XP_004144226.1|  PREDICTED: probable serine/threonine-protein...  82.4    2e-15   Cucumis sativus [cucumbers]
ref|XP_004491634.1|  PREDICTED: probable serine/threonine-protein...  82.4    2e-15   
ref|XP_006422467.1|  hypothetical protein CICLE_v10028235mg           82.0    2e-15   Citrus clementina [clementine]
ref|XP_002510650.1|  receptor protein kinase, putative                82.0    2e-15   Ricinus communis
ref|XP_006486632.1|  PREDICTED: probable serine/threonine-protein...  82.0    3e-15   Citrus sinensis [apfelsine]
ref|XP_006828955.1|  hypothetical protein AMTR_s00001p00232510        81.6    3e-15   Amborella trichopoda
ref|XP_009400327.1|  PREDICTED: probable serine/threonine-protein...  81.6    3e-15   
ref|XP_009384615.1|  PREDICTED: probable serine/threonine-protein...  81.6    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS73400.1|  hypothetical protein M569_01345                       81.6    3e-15   Genlisea aurea
ref|XP_004491635.1|  PREDICTED: probable serine/threonine-protein...  81.6    3e-15   Cicer arietinum [garbanzo]
ref|XP_011045216.1|  PREDICTED: probable serine/threonine-protein...  81.3    4e-15   Populus euphratica
ref|XP_008221154.1|  PREDICTED: probable serine/threonine-protein...  81.3    4e-15   Prunus mume [ume]
ref|XP_009594040.1|  PREDICTED: probable serine/threonine-protein...  80.9    5e-15   Nicotiana tomentosiformis
ref|XP_009781086.1|  PREDICTED: probable serine/threonine-protein...  80.9    6e-15   Nicotiana sylvestris
ref|XP_007222343.1|  hypothetical protein PRUPE_ppa004797mg           80.5    7e-15   
ref|XP_011045207.1|  PREDICTED: probable serine/threonine-protein...  80.1    9e-15   Populus euphratica
ref|XP_004139949.1|  PREDICTED: probable serine/threonine-protein...  79.3    2e-14   Cucumis sativus [cucumbers]
ref|XP_004154543.1|  PREDICTED: probable serine/threonine-protein...  79.0    3e-14   
ref|XP_002312914.1|  kinase family protein                            78.6    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006363095.1|  PREDICTED: probable serine/threonine-protein...  78.2    6e-14   Solanum tuberosum [potatoes]
ref|XP_009781084.1|  PREDICTED: probable serine/threonine-protein...  77.8    6e-14   Nicotiana sylvestris
ref|XP_004246370.1|  PREDICTED: probable serine/threonine-protein...  77.8    6e-14   Solanum lycopersicum
ref|XP_009781085.1|  PREDICTED: probable serine/threonine-protein...  77.4    1e-13   Nicotiana sylvestris
emb|CDP09344.1|  unnamed protein product                              76.6    2e-13   Coffea canephora [robusta coffee]
ref|XP_009337367.1|  PREDICTED: probable serine/threonine-protein...  76.3    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_009337366.1|  PREDICTED: probable serine/threonine-protein...  76.3    2e-13   Pyrus x bretschneideri [bai li]
gb|ADE76295.1|  unknown                                               76.3    2e-13   Picea sitchensis
ref|XP_010101852.1|  putative serine/threonine-protein kinase         75.9    3e-13   Morus notabilis
ref|XP_008375673.1|  PREDICTED: probable serine/threonine-protein...  73.6    3e-13   
ref|XP_008384888.1|  PREDICTED: probable serine/threonine-protein...  75.9    3e-13   
ref|XP_009781087.1|  PREDICTED: probable serine/threonine-protein...  75.9    3e-13   Nicotiana sylvestris
ref|XP_009629803.1|  PREDICTED: probable serine/threonine-protein...  75.9    3e-13   Nicotiana tomentosiformis
ref|XP_010097731.1|  putative serine/threonine-protein kinase         75.5    5e-13   
ref|XP_002526522.1|  receptor protein kinase, putative                75.5    5e-13   Ricinus communis
ref|XP_004300263.1|  PREDICTED: probable serine/threonine-protein...  75.5    5e-13   Fragaria vesca subsp. vesca
ref|XP_007219059.1|  hypothetical protein PRUPE_ppa004847mg           75.1    6e-13   Prunus persica
ref|XP_008232240.1|  PREDICTED: probable serine/threonine-protein...  75.1    6e-13   Prunus mume [ume]
ref|XP_002527892.1|  receptor protein kinase, putative                75.1    6e-13   Ricinus communis
ref|XP_009374331.1|  PREDICTED: probable serine/threonine-protein...  75.1    7e-13   Pyrus x bretschneideri [bai li]
ref|XP_007134779.1|  hypothetical protein PHAVU_010G075300g           74.7    7e-13   Phaseolus vulgaris [French bean]
ref|XP_009374328.1|  PREDICTED: probable serine/threonine-protein...  74.7    7e-13   Pyrus x bretschneideri [bai li]
ref|XP_009374330.1|  PREDICTED: probable serine/threonine-protein...  74.7    7e-13   Pyrus x bretschneideri [bai li]
gb|KHN22546.1|  Putative serine/threonine-protein kinase              74.7    8e-13   Glycine soja [wild soybean]
ref|XP_009374327.1|  PREDICTED: probable serine/threonine-protein...  74.7    8e-13   Pyrus x bretschneideri [bai li]
gb|KJB74454.1|  hypothetical protein B456_011G2959002                 72.4    8e-13   Gossypium raimondii
ref|XP_010650958.1|  PREDICTED: probable serine/threonine-protein...  74.3    1e-12   Vitis vinifera
ref|XP_006464341.1|  PREDICTED: probable serine/threonine-protein...  73.9    1e-12   
ref|XP_009769483.1|  PREDICTED: probable serine/threonine-protein...  74.3    1e-12   Nicotiana sylvestris
gb|EPS71043.1|  hypothetical protein M569_03708                       74.3    1e-12   Genlisea aurea
ref|XP_006445511.1|  hypothetical protein CICLE_v10019840mg           73.9    1e-12   
ref|XP_004147901.1|  PREDICTED: probable serine/threonine-protein...  73.9    1e-12   Cucumis sativus [cucumbers]
gb|KJB74460.1|  hypothetical protein B456_011G2959002                 72.0    1e-12   Gossypium raimondii
ref|XP_004162757.1|  PREDICTED: probable serine/threonine-protein...  73.9    1e-12   
ref|XP_007008712.1|  BR-signaling kinase 2 isoform 2                  73.9    2e-12   
ref|XP_006464340.1|  PREDICTED: probable serine/threonine-protein...  73.6    2e-12   Citrus sinensis [apfelsine]
ref|XP_008438236.1|  PREDICTED: probable serine/threonine-protein...  73.6    2e-12   Cucumis melo [Oriental melon]
ref|XP_004229508.1|  PREDICTED: probable serine/threonine-protein...  73.6    2e-12   Solanum lycopersicum
ref|XP_008448868.1|  PREDICTED: probable serine/threonine-protein...  73.6    2e-12   Cucumis melo [Oriental melon]
ref|XP_007008713.1|  BR-signaling kinase 2 isoform 3                  73.9    2e-12   
ref|XP_008355658.1|  PREDICTED: probable serine/threonine-protein...  73.6    2e-12   
ref|XP_008355649.1|  PREDICTED: probable serine/threonine-protein...  73.6    2e-12   
ref|XP_008355642.1|  PREDICTED: probable serine/threonine-protein...  73.6    2e-12   
ref|XP_007008711.1|  BR-signaling kinase 2 isoform 1                  73.6    2e-12   
ref|XP_007210970.1|  hypothetical protein PRUPE_ppa022548mg           73.6    2e-12   Prunus persica
ref|XP_008355637.1|  PREDICTED: probable serine/threonine-protein...  73.6    2e-12   
ref|XP_010677274.1|  PREDICTED: probable serine/threonine-protein...  73.2    2e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP28924.1|  hypothetical protein JCGZ_14695                       73.2    2e-12   Jatropha curcas
ref|XP_009781644.1|  PREDICTED: probable serine/threonine-protein...  73.2    3e-12   Nicotiana sylvestris
ref|XP_011019187.1|  PREDICTED: probable serine/threonine-protein...  73.2    3e-12   Populus euphratica
ref|XP_006445512.1|  hypothetical protein CICLE_v10019840mg           72.8    3e-12   
ref|XP_003608643.1|  Protein kinase-like protein                      73.2    3e-12   
ref|XP_006445513.1|  hypothetical protein CICLE_v10019840mg           73.2    3e-12   Citrus clementina [clementine]
ref|XP_009397594.1|  PREDICTED: probable serine/threonine-protein...  73.2    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010275290.1|  PREDICTED: probable serine/threonine-protein...  73.2    3e-12   
gb|ACJ85588.1|  unknown                                               72.8    3e-12   Medicago truncatula
gb|KDP24521.1|  hypothetical protein JCGZ_25085                       72.8    3e-12   Jatropha curcas
gb|KEH29001.1|  LRR receptor-like kinase                              72.4    4e-12   Medicago truncatula
gb|AES90840.2|  LRR receptor-like kinase                              72.8    4e-12   Medicago truncatula
gb|KJB36863.1|  hypothetical protein B456_006G179500                  72.4    5e-12   Gossypium raimondii
ref|XP_006847686.1|  hypothetical protein AMTR_s00149p00051550        72.4    5e-12   Amborella trichopoda
ref|XP_010256740.1|  PREDICTED: probable serine/threonine-protein...  72.4    5e-12   
ref|XP_004294233.1|  PREDICTED: probable serine/threonine-protein...  72.4    5e-12   Fragaria vesca subsp. vesca
ref|XP_011460883.1|  PREDICTED: probable serine/threonine-protein...  72.4    5e-12   Fragaria vesca subsp. vesca
ref|XP_002322938.1|  kinase family protein                            72.4    5e-12   Populus trichocarpa [western balsam poplar]
gb|KHG04747.1|  hypothetical protein F383_01426                       72.4    5e-12   Gossypium arboreum [tree cotton]
ref|XP_009613653.1|  PREDICTED: probable serine/threonine-protein...  72.4    5e-12   Nicotiana tomentosiformis
ref|XP_008238295.1|  PREDICTED: probable serine/threonine-protein...  72.4    6e-12   Prunus mume [ume]
ref|XP_008219944.1|  PREDICTED: probable serine/threonine-protein...  72.4    6e-12   Prunus mume [ume]
ref|XP_007207418.1|  hypothetical protein PRUPE_ppa004824mg           72.0    6e-12   Prunus persica
ref|XP_008219936.1|  PREDICTED: probable serine/threonine-protein...  72.0    6e-12   
ref|XP_006354609.1|  PREDICTED: probable serine/threonine-protein...  72.0    6e-12   Solanum tuberosum [potatoes]
gb|KHN32516.1|  Putative serine/threonine-protein kinase              72.0    6e-12   Glycine soja [wild soybean]
ref|XP_002276280.1|  PREDICTED: probable serine/threonine-protein...  72.0    6e-12   Vitis vinifera
gb|KEH29000.1|  LRR receptor-like kinase                              72.0    6e-12   Medicago truncatula
ref|XP_003520945.1|  PREDICTED: probable serine/threonine-protein...  72.0    7e-12   
gb|EYU26629.1|  hypothetical protein MIMGU_mgv1a005339mg              72.0    7e-12   Erythranthe guttata [common monkey flower]
gb|AFW87784.1|  putative protein kinase superfamily protein           69.7    7e-12   
ref|XP_002975669.1|  hypothetical protein SELMODRAFT_103506           72.0    7e-12   
gb|EYU26628.1|  hypothetical protein MIMGU_mgv1a005339mg              72.0    7e-12   Erythranthe guttata [common monkey flower]
gb|EYU40299.1|  hypothetical protein MIMGU_mgv1a005192mg              71.6    7e-12   Erythranthe guttata [common monkey flower]
ref|XP_010104360.1|  putative serine/threonine-protein kinase         72.0    8e-12   Morus notabilis
gb|EYU40298.1|  hypothetical protein MIMGU_mgv1a005192mg              71.6    8e-12   Erythranthe guttata [common monkey flower]
ref|XP_004133947.1|  PREDICTED: probable serine/threonine-protein...  71.6    9e-12   Cucumis sativus [cucumbers]
ref|XP_007026838.1|  Kinase protein with tetratricopeptide repeat...  71.6    1e-11   
ref|XP_009626367.1|  PREDICTED: probable serine/threonine-protein...  71.2    1e-11   
ref|XP_011093461.1|  PREDICTED: probable serine/threonine-protein...  71.2    1e-11   Sesamum indicum [beniseed]
ref|XP_007155758.1|  hypothetical protein PHAVU_003G229100g           70.9    2e-11   Phaseolus vulgaris [French bean]
ref|XP_004983586.1|  PREDICTED: probable serine/threonine-protein...  70.9    2e-11   Setaria italica
ref|XP_006651012.1|  PREDICTED: probable serine/threonine-protein...  70.9    2e-11   
ref|XP_006662088.1|  PREDICTED: probable serine/threonine-protein...  70.9    2e-11   Oryza brachyantha
gb|KJB37545.1|  hypothetical protein B456_006G209500                  70.5    2e-11   Gossypium raimondii
ref|XP_001772928.1|  predicted protein                                70.5    2e-11   
emb|CDY12866.1|  BnaA09g14080D                                        67.8    2e-11   Brassica napus [oilseed rape]
ref|XP_006280372.1|  hypothetical protein CARUB_v10026298mg           70.5    3e-11   Capsella rubella
ref|XP_004513275.1|  PREDICTED: probable serine/threonine-protein...  70.5    3e-11   Cicer arietinum [garbanzo]
ref|XP_006401013.1|  hypothetical protein EUTSA_v10013377mg           70.1    3e-11   Eutrema salsugineum [saltwater cress]
ref|XP_001753441.1|  predicted protein                                70.1    3e-11   
ref|XP_009126720.1|  PREDICTED: probable serine/threonine-protein...  70.1    3e-11   Brassica rapa
gb|EEC67482.1|  hypothetical protein OsI_34730                        70.1    3e-11   Oryza sativa Indica Group [Indian rice]
emb|CDY32670.1|  BnaA02g07320D                                        70.1    3e-11   Brassica napus [oilseed rape]
ref|XP_006280371.1|  hypothetical protein CARUB_v10026298mg           69.7    3e-11   
ref|NP_001065455.1|  Os10g0571300                                     70.1    3e-11   
ref|XP_002520456.1|  receptor protein kinase, putative                69.7    4e-11   Ricinus communis
ref|XP_002308195.1|  kinase family protein                            69.7    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003549974.1|  PREDICTED: probable serine/threonine-protein...  69.7    4e-11   Glycine max [soybeans]
ref|XP_006381227.1|  hypothetical protein POPTR_0006s09500g           69.7    4e-11   
ref|XP_003524482.1|  PREDICTED: probable serine/threonine-protein...  69.7    4e-11   Glycine max [soybeans]
gb|EAZ25481.1|  hypothetical protein OsJ_09304                        69.7    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048870.1|  Os03g0132800                                     69.7    4e-11   
ref|XP_006350809.1|  PREDICTED: probable serine/threonine-protein...  69.7    4e-11   
emb|CDY02851.1|  BnaC02g10380D                                        69.7    5e-11   
ref|XP_003574368.1|  PREDICTED: probable serine/threonine-protein...  69.7    5e-11   Brachypodium distachyon [annual false brome]
ref|XP_011085061.1|  PREDICTED: probable serine/threonine-protein...  69.7    5e-11   Sesamum indicum [beniseed]
ref|XP_010262700.1|  PREDICTED: probable serine/threonine-protein...  69.3    5e-11   Nelumbo nucifera [Indian lotus]
ref|XP_011041263.1|  PREDICTED: probable serine/threonine-protein...  69.3    6e-11   Populus euphratica
ref|XP_011094943.1|  PREDICTED: probable serine/threonine-protein...  69.3    6e-11   Sesamum indicum [beniseed]
ref|XP_004509006.1|  PREDICTED: probable serine/threonine-protein...  69.3    6e-11   
ref|XP_011085053.1|  PREDICTED: probable serine/threonine-protein...  69.3    7e-11   Sesamum indicum [beniseed]
gb|AFW87785.1|  putative protein kinase superfamily protein           69.3    7e-11   
ref|XP_011041262.1|  PREDICTED: probable serine/threonine-protein...  69.3    7e-11   Populus euphratica
ref|NP_001148892.1|  ATP binding protein                              69.3    7e-11   
ref|XP_002467458.1|  hypothetical protein SORBIDRAFT_01g028460        69.3    7e-11   Sorghum bicolor [broomcorn]
ref|XP_002866308.1|  hypothetical protein ARALYDRAFT_496029           68.9    7e-11   
ref|XP_004145595.1|  PREDICTED: probable serine/threonine-protein...  68.9    7e-11   Cucumis sativus [cucumbers]
ref|XP_009120410.1|  PREDICTED: probable serine/threonine-protein...  68.9    7e-11   Brassica rapa
ref|XP_008658549.1|  PREDICTED: probable serine/threonine-protein...  68.9    7e-11   Zea mays [maize]
ref|NP_200709.2|  brassinosteroid-signaling kinase 5                  68.9    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010269970.1|  PREDICTED: probable serine/threonine-protein...  68.9    8e-11   Nelumbo nucifera [Indian lotus]
ref|XP_011028219.1|  PREDICTED: probable serine/threonine-protein...  68.9    8e-11   Populus euphratica
ref|XP_004509007.1|  PREDICTED: probable serine/threonine-protein...  68.9    8e-11   Cicer arietinum [garbanzo]
gb|KJB16992.1|  hypothetical protein B456_002G259200                  68.9    9e-11   Gossypium raimondii
emb|CDY67218.1|  BnaC09g53790D                                        68.9    9e-11   Brassica napus [oilseed rape]
gb|KGN55487.1|  hypothetical protein Csa_4G653480                     68.2    1e-10   Cucumis sativus [cucumbers]
ref|XP_010685653.1|  PREDICTED: probable serine/threonine-protein...  68.6    1e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002280602.1|  PREDICTED: probable serine/threonine-protein...  68.6    1e-10   Vitis vinifera
ref|XP_004157122.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  68.6    1e-10   
ref|XP_008452940.1|  PREDICTED: probable serine/threonine-protein...  68.6    1e-10   
ref|XP_008244902.1|  PREDICTED: probable serine/threonine-protein...  68.6    1e-10   Prunus mume [ume]
gb|AAC13615.1|  F6N23.9 gene product                                  68.2    1e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDP06541.1|  unnamed protein product                              68.2    1e-10   Coffea canephora [robusta coffee]
ref|XP_006385621.1|  kinase family protein                            68.2    1e-10   
gb|KDO86128.1|  hypothetical protein CISIN_1g011068mg                 67.8    2e-10   Citrus sinensis [apfelsine]
ref|XP_007219058.1|  hypothetical protein PRUPE_ppa004843mg           67.8    2e-10   Prunus persica
gb|KDP46579.1|  hypothetical protein JCGZ_08551                       67.8    2e-10   Jatropha curcas
ref|XP_004242068.2|  PREDICTED: probable serine/threonine-protein...  67.8    2e-10   Solanum lycopersicum
ref|XP_009374326.1|  PREDICTED: probable serine/threonine-protein...  67.8    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_009373443.1|  PREDICTED: probable serine/threonine-protein...  67.8    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_010056495.1|  PREDICTED: probable serine/threonine-protein...  67.8    2e-10   Eucalyptus grandis [rose gum]
ref|XP_008385086.1|  PREDICTED: probable serine/threonine-protein...  67.8    2e-10   
ref|NP_191980.2|  BR-signaling kinase 3                               67.8    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011032201.1|  PREDICTED: probable serine/threonine-protein...  67.8    2e-10   Populus euphratica
ref|XP_011032200.1|  PREDICTED: probable serine/threonine-protein...  67.8    2e-10   Populus euphratica
ref|XP_004302682.1|  PREDICTED: probable serine/threonine-protein...  67.8    2e-10   
ref|XP_010087901.1|  putative serine/threonine-protein kinase         67.4    2e-10   
ref|XP_002875018.1|  kinase family protein                            67.8    2e-10   
ref|XP_010477276.1|  PREDICTED: probable serine/threonine-protein...  64.7    2e-10   
ref|XP_010535431.1|  PREDICTED: probable serine/threonine-protein...  67.4    2e-10   
ref|XP_001770164.1|  predicted protein                                67.4    2e-10   
