BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I19

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766349.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    168   4e-46   Nicotiana sylvestris
ref|XP_009593112.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    166   3e-45   Nicotiana tomentosiformis
ref|XP_006352588.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    165   5e-45   Solanum tuberosum [potatoes]
ref|XP_004248314.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    164   2e-44   Solanum lycopersicum
emb|CAC80377.1|  glyceraldehyde-3-phosphate dehydrogenase               164   2e-44   Capsicum annuum
ref|XP_011095736.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    159   2e-42   Sesamum indicum [beniseed]
ref|XP_002315071.2|  hypothetical protein POPTR_0010s17930g             157   4e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010276220.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_011086336.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   1e-41   Sesamum indicum [beniseed]
ref|XP_002263263.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    156   2e-41   Vitis vinifera
gb|EYU27576.1|  hypothetical protein MIMGU_mgv1a020814mg                155   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_011013977.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   4e-41   Populus euphratica
ref|XP_008226146.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    154   6e-41   Prunus mume [ume]
ref|XP_007214718.1|  hypothetical protein PRUPE_ppa006087mg             154   6e-41   Prunus persica
ref|XP_002312235.1|  glyceraldehyde 3-phosphate dehydrogenase 1 f...    154   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_011016312.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    153   2e-40   Populus euphratica
ref|XP_007022675.1|  Glyceraldehyde-3-phosphate dehydrogenase of ...    151   3e-40   
ref|XP_004139839.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    152   4e-40   Cucumis sativus [cucumbers]
gb|EYU33796.1|  hypothetical protein MIMGU_mgv1a006939mg                152   5e-40   Erythranthe guttata [common monkey flower]
ref|XP_010941678.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    152   6e-40   Elaeis guineensis
ref|XP_010095945.1|  Glyceraldehyde-3-phosphate dehydrogenase           152   8e-40   
ref|XP_010914235.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    150   2e-39   Elaeis guineensis
ref|XP_008383156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    150   2e-39   Malus domestica [apple tree]
ref|XP_009350183.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    150   2e-39   Pyrus x bretschneideri [bai li]
emb|CDP13563.1|  unnamed protein product                                150   2e-39   Coffea canephora [robusta coffee]
ref|XP_008447086.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    150   2e-39   Cucumis melo [Oriental melon]
gb|AJA29689.1|  glyceraldehyde-3-phosphate dehydrogenase                150   3e-39   Betula luminifera [liang ye hua]
ref|XP_009414498.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    150   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB45877.1|  hypothetical protein B456_007G336900                    148   1e-38   Gossypium raimondii
gb|KJB45876.1|  hypothetical protein B456_007G336900                    148   1e-38   Gossypium raimondii
gb|KJB45878.1|  hypothetical protein B456_007G336900                    148   2e-38   Gossypium raimondii
gb|KJB14046.1|  hypothetical protein B456_002G108700                    148   2e-38   Gossypium raimondii
ref|XP_008371994.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    147   5e-38   
ref|XP_007022674.1|  Glyceraldehyde-3-phosphate dehydrogenase of ...    145   6e-38   
gb|KDP25059.1|  hypothetical protein JCGZ_22594                         145   1e-37   Jatropha curcas
ref|XP_008456299.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    145   1e-37   Cucumis melo [Oriental melon]
ref|XP_010537806.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    145   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_009408252.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    144   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007022673.1|  Glyceraldehyde-3-phosphate dehydrogenase of ...    144   4e-37   
ref|XP_008776392.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    144   4e-37   Phoenix dactylifera
ref|XP_006307603.1|  hypothetical protein CARUB_v10009227mg             142   1e-36   Capsella rubella
emb|CDY35080.1|  BnaA06g10900D                                          142   2e-36   Brassica napus [oilseed rape]
gb|EPS71916.1|  hypothetical protein M569_02842                         142   2e-36   Genlisea aurea
ref|XP_007149305.1|  hypothetical protein PHAVU_005G059200g             142   2e-36   Phaseolus vulgaris [French bean]
ref|XP_010531997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    141   2e-36   Tarenaya hassleriana [spider flower]
gb|KHG14985.1|  Glyceraldehyde-3-phosphate dehydrogenase                141   2e-36   Gossypium arboreum [tree cotton]
ref|XP_004140018.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    142   2e-36   
ref|XP_004154566.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    142   3e-36   
emb|CDY33343.1|  BnaC05g12400D                                          141   4e-36   Brassica napus [oilseed rape]
ref|XP_004488757.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    140   5e-36   
ref|XP_004306563.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    141   6e-36   Fragaria vesca subsp. vesca
gb|AAM67077.1|  putative glyceraldehyde-3-phosphate dehydrogenase       141   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003596040.1|  Glyceraldehyde-3-phosphate dehydrogenase           140   7e-36   
ref|NP_173080.1|  glyceraldehyde 3-phosphate dehydrogenase              140   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003596038.1|  Glyceraldehyde-3-phosphate dehydrogenase           140   7e-36   Medicago truncatula
ref|XP_004488755.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    140   1e-35   Cicer arietinum [garbanzo]
gb|KGN46796.1|  hypothetical protein Csa_6G136010                       141   1e-35   Cucumis sativus [cucumbers]
gb|KFK42362.1|  hypothetical protein AALP_AA2G245800                    137   1e-35   Arabis alpina [alpine rockcress]
ref|XP_002890157.1|  GAPCP-2                                            140   1e-35   
emb|CDY25342.1|  BnaC01g30110D                                          140   1e-35   Brassica napus [oilseed rape]
emb|CDY22281.1|  BnaC02g25850D                                          140   1e-35   Brassica napus [oilseed rape]
ref|XP_009128365.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    140   1e-35   Brassica rapa
gb|KFK42359.1|  hypothetical protein AALP_AA2G245800                    137   2e-35   Arabis alpina [alpine rockcress]
ref|XP_010417619.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    139   2e-35   
gb|KHG16589.1|  Glyceraldehyde-3-phosphate dehydrogenase-2C cytos...    139   2e-35   Gossypium arboreum [tree cotton]
ref|XP_010417618.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    139   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010429843.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    139   3e-35   Camelina sativa [gold-of-pleasure]
gb|AAO22684.1|  putative glyceraldehyde-3-phosphate dehydrogenase       139   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693410.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    139   3e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006389879.1|  hypothetical protein EUTSA_v10018604mg             139   4e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010537807.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    138   6e-35   Tarenaya hassleriana [spider flower]
ref|XP_003547755.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    138   7e-35   Glycine max [soybeans]
ref|XP_010472812.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    138   8e-35   Camelina sativa [gold-of-pleasure]
gb|ADJ96634.1|  glyceraldehyde-3-phosphate dehydrogenase                138   8e-35   Guzmania wittmackii x Guzmania lingulata
ref|XP_004488756.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    137   8e-35   