ref|XP_006429250.1|  hypothetical protein CICLE_v10011574mg           67.4    2e-10   
ref|XP_006480926.1|  PREDICTED: probable serine/threonine-protein...  67.4    3e-10   
ref|XP_009395438.1|  PREDICTED: probable serine/threonine-protein...  67.4    3e-10   
ref|XP_003574272.1|  PREDICTED: probable serine/threonine-protein...  67.4    3e-10   
ref|XP_009111467.1|  PREDICTED: probable serine/threonine-protein...  67.0    3e-10   
emb|CDY07203.1|  BnaCnng02180D                                        67.0    3e-10   
ref|XP_006287612.1|  hypothetical protein CARUB_v10000824mg           67.0    3e-10   
ref|XP_007016247.1|  Kinase protein with tetratricopeptide repeat...  67.0    3e-10   
ref|XP_007051830.1|  BR-signaling kinase 3                            67.0    4e-10   
ref|XP_009382808.1|  PREDICTED: probable serine/threonine-protein...  67.0    4e-10   
ref|XP_010066321.1|  PREDICTED: probable serine/threonine-protein...  67.0    4e-10   
ref|XP_001782381.1|  predicted protein                                67.0    4e-10   
ref|XP_010066320.1|  PREDICTED: probable serine/threonine-protein...  67.0    4e-10   
gb|EPS63745.1|  hypothetical protein M569_11039                       66.6    5e-10   
ref|XP_010443652.1|  PREDICTED: probable serine/threonine-protein...  66.2    6e-10   
ref|XP_006396266.1|  hypothetical protein EUTSA_v10028608mg           66.2    6e-10   
ref|XP_008373543.1|  PREDICTED: probable serine/threonine-protein...  66.2    6e-10   
ref|XP_002314137.1|  kinase family protein                            66.2    6e-10   
ref|XP_008370030.1|  PREDICTED: probable serine/threonine-protein...  66.2    6e-10   
gb|EEE51445.1|  hypothetical protein OsJ_32540                        67.0    6e-10   
gb|KDO86129.1|  hypothetical protein CISIN_1g011068mg                 65.5    7e-10   
ref|XP_011469028.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  66.2    7e-10   
ref|XP_002307775.2|  hypothetical protein POPTR_0005s27070g           66.2    7e-10   
ref|XP_010427322.1|  PREDICTED: probable serine/threonine-protein...  66.2    7e-10   
ref|XP_007205108.1|  hypothetical protein PRUPE_ppa004740mg           65.9    8e-10   
ref|XP_010661772.1|  PREDICTED: probable serine/threonine-protein...  65.9    8e-10   
ref|XP_010661771.1|  PREDICTED: probable serine/threonine-protein...  65.9    8e-10   
emb|CDY51145.1|  BnaA09g51800D                                        65.9    8e-10   
ref|XP_008239954.1|  PREDICTED: probable serine/threonine-protein...  65.9    8e-10   
ref|XP_006445068.1|  hypothetical protein CICLE_v10019852mg           65.9    9e-10   
ref|XP_006445067.1|  hypothetical protein CICLE_v10019852mg           65.9    9e-10   
ref|XP_002299839.1|  kinase family protein                            65.9    9e-10   
gb|KDO86130.1|  hypothetical protein CISIN_1g011068mg                 65.9    9e-10   
ref|XP_002468567.1|  hypothetical protein SORBIDRAFT_01g048160        65.9    9e-10   
ref|XP_001769037.1|  predicted protein                                65.1    1e-09   
ref|XP_008366761.1|  PREDICTED: probable serine/threonine-protein...  65.9    1e-09   
ref|XP_011023358.1|  PREDICTED: probable serine/threonine-protein...  65.9    1e-09   
ref|XP_011023359.1|  PREDICTED: probable serine/threonine-protein...  65.5    1e-09   
ref|XP_006414164.1|  hypothetical protein EUTSA_v10025008mg           65.5    1e-09   
ref|XP_006424976.1|  hypothetical protein CICLE_v10028295mg           65.5    1e-09   
ref|XP_009134535.1|  PREDICTED: probable serine/threonine-protein...  65.5    1e-09   
ref|XP_002321250.2|  hypothetical protein POPTR_0014s17740g           65.5    1e-09   
ref|XP_009134536.1|  PREDICTED: probable serine/threonine-protein...  65.5    1e-09   
ref|XP_008464075.1|  PREDICTED: probable serine/threonine-protein...  65.5    1e-09   
ref|XP_004143136.1|  PREDICTED: probable serine/threonine-protein...  65.5    1e-09   
ref|XP_006414165.1|  hypothetical protein EUTSA_v10025008mg           65.5    1e-09   
ref|XP_001754196.1|  predicted protein                                65.1    1e-09   
emb|CDP09742.1|  unnamed protein product                              65.1    1e-09   
ref|XP_010483518.1|  PREDICTED: probable serine/threonine-protein...  65.1    1e-09   
emb|CDX74345.1|  BnaA03g27020D                                        65.1    1e-09   
emb|CDX91898.1|  BnaC03g32000D                                        65.1    1e-09   
ref|XP_011010377.1|  PREDICTED: probable serine/threonine-protein...  65.5    1e-09   
ref|XP_010273050.1|  PREDICTED: probable serine/threonine-protein...  65.1    1e-09   
gb|KDO66709.1|  hypothetical protein CISIN_1g011349mg                 64.7    2e-09   
ref|XP_002509803.1|  receptor protein kinase, putative                63.5    2e-09   
ref|XP_006827662.1|  hypothetical protein AMTR_s00009p00252980        65.1    2e-09   
ref|XP_009358810.1|  PREDICTED: probable serine/threonine-protein...  65.1    2e-09   
gb|AAM62649.1|  protein kinase-like protein                           65.1    2e-09   
ref|NP_190971.1|  Protein kinase protein with tetratricopeptide r...  65.1    2e-09   
ref|XP_010529125.1|  PREDICTED: probable serine/threonine-protein...  65.1    2e-09   
gb|KDO66707.1|  hypothetical protein CISIN_1g011349mg                 64.7    2e-09   
gb|AAF19710.1|AC008047_17  F2K11.13                                   65.1    2e-09   
gb|KFK27443.1|  hypothetical protein AALP_AA8G383000                  64.7    2e-09   
gb|EYU41809.1|  hypothetical protein MIMGU_mgv1a004097mg              65.1    2e-09   
gb|KDO66708.1|  hypothetical protein CISIN_1g011349mg                 64.7    2e-09   
ref|XP_010273058.1|  PREDICTED: probable serine/threonine-protein...  64.7    2e-09   
ref|XP_011035234.1|  PREDICTED: probable serine/threonine-protein...  64.7    2e-09   
ref|XP_008788683.1|  PREDICTED: probable serine/threonine-protein...  64.7    2e-09   
ref|XP_002876237.1|  kinase family protein                            64.7    2e-09   
ref|XP_009396196.1|  PREDICTED: probable serine/threonine-protein...  64.7    2e-09   
ref|XP_011035233.1|  PREDICTED: probable serine/threonine-protein...  64.7    2e-09   
ref|XP_006424975.1|  hypothetical protein CICLE_v10028295mg           64.7    2e-09   
ref|XP_006290975.1|  hypothetical protein CARUB_v10017094mg           64.7    2e-09   
ref|XP_010504192.1|  PREDICTED: probable serine/threonine-protein...  64.7    2e-09   
gb|KEH30209.1|  LRR receptor-like kinase                              64.3    2e-09   
ref|XP_010515916.1|  PREDICTED: probable serine/threonine-protein...  64.7    2e-09   
ref|XP_010427068.1|  PREDICTED: probable serine/threonine-protein...  64.7    2e-09   
ref|XP_002301354.1|  kinase family protein                            64.7    2e-09   
gb|KDO66706.1|  hypothetical protein CISIN_1g011349mg                 64.3    3e-09   
ref|XP_004295719.1|  PREDICTED: probable serine/threonine-protein...  64.3    3e-09   
ref|XP_004985824.1|  PREDICTED: probable serine/threonine-protein...  64.3    3e-09   
gb|KJB49494.1|  hypothetical protein B456_008G122000                  64.3    3e-09   
emb|CDY13169.1|  BnaC04g26660D                                        64.3    3e-09   
ref|XP_011460884.1|  PREDICTED: probable serine/threonine-protein...  64.3    3e-09   
gb|KJB49493.1|  hypothetical protein B456_008G122000                  63.9    3e-09   
ref|XP_004985825.1|  PREDICTED: probable serine/threonine-protein...  64.3    3e-09   
ref|XP_011081147.1|  PREDICTED: probable serine/threonine-protein...  64.3    3e-09   
gb|KFK34649.1|  hypothetical protein AALP_AA5G173200                  64.3    3e-09   
ref|XP_009139269.1|  PREDICTED: probable serine/threonine-protein...  64.3    3e-09   
ref|XP_004298792.1|  PREDICTED: probable serine/threonine-protein...  64.3    3e-09   
emb|CDX76175.1|  BnaA04g04390D                                        64.3    3e-09   
gb|KHG24015.1|  hypothetical protein F383_06670                       63.9    3e-09   
emb|CDY64092.1|  BnaCnng43070D                                        64.3    3e-09   
ref|XP_002270065.1|  PREDICTED: probable serine/threonine-protein...  64.3    3e-09   
emb|CDY68942.1|  BnaAnng28860D                                        64.3    3e-09   
emb|CDY34359.1|  BnaA09g11010D                                        64.3    3e-09   
ref|XP_010430453.1|  PREDICTED: probable serine/threonine-protein...  64.3    3e-09   
gb|KHG24016.1|  hypothetical protein F383_06670                       63.9    3e-09   
ref|XP_009112941.1|  PREDICTED: probable serine/threonine-protein...  64.3    3e-09   
emb|CDY25502.1|  BnaC09g11270D                                        64.3    3e-09   
ref|XP_011036082.1|  PREDICTED: probable serine/threonine-protein...  64.3    3e-09   
ref|XP_002320126.1|  kinase family protein                            64.3    3e-09   
ref|XP_008799360.1|  PREDICTED: probable serine/threonine-protein...  63.9    3e-09   
ref|NP_176539.4|  Protein kinase protein with tetratricopeptide r...  63.9    3e-09   
ref|XP_010418376.1|  PREDICTED: probable serine/threonine-protein...  63.9    3e-09   
ref|XP_009112750.1|  PREDICTED: probable serine/threonine-protein...  63.9    3e-09   
ref|XP_006403626.1|  hypothetical protein EUTSA_v10010321mg           63.9    3e-09   
ref|XP_002887955.1|  kinase family protein                            63.9    4e-09   
ref|XP_003558885.1|  PREDICTED: probable serine/threonine-protein...  63.9    4e-09   
ref|XP_009337369.1|  PREDICTED: probable serine/threonine-protein...  63.9    4e-09   
ref|XP_006848031.1|  hypothetical protein AMTR_s00029p00181840        63.9    4e-09   
emb|CDY66348.1|  BnaC04g54930D                                        63.9    4e-09   
ref|XP_006391738.1|  hypothetical protein EUTSA_v10023428mg           63.9    4e-09   
ref|XP_008355608.1|  PREDICTED: probable serine/threonine-protein...  63.9    4e-09   
gb|KDO76141.1|  hypothetical protein CISIN_1g0113532mg                62.4    4e-09   
ref|XP_010934997.1|  PREDICTED: probable serine/threonine-protein...  63.9    4e-09   
ref|XP_010105949.1|  putative serine/threonine-protein kinase         63.9    4e-09   
ref|XP_006302192.1|  hypothetical protein CARUB_v10020201mg           63.9    4e-09   
gb|KDO76138.1|  hypothetical protein CISIN_1g0113532mg                63.5    4e-09   
gb|EPS66661.1|  hypothetical protein M569_08114                       63.9    4e-09   
ref|XP_010553513.1|  PREDICTED: probable serine/threonine-protein...  63.5    5e-09   
ref|XP_010528620.1|  PREDICTED: probable serine/threonine-protein...  63.5    5e-09   
gb|KDO76139.1|  hypothetical protein CISIN_1g0113532mg                62.8    5e-09   
ref|XP_003543546.1|  PREDICTED: probable serine/threonine-protein...  63.5    5e-09   
gb|KDP25437.1|  hypothetical protein JCGZ_20593                       63.5    5e-09   
ref|XP_004507141.1|  PREDICTED: probable serine/threonine-protein...  63.5    5e-09   
ref|XP_010941215.1|  PREDICTED: probable serine/threonine-protein...  63.5    5e-09   
ref|XP_008238842.1|  PREDICTED: probable serine/threonine-protein...  63.5    6e-09   
ref|XP_006405374.1|  hypothetical protein EUTSA_v10027736mg           63.5    6e-09   
gb|KFK40503.1|  hypothetical protein AALP_AA2G004300                  63.5    6e-09   
ref|XP_001757342.1|  predicted protein                                62.4    6e-09   
pdb|4I92|A  Chain A, Structure Of The Bsk8 Kinase Domain              62.4    6e-09   
gb|KJB52104.1|  hypothetical protein B456_008G246800                  63.2    6e-09   
ref|XP_009627922.1|  PREDICTED: probable serine/threonine-protein...  63.5    6e-09   
ref|XP_009346992.1|  PREDICTED: probable serine/threonine-protein...  63.5    6e-09   
emb|CDP09128.1|  unnamed protein product                              63.5    6e-09   
gb|KDO76140.1|  hypothetical protein CISIN_1g0113532mg                62.8    6e-09   
ref|XP_008437265.1|  PREDICTED: probable serine/threonine-protein...  63.2    6e-09   
ref|XP_007209958.1|  hypothetical protein PRUPE_ppa004862mg           63.2    7e-09   
ref|XP_004143908.1|  PREDICTED: probable serine/threonine-protein...  63.2    7e-09   
pdb|4I93|A  Chain A, Structure Of The Bsk8 Kinase Domain (semet L...  62.0    7e-09   
gb|KEH18870.1|  LRR receptor-like kinase                              63.2    8e-09   
ref|XP_011029267.1|  PREDICTED: probable serine/threonine-protein...  63.2    8e-09   
ref|XP_007040220.1|  Kinase protein with tetratricopeptide repeat...  63.2    8e-09   
ref|XP_007040223.1|  Kinase protein with tetratricopeptide repeat...  63.2    8e-09   
ref|XP_006439590.1|  hypothetical protein CICLE_v10019894mg           62.8    9e-09   
ref|XP_003521048.1|  PREDICTED: probable serine/threonine-protein...  62.8    9e-09   
ref|XP_010540278.1|  PREDICTED: probable serine/threonine-protein...  62.8    9e-09   
ref|XP_010314694.1|  PREDICTED: probable serine/threonine-protein...  62.8    9e-09   
ref|XP_004507143.1|  PREDICTED: probable serine/threonine-protein...  62.8    9e-09   
gb|KJB52101.1|  hypothetical protein B456_008G246800                  62.8    9e-09   
gb|EYU23482.1|  hypothetical protein MIMGU_mgv1a005326mg              62.8    9e-09   
ref|XP_004507142.1|  PREDICTED: probable serine/threonine-protein...  62.8    9e-09   
ref|XP_002511845.1|  receptor protein kinase, putative                62.8    9e-09   
ref|XP_009594297.1|  PREDICTED: probable serine/threonine-protein...  62.8    1e-08   
gb|EYU23481.1|  hypothetical protein MIMGU_mgv1a005326mg              62.8    1e-08   
ref|XP_002870647.1|  kinase family protein                            62.8    1e-08   
ref|XP_007135047.1|  hypothetical protein PHAVU_010G097200g           62.8    1e-08   
ref|XP_004510799.1|  PREDICTED: probable serine/threonine-protein...  62.8    1e-08   
ref|XP_003525398.1|  PREDICTED: probable serine/threonine-protein...  62.8    1e-08   
gb|KHN23649.1|  Putative serine/threonine-protein kinase              62.8    1e-08   
ref|XP_006349787.1|  PREDICTED: probable serine/threonine-protein...  62.8    1e-08   
ref|XP_009796958.1|  PREDICTED: probable serine/threonine-protein...  62.8    1e-08   
ref|XP_004249553.1|  PREDICTED: probable serine/threonine-protein...  62.8    1e-08   
gb|KEH30208.1|  LRR receptor-like kinase                              62.8    1e-08   
ref|XP_009630032.1|  PREDICTED: probable serine/threonine-protein...  62.4    1e-08   
ref|NP_198942.1|  brassinosteroid-signaling kinase 8                  62.4    1e-08   
gb|KHG03553.1|  hypothetical protein F383_27880                       62.4    1e-08   
ref|XP_009768644.1|  PREDICTED: probable serine/threonine-protein...  62.4    1e-08   
ref|XP_004165237.1|  PREDICTED: probable serine/threonine-protein...  62.4    1e-08   
ref|XP_008801372.1|  PREDICTED: probable serine/threonine-protein...  62.4    1e-08   
gb|AAX61122.1|  stress-inducible protein kinase                       61.6    1e-08   
ref|XP_009772223.1|  PREDICTED: probable serine/threonine-protein...  62.4    1e-08   
gb|KHG11028.1|  hypothetical protein F383_13634                       62.0    1e-08   
ref|XP_010553263.1|  PREDICTED: probable serine/threonine-protein...  62.4    1e-08   
ref|XP_004146525.1|  PREDICTED: probable serine/threonine-protein...  62.4    1e-08   
ref|XP_008452028.1|  PREDICTED: probable serine/threonine-protein...  62.4    1e-08   
gb|KDO76136.1|  hypothetical protein CISIN_1g0113532mg                62.0    1e-08   
ref|XP_008452029.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-08   
ref|XP_009342511.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-08   
gb|KDO76133.1|  hypothetical protein CISIN_1g0113532mg                62.0    2e-08   
ref|XP_009342509.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-08   
ref|XP_009342508.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-08   
ref|XP_008787537.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-08   
emb|CDY07908.1|  BnaC03g36150D                                        62.0    2e-08   
ref|XP_007132022.1|  hypothetical protein PHAVU_011G060100g           62.0    2e-08   
ref|XP_009342510.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-08   
ref|XP_006356351.1|  PREDICTED: probable serine/threonine-protein...  62.4    2e-08   
gb|KDO76134.1|  hypothetical protein CISIN_1g0113532mg                62.0    2e-08   
ref|XP_006476603.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-08   
ref|XP_006439591.1|  hypothetical protein CICLE_v10019894mg           62.0    2e-08   
ref|XP_009135987.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-08   
ref|XP_008219902.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-08   
emb|CDP08380.1|  unnamed protein product                              58.2    2e-08   
dbj|BAJ85945.1|  predicted protein                                    61.6    2e-08   
tpg|DAA43200.1|  TPA: putative protein kinase superfamily protein     60.1    2e-08   
ref|XP_006339002.1|  PREDICTED: probable serine/threonine-protein...  61.6    2e-08   
emb|CDX73964.1|  BnaA03g30830D                                        61.6    2e-08   
ref|XP_002467567.1|  hypothetical protein SORBIDRAFT_01g030290        61.6    2e-08   
ref|XP_010931161.1|  PREDICTED: probable serine/threonine-protein...  61.6    2e-08   
ref|XP_003528859.1|  PREDICTED: probable serine/threonine-protein...  61.6    2e-08   
gb|AAO42035.1|  putative protein kinase                               61.6    2e-08   
ref|XP_010940470.1|  PREDICTED: probable serine/threonine-protein...  61.6    2e-08   
ref|XP_011022704.1|  PREDICTED: probable serine/threonine-protein...  61.6    2e-08   
tpg|DAA35281.1|  TPA: putative protein kinase superfamily protein     62.0    2e-08   
ref|XP_009794755.1|  PREDICTED: probable serine/threonine-protein...  61.6    3e-08   
ref|XP_007160056.1|  hypothetical protein PHAVU_002G289000g           61.6    3e-08   
ref|XP_004250894.1|  PREDICTED: probable serine/threonine-protein...  61.6    3e-08   
ref|NP_199469.1|  BR-signaling kinase 2                               61.6    3e-08   
ref|XP_009789548.1|  PREDICTED: probable serine/threonine-protein...  61.6    3e-08   
ref|XP_010934763.1|  PREDICTED: probable serine/threonine-protein...  61.6    3e-08   
ref|XP_011022702.1|  PREDICTED: probable serine/threonine-protein...  61.6    3e-08   
ref|XP_007207435.1|  hypothetical protein PRUPE_ppa005064mg           61.6    3e-08   
ref|XP_009101507.1|  PREDICTED: probable serine/threonine-protein...  61.6    3e-08   
ref|XP_002303586.2|  kinase family protein                            61.6    3e-08   



>ref|XP_009771504.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Nicotiana sylvestris]
Length=264

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 67/99 (68%), Gaps = 7/99 (7%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLS-SNGKDsgggggggaaseggasVFAEFSLSE  292
            MGCW S+ S   P S  DHR    H     SNG          A S+GG   F+EFSL+E
Sbjct  1    MGCWHSSLSSKDPTS--DHRHVHTHKPPRFSNG----TTAAAAAVSDGGVPAFSEFSLAE  54

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LK ATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK
Sbjct  55   LKTATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  93



>ref|XP_009771502.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Nicotiana sylvestris]
Length=272

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 67/99 (68%), Gaps = 7/99 (7%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLS-SNGKDsgggggggaaseggasVFAEFSLSE  292
            MGCW S+ S   P S  DHR    H     SNG          A S+GG   F+EFSL+E
Sbjct  1    MGCWHSSLSSKDPTS--DHRHVHTHKPPRFSNG----TTAAAAAVSDGGVPAFSEFSLAE  54

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LK ATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK
Sbjct  55   LKTATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  93



>ref|XP_009606854.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
Length=501

 Score =   106 bits (264),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 63/99 (64%), Positives = 67/99 (68%), Gaps = 7/99 (7%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLS-SNGKDsgggggggaaseggasVFAEFSLSE  292
            MGCW S+ S   P S  DHR    H     SNG          A S+GG   F+EFSL+E
Sbjct  1    MGCWHSSLSSKDPTS--DHRHVHTHKPPRFSNG----TTAAAPAVSDGGVPAFSEFSLAE  54

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LK ATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK
Sbjct  55   LKTATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  93



>ref|XP_009618839.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
Length=497

 Score =   106 bits (264),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 64/98 (65%), Positives = 71/98 (72%), Gaps = 8/98 (8%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC QS+  ++   SEKD R G      +SNG        G A  +GG  VF+EFSLSEL
Sbjct  1    MGCCQSSIQQELS-SEKDQRHGGVSHPRASNG-------TGAAVGDGGVPVFSEFSLSEL  52

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSSEFIVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  53   KAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVK  90



>ref|XP_009777631.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana sylvestris]
Length=497

 Score =   105 bits (261),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 64/98 (65%), Positives = 71/98 (72%), Gaps = 8/98 (8%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC QS+  ++   SEKD R G      +SNG        G A  +GG  VF+EFSLSEL
Sbjct  1    MGCCQSSILQELS-SEKDQRHGGVSHPRASNG-------TGAAVGDGGVPVFSEFSLSEL  52

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSSEFIVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  53   KAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVK  90



>ref|XP_004238413.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Solanum lycopersicum]
Length=498

 Score =   105 bits (261),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 66/98 (67%), Positives = 72/98 (73%), Gaps = 7/98 (7%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC QS+  K+   SEKD R G        N + S G G G A  +GG  VF+EFSLSEL
Sbjct  1    MGCCQSSILKELS-SEKDQRHG------VVNARASNGTGAGAAVGDGGVPVFSEFSLSEL  53

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSSEFIVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  54   KAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVK  91



>ref|XP_006342111.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Solanum tuberosum]
Length=498

 Score =   105 bits (261),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 66/98 (67%), Positives = 72/98 (73%), Gaps = 7/98 (7%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC QS+  K+   SEKD R G        N + S G G G A  +GG  VF+EFSLSEL
Sbjct  1    MGCCQSSILKELS-SEKDQRHG------VVNARPSNGTGAGAAVGDGGVPVFSEFSLSEL  53

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSSEFIVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  54   KAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVK  91



>emb|CAN74078.1| hypothetical protein VITISV_000979 [Vitis vinifera]
Length=508

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 63/101 (62%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKD---HRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSL  286
            MGC QS+  K R  SEKD      G  HT  S+    +  G G G    GG   F+EFSL
Sbjct  1    MGCCQSSLFK-RTRSEKDRYPQTTGLNHTPPSNGTDAAAAGVGDGGGGAGGVPAFSEFSL  59

Query  287  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            ++LKAATNNFSS+FIVSESGEKAPNVVYKGRLQNRRWIAVK
Sbjct  60   ADLKAATNNFSSDFIVSESGEKAPNVVYKGRLQNRRWIAVK  100



>ref|XP_002285926.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Vitis vinifera]
 emb|CBI18875.3| unnamed protein product [Vitis vinifera]
Length=508

 Score =   100 bits (249),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 62/101 (61%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKD---HRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSL  286
            MGC QS+  K R  S+KD      G  HT  S+    +  G G G    GG   F+EFSL
Sbjct  1    MGCCQSSLFK-RTRSDKDRYPQTTGLNHTPPSNGTDAAAAGVGDGGEGAGGVPAFSEFSL  59

Query  287  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            ++LKAATNNFSS+FIVSESGEKAPNVVYKGRLQNRRWIAVK
Sbjct  60   ADLKAATNNFSSDFIVSESGEKAPNVVYKGRLQNRRWIAVK  100



>emb|CDP07307.1| unnamed protein product [Coffea canephora]
Length=500

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 59/104 (57%), Positives = 65/104 (63%), Gaps = 17/104 (16%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQ------GQGHTLLSSNGKDsgggggggaaseggasVFAE  277
            MGC QS         +KD         GQ H   SSNG +  G  G           F+E
Sbjct  1    MGCCQSFLPMGSRPRDKDQHHYGGAVGGQPHHPRSSNGTEGAGAQG-----------FSE  49

Query  278  FSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            FSL+ELKAATNNFSS+FIVSESGEKAPNVVY+GRLQNRRWIAVK
Sbjct  50   FSLAELKAATNNFSSDFIVSESGEKAPNVVYRGRLQNRRWIAVK  93



>ref|XP_008236113.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Prunus mume]
Length=502

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC +S  S+ +P    D  Q Q H   S           G     GGA  F+EFS S+L
Sbjct  1    MGCCESKVSEKQP----DKLQIQAHANNSRTPTHHQNPSPGSDPETGGAPPFSEFSFSDL  56

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSS+FIVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  57   KAATNNFSSDFIVSESGEKAPNLVYKGRLQNRRWIAVK  94



>gb|EYU38018.1| hypothetical protein MIMGU_mgv1a004862mg [Erythranthe guttata]
Length=393

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 64/100 (64%), Gaps = 3/100 (3%)
 Frame = +2

Query  116  MGCWQSTF--SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLS  289
            MGC  S F  ++  P  EK    G G  LLS+       GG     +  G   F+EFS +
Sbjct  1    MGCCVSKFQPTETHPEKEKTKTHGPGQ-LLSTRPPPPAVGGAEPGLASSGVPSFSEFSFA  59

Query  290  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            +LK ATNNFS +FIVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  60   DLKTATNNFSPDFIVSESGEKAPNIVYKGRLQNRRWIAVK  99



>emb|CAA18746.1| putative protein [Arabidopsis thaliana]
 emb|CAB80240.1| putative protein [Arabidopsis thaliana]
Length=524

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 69/105 (66%), Gaps = 8/105 (8%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQ-------GHTLLSSNGKDsgggggggaaseggasVFA  274
            MGC QS FS D P+  KD  Q Q       G    + NG   G  G GG    GG   F+
Sbjct  1    MGCCQSLFSGDNPLG-KDGVQPQPLSQNNHGGATTADNGGSGGASGVGGGGGGGGIPSFS  59

Query  275  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  60   EFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  104



>ref|NP_567980.1| BR-signaling kinase 1 [Arabidopsis thaliana]
 sp|Q944A7.1|Y4523_ARATH RecName: Full=Probable serine/threonine-protein kinase At4g35230 
[Arabidopsis thaliana]
 gb|AAL27496.1|AF439824_1 AT4g35230/F23E12_210 [Arabidopsis thaliana]
 gb|AAM98327.1| At4g35230/F23E12_210 [Arabidopsis thaliana]
 gb|AEE86482.1| BR-signaling kinase 1 [Arabidopsis thaliana]
Length=512

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 69/105 (66%), Gaps = 8/105 (8%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQ-------GHTLLSSNGKDsgggggggaaseggasVFA  274
            MGC QS FS D P+  KD  Q Q       G    + NG   G  G GG    GG   F+
Sbjct  1    MGCCQSLFSGDNPLG-KDGVQPQPLSQNNHGGATTADNGGSGGASGVGGGGGGGGIPSFS  59

Query  275  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  60   EFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  104



>ref|XP_008360691.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Malus domestica]
Length=503

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 56/98 (57%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC +S  S+ +P  EK   Q   H   S N         G     GGA  F+EFS ++L
Sbjct  1    MGCCESKVSEKQP-PEKIQTQQLAHN--SRNPTHHPNPTSGSDPETGGAPPFSEFSFADL  57

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  58   KAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVK  95



>ref|XP_010061148.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Eucalyptus grandis]
 gb|KCW68068.1| hypothetical protein EUGRSUZ_F01752 [Eucalyptus grandis]
Length=524

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 65/116 (56%), Positives = 75/116 (65%), Gaps = 18/116 (16%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHR---QGQGHTLLSSN--------GKD----sgggggggaas  250
            MGC +S+F KD    +KDHR   Q +G    S+N        G D     G G GG    
Sbjct  1    MGCCKSSFLKDAGSDDKDHRPHHQRRGGYPASANSLRQQPANGTDHSGGGGAGAGGAGGG  60

Query  251  eggasVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
             G A  F+EFSL++L+AATNNFSS+FIVSESGEKAPNVVYKGRLQ   NRRWIAVK
Sbjct  61   VGSAGFFSEFSLADLRAATNNFSSDFIVSESGEKAPNVVYKGRLQNQNNRRWIAVK  116



>gb|EYU38017.1| hypothetical protein MIMGU_mgv1a004862mg [Erythranthe guttata]
Length=507

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 55/100 (55%), Positives = 64/100 (64%), Gaps = 3/100 (3%)
 Frame = +2

Query  116  MGCWQSTF--SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLS  289
            MGC  S F  ++  P  EK    G G  LLS+       GG     +  G   F+EFS +
Sbjct  1    MGCCVSKFQPTETHPEKEKTKTHGPGQ-LLSTRPPPPAVGGAEPGLASSGVPSFSEFSFA  59

Query  290  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            +LK ATNNFS +FIVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  60   DLKTATNNFSPDFIVSESGEKAPNIVYKGRLQNRRWIAVK  99



>ref|XP_009341554.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Pyrus x bretschneideri]
Length=503

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 56/98 (57%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC  S  S+ +P  EK   Q   H   S N         G     GGA  F+EFS ++L
Sbjct  1    MGCCASKVSEKQP-PEKIQTQQLAHN--SRNPTHHPNPTSGSDPETGGAPPFSEFSFADL  57

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  58   KAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVK  95



>ref|XP_007199796.1| hypothetical protein PRUPE_ppa004587mg [Prunus persica]
 gb|EMJ00995.1| hypothetical protein PRUPE_ppa004587mg [Prunus persica]
Length=502

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 54/98 (55%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC +S  ++ +P    +  Q Q H   S           G     GGA  F+EFS S+L
Sbjct  1    MGCCESKVTEKQP----EKLQTQAHANNSRTPTHHPNPSPGSDPETGGAPPFSEFSFSDL  56

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  57   KAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVK  94



>ref|XP_007199795.1| hypothetical protein PRUPE_ppa004587mg [Prunus persica]
 gb|EMJ00994.1| hypothetical protein PRUPE_ppa004587mg [Prunus persica]
Length=447

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 54/98 (55%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC +S  ++ +P    +  Q Q H   S           G     GGA  F+EFS S+L
Sbjct  1    MGCCESKVTEKQP----EKLQTQAHANNSRTPTHHPNPSPGSDPETGGAPPFSEFSFSDL  56

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  57   KAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVK  94



>ref|XP_010266119.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nelumbo nucifera]
Length=503

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSLS+L+AATNNFSS+FIVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  51   FSEFSLSDLRAATNNFSSDFIVSESGEKAPNLVYKGRLQNRRWIAVK  97