gb|KHN22160.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic     137   9e-35   Glycine soja [wild soybean]
emb|CDX79324.1|  BnaC06g19790D                                          137   9e-35   
ref|XP_009399260.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    137   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIX10972.1|  glyceraldehyde-3-phosphate dehydrogenase                136   3e-34   Ornithogalum longebracteatum [sea-onion]
ref|XP_006416830.1|  hypothetical protein EUTSA_v10007716mg             136   4e-34   
ref|NP_178071.1|  glyceraldehyde-3-phosphate dehydrogenase GAPCP1       136   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889251.1|  GAPCP-1                                            136   4e-34   
ref|NP_001242854.1|  uncharacterized protein LOC100804853               136   4e-34   
ref|XP_009149063.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    135   5e-34   Brassica rapa
gb|AFK39182.1|  unknown                                                 134   1e-33   Medicago truncatula
emb|CDX67990.1|  BnaA07g20300D                                          135   1e-33   
ref|XP_009104524.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    134   1e-33   Brassica rapa
ref|XP_006302200.1|  hypothetical protein CARUB_v10020208mg             134   3e-33   
gb|ABK24753.1|  unknown                                                 132   7e-33   Picea sitchensis
ref|XP_010240502.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    132   7e-33   Brachypodium distachyon [annual false brome]
ref|XP_010064086.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    132   9e-33   Eucalyptus grandis [rose gum]
gb|ACN40575.1|  unknown                                                 132   1e-32   Picea sitchensis
ref|XP_002451619.1|  hypothetical protein SORBIDRAFT_04g004750          132   1e-32   Sorghum bicolor [broomcorn]
ref|NP_001130796.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...    131   2e-32   Zea mays [maize]
gb|ACL54292.1|  unknown                                                 130   3e-32   Zea mays [maize]
ref|XP_006853569.1|  hypothetical protein AMTR_s00032p00242890          131   3e-32   
ref|NP_001149357.1|  LOC100282981                                       130   3e-32   Zea mays [maize]
ref|XP_006646946.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    130   3e-32   
ref|NP_001046031.1|  Os02g0171100                                       130   4e-32   
gb|EMS57422.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic     130   4e-32   Triticum urartu
ref|XP_003570206.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    130   4e-32   Brachypodium distachyon [annual false brome]
gb|AIZ74327.1|  NAD+-dependent glyceraldehyde-3-phosphate dehydro...    130   4e-32   Pinus massoniana [Chinese red pine]
gb|AAD10215.1|  glyceraldehyde-3-phosphate dehydrogenase                130   4e-32   Pinus sylvestris [Scotch pine]
dbj|BAJ86344.1|  predicted protein                                      129   7e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAD10214.1|  glyceraldehyde-3-phosphate dehydrogenase                129   1e-31   Pinus sylvestris [Scotch pine]
gb|EMS45411.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic     129   1e-31   Triticum urartu
ref|XP_004951761.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    129   2e-31   Setaria italica
gb|AIX97549.1|  glyceraldehyde-3-phosphate dehydrogenase                128   2e-31   Myrciaria dubia [camu-camu]
emb|CAA04942.1|  NAD-dependent glyceraldehyde-3-phosphate dehydro...    127   3e-31   Pinus sylvestris [Scotch pine]
gb|EAZ37938.1|  hypothetical protein OsJ_22288                          128   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058309.1|  Os06g0666600                                       128   3e-31   
ref|XP_010476736.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010459169.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010459168.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    122   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002513328.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    122   5e-29   Ricinus communis