>ref|XP_007017989.1| BR-signaling kinase 1 [Theobroma cacao]
 gb|EOY15214.1| BR-signaling kinase 1 [Theobroma cacao]
Length=517

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 64/115 (56%), Positives = 69/115 (60%), Gaps = 23/115 (20%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKD--------------HRQGQGHTLLSSNGKDsgggggggaase  253
            MGC +S+F K R    K               H Q        SNG DS GGG GG    
Sbjct  1    MGCCESSFLKGRGSRRKTNYNHHHNSSSNNNRHAQANNGPPQPSNGTDSVGGGAGGVPD-  59

Query  254  ggasVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
                 FAEFSL+ELKAATNNFSS+FIVSESGEKAPNVVYKGRLQ   NRRWIA+K
Sbjct  60   -----FAEFSLTELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDNNRRWIAIK  109



>ref|XP_007041655.1| BR-signaling kinase 1 isoform 1 [Theobroma cacao]
 gb|EOX97486.1| BR-signaling kinase 1 isoform 1 [Theobroma cacao]
Length=521

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 59/99 (60%), Positives = 69/99 (70%), Gaps = 6/99 (6%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC QS+F ++  P  EKD  Q Q       N   SG G G   A+  G   F+EFSL++
Sbjct  1    MGCCQSSFLTETHP--EKDQTQQQQE---PRNHNQSGSGAGLDPAAANGVPSFSEFSLAD  55

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNR+WIAVK
Sbjct  56   LKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRKWIAVK  94



>gb|KJB15932.1| hypothetical protein B456_002G205100 [Gossypium raimondii]
Length=503

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = +2

Query  116  MGCWQST-FSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC QS+  ++  P +++  +Q Q H     N   +  G G   A   G   F+EFSL++
Sbjct  1    MGCCQSSCLTETHPENDQSRQQQQEH----RNHSQAVSGAGPDPAVANGVPSFSEFSLAD  56

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNR+WIAVK
Sbjct  57   LKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRKWIAVK  95



>emb|CDX69121.1| BnaC01g03320D [Brassica napus]
Length=506

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 57/98 (58%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC QS  S +     KD  Q    T     G  +   GG G  + GG   F+EFS S+L
Sbjct  1    MGCCQSLCSDEHQPLGKDGAQPPQATQNHRGGATTADNGGAGGVAGGGIPSFSEFSFSDL  60

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  61   KAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  98



>ref|XP_011088682.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Sesamum indicum]
Length=505

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 53/98 (54%), Positives = 60/98 (61%), Gaps = 1/98 (1%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC  S F       EK+  Q  G   L S  +       G  A  G    FAEFSL++L
Sbjct  1    MGCCASKFPPTETHPEKEKSQNHGPASLLS-ARTPPPPPAGVPADPGVIPSFAEFSLADL  59

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            K ATN+F+ +FIVSESGEKAPNVVYKGRL NRRWIAVK
Sbjct  60   KTATNSFTPDFIVSESGEKAPNVVYKGRLHNRRWIAVK  97



>ref|XP_007041656.1| BR-signaling kinase 1 isoform 2 [Theobroma cacao]
 gb|EOX97487.1| BR-signaling kinase 1 isoform 2 [Theobroma cacao]
Length=452

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 69/99 (70%), Gaps = 6/99 (6%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC QS+F ++  P  EKD  Q Q       N   SG G G   A+  G   F+EFSL++
Sbjct  1    MGCCQSSFLTETHP--EKDQTQQQQE---PRNHNQSGSGAGLDPAAANGVPSFSEFSLAD  55

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNR+WIAVK
Sbjct  56   LKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRKWIAVK  94



>ref|XP_010094592.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB56346.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=501

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 58/105 (55%), Positives = 68/105 (65%), Gaps = 19/105 (18%)
 Frame = +2

Query  116  MGCWQSTF---SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSL  286
            MGC  S+    + D       H+Q Q +   SSNG D+ GG  G          F+EFSL
Sbjct  1    MGCCASSLRGPNADTRNHPHQHQQAQNNN--SSNGTDAAGGSPG----------FSEFSL  48

Query  287  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ----NRRWIAVK  409
            ++L+AATNNFSS+FIVSESGEKAPNVVYKGRLQ    NRRWIAVK
Sbjct  49   ADLRAATNNFSSDFIVSESGEKAPNVVYKGRLQNQNNNRRWIAVK  93



>ref|XP_009350608.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Pyrus x bretschneideri]
Length=420

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 53/98 (54%), Positives = 63/98 (64%), Gaps = 3/98 (3%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC +S  S+++   EK   Q   H   S           G     GG   F+EFS ++L
Sbjct  1    MGCCESKVSENQQ-PEKIQTQHLAHN--SQTPTHHTNPTSGSDPETGGTPPFSEFSFADL  57

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  58   KAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVK  95



>ref|XP_010646185.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Vitis vinifera]
 emb|CBI37790.3| unnamed protein product [Vitis vinifera]
Length=500

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 8/99 (8%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC +S+F ++  P  +  H     H   +             + ++GG   F+EFS S+
Sbjct  1    MGCCESSFLTETHPEKDDQHHHNNSHNTQNP-------PFSPPSPADGGVPSFSEFSFSD  53

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  54   LKAATNNFSSDSIVSESGEKAPNIVYKGRLQNRRWIAVK  92



>gb|EYU17508.1| hypothetical protein MIMGU_mgv11b014057mg [Erythranthe guttata]
Length=107

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 65/102 (64%), Gaps = 19/102 (19%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQG---QGHTLLSS-NGKDsgggggggaaseggasVFAEFS  283
            MGCW S   + R  SEKD  Q     GH   SS NG  SGG              FAEFS
Sbjct  1    MGCWVSKEHRRRS-SEKDQWQQQQQHGHRRSSSVNGASSGG--------------FAEFS  45

Query  284  LSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            L+EL+AATNNFSSE IVSESGEKAPNVVY+GRLQN R IAVK
Sbjct  46   LAELRAATNNFSSENIVSESGEKAPNVVYEGRLQNHRGIAVK  87



>ref|XP_008382473.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Malus domestica]
Length=503

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 54/98 (55%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC +S  S+++   EK   Q   H   S           G     GGA  F+EFS ++L
Sbjct  1    MGCCESKVSENQQ-PEKIQTQHLAHN--SRTPTHHTNPTSGSDPETGGAPPFSEFSFADL  57

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  58   KAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVK  95



>gb|KHG14731.1| hypothetical protein F383_06315 [Gossypium arboreum]
Length=493

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            F+EFSL+ELKAATNNFSS+FIVSESGEKAPNVVYKGRLQ   NRRWIA+K
Sbjct  58   FSEFSLAELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDTNRRWIAIK  107



>gb|KJB57984.1| hypothetical protein B456_009G188600 [Gossypium raimondii]
Length=517

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            F+EFSL+ELKAATNNFSS+FIVSESGEKAPNVVYKGRLQ   NRRWIA+K
Sbjct  60   FSEFSLAELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDTNRRWIAIK  109



>gb|KHG04837.1| hypothetical protein F383_29489 [Gossypium arboreum]
Length=503

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 13/103 (13%)
 Frame = +2

Query  116  MGCWQST-FSKDRPISEKDHRQGQ---GHT-LLSSNGKDsgggggggaaseggasVFAEF  280
            MGC QS+  ++  P  ++  +Q Q    H+  +S  G D     G  +        F+EF
Sbjct  1    MGCCQSSCLTETHPEKDQSRQQQQEPRNHSQAVSGAGPDPAVANGVPS--------FSEF  52

Query  281  SLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            SL++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNR+WIAVK
Sbjct  53   SLADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRKWIAVK  95



>ref|XP_009108623.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Brassica rapa]
Length=487

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  51   FSEFSLADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  97



>gb|KDO85050.1| hypothetical protein CISIN_1g009750mg [Citrus sinensis]
Length=365

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 4/51 (8%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ----NRRWIAVK  409
            FAEFSL++L+AATNNFSS+FIVSESGEKAPNVVYKGRLQ    NRRWIAVK
Sbjct  54   FAEFSLADLRAATNNFSSDFIVSESGEKAPNVVYKGRLQDGNDNRRWIAVK  104



>gb|KJB29674.1| hypothetical protein B456_005G113100 [Gossypium raimondii]
Length=404

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            F+EFSL+ELKAATNNFSS+FIVSE GEKAPNVVYKGRLQ   NRRWIA+K
Sbjct  62   FSEFSLAELKAATNNFSSDFIVSECGEKAPNVVYKGRLQNDNNRRWIAIK  111



>gb|KDP24732.1| hypothetical protein JCGZ_25333 [Jatropha curcas]
Length=500

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS S+LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  46   FSEFSFSDLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  92



>ref|XP_009108622.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Brassica rapa]
Length=505

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  51   FSEFSLADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  97



>emb|CDX75483.1| BnaA01g02190D [Brassica napus]
Length=510

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS S+LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  57   FSEFSFSDLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  103



>gb|KJB57985.1| hypothetical protein B456_009G188600 [Gossypium raimondii]
Length=407

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            F+EFSL+ELKAATNNFSS+FIVSESGEKAPNVVYKGRLQ   NRRWIA+K
Sbjct  60   FSEFSLAELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDTNRRWIAIK  109



>emb|CDX76321.1| BnaA08g10790D [Brassica napus]
Length=507

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  51   FSEFSLADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  97



>gb|KJB29673.1| hypothetical protein B456_005G113100 [Gossypium raimondii]
Length=380

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            F+EFSL+ELKAATNNFSS+FIVSE GEKAPNVVYKGRLQ   NRRWIA+K
Sbjct  62   FSEFSLAELKAATNNFSSDFIVSECGEKAPNVVYKGRLQNDNNRRWIAIK  111



>ref|XP_002306223.1| kinase family protein [Populus trichocarpa]
 gb|EEE86734.1| kinase family protein [Populus trichocarpa]
Length=499

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 53/99 (54%), Positives = 60/99 (61%), Gaps = 9/99 (9%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC  S+F S+  P  EKDH++                 G        G   F EFS S+
Sbjct  1    MGCCSSSFLSETHP--EKDHKKTH------QQQPPRNPSGSAVLDPATGVPSFCEFSFSD  52

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LK ATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  53   LKTATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  91



>ref|XP_004290043.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Fragaria vesca subsp. vesca]
Length=507

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS S+LK ATNNFSS++IVSESGEKAPNVVYKGRL NRRWIAVK
Sbjct  53   FSEFSFSDLKTATNNFSSDYIVSESGEKAPNVVYKGRLNNRRWIAVK  99



>ref|XP_009104299.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Brassica rapa]
Length=512

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS S+LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  59   FSEFSFSDLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  105



>ref|XP_011075006.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Sesamum indicum]
Length=478

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF LSELK+ATNNFSSE IVSESGEKAPNVVY+GRLQNRRWIAVK
Sbjct  24   FTEFLLSELKSATNNFSSENIVSESGEKAPNVVYEGRLQNRRWIAVK  70



>gb|KDO85049.1| hypothetical protein CISIN_1g009750mg [Citrus sinensis]
Length=527

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 4/51 (8%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ----NRRWIAVK  409
            FAEFSL++L+AATNNFSS+FIVSESGEKAPNVVYKGRLQ    NRRWIAVK
Sbjct  54   FAEFSLADLRAATNNFSSDFIVSESGEKAPNVVYKGRLQDGNDNRRWIAVK  104



>ref|XP_006435324.1| hypothetical protein CICLE_v10000906mg [Citrus clementina]
 ref|XP_006473759.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Citrus sinensis]
 gb|ESR48564.1| hypothetical protein CICLE_v10000906mg [Citrus clementina]
 gb|KDO85048.1| hypothetical protein CISIN_1g009750mg [Citrus sinensis]
Length=512

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 4/51 (8%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ----NRRWIAVK  409
            FAEFSL++L+AATNNFSS+FIVSESGEKAPNVVYKGRLQ    NRRWIAVK
Sbjct  54   FAEFSLADLRAATNNFSSDFIVSESGEKAPNVVYKGRLQDGNDNRRWIAVK  104



>gb|KJB29672.1| hypothetical protein B456_005G113100 [Gossypium raimondii]
Length=519

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            F+EFSL+ELKAATNNFSS+FIVSE GEKAPNVVYKGRLQ   NRRWIA+K
Sbjct  62   FSEFSLAELKAATNNFSSDFIVSECGEKAPNVVYKGRLQNDNNRRWIAIK  111



>ref|XP_008448319.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X4 [Cucumis melo]
Length=499

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC +STF ++  P   +  +    +  +          G          S F+EFS S+
Sbjct  1    MGCCESTFLTETHPEKLQSQQPAPPYVAVEPPPPLPPAVGPEPTQLGEMVSTFSEFSFSD  60

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LKAAT+NF+S FIVSESGEKAPN+VYKGRL NR+WIAVK
Sbjct  61   LKAATDNFNSNFIVSESGEKAPNIVYKGRLHNRKWIAVK  99



>gb|AFN88212.1| putative serine/threonine-protein kinase [Phaseolus vulgaris]
Length=376

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVK  409
            FAEFSL ELKAATNNFSSE+IVSESGEKAPN+VYKGRL N+ RWIAVK
Sbjct  64   FAEFSLPELKAATNNFSSEYIVSESGEKAPNLVYKGRLHNQSRWIAVK  111



>ref|XP_011101028.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Sesamum indicum]
Length=494

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            FAEFSL+ELK+ATNNFSS+ IVSESGEKAPNVVY+GRLQN+RWIAVK
Sbjct  41   FAEFSLAELKSATNNFSSDNIVSESGEKAPNVVYEGRLQNQRWIAVK  87



>ref|XP_008448317.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X3 [Cucumis melo]
Length=502

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC +STF ++  P   +  +    +  +          G          S F+EFS S+
Sbjct  1    MGCCESTFLTETHPEKLQSQQPAPPYVAVEPPPPLPPAVGPEPTQLGEMVSTFSEFSFSD  60

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LKAAT+NF+S FIVSESGEKAPN+VYKGRL NR+WIAVK
Sbjct  61   LKAATDNFNSNFIVSESGEKAPNIVYKGRLHNRKWIAVK  99



>ref|XP_010242854.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nelumbo nucifera]
Length=500

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 52/98 (53%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC +S+   +    +K+ +Q Q +     N        G   A+ GG   F+EFSLS+L
Sbjct  1    MGCCESSLLTEAD-PDKEKKQNQHNQNPPFNHPPPSADDGPAGAAAGGVPPFSEFSLSDL  59

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            +AATNNFSS+ IVSESGEKAPN+VYKGRLQNR+WIAVK
Sbjct  60   RAATNNFSSDNIVSESGEKAPNLVYKGRLQNRQWIAVK  97



>gb|KHG00998.1| hypothetical protein F383_22564 [Gossypium arboreum]
Length=521

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            F+EFSL+ELKAATNNFSS+FIVSE GEKAPNVVYKGRLQ   NRRWIA+K
Sbjct  64   FSEFSLAELKAATNNFSSDFIVSECGEKAPNVVYKGRLQNDNNRRWIAIK  113



>ref|XP_004291229.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Fragaria vesca subsp. vesca]
Length=529

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            F+EFSL+EL+AATNNFSS+FIVSESGEKAPNVVYKGRLQ   NRRWIAVK
Sbjct  74   FSEFSLAELRAATNNFSSDFIVSESGEKAPNVVYKGRLQNNNNRRWIAVK  123



>ref|XP_008448316.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Cucumis melo]
Length=517

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC +STF ++  P   +  +    +  +          G          S F+EFS S+
Sbjct  1    MGCCESTFLTETHPEKLQSQQPAPPYVAVEPPPPLPPAVGPEPTQLGEMVSTFSEFSFSD  60

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LKAAT+NF+S FIVSESGEKAPN+VYKGRL NR+WIAVK
Sbjct  61   LKAATDNFNSNFIVSESGEKAPNIVYKGRLHNRKWIAVK  99



>ref|XP_008448315.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Cucumis melo]
Length=520

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC +STF ++  P   +  +    +  +          G          S F+EFS S+
Sbjct  1    MGCCESTFLTETHPEKLQSQQPAPPYVAVEPPPPLPPAVGPEPTQLGEMVSTFSEFSFSD  60

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LKAAT+NF+S FIVSESGEKAPN+VYKGRL NR+WIAVK
Sbjct  61   LKAATDNFNSNFIVSESGEKAPNIVYKGRLHNRKWIAVK  99



>ref|XP_009401888.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=448

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            FAEFSL+ELKAATN FS+E IVSESG+KAPN+VYKGRLQNRRWIAVK
Sbjct  57   FAEFSLAELKAATNGFSAENIVSESGDKAPNLVYKGRLQNRRWIAVK  103



>gb|EYU17513.1| hypothetical protein MIMGU_mgv1a005152mg [Erythranthe guttata]
Length=495

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 61/102 (60%), Positives = 65/102 (64%), Gaps = 19/102 (19%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQG---QGHTLLSS-NGKDsgggggggaaseggasVFAEFS  283
            MGCW S   + R  SEKD  Q     GH   SS NG  SGG              FAEFS
Sbjct  1    MGCWVSKEHRRRS-SEKDQWQQQQQHGHRRSSSVNGASSGG--------------FAEFS  45

Query  284  LSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            L+EL+AATNNFSSE IVSESGEKAPNVVY+GRLQN R IAVK
Sbjct  46   LAELRAATNNFSSENIVSESGEKAPNVVYEGRLQNHRGIAVK  87



>ref|XP_002525749.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF36648.1| receptor protein kinase, putative [Ricinus communis]
Length=500

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 7/99 (7%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC +S+  ++  P  EKD  + Q       N  ++            G   F+EFS S+
Sbjct  1    MGCCESSLVTETHP--EKDQTKKQTQI----NNHNNPSPSSVLLDPSTGIPSFSEFSFSD  54

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LKAAT+NFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  55   LKAATDNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  93



>ref|XP_003519690.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoformX1 [Glycine max]
 gb|KHN29875.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=509

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVK  409
            F+EFSL+ELKAATNNFSSE+IVSESGEKAPN+VYKGRLQN+ RWIAVK
Sbjct  56   FSEFSLAELKAATNNFSSEYIVSESGEKAPNLVYKGRLQNQSRWIAVK  103



>ref|XP_006575761.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X2 [Glycine max]
Length=503

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVK  409
            F+EFSL+ELKAATNNFSSE+IVSESGEKAPN+VYKGRLQN+ RWIAVK
Sbjct  56   FSEFSLAELKAATNNFSSEYIVSESGEKAPNLVYKGRLQNQSRWIAVK  103



>gb|KFK30163.1| hypothetical protein AALP_AA7G225300 [Arabis alpina]
Length=511

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 60/104 (58%), Positives = 68/104 (65%), Gaps = 7/104 (7%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasV------FAE  277
            MGC QS  S   P+  KD  Q Q  T   S   D+GG GGG AA             F+E
Sbjct  1    MGCCQSLCSGKNPLV-KDPTQPQQLTHGGSTAVDNGGIGGGVAAGGVVVGTGGGIPSFSE  59

Query  278  FSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            FSL++LK+AT NFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  60   FSLADLKSATTNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  103



>ref|XP_006412130.1| hypothetical protein EUTSA_v10024929mg [Eutrema salsugineum]
 gb|ESQ53583.1| hypothetical protein EUTSA_v10024929mg [Eutrema salsugineum]
Length=519

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  65   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  111



>ref|XP_010446962.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Camelina sativa]
Length=518

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  63   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  109



>ref|XP_002867085.1| hypothetical protein ARALYDRAFT_328224 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43344.1| hypothetical protein ARALYDRAFT_328224 [Arabidopsis lyrata subsp. 
lyrata]
Length=524

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  60   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  106



>ref|XP_006284955.1| hypothetical protein CARUB_v10006257mg [Capsella rubella]
 gb|EOA17853.1| hypothetical protein CARUB_v10006257mg [Capsella rubella]
Length=518

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  64   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  110



>ref|XP_009401887.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=511

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            FAEFSL+ELKAATN FS+E IVSESG+KAPN+VYKGRLQNRRWIAVK
Sbjct  57   FAEFSLAELKAATNGFSAENIVSESGDKAPNLVYKGRLQNRRWIAVK  103



>ref|XP_011046295.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Populus euphratica]
Length=499

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 52/99 (53%), Positives = 60/99 (61%), Gaps = 9/99 (9%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC  S+F S+  P  EKDH++                 G        G   F EFS S+
Sbjct  1    MGCCSSSFLSETHP--EKDHKKTH------QQQPPRNPSGSAVLDPATGVPSFCEFSFSD  52

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            L+ ATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  53   LRTATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  91



>emb|CDY17529.1| BnaC03g65340D [Brassica napus]
Length=507

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  51   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  97



>ref|XP_008377092.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Malus domestica]
Length=510

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            F+EFSL++LK+ATNNFSS+FIVSESGEKAPNVVYKGRLQ   NRRWIAVK
Sbjct  55   FSEFSLADLKSATNNFSSDFIVSESGEKAPNVVYKGRLQNQNNRRWIAVK  104



>ref|XP_011046296.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Populus euphratica]
Length=433

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 52/99 (53%), Positives = 60/99 (61%), Gaps = 9/99 (9%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC  S+F S+  P  EKDH++                 G        G   F EFS S+
Sbjct  1    MGCCSSSFLSETHP--EKDHKKTH------QQQPPRNPSGSAVLDPATGVPSFCEFSFSD  52

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            L+ ATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  53   LRTATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  91



>emb|CDP14516.1| unnamed protein product [Coffea canephora]
Length=520

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL++LKAATNNFS +FIVSESGEKA N+VYKGRLQNRRWIAVK
Sbjct  64   FSEFSLADLKAATNNFSPDFIVSESGEKAHNLVYKGRLQNRRWIAVK  110



>ref|XP_010437502.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Camelina sativa]
Length=516

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  62   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  108



>ref|XP_010432311.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Camelina sativa]
 ref|XP_010432312.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Camelina sativa]
Length=514

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  60   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  106



>ref|XP_010530944.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At4g35230 [Tarenaya hassleriana]
Length=503

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS ++LKAATNNFSS+ IVSESGE+APN+VYKGRLQNRRWIAVK
Sbjct  49   FSEFSFADLKAATNNFSSDNIVSESGERAPNLVYKGRLQNRRWIAVK  95



>ref|XP_010918220.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Elaeis guineensis]
Length=513

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL+ELKAATN F SE IVSESGEKAPN+VYKGRLQ+RRWIAVK
Sbjct  64   FSEFSLAELKAATNGFGSENIVSESGEKAPNLVYKGRLQDRRWIAVK  110



>ref|XP_003618098.1| Receptor like protein kinase [Medicago truncatula]
Length=586

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN-RRWIAVK  409
            F+EFSLS+LKAATNNFSSE+IVSESGEKAPN+VYKGRLQN +RWIAVK
Sbjct  69   FSEFSLSDLKAATNNFSSEYIVSESGEKAPNLVYKGRLQNQKRWIAVK  116



>gb|AET01057.2| LRR receptor-like kinase [Medicago truncatula]
Length=524

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN-RRWIAVK  409
            F+EFSLS+LKAATNNFSSE+IVSESGEKAPN+VYKGRLQN +RWIAVK
Sbjct  69   FSEFSLSDLKAATNNFSSEYIVSESGEKAPNLVYKGRLQNQKRWIAVK  116



>gb|KDP36831.1| hypothetical protein JCGZ_08122 [Jatropha curcas]
Length=509

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 56/101 (55%), Positives = 63/101 (62%), Gaps = 3/101 (3%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC QS+F + R   EK       H   + +      G     A+ GG   F EFSL++L
Sbjct  1    MGCCQSSFFEVRVPEEKASNNHNNHHHQNHHPCHPSNGTEPSTAASGGIPSFIEFSLADL  60

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            KAATNNFS EFIVSESGEKAPNVVYKGRLQ   NR WIAVK
Sbjct  61   KAATNNFSPEFIVSESGEKAPNVVYKGRLQNQDNRTWIAVK  101



>ref|XP_008464872.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Cucumis melo]
Length=509

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            F+EFS ++LKAATNNFSS++IVSESGEKAPNVVYKGRLQ   NRRWIAVK
Sbjct  52   FSEFSFADLKAATNNFSSDYIVSESGEKAPNVVYKGRLQNQNNRRWIAVK  101



>ref|XP_010526870.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Tarenaya hassleriana]
Length=500

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS ++LK ATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  50   FSEFSFADLKVATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  96



>gb|KHG04795.1| putative inactive receptor-like kinase SSP [Gossypium arboreum]
Length=502

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL++LKAATNNFSS+ IVSESGEKAPN+VYKGRL+NR+WIAVK
Sbjct  48   FSEFSLADLKAATNNFSSDNIVSESGEKAPNLVYKGRLKNRKWIAVK  94



>ref|XP_010690264.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Beta vulgaris subsp. vulgaris]
Length=504

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            FAEFS ++LK+ATNNF+SEFIVSESGEKAPN+VYKGRL+N++WIAVK
Sbjct  51   FAEFSFADLKSATNNFNSEFIVSESGEKAPNLVYKGRLKNQQWIAVK  97



>ref|XP_003544865.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform 2 [Glycine max]
Length=479

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVK  409
            F+EFSL+ELKAATNNFSS++IVSESGEKAPN+VYKGRLQN  RWIAVK
Sbjct  42   FSEFSLAELKAATNNFSSDYIVSESGEKAPNLVYKGRLQNHSRWIAVK  89



>ref|XP_010103334.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB95401.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=514

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL++LKAATNNFS++FIVSESG KAPNVVYKGRL NR WIAVK
Sbjct  61   FCEFSLADLKAATNNFSADFIVSESGAKAPNVVYKGRLHNRSWIAVK  107



>ref|XP_009413047.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Musa acuminata subsp. malaccensis]
Length=513

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            FAEFSL ELKAATN F++E IVSESG+KAPN+VYKGRLQ+RRWIAVK
Sbjct  59   FAEFSLEELKAATNGFAAESIVSESGDKAPNLVYKGRLQHRRWIAVK  105



>gb|KDO68274.1| hypothetical protein CISIN_1g0105291mg, partial [Citrus sinensis]
Length=239

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 20/109 (18%)
 Frame = +2

Query  116  MGCWQSTFSKD-----------RPISEKDHRQGQGHTLLSSNGKDsgggggggaasegga  262
            MGC +S+F K+           RP++++           +S   D+         +   A
Sbjct  1    MGCCESSFLKETQRERDEVMNERPLTQRKE---------ASTESDTATPTATVQPTNEEA  51

Query  263  sVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
             +F+EFS  +L+AATNNFSS+ IVSESGEKA NVVYKGRL+NR+WIAVK
Sbjct  52   PLFSEFSFLDLRAATNNFSSDNIVSESGEKAANVVYKGRLENRQWIAVK  100



>ref|XP_010692837.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Beta vulgaris subsp. vulgaris]
Length=489

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 49/98 (50%), Positives = 60/98 (61%), Gaps = 17/98 (17%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC+QST     P    +H  G G +    +G                +++F EFSL EL
Sbjct  1    MGCFQSTLVP--PKQPLNHANGAGDSSDIGDG---------------TSALFLEFSLQEL  43

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            KAAT+NFSS+ IVSE GEKAPNVVY+GRLQNRR I+VK
Sbjct  44   KAATDNFSSKSIVSEGGEKAPNVVYRGRLQNRRLISVK  81



>ref|XP_003544864.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform 1 [Glycine max]
 gb|KHN46875.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=497

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVK  409
            F+EFSL+ELKAATNNFSS++IVSESGEKAPN+VYKGRLQN  RWIAVK
Sbjct  42   FSEFSLAELKAATNNFSSDYIVSESGEKAPNLVYKGRLQNHSRWIAVK  89



>gb|KJB47750.1| hypothetical protein B456_008G040100 [Gossypium raimondii]
Length=412

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL+ LKAATNNFSS+ IVSESGEKAPN+VYKGRL+NR+WIAVK
Sbjct  48   FSEFSLAGLKAATNNFSSDNIVSESGEKAPNLVYKGRLKNRKWIAVK  94



>ref|XP_009123286.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Brassica rapa]
Length=162

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+ FS S+LKAATNNFSS+ IVSESGEK+PN+VYKG+LQNRRWIAVK
Sbjct  58   FSAFSFSDLKAATNNFSSDNIVSESGEKSPNLVYKGQLQNRRWIAVK  104



>ref|XP_009334288.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Pyrus x bretschneideri]
Length=505

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 53/101 (52%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC +S+F   R    + H         ++N       G   AA  G    F+EFSL++L
Sbjct  1    MGCCESSFIHAR--QHQHHPLDTFSAFAAANRTPQPSNGRADAAGAGAVPGFSEFSLADL  58

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            K ATNNFSS FIVS+SGEKAPNVVYKGRLQ   NRRWIAVK
Sbjct  59   KGATNNFSSNFIVSKSGEKAPNVVYKGRLQNQDNRRWIAVK  99



>ref|XP_008375097.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Malus domestica]
Length=146

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS ++LKAATNNFSS++IVSESGEKAPN+VYKG L NR WIAVK
Sbjct  49   FXEFSFADLKAATNNFSSDYIVSESGEKAPNLVYKGWLXNRCWIAVK  95



>ref|XP_004158304.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Cucumis sativus]
Length=235

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 46/51 (90%), Gaps = 3/51 (6%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
             F+EFS ++LKAATNNFSS++IVSESG+KAPNVV+KGRLQ   NRRWIAVK
Sbjct  44   AFSEFSFADLKAATNNFSSDYIVSESGDKAPNVVFKGRLQNQNNRRWIAVK  94



>ref|XP_008791986.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Phoenix dactylifera]
Length=511

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL ELKAATN F S  IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  62   FSEFSLVELKAATNGFGSGNIVSESGEKAPNLVYKGRLQNRRWIAVK  108



>ref|XP_010548144.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Tarenaya hassleriana]
Length=492

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS ++LK AT+NFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  38   FSEFSFADLKTATSNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVK  84



>gb|AFK46540.1| unknown [Medicago truncatula]
Length=524

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN-RRWIAVK  409
            F+EFS S+LKAATNNFSSE+IVSESGEKAPN+VYKGRLQN +RWIAVK
Sbjct  69   FSEFSPSDLKAATNNFSSEYIVSESGEKAPNLVYKGRLQNQKRWIAVK  116



>ref|XP_011034902.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Populus euphratica]
Length=523

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 42/53 (79%), Positives = 44/53 (83%), Gaps = 6/53 (11%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ------NRRWIAVK  409
            F EFSL++LKAATNNFS EFIVSESGEKAPNVVYKGRLQ      NR WIAVK
Sbjct  61   FTEFSLADLKAATNNFSPEFIVSESGEKAPNVVYKGRLQNHDNNNNRSWIAVK  113



>ref|XP_002300657.1| hypothetical protein POPTR_0002s01310g [Populus trichocarpa]
 gb|EEE79930.1| hypothetical protein POPTR_0002s01310g [Populus trichocarpa]
Length=520

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/53 (79%), Positives = 44/53 (83%), Gaps = 6/53 (11%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ------NRRWIAVK  409
            F EFSL++LKAATNNFS EFIVSESGEKAPNVVYKGRLQ      NR WIAVK
Sbjct  61   FTEFSLADLKAATNNFSPEFIVSESGEKAPNVVYKGRLQNHDNNNNRSWIAVK  113



>gb|KJB47748.1| hypothetical protein B456_008G040100 [Gossypium raimondii]
 gb|KJB47749.1| hypothetical protein B456_008G040100 [Gossypium raimondii]
Length=502

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL+ LKAATNNFSS+ IVSESGEKAPN+VYKGRL+NR+WIAVK
Sbjct  48   FSEFSLAGLKAATNNFSSDNIVSESGEKAPNLVYKGRLKNRKWIAVK  94



>ref|XP_007142560.1| hypothetical protein PHAVU_008G291100g [Phaseolus vulgaris]
 gb|ESW14554.1| hypothetical protein PHAVU_008G291100g [Phaseolus vulgaris]
Length=538

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVK  409
            FAEFSL ELKAATNNFSSE+IVS SGEKAPN+VYKGRL N+ RWIAVK
Sbjct  66   FAEFSLPELKAATNNFSSEYIVSGSGEKAPNLVYKGRLHNQSRWIAVK  113



>ref|XP_006855115.1| hypothetical protein AMTR_s00031p00205960 [Amborella trichopoda]
 gb|ERN16582.1| hypothetical protein AMTR_s00031p00205960 [Amborella trichopoda]
Length=260

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
             FAEFSLS+L+AA +NFS EFIVSE GEKAPN+VYKGRL ++RWIA+K
Sbjct  49   AFAEFSLSDLRAAASNFSPEFIVSEGGEKAPNLVYKGRLPDKRWIAIK  96



>ref|XP_006486634.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X3 [Citrus sinensis]
Length=506

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 20/109 (18%)
 Frame = +2

Query  116  MGCWQSTFSKD-----------RPISEKDHRQGQGHTLLSSNGKDsgggggggaasegga  262
            MGC +S+F K+           RP++++           +S   D+         +   A
Sbjct  1    MGCCESSFLKETQRERDEVMNERPLTQRKE---------ASTESDTATPTATVQPTNEEA  51

Query  263  sVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
             +F+EFS  +L+AATNNFSS+ IVSESGEKA NVVYKGRL+NR+WIAVK
Sbjct  52   PLFSEFSFLDLRAATNNFSSDNIVSESGEKAANVVYKGRLENRQWIAVK  100



>ref|XP_004144226.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Cucumis sativus]
 gb|KGN47553.1| hypothetical protein Csa_6G358660 [Cucumis sativus]
Length=509

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVK  409
            F+EFS ++LKAATNNFSS++IVSESG+KAPNVV+KGRLQ   NRRWIAVK
Sbjct  52   FSEFSFADLKAATNNFSSDYIVSESGDKAPNVVFKGRLQNQNNRRWIAVK  101



>ref|XP_004491634.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X1 [Cicer arietinum]
Length=562

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVK  409
            F+EFSL++LK+ATNNFSSE+IVSESGEKAPN+VYKG+LQN   +RWIAVK
Sbjct  78   FSEFSLTDLKSATNNFSSEYIVSESGEKAPNLVYKGKLQNQNQKRWIAVK  127



>ref|XP_006422467.1| hypothetical protein CICLE_v10028235mg [Citrus clementina]
 ref|XP_006486633.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X2 [Citrus sinensis]
 gb|ESR35707.1| hypothetical protein CICLE_v10028235mg [Citrus clementina]
Length=508

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 20/109 (18%)
 Frame = +2

Query  116  MGCWQSTFSKD-----------RPISEKDHRQGQGHTLLSSNGKDsgggggggaasegga  262
            MGC +S+F K+           RP++++           +S   D+         +   A
Sbjct  1    MGCCESSFLKETQRERDEVMNERPLTQRKE---------ASTESDTATPTATVQPTNEEA  51

Query  263  sVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
             +F+EFS  +L+AATNNFSS+ IVSESGEKA NVVYKGRL+NR+WIAVK
Sbjct  52   PLFSEFSFLDLRAATNNFSSDNIVSESGEKAANVVYKGRLENRQWIAVK  100



>ref|XP_002510650.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF52837.1| receptor protein kinase, putative [Ricinus communis]
Length=513