ref|XP_006422270.1|  hypothetical protein CICLE_v10005029mg             120   1e-28   Citrus clementina [clementine]
emb|CAA06030.1|  glyeraldehyde-3-phosphate dehydrogenase                119   2e-28   Marsilea quadrifolia
gb|KDO61570.1|  hypothetical protein CISIN_1g014424mg                   119   3e-28   Citrus sinensis [apfelsine]
gb|KDO61569.1|  hypothetical protein CISIN_1g014424mg                   119   4e-28   Citrus sinensis [apfelsine]
gb|KDO61568.1|  hypothetical protein CISIN_1g014424mg                   119   5e-28   Citrus sinensis [apfelsine]
ref|XP_006854435.1|  hypothetical protein AMTR_s00039p00217390          117   3e-27   Amborella trichopoda
ref|XP_006656350.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    116   5e-27   Oryza brachyantha
gb|EMT03645.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic     116   6e-27   
ref|XP_008666027.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    114   6e-27   
gb|KJB81433.1|  hypothetical protein B456_013G145400                    114   3e-26   Gossypium raimondii
gb|AAD34682.1|AC006341_10  Similar to gb|AJ001706 NAD-dependent g...    112   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002982970.1|  hypothetical protein SELMODRAFT_234134             111   2e-25   
emb|CAC80386.1|  glyceraldehyde-3-phosphate dehydrogenase               111   2e-25   Marchantia polymorpha
ref|XP_002965494.1|  hypothetical protein SELMODRAFT_439282             111   5e-25   
ref|XP_010023558.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    106   8e-25   
gb|KCW59857.1|  hypothetical protein EUGRSUZ_H02597                     107   1e-24   Eucalyptus grandis [rose gum]
ref|XP_001781685.1|  predicted protein                                  109   2e-24   
gb|KCW59862.1|  hypothetical protein EUGRSUZ_H02597                     105   2e-24   Eucalyptus grandis [rose gum]
ref|XP_001781691.1|  predicted protein                                  108   3e-24   
emb|CAC80387.1|  glyceraldehyde-3-phosphate dehydrogenase               108   4e-24   Physcomitrella patens
gb|ABK00055.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    107   9e-24   Marchantia polymorpha
gb|EMT07642.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic     102   2e-23   
emb|CAN71286.1|  hypothetical protein VITISV_007003                     100   2e-21   Vitis vinifera
ref|XP_008809607.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.0    4e-21   Phoenix dactylifera
emb|CAC80385.1|  glyceraldehyde-3-phosphate dehydrogenase             97.4    1e-20   Marchantia polymorpha
gb|ABK00054.1|  cytosolic glyceraldehyde-3-phosphate dehydrogenase    97.4    1e-20   Marchantia polymorpha
gb|ABK24012.1|  unknown                                               97.1    2e-20   Picea sitchensis
ref|XP_002511238.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  91.3    3e-20   
ref|XP_007137947.1|  hypothetical protein PHAVU_009G1685000g          92.0    4e-20   Phaseolus vulgaris [French bean]
sp|P34924.1|G3PC_PINSY  RecName: Full=Glyceraldehyde-3-phosphate ...  95.9    4e-20   Pinus sylvestris [Scotch pine]
gb|ERG80260.1|  glyceraldehyde-3-phosphate dehydrogenase              95.9    6e-20   
ref|NP_001291329.1|  glyceraldehyde-3-phosphate dehydrogenase         95.5    6e-20   Sesamum indicum [beniseed]
emb|CBY35474.1|  unnamed protein product                              95.5    7e-20   Oikopleura dioica
sp|Q39769.1|G3PC_GINBI  RecName: Full=Glyceraldehyde-3-phosphate ...  95.5    8e-20   Ginkgo biloba [ginkgo]
gb|AAC08320.1|  glyceraldehyde 3-phosphate dehydrogenase              95.1    8e-20   Ogataea angusta
ref|WP_043641218.1|  glyceraldehyde-3-phosphate dehydrogenase         95.1    8e-20   
ref|XP_003147614.1|  glyceraldehyde-3-phosphate dehydrogenase         92.8    8e-20   
ref|XP_003142010.1|  glyceraldehyde-3-phosphate dehydrogenase         93.2    1e-19   
gb|KEH25421.1|  glyceraldehyde-3-phosphate dehydrogenase              94.7    1e-19   Medicago truncatula
gb|AIE44418.1|  glyceraldehyde 3-phosphate dehydrogenase              94.7    1e-19   Fasciola hepatica
ref|XP_001526454.1|  glyceraldehyde-3-phosphate dehydrogenase         94.7    1e-19   Lodderomyces elongisporus NRRL YB-4239