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 55/111 (50%), Positives = 62/111 (56%), Gaps = 19/111 (17%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDH-------RQGQGHTLLSSNGKDsgggggggaaseggasVFA  274
            MGC  S+  +   ISEK          Q Q       NGK +     G ++       F 
Sbjct  1    MGCCHSSLFQVPFISEKKEPNHNYSKNQNQDQNHQPPNGKGAACPPAGTSSG------FT  54

Query  275  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ------NRRWIAVK  409
             FS ++LKAATNNFSSEFIVSESGEKAPNVVYKGRLQ      NR WIAVK
Sbjct  55   IFSFADLKAATNNFSSEFIVSESGEKAPNVVYKGRLQKQDNNNNRTWIAVK  105



>ref|XP_006486632.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X1 [Citrus sinensis]
Length=515

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 20/109 (18%)
 Frame = +2

Query  116  MGCWQSTFSKD-----------RPISEKDHRQGQGHTLLSSNGKDsgggggggaasegga  262
            MGC +S+F K+           RP++++           +S   D+         +   A
Sbjct  1    MGCCESSFLKETQRERDEVMNERPLTQRKE---------ASTESDTATPTATVQPTNEEA  51

Query  263  sVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
             +F+EFS  +L+AATNNFSS+ IVSESGEKA NVVYKGRL+NR+WIAVK
Sbjct  52   PLFSEFSFLDLRAATNNFSSDNIVSESGEKAANVVYKGRLENRQWIAVK  100



>ref|XP_006828955.1| hypothetical protein AMTR_s00001p00232510 [Amborella trichopoda]
 gb|ERM96371.1| hypothetical protein AMTR_s00001p00232510 [Amborella trichopoda]
Length=492

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 46/98 (47%), Positives = 60/98 (61%), Gaps = 14/98 (14%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC +ST  +  P       Q Q   L +++ K++   G            F+E SL +L
Sbjct  1    MGCCESTLKETHP------DQDQHQELATASDKEALEVGNVP--------AFSELSLEDL  46

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            +AAT NF+SE IVSESG+KAPNVVYKGRL N++WIAVK
Sbjct  47   RAATQNFNSELIVSESGDKAPNVVYKGRLHNKQWIAVK  84



>ref|XP_009400327.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Musa acuminata subsp. malaccensis]
Length=502

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC  S+   ++ P+ ++ H+     +L     + S         S      FA+FSL+E
Sbjct  1    MGCCNSSLLPENHPVEKRSHQ-----SLQQQQRRPSLSLQAAVEGSGREVPAFAQFSLAE  55

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            LKAATN F+ +  VSESG+KAPNVVYKGRLQ+RRWIAVK
Sbjct  56   LKAATNGFNPQNAVSESGDKAPNVVYKGRLQSRRWIAVK  94



>ref|XP_009384615.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Musa acuminata subsp. malaccensis]
Length=516

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            FAEFSL+ELKAATN F +  IVSESG+KAPN+VYKGRL+NRRWIAVK
Sbjct  62   FAEFSLAELKAATNGFDAGNIVSESGDKAPNLVYKGRLKNRRWIAVK  108



>gb|EPS73400.1| hypothetical protein M569_01345 [Genlisea aurea]
Length=484

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 55/100 (55%), Positives = 61/100 (61%), Gaps = 24/100 (24%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLL--SSNGKDsgggggggaaseggasVFAEFSLS  289
            MGC  ST     P SEK  RQ     LL  S NG  + G              FAEFSL+
Sbjct  1    MGCCIST---KHPSSEKGQRQ-----LLQPSVNGGSAMG--------------FAEFSLA  38

Query  290  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            +LK+ATNNFSSE IVS SGEKAPN+VY+GRL N RWIAVK
Sbjct  39   DLKSATNNFSSENIVSGSGEKAPNLVYQGRLHNNRWIAVK  78



>ref|XP_004491635.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X2 [Cicer arietinum]
Length=535

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 3/50 (6%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVK  409
            F+EFSL++LK+ATNNFSSE+IVSESGEKAPN+VYKG+LQN   +RWIAVK
Sbjct  78   FSEFSLTDLKSATNNFSSEYIVSESGEKAPNLVYKGKLQNQNQKRWIAVK  127



>ref|XP_011045216.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Populus euphratica]
Length=478

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 51/101 (50%), Positives = 59/101 (58%), Gaps = 13/101 (13%)
 Frame = +2

Query  116  MGCWQST-FSKDRPISEKDHRQG--QGHTLLSSNGKDsgggggggaaseggasVFAEFSL  286
            MGC  S+  ++  P  EKDH++   Q H L  S                 G   F EFS 
Sbjct  1    MGCCSSSILAETHP--EKDHKKTHQQQHPLNPSG--------SIVLDPATGIPSFCEFSF  50

Query  287  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
             +L+ ATNNFS   IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  51   PDLRTATNNFSPGNIVSESGEKAPNLVYKGRLQNRRWIAVK  91



>ref|XP_008221154.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Prunus mume]
Length=502

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 13/103 (13%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasV--FAEFSLS  289
            MGC +S+F + R   +  HR+       ++   D+         +E   +V  F+EFSL+
Sbjct  1    MGCCESSFIRGRQ-HQYLHRR-------NTTATDNNQAPQASNGTESAGAVLGFSEFSLA  52

Query  290  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRR---WIAVK  409
            +LK ATNNFSS+FIVSESG+KAPNVVYKGRLQN+    WIA+K
Sbjct  53   DLKNATNNFSSDFIVSESGDKAPNVVYKGRLQNQNSPSWIAIK  95



>ref|XP_009594040.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
Length=508

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL++LK ATNNFSSE IVSESGEKAPNVVYKGRLQN   IAVK
Sbjct  54   FSEFSLTDLKTATNNFSSELIVSESGEKAPNVVYKGRLQNCHCIAVK  100



>ref|XP_009781086.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X3 [Nicotiana sylvestris]
Length=495

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 61/99 (62%), Gaps = 10/99 (10%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC QS F + +    +K+  Q    T L++NG             +     F EFSL+E
Sbjct  1    MGCLQSKFKTANVQSPDKEPSQPDSKTDLAANGD---------QVDQDQVPAFKEFSLAE  51

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            L+AATN FSSE IVSESGEKAPNVVY+G+L++ R +A+K
Sbjct  52   LRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRIVAIK  90



>ref|XP_007222343.1| hypothetical protein PRUPE_ppa004797mg [Prunus persica]
 gb|EMJ23542.1| hypothetical protein PRUPE_ppa004797mg [Prunus persica]
Length=491

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 48/103 (47%), Positives = 63/103 (61%), Gaps = 13/103 (13%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasV--FAEFSLS  289
            MGC +S+F + R      HR        ++   D+         +E   +V  F+EFSL+
Sbjct  1    MGCCESSFIRGRQQQYLHHR--------NTTATDNNQAPQASNGTESAGAVLGFSEFSLA  52

Query  290  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRR---WIAVK  409
            +LK ATNNFS +FIVSESG+KAPNVVYKGRLQN+    WIA+K
Sbjct  53   DLKNATNNFSYDFIVSESGDKAPNVVYKGRLQNQNSPSWIAIK  95



>ref|XP_011045207.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Populus euphratica]
Length=500

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 51/101 (50%), Positives = 59/101 (58%), Gaps = 13/101 (13%)
 Frame = +2

Query  116  MGCWQST-FSKDRPISEKDHRQG--QGHTLLSSNGKDsgggggggaaseggasVFAEFSL  286
            MGC  S+  ++  P  EKDH++   Q H L  S                 G   F EFS 
Sbjct  1    MGCCSSSILAETHP--EKDHKKTHQQQHPLNPSG--------SIVLDPATGIPSFCEFSF  50

Query  287  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
             +L+ ATNNFS   IVSESGEKAPN+VYKGRLQNRRWIAVK
Sbjct  51   PDLRTATNNFSPGNIVSESGEKAPNLVYKGRLQNRRWIAVK  91



>ref|XP_004139949.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Cucumis sativus]
 gb|KGN46722.1| hypothetical protein Csa_6G127340 [Cucumis sativus]
Length=514

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS S+LKAAT+NF+S FIVSES EKA N+VYKGRL NR+WIAVK
Sbjct  53   FSEFSFSDLKAATDNFNSNFIVSESSEKALNIVYKGRLHNRKWIAVK  99



>ref|XP_004154543.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Cucumis sativus]
Length=514

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS S+LKAAT+NF+S FIVSES EKA N+VYKGRL NR+WIAVK
Sbjct  53   FSEFSFSDLKAATDNFNSNFIVSESSEKAFNIVYKGRLHNRKWIAVK  99



>ref|XP_002312914.1| kinase family protein [Populus trichocarpa]
 gb|EEE86869.1| kinase family protein [Populus trichocarpa]
Length=498

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 56/96 (58%), Gaps = 9/96 (9%)
 Frame = +2

Query  122  CWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSELKA  301
            C  S  ++  P  EKDH++      L+ +G               G   F EFS  +LK 
Sbjct  4    CCSSILAETHP--EKDHKKTHQQHPLNPSG-------SIVLDPATGIPSFCEFSFPDLKT  54

Query  302  ATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            ATNNFS + IVSESGEKAPN+VYKGRLQNRR IAVK
Sbjct  55   ATNNFSPDNIVSESGEKAPNLVYKGRLQNRRSIAVK  90



>ref|XP_006363095.1| PREDICTED: probable serine/threonine-protein kinase At5g41260-like 
[Solanum tuberosum]
Length=491

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EFSL ELK ATN FSSE IVSE GEKAPNVVYKG L+N RW+AVK
Sbjct  40   VFTEFSLDELKMATNGFSSENIVSEHGEKAPNVVYKGLLENGRWVAVK  87



>ref|XP_009781084.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Nicotiana sylvestris]
Length=500

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 59/104 (57%), Gaps = 15/104 (14%)
 Frame = +2

Query  116  MGCWQSTF------SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAE  277
            MGC QS F      S D+  S+ D +         +NG             +     F E
Sbjct  1    MGCLQSKFKTANVQSPDKEPSQPDSKTDLAGKPGQANGD---------QVDQDQVPAFKE  51

Query  278  FSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            FSL+EL+AATN FSSE IVSESGEKAPNVVY+G+L++ R +A+K
Sbjct  52   FSLAELRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRIVAIK  95



>ref|XP_004246370.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Solanum lycopersicum]
Length=491

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EFSL ELK ATN FSSE IVSE GEKAPNVVYKG L+N RW+AVK
Sbjct  40   VFTEFSLDELKMATNGFSSENIVSEHGEKAPNVVYKGLLENGRWVAVK  87



>ref|XP_009781085.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Nicotiana sylvestris]
Length=499

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 60/104 (58%), Gaps = 16/104 (15%)
 Frame = +2

Query  116  MGCWQSTF------SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAE  277
            MGC QS F      S D+  S+ D +   G     +NG             +     F E
Sbjct  1    MGCLQSKFKTANVQSPDKEPSQPDSKTDLGKPG-QANGD---------QVDQDQVPAFKE  50

Query  278  FSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            FSL+EL+AATN FSSE IVSESGEKAPNVVY+G+L++ R +A+K
Sbjct  51   FSLAELRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRIVAIK  94



>emb|CDP09344.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF L+EL+AATN FSSE IVSESGEKAPNVVY+G+L+N R +A+K
Sbjct  40   VFKEFGLAELRAATNGFSSELIVSESGEKAPNVVYRGKLRNNRLVAIK  87



>ref|XP_009337367.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X2 [Pyrus x bretschneideri]
Length=490

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK
Sbjct  40   VFSEFSLEQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVK  87



>ref|XP_009337366.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X1 [Pyrus x bretschneideri]
Length=491

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK
Sbjct  40   VFSEFSLEQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVK  87



>gb|ADE76295.1| unknown [Picea sitchensis]
Length=487

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F E++L++LKAAT  FSSE+IVSE GEKAPNVV+KG+L+N RWIAVK
Sbjct  40   FKEYALADLKAATRGFSSEYIVSEGGEKAPNVVFKGKLENNRWIAVK  86



>ref|XP_010101852.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB89989.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=492

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL  LKAATN FSSE IVSE GEKAPNVVYKG+L+  RWIAVK
Sbjct  41   FSEFSLENLKAATNGFSSENIVSEHGEKAPNVVYKGKLEGSRWIAVK  87



>ref|XP_008375673.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Malus domestica]
Length=237

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF L+EL+ ATN F+SE IVSESGEKAPNVVY+G+L+N R++A+K
Sbjct  37   VFKEFGLAELRTATNGFNSELIVSESGEKAPNVVYRGKLRNNRFVAIK  84



>ref|XP_008384888.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Malus domestica]
Length=491

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK
Sbjct  41   VFSEFSLDQLKAATSAFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVK  88



>ref|XP_009781087.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X4 [Nicotiana sylvestris]
Length=494

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 60/99 (61%), Gaps = 11/99 (11%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC QS F + +    +K+  Q    T L++  +            +     F EFSL+E
Sbjct  1    MGCLQSKFKTANVQSPDKEPSQPDSKTDLANGDQ----------VDQDQVPAFKEFSLAE  50

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            L+AATN FSSE IVSESGEKAPNVVY+G+L++ R +A+K
Sbjct  51   LRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRIVAIK  89



>ref|XP_009629803.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
Length=494

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 60/99 (61%), Gaps = 11/99 (11%)
 Frame = +2

Query  116  MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  292
            MGC QS F + +    +K+  Q    T L++  +            +     F EFSL+E
Sbjct  1    MGCLQSKFKTANVQSPDKEPSQPDSKTDLANGDQ----------VDQDQVPAFKEFSLAE  50

Query  293  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            L+AATN FSSE IVSESGEKAPNVVY+G+L++ R +A+K
Sbjct  51   LRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRIVAIK  89



>ref|XP_010097731.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB70686.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=507

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF L+EL+AATN FSSE IVSESGEKAPNVVY+G+L+N R +A+K
Sbjct  42   VFKEFGLAELRAATNGFSSELIVSESGEKAPNVVYRGKLRNNRLVAIK  89



>ref|XP_002526522.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF35913.1| receptor protein kinase, putative [Ricinus communis]
Length=511

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL+EL+AATN F++ FIVSESGEKAPNVVYKG+L N R +A+K
Sbjct  60   FREFSLAELRAATNGFATHFIVSESGEKAPNVVYKGKLNNNRLVAIK  106



>ref|XP_004300263.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Fragaria vesca subsp. vesca]
Length=496

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F E+SL EL+ ATN FSS+FIVSESGEKAPNVVYKG+L+N R +AVK
Sbjct  43   FKEYSLHELRKATNGFSSDFIVSESGEKAPNVVYKGKLENNRLVAVK  89



>ref|XP_007219059.1| hypothetical protein PRUPE_ppa004847mg [Prunus persica]
 gb|EMJ20258.1| hypothetical protein PRUPE_ppa004847mg [Prunus persica]
Length=489

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL+EL+AATN F+SE IVSESGEKAPNVVY+G+L+N R +A+K
Sbjct  38   FKEFSLAELRAATNGFNSELIVSESGEKAPNVVYRGKLRNNRLVAIK  84



>ref|XP_008232240.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Prunus mume]
Length=489

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL+EL+AATN F+SE IVSESGEKAPNVVY+G+L+N R +A+K
Sbjct  38   FKEFSLAELRAATNGFNSELIVSESGEKAPNVVYRGKLRNNRLVAIK  84



>ref|XP_002527892.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF34523.1| receptor protein kinase, putative [Ricinus communis]
Length=491

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL +LKAAT+ FSSE IVSE GEKAPNVVYKGRL N  WIAVK
Sbjct  41   FTEFSLDQLKAATSGFSSENIVSEHGEKAPNVVYKGRLDNDHWIAVK  87



>ref|XP_009374331.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X4 [Pyrus x bretschneideri]
Length=489

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK
Sbjct  40   FSEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVK  86



>ref|XP_007134779.1| hypothetical protein PHAVU_010G075300g [Phaseolus vulgaris]
 gb|ESW06773.1| hypothetical protein PHAVU_010G075300g [Phaseolus vulgaris]
Length=491

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL +LKAATN FSSE IVSE GEKAPNVVYKG+L N +WIA+K
Sbjct  41   FGEFSLEQLKAATNGFSSENIVSEHGEKAPNVVYKGKLDNGQWIAIK  87



>ref|XP_009374328.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X2 [Pyrus x bretschneideri]
Length=491

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK
Sbjct  42   FSEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVK  88



>ref|XP_009374330.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X3 [Pyrus x bretschneideri]
Length=490

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK
Sbjct  40   FSEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVK  86



>gb|KHN22546.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=517

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAV  406
            F EFSL +LKAATN FSSE IVSE GEKAPNVVYKG+L N +WIA+
Sbjct  41   FGEFSLEQLKAATNGFSSENIVSEHGEKAPNVVYKGKLDNGQWIAI  86



>ref|XP_009374327.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X1 [Pyrus x bretschneideri]
Length=492

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK
Sbjct  42   FSEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVK  88



>gb|KJB74454.1| hypothetical protein B456_011G2959002, partial [Gossypium raimondii]
 gb|KJB74455.1| hypothetical protein B456_011G2959002, partial [Gossypium raimondii]
 gb|KJB74456.1| hypothetical protein B456_011G2959002, partial [Gossypium raimondii]
 gb|KJB74458.1| hypothetical protein B456_011G2959002, partial [Gossypium raimondii]
Length=252

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 56/98 (57%), Gaps = 14/98 (14%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC+QS       +        Q ++ L  NG+                  F EFSL+EL
Sbjct  1    MGCFQSKIPHQ--LPPPPPPPPQTNSDLDGNGEQQAVP------------AFNEFSLAEL  46

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            +AA+N FS++ IVSESGEKAPNVVY+G+L+N R +A+K
Sbjct  47   RAASNGFSTDLIVSESGEKAPNVVYRGKLKNNRVVAIK  84



>ref|XP_010650958.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Vitis vinifera]
 emb|CBI16029.3| unnamed protein product [Vitis vinifera]
Length=490

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  197  LSSNGKDsgggggggaaseggasVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKG  376
            L SN +DS     GG         F EFSL +L+AAT+ FSS+ IVSE GEKAPNVVYKG
Sbjct  16   LKSNSQDSFDLENGGKNEGDSLPSFGEFSLDQLRAATSGFSSDNIVSEHGEKAPNVVYKG  75

Query  377  RLQNRRWIAVK  409
            +L++ RWIAVK
Sbjct  76   KLEDDRWIAVK  86



>ref|XP_006464341.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X2 [Citrus sinensis]
Length=419

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L++L+AATN FSSE IVSESG+KAPNVVY+GRL+N R +A+K
Sbjct  46   FKEFVLADLRAATNGFSSELIVSESGDKAPNVVYRGRLKNNRLVAIK  92



>ref|XP_009769483.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Nicotiana sylvestris]
Length=491

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL ELK ATN FS E IVSE GEKAPNVVYKG L+N RW+AVK
Sbjct  41   FTEFSLDELKIATNGFSPENIVSEHGEKAPNVVYKGLLENGRWVAVK  87



>gb|EPS71043.1| hypothetical protein M569_03708 [Genlisea aurea]
Length=496

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L+EL+AATN FSSE IVSESGEKAPNVVYKG+L+N + +A+K
Sbjct  42   FKEFGLAELRAATNGFSSELIVSESGEKAPNVVYKGKLRNNQLVAIK  88



>ref|XP_006445511.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
 gb|ESR58751.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
Length=418

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L++L+AATN FSSE IVSESG+KAPNVVY+GRL+N R +A+K
Sbjct  46   FKEFVLADLRAATNGFSSELIVSESGDKAPNVVYRGRLKNNRLVAIK  92



>ref|XP_004147901.1| PREDICTED: probable serine/threonine-protein kinase At5g41260-like 
[Cucumis sativus]
 gb|KGN54339.1| hypothetical protein Csa_4G305340 [Cucumis sativus]
Length=491

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS   LKAAT +FSSE IVSE GEKAPNVVYKG+L N RWIAVK
Sbjct  41   FSEFSFERLKAATGSFSSENIVSEHGEKAPNVVYKGKLDNGRWIAVK  87



>gb|KJB74460.1| hypothetical protein B456_011G2959002, partial [Gossypium raimondii]
Length=266

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 56/98 (57%), Gaps = 14/98 (14%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC+QS       +        Q ++ L  NG+                  F EFSL+EL
Sbjct  1    MGCFQSKIPHQ--LPPPPPPPPQTNSDLDGNGEQQAVP------------AFNEFSLAEL  46

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            +AA+N FS++ IVSESGEKAPNVVY+G+L+N R +A+K
Sbjct  47   RAASNGFSTDLIVSESGEKAPNVVYRGKLKNNRVVAIK  84



>ref|XP_004162757.1| PREDICTED: probable serine/threonine-protein kinase At5g41260-like 
[Cucumis sativus]
Length=491

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS   LKAAT +FSSE IVSE GEKAPNVVYKG+L N RWIAVK
Sbjct  41   FSEFSFERLKAATGSFSSENIVSEHGEKAPNVVYKGKLDNGRWIAVK  87



>ref|XP_007008712.1| BR-signaling kinase 2 isoform 2 [Theobroma cacao]
 gb|EOY17522.1| BR-signaling kinase 2 isoform 2 [Theobroma cacao]
Length=474

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L EL+AATN FSSE IVSESGEKAPNVVY+G+L+N R +A+K
Sbjct  186  FKEFGLVELRAATNGFSSELIVSESGEKAPNVVYRGKLKNNRVVAIK  232



>ref|XP_006464340.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X1 [Citrus sinensis]
 gb|KDO85367.1| hypothetical protein CISIN_1g010932mg [Citrus sinensis]
Length=497

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L++L+AATN FSSE IVSESG+KAPNVVY+GRL+N R +A+K
Sbjct  46   FKEFVLADLRAATNGFSSELIVSESGDKAPNVVYRGRLKNNRLVAIK  92



>ref|XP_008438236.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Cucumis melo]
 ref|XP_008438237.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Cucumis melo]
Length=491

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L EL+AATN FSSE IVSESGEKAPNVVY+G+L+N R +A+K
Sbjct  41   FKEFELVELRAATNGFSSELIVSESGEKAPNVVYRGKLRNNRLVAIK  87



>ref|XP_004229508.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Solanum lycopersicum]
Length=492

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EFSL+EL+AATN FSSE IVSESGEKAPNVVY+G+L++ R  A+K
Sbjct  40   VFKEFSLAELRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRLAAIK  87



>ref|XP_008448868.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Cucumis melo]
Length=491

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS   LKAAT  FSSE IVSE GEKAPNVVYKG+L N RWIAVK
Sbjct  41   FSEFSFERLKAATGGFSSENIVSEHGEKAPNVVYKGKLDNGRWIAVK  87



>ref|XP_007008713.1| BR-signaling kinase 2 isoform 3 [Theobroma cacao]
 gb|EOY17523.1| BR-signaling kinase 2 isoform 3 [Theobroma cacao]
Length=571

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L EL+AATN FSSE IVSESGEKAPNVVY+G+L+N R +A+K
Sbjct  186  FKEFGLVELRAATNGFSSELIVSESGEKAPNVVYRGKLKNNRVVAIK  232



>ref|XP_008355658.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X4 [Malus domestica]
Length=489

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK
Sbjct  40   FNEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVK  86



>ref|XP_008355649.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X3 [Malus domestica]
Length=490

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK
Sbjct  40   FNEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVK  86



>ref|XP_008355642.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X2 [Malus domestica]
Length=491

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK
Sbjct  42   FNEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVK  88



>ref|XP_007008711.1| BR-signaling kinase 2 isoform 1 [Theobroma cacao]
 gb|EOY17521.1| BR-signaling kinase 2 isoform 1 [Theobroma cacao]
Length=617

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L EL+AATN FSSE IVSESGEKAPNVVY+G+L+N R +A+K
Sbjct  166  FKEFGLVELRAATNGFSSELIVSESGEKAPNVVYRGKLKNNRVVAIK  212



>ref|XP_007210970.1| hypothetical protein PRUPE_ppa022548mg [Prunus persica]
 gb|EMJ12169.1| hypothetical protein PRUPE_ppa022548mg [Prunus persica]
Length=495

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 48/103 (47%), Positives = 55/103 (53%), Gaps = 18/103 (17%)
 Frame = +2

Query  116  MGCWQST-----FSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEF  280
            MGC  S       S D P S  D      H   S+NG  +               VF E+
Sbjct  1    MGCLHSKTTHLHLSPDDPSSLPD-----THKPDSANGDQAELEAQAP--------VFKEY  47

Query  281  SLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            SL EL+ ATN FSSE IVSESGEKAPNVVY+G+L N R +AVK
Sbjct  48   SLDELRKATNGFSSECIVSESGEKAPNVVYRGKLDNNRLVAVK  90



>ref|XP_008355637.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X1 [Malus domestica]
Length=492

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK
Sbjct  42   FNEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVK  88



>ref|XP_010677274.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Beta vulgaris subsp. vulgaris]
Length=497

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F E+SL+EL+ ATN FS+E IVSESGEKAPNVVY+GRL+  R+IAVK
Sbjct  46   FKEYSLNELRKATNGFSTECIVSESGEKAPNVVYRGRLETNRFIAVK  92



>gb|KDP28924.1| hypothetical protein JCGZ_14695 [Jatropha curcas]
Length=494

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL+EL+AAT+ FSS+FIVSESG+KAPNVVY+G+L N R +A+K
Sbjct  43   FREFSLAELRAATSGFSSDFIVSESGDKAPNVVYRGKLNNNRLVAIK  89



>ref|XP_009781644.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana sylvestris]
Length=488

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/98 (40%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC+QS     +   E+  ++    T L++  +                  F EF+L++L
Sbjct  1    MGCFQSKTVNVKSTIEEPPKEDDSKTDLANGDQ---------------VPAFKEFALADL  45

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            +AATN FSSE IVSESGEKAPN+VY+G+L++ R +A+K
Sbjct  46   RAATNGFSSELIVSESGEKAPNIVYRGKLRSNRLVAIK  83



>ref|XP_011019187.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Populus euphratica]
Length=491

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS  +LKAAT+ FSS+ IVSE GEKAPNVVYKG+L N RWIAVK
Sbjct  41   FTEFSFEQLKAATSGFSSDNIVSEHGEKAPNVVYKGKLDNDRWIAVK  87



>ref|XP_006445512.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
 gb|ESR58752.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
Length=419

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L++L+AATN FSSE IVSESG+KAPNVVY+GRL+N R +A+K
Sbjct  46   FKEFVLADLRAATNGFSSELIVSESGDKAPNVVYRGRLKNNRLVAIK  92



>ref|XP_003608643.1| Protein kinase-like protein [Medicago truncatula]
Length=539

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF E+ L+EL+ AT+ FS+E+IVSESGEKAPNVVYKG+L+N R +AVK
Sbjct  44   VFKEYGLNELRRATHEFSTEYIVSESGEKAPNVVYKGKLENNRLVAVK  91



>ref|XP_006445513.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
 gb|ESR58753.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
Length=497

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L++L+AATN FSSE IVSESG+KAPNVVY+GRL+N R +A+K
Sbjct  46   FKEFVLADLRAATNGFSSELIVSESGDKAPNVVYRGRLKNNRLVAIK  92



>ref|XP_009397594.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Musa acuminata subsp. malaccensis]
Length=534

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F++FS +ELKAAT+ FS + IVSESG+KAPNVVYKGRLQNRR I VK
Sbjct  80   FSQFSFAELKAATDGFSPQNIVSESGDKAPNVVYKGRLQNRRRIVVK  126



>ref|XP_010275290.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nelumbo nucifera]
 ref|XP_010275291.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nelumbo nucifera]
Length=491

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF+L+EL+ ATN FSS +IVSESGEKAPNVVY+G+L+N R +AVK
Sbjct  40   FKEFALAELRTATNGFSSNYIVSESGEKAPNVVYRGKLENNRLVAVK  86



>gb|ACJ85588.1| unknown [Medicago truncatula]
Length=434

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+E+SL ELKAATN FSSE IVSE GEKAPNVVYKG+L+N + IAVK
Sbjct  41   FSEYSLEELKAATNGFSSENIVSEHGEKAPNVVYKGKLENGQLIAVK  87



>gb|KDP24521.1| hypothetical protein JCGZ_25085 [Jatropha curcas]
Length=491

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL  LKAAT+ F+S+ IVSE GEKAPNVVYKG+L N RWIAVK
Sbjct  41   FTEFSLDHLKAATSGFASDNIVSEHGEKAPNVVYKGKLDNDRWIAVK  87



>gb|KEH29001.1| LRR receptor-like kinase [Medicago truncatula]
Length=409

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+E+SL ELKAATN FSSE IVSE GEKAPNVVYKG+L+N + IAVK
Sbjct  41   FSEYSLEELKAATNGFSSENIVSEHGEKAPNVVYKGKLENGQLIAVK  87



>gb|AES90840.2| LRR receptor-like kinase [Medicago truncatula]
Length=498

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF E+ L+EL+ AT+ FS+E+IVSESGEKAPNVVYKG+L+N R +AVK
Sbjct  44   VFKEYGLNELRRATHEFSTEYIVSESGEKAPNVVYKGKLENNRLVAVK  91



>gb|KJB36863.1| hypothetical protein B456_006G179500 [Gossypium raimondii]
Length=491

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL +LK AT+ FSS+ IVSE GEKAPNVVYKG+L N RW+AVK
Sbjct  41   FGEFSLEQLKVATSGFSSDNIVSEHGEKAPNVVYKGKLDNDRWVAVK  87



>ref|XP_006847686.1| hypothetical protein AMTR_s00149p00051550 [Amborella trichopoda]
 gb|ERN09267.1| hypothetical protein AMTR_s00149p00051550 [Amborella trichopoda]
Length=500

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F E+ L+EL+AATN FS E I+SESGEKAPNVVYKG+L N R IA+K
Sbjct  40   FKEYGLAELRAATNGFSRELIISESGEKAPNVVYKGKLDNNRLIAIK  86



>ref|XP_010256740.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Nelumbo nucifera]
 ref|XP_010256741.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Nelumbo nucifera]
Length=491

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+E+SL +L+AAT  FS + IVSE GEKAPNVVYKGRL+N RWIAVK
Sbjct  41   FSEYSLEQLRAATAGFSVDNIVSEHGEKAPNVVYKGRLENDRWIAVK  87



>ref|XP_004294233.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X2 [Fragaria vesca subsp. vesca]
Length=490

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG L + RWIAVK
Sbjct  41   FVEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGTLDDGRWIAVK  87



>ref|XP_011460883.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X1 [Fragaria vesca subsp. vesca]
Length=491

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG L + RWIAVK
Sbjct  41   FVEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGTLDDGRWIAVK  87



>ref|XP_002322938.1| kinase family protein [Populus trichocarpa]
 gb|EEF04699.1| kinase family protein [Populus trichocarpa]
Length=491

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS  +L+AAT+ FSS+ IVSE GEKAPNVVYKG+L N RWIAVK
Sbjct  41   FTEFSFEQLRAATSGFSSDNIVSEHGEKAPNVVYKGKLDNDRWIAVK  87



>gb|KHG04747.1| hypothetical protein F383_01426 [Gossypium arboreum]
 gb|KHG09571.1| hypothetical protein F383_06576 [Gossypium arboreum]
Length=488

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 56/98 (57%), Gaps = 14/98 (14%)
 Frame = +2

Query  116  MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  295
            MGC+QS       +        Q ++ L  NG+                  F EFSL+EL
Sbjct  1    MGCFQSKIPHQ--LPPPPPPPPQTNSDLDGNGEQQAVP------------AFNEFSLAEL  46

Query  296  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            +AA+N FS++ IVSESGEKAPNVVY+G+L+N R +A+K
Sbjct  47   RAASNGFSTDLIVSESGEKAPNVVYRGKLKNNRVVAIK  84



>ref|XP_009613653.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Nicotiana tomentosiformis]
Length=491

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL ELK AT+ FS E IVSE GEKAPNVVYKG L+N RW+AVK
Sbjct  41   FTEFSLDELKIATSGFSPENIVSEHGEKAPNVVYKGLLENGRWVAVK  87



>ref|XP_008238295.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Prunus mume]
Length=495

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            +F E+SL EL+ ATN FSSE IVSESGEKAPNVVY+G+L N R +AVK
Sbjct  43   MFKEYSLDELRKATNGFSSECIVSESGEKAPNVVYRGKLDNNRLVAVK  90



>ref|XP_008219944.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X2 [Prunus mume]
Length=490

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EF+L +LKAAT+ FSSE +VSE GEKAPNVVYKG L + RWIAVK
Sbjct  41   FSEFTLDQLKAATSGFSSENVVSEHGEKAPNVVYKGTLDDGRWIAVK  87



>ref|XP_007207418.1| hypothetical protein PRUPE_ppa004824mg [Prunus persica]
 gb|EMJ08617.1| hypothetical protein PRUPE_ppa004824mg [Prunus persica]
Length=490

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EF+L +LKAAT+ FSSE +VSE GEKAPNVVYKG L + RWIAVK
Sbjct  41   FSEFTLDQLKAATSGFSSENVVSEHGEKAPNVVYKGTLDDGRWIAVK  87



>ref|XP_008219936.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X1 [Prunus mume]
Length=491

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EF+L +LKAAT+ FSSE +VSE GEKAPNVVYKG L + RWIAVK
Sbjct  41   FSEFTLDQLKAATSGFSSENVVSEHGEKAPNVVYKGTLDDGRWIAVK  87



>ref|XP_006354609.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Solanum tuberosum]
Length=492

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL+EL+AATN FSSE IVSESGEKAPNVVY+G+L++ R  A+K
Sbjct  41   FKEFSLAELRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRLAAIK  87



>gb|KHN32516.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=491

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF+L +LK ATN FSSE IVSE GEKAPNVVYKG+L N +WIA+K
Sbjct  41   FGEFNLEQLKVATNGFSSENIVSEHGEKAPNVVYKGKLDNGQWIAIK  87



>ref|XP_002276280.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Vitis vinifera]
 emb|CBI30458.3| unnamed protein product [Vitis vinifera]
Length=491

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL +LKAAT+ FSS+ IVSE GEKAPN+VYKG+L   RWIAVK
Sbjct  41   FTEFSLDQLKAATSGFSSDNIVSEHGEKAPNIVYKGKLDADRWIAVK  87



>gb|KEH29000.1| LRR receptor-like kinase [Medicago truncatula]
Length=495

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+E+SL ELKAATN FSSE IVSE GEKAPNVVYKG+L+N + IAVK
Sbjct  41   FSEYSLEELKAATNGFSSENIVSEHGEKAPNVVYKGKLENGQLIAVK  87



>ref|XP_003520945.1| PREDICTED: probable serine/threonine-protein kinase At5g41260-like 
[Glycine max]
Length=491

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF+L +LK ATN FSSE IVSE GEKAPNVVYKG+L N +WIA+K
Sbjct  41   FGEFNLEQLKVATNGFSSENIVSEHGEKAPNVVYKGKLDNGQWIAIK  87



>gb|EYU26629.1| hypothetical protein MIMGU_mgv1a005339mg [Erythranthe guttata]
Length=477

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F +FS  ELK ATN FSSE IVSE GEKAPNVVYKG L N RWIAVK
Sbjct  38   FRDFSWDELKTATNGFSSENIVSEHGEKAPNVVYKGLLDNDRWIAVK  84



>gb|AFW87784.1| putative protein kinase superfamily protein [Zea mays]
Length=218

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF+L+EL+AAT  FS++ IVSESGEKAPN VY+GRL   R IAVK
Sbjct  53   VFREFALAELRAATKGFSADLIVSESGEKAPNAVYRGRLDGGRLIAVK  100



>ref|XP_002975669.1| hypothetical protein SELMODRAFT_103506, partial [Selaginella 
moellendorffii]
 ref|XP_002978854.1| hypothetical protein SELMODRAFT_109237, partial [Selaginella 
moellendorffii]
 gb|EFJ20301.1| hypothetical protein SELMODRAFT_109237, partial [Selaginella 
moellendorffii]
 gb|EFJ23298.1| hypothetical protein SELMODRAFT_103506, partial [Selaginella 
moellendorffii]
Length=455

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS  +L+ ATN FS+++IVSESG+KAPN VYKGRL   RWIAVK
Sbjct  6    FREFSFEQLREATNGFSADYIVSESGDKAPNHVYKGRLDQNRWIAVK  52



>gb|EYU26628.1| hypothetical protein MIMGU_mgv1a005339mg [Erythranthe guttata]
Length=488

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F +FS  ELK ATN FSSE IVSE GEKAPNVVYKG L N RWIAVK
Sbjct  38   FRDFSWDELKTATNGFSSENIVSEHGEKAPNVVYKGLLDNDRWIAVK  84



>gb|EYU40299.1| hypothetical protein MIMGU_mgv1a005192mg [Erythranthe guttata]
Length=412

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L+EL+ ATN FSSE IVSESGEKAPNVVYKG+L++ R +A+K
Sbjct  41   FREFGLAELRGATNGFSSELIVSESGEKAPNVVYKGKLRSNRLVAIK  87



>ref|XP_010104360.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB99780.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=495

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F E+ L+EL+ ATN FS+E+IVSESGEKAPNVVY+G+L N R++AVK
Sbjct  44   FKEYGLNELRKATNGFSTEYIVSESGEKAPNVVYRGKLHNNRFVAVK  90



>gb|EYU40298.1| hypothetical protein MIMGU_mgv1a005192mg [Erythranthe guttata]
Length=493

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L+EL+ ATN FSSE IVSESGEKAPNVVYKG+L++ R +A+K
Sbjct  41   FREFGLAELRGATNGFSSELIVSESGEKAPNVVYKGKLRSNRLVAIK  87



>ref|XP_004133947.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Cucumis sativus]
 ref|XP_004168938.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Cucumis sativus]
 gb|KGN56652.1| hypothetical protein Csa_3G127150 [Cucumis sativus]
Length=491

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L EL+AATN FSSE IVSESG+KAPNVVY+G+L+N R +A+K
Sbjct  41   FKEFELVELRAATNGFSSELIVSESGKKAPNVVYRGKLRNNRLVAIK  87



>ref|XP_007026838.1| Kinase protein with tetratricopeptide repeat domain [Theobroma 
cacao]
 gb|EOY07340.1| Kinase protein with tetratricopeptide repeat domain [Theobroma 
cacao]
Length=491

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL +LKAAT  FSS+ IVSE GEKAPNVV+KG+L N RW+AVK
Sbjct  41   FSEFSLEQLKAATCGFSSDNIVSEHGEKAPNVVFKGKLDNDRWVAVK  87



>ref|XP_009626367.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
 ref|XP_009626368.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
 ref|XP_009626369.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
 ref|XP_009626370.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
 ref|XP_009626372.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
 ref|XP_009626373.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
 ref|XP_009626374.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
Length=486

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L++L+AATN FSSE IVSESGEKAPN+VY+G+L++ R +A+K
Sbjct  35   FKEFGLADLRAATNGFSSELIVSESGEKAPNIVYRGKLRSNRLVAIK  81



>ref|XP_011093461.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Sesamum indicum]
Length=492

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L+EL+AATN FSS+ IVSESGEKAPNVVY+G+L++ R +A+K
Sbjct  41   FKEFGLAELRAATNGFSSDLIVSESGEKAPNVVYRGKLRSNRLVAIK  87



>ref|XP_007155758.1| hypothetical protein PHAVU_003G229100g [Phaseolus vulgaris]
 gb|ESW27752.1| hypothetical protein PHAVU_003G229100g [Phaseolus vulgaris]
Length=496

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F E+ LSEL+ ATN F++++IVSESGEKAPNVVY+G+L+N R +AVK
Sbjct  45   FKEYGLSELRRATNEFNTDYIVSESGEKAPNVVYRGKLENNRLVAVK  91



>ref|XP_004983586.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Setaria italica]
Length=505

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF+L+EL+AAT  FS++ IVSESGEKAPNVVY+GRL   R IAVK
Sbjct  53   VFREFALAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVK  100



>ref|XP_006651012.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Oryza brachyantha]
Length=501

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVK  409
            FAEFSL+EL+AAT  F++E IVSESGEKAPN VY+GRLQ +RR IAVK
Sbjct  43   FAEFSLAELRAATGGFAAENIVSESGEKAPNFVYRGRLQSSRRAIAVK  90



>ref|XP_006662088.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Oryza brachyantha]
Length=505

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF+L+EL+AAT  FS++ IVSESGEKAPNVVY+GRL   R IAVK
Sbjct  53   VFREFALAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVK  100



>gb|KJB37545.1| hypothetical protein B456_006G209500 [Gossypium raimondii]
Length=488

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F E+S+  LK AT+ FS E IVSE GEKAPNVVYKG+L+N+RWIAVK
Sbjct  41   FREYSIDTLKMATSGFSVENIVSEHGEKAPNVVYKGKLENQRWIAVK  87



>ref|XP_001772928.1| predicted protein [Physcomitrella patens]
 gb|EDQ62330.1| predicted protein, partial [Physcomitrella patens]
Length=460

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF+L  L+AATN+FSS+ IVSESGEKAPN VYKGRL  +R+IA+K
Sbjct  6    FREFTLESLRAATNSFSSDQIVSESGEKAPNFVYKGRLDQKRFIAIK  52



>emb|CDY12866.1| BnaA09g14080D [Brassica napus]
Length=174

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF+L +LK+AT+ F+ E+IVSE GEKAPNVVY+G+L+N++ IAVK
Sbjct  41   FREFTLDQLKSATSGFAVEYIVSEHGEKAPNVVYRGKLENQKKIAVK  87



>ref|XP_006280372.1| hypothetical protein CARUB_v10026298mg [Capsella rubella]
 gb|EOA13270.1| hypothetical protein CARUB_v10026298mg [Capsella rubella]
Length=489

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS  +L+AAT+ FS++ IVSE G KAPNVVYKGRL++ RWIAVK
Sbjct  37   FTEFSFDQLRAATSGFSTDSIVSEHGVKAPNVVYKGRLEDDRWIAVK  83



>ref|XP_004513275.1| PREDICTED: probable serine/threonine-protein kinase At5g41260-like 
[Cicer arietinum]
Length=491

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F E+SL ELKAAT+ FSSE IVSE GEKAPNVVYKG+L+N + IAVK
Sbjct  41   FCEYSLDELKAATDGFSSENIVSEHGEKAPNVVYKGKLENGKLIAVK  87



>ref|XP_006401013.1| hypothetical protein EUTSA_v10013377mg [Eutrema salsugineum]
 gb|ESQ42466.1| hypothetical protein EUTSA_v10013377mg [Eutrema salsugineum]
Length=489

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS  +L+AAT+ FS++ IVSE G KAPNVVYKGRL++ RWIAVK
Sbjct  37   FTEFSFDQLRAATSGFSTDSIVSEHGVKAPNVVYKGRLEDDRWIAVK  83



>ref|XP_001753441.1| predicted protein [Physcomitrella patens]
 gb|EDQ81664.1| predicted protein [Physcomitrella patens]
Length=477

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFSL  L+ ATN+FSS+ IVSESGEKAPN VYKGRL    WIA+K
Sbjct  23   FREFSLESLRVATNSFSSDQIVSESGEKAPNFVYKGRLDQNHWIAIK  69



>ref|XP_009126720.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Brassica rapa]
Length=489

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS  +L+AAT+ FS++ IVSE G KAPNVVYKGRL++ RWIAVK
Sbjct  37   FSEFSFDQLRAATSGFSTDSIVSEHGVKAPNVVYKGRLEDGRWIAVK  83



>gb|EEC67482.1| hypothetical protein OsI_34730 [Oryza sativa Indica Group]
Length=493

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF L+EL+AAT  FS++ IVSESGEKAPNVVY+GRL   R IAVK
Sbjct  41   VFREFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVK  88



>emb|CDY32670.1| BnaA02g07320D [Brassica napus]
Length=489

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFS  +L+AAT+ FS++ IVSE G KAPNVVYKGRL++ RWIAVK
Sbjct  37   FSEFSFDQLRAATSGFSTDSIVSEHGVKAPNVVYKGRLEDGRWIAVK  83



>ref|XP_006280371.1| hypothetical protein CARUB_v10026298mg [Capsella rubella]
 gb|EOA13269.1| hypothetical protein CARUB_v10026298mg [Capsella rubella]
Length=438

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS  +L+AAT+ FS++ IVSE G KAPNVVYKGRL++ RWIAVK
Sbjct  37   FTEFSFDQLRAATSGFSTDSIVSEHGVKAPNVVYKGRLEDDRWIAVK  83



>ref|NP_001065455.1| Os10g0571300 [Oryza sativa Japonica Group]
 gb|AAL86491.1|AC077693_30 putative protein kinase [Oryza sativa Japonica Group]
 gb|AAP55105.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27292.1| Os10g0571300 [Oryza sativa Japonica Group]
Length=512

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF L+EL+AAT  FS++ IVSESGEKAPNVVY+GRL   R IAVK
Sbjct  60   VFREFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVK  107



>ref|XP_002520456.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF41869.1| receptor protein kinase, putative [Ricinus communis]
Length=487

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVK  409
            F EFSL +L+AAT+ FS++ IVSE GEKAPNVVYKGR Q + RWIA+K
Sbjct  36   FKEFSLEQLRAATSGFSTDHIVSEHGEKAPNVVYKGRFQDDNRWIAIK  83



>ref|XP_002308195.1| kinase family protein [Populus trichocarpa]
 gb|EEE91718.1| kinase family protein [Populus trichocarpa]
Length=491

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS  +LKAAT+ FSS+ IVSE GEKAPNVVYKG+L N  WIAVK
Sbjct  41   FTEFSFEQLKAATSGFSSDNIVSEHGEKAPNVVYKGKLDNDCWIAVK  87



>ref|XP_003549974.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Glycine max]
 gb|KHN01674.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=498

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F E+ L EL+ ATN FS+++IVSESGEKAPNVVY+G+L+N R +AVK
Sbjct  45   FKEYGLIELRRATNEFSTDYIVSESGEKAPNVVYRGKLENNRLVAVK  91



>ref|XP_006381227.1| hypothetical protein POPTR_0006s09500g [Populus trichocarpa]
 gb|ERP59024.1| hypothetical protein POPTR_0006s09500g [Populus trichocarpa]
Length=492

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS  +LKAAT+ FSS+ IVSE GEKAPNVVYKG+L N  WIAVK
Sbjct  41   FTEFSFEQLKAATSGFSSDNIVSEHGEKAPNVVYKGKLDNDCWIAVK  87



>ref|XP_003524482.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Glycine max]
 gb|KHN21023.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=496

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F E+ L EL+ ATN FS+++IVSESGEKAPNVVY+G+L+N R +AVK
Sbjct  45   FKEYGLIELRRATNEFSTDYIVSESGEKAPNVVYRGKLENNRLVAVK  91



>gb|EAZ25481.1| hypothetical protein OsJ_09304 [Oryza sativa Japonica Group]
Length=531

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVK  409
            FAEFSL+EL+AAT  F++E IVSESGEKAPN VY+GRLQ  RR IAVK
Sbjct  53   FAEFSLAELRAATGGFAAENIVSESGEKAPNFVYRGRLQRTRRAIAVK  100



>ref|NP_001048870.1| Os03g0132800 [Oryza sativa Japonica Group]
 gb|ABF93827.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10784.1| Os03g0132800 [Oryza sativa Japonica Group]
 gb|EAY88407.1| hypothetical protein OsI_09868 [Oryza sativa Indica Group]
 dbj|BAH00780.1| unnamed protein product [Oryza sativa Japonica Group]
Length=531

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVK  409
            FAEFSL+EL+AAT  F++E IVSESGEKAPN VY+GRLQ  RR IAVK
Sbjct  53   FAEFSLAELRAATGGFAAENIVSESGEKAPNFVYRGRLQRTRRAIAVK  100



>ref|XP_006350809.1| PREDICTED: probable serine/threonine-protein kinase At5g41260-like 
[Solanum tuberosum]
Length=491

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVK  409
            VF E+ L ELKAAT+NFS+  IVSE GEKAPNVV+KGRL  N RWIA+K
Sbjct  40   VFKEYGLEELKAATSNFSANNIVSEHGEKAPNVVFKGRLNGNGRWIAIK  88



>emb|CDY02851.1| BnaC02g10380D [Brassica napus]
Length=489

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS  +L+AAT+ FS++ IVSE G KAPNVVYKGRL++ RWIAVK
Sbjct  37   FTEFSFDQLRAATSGFSTDSIVSEHGVKAPNVVYKGRLEDGRWIAVK  83



>ref|XP_003574368.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Brachypodium distachyon]
Length=512

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF L+EL+AAT  FS++ IVSESGEKAPNVVY+GRL   R IAVK
Sbjct  60   VFREFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVK  107



>ref|XP_011085061.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Sesamum indicum]
Length=481

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L+EL+AATN FSSE IVSE GEKAPNVVY+G+L++ R  A+K
Sbjct  29   FKEFGLAELRAATNGFSSELIVSECGEKAPNVVYRGKLRSNRLAAIK  75



>ref|XP_010262700.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Nelumbo nucifera]
Length=489

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F+EFSL  LK AT+ FS+  IVSE GEKAPNVVYKG L+N RWIAVK
Sbjct  41   FSEFSLELLKVATSGFSANNIVSEHGEKAPNVVYKGMLENDRWIAVK  87



>ref|XP_011041263.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Populus euphratica]
Length=524

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 6/53 (11%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRL------QNRRWIAVK  409
            F EFS ++L+AATNNFS EFIVSESGEKA NVVYKGRL       N  WIAVK
Sbjct  66   FTEFSFADLQAATNNFSPEFIVSESGEKASNVVYKGRLQNQNNSNNISWIAVK  118



>ref|XP_011094943.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Sesamum indicum]
Length=488

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS  ELKAATN FS E IVSE GEKAPNVVYKG L++  WIAVK
Sbjct  38   FREFSWEELKAATNGFSPENIVSEHGEKAPNVVYKGFLESEGWIAVK  84



>ref|XP_004509006.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X1 [Cicer arietinum]
Length=541

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F E+ L+EL+ AT+ FS+++IVSESGEKAPNVVY+G+L+N R +AVK
Sbjct  45   FKEYGLNELRRATHEFSTDYIVSESGEKAPNVVYRGKLENNRLVAVK  91



>ref|XP_011085053.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Sesamum indicum]
Length=493

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EF L+EL+AATN FSSE IVSE GEKAPNVVY+G+L++ R  A+K
Sbjct  41   FKEFGLAELRAATNGFSSELIVSECGEKAPNVVYRGKLRSNRLAAIK  87



>gb|AFW87785.1| putative protein kinase superfamily protein [Zea mays]
Length=505

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF+L+EL+AAT  FS++ IVSESGEKAPN VY+GRL   R IAVK
Sbjct  53   VFREFALAELRAATKGFSADLIVSESGEKAPNAVYRGRLDGGRLIAVK  100



>ref|XP_011041262.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Populus euphratica]
Length=532

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 6/53 (11%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRL------QNRRWIAVK  409
            F EFS ++L+AATNNFS EFIVSESGEKA NVVYKGRL       N  WIAVK
Sbjct  66   FTEFSFADLQAATNNFSPEFIVSESGEKASNVVYKGRLQNQNNSNNISWIAVK  118



>ref|NP_001148892.1| ATP binding protein [Zea mays]
 gb|ACG33321.1| ATP binding protein [Zea mays]
Length=505

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF+L+EL+AAT  FS++ IVSESGEKAPN VY+GRL   R IAVK
Sbjct  53   VFREFALAELRAATKGFSADLIVSESGEKAPNAVYRGRLDGGRLIAVK  100



>ref|XP_002467458.1| hypothetical protein SORBIDRAFT_01g028460 [Sorghum bicolor]
 gb|EER94456.1| hypothetical protein SORBIDRAFT_01g028460 [Sorghum bicolor]
Length=505

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  266  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            VF EF+L+EL+AAT  FS++ IVSESGEKAPN VY+GRL   R IAVK
Sbjct  53   VFREFALAELRAATKGFSADLIVSESGEKAPNAVYRGRLDGGRLIAVK  100



>ref|XP_002866308.1| hypothetical protein ARALYDRAFT_496029 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42567.1| hypothetical protein ARALYDRAFT_496029 [Arabidopsis lyrata subsp. 
lyrata]
Length=489

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  269  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVK  409
            F EFS  +L+AAT  FS++ IVSE G KAPNVVYKGRL++ RWIAVK
Sbjct  37   FTEFSFDQLRAATCGFSTDSIVSEHGVKAPNVVYKGRLEDDRWIAVK  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564491502050