ref|XP_001752151.1|  predicted protein                                94.7    1e-19   
ref|XP_007137943.1|  hypothetical protein PHAVU_009G1684000g          92.4    1e-19   Phaseolus vulgaris [French bean]
ref|XP_006684692.1|  glyceraldehyde 3-phosphate dehydrogenase         94.4    1e-19   Yamadazyma tenuis ATCC 10573
gb|AHB86970.1|  glyceraldehyde 3-phosphate dehydrogenase              94.4    1e-19   Sedum alfredii
sp|P26521.1|G3PC_RANAC  RecName: Full=Glyceraldehyde-3-phosphate ...  94.4    1e-19   Ranunculus acris [cmmon buttercup]
gb|KCW83196.1|  hypothetical protein EUGRSUZ_B00144                   94.0    2e-19   Eucalyptus grandis [rose gum]
gb|KCW83197.1|  hypothetical protein EUGRSUZ_B00144                   94.0    2e-19   Eucalyptus grandis [rose gum]
ref|XP_004489569.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  94.4    2e-19   Cicer arietinum [garbanzo]
ref|XP_010026741.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  94.4    2e-19   Eucalyptus grandis [rose gum]
gb|KGK40669.1|  hypothetical protein JL09_g247                        94.0    2e-19   Pichia kudriavzevii
ref|XP_002419583.1|  glyceraldehyde-3-phosphate dehydrogenase, pu...  94.0    2e-19   Candida dubliniensis CD36
gb|EMG45427.1|  Glyceraldehyde-3-phosphate dehydrogenase              94.0    2e-19   Candida maltosa Xu316
gb|KHG15503.1|  Glyceraldehyde-3-phosphate dehydrogenase-2C cytos...  93.6    2e-19   Gossypium arboreum [tree cotton]
ref|XP_010025353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  94.0    2e-19   Eucalyptus grandis [rose gum]
ref|XP_005642719.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  94.4    2e-19   Coccomyxa subellipsoidea C-169
sp|Q9Y796.1|G3P_CRYCU  RecName: Full=Glyceraldehyde-3-phosphate d...  94.0    2e-19   Cutaneotrichosporon curvatus
sp|P48812.1|G3P_BRUMA  RecName: Full=Glyceraldehyde-3-phosphate d...  93.6    3e-19   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001899850.1|  Glyceraldehyde 3-phosphate dehydrogenase         93.6    3e-19   Brugia malayi [agent of lymphatic filariasis]
ref|NP_001275344.1|  glyceraldehyde-3-phosphate dehydrogenase         93.6    3e-19   Solanum tuberosum [potatoes]
ref|XP_010320554.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    3e-19   
gb|AAM92008.1|AF527779_1  glyceraldehyde 3-phosphate dehydrogenase    93.6    3e-19   Solanum tuberosum [potatoes]
ref|XP_001899849.1|  Glyceraldehyde 3-phosphate dehydrogenase         93.6    3e-19   Brugia malayi [agent of lymphatic filariasis]
pdb|4K9D|A  Chain A, X-ray Crystal Structure Of A Glyceraldehyde ...  93.6    3e-19   Brugia malayi [agent of lymphatic filariasis]
emb|CDK28313.1|  unnamed protein product                              93.6    3e-19   Kuraishia capsulata CBS 1993
gb|ACJ22876.1|  glyceraldehyde 3-phosphate dehydrogenase              93.6    3e-19   Candida tropicalis
ref|XP_011086733.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    3e-19   Sesamum indicum [beniseed]
gb|AGV54709.1|  glyceraldehyde-3-dehydrogenase C subunit              93.6    3e-19   Phaseolus vulgaris [French bean]
gb|KHJ86520.1|  putative glyceraldehyde-3-phosphate dehydrogenase...  92.4    3e-19   Oesophagostomum dentatum [nodule worm]
ref|XP_002263145.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    3e-19   Vitis vinifera
emb|CDP97885.1|  Protein Bm5699, isoform a                            93.6    3e-19   Brugia malayi [agent of lymphatic filariasis]
gb|ADR72970.1|  glyceraldehyde-3-phosphate dehydrogenase              93.6    3e-19   Candida tropicalis
gb|AGV54256.1|  glyceraldehyde-3-phosphate dehydrogenase              93.6    3e-19   Phaseolus vulgaris [French bean]
ref|XP_010242342.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    3e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010248871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.2    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010248875.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.2    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_006347401.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.2    4e-19   Solanum tuberosum [potatoes]
gb|EJD75049.1|  glyceraldehyde-3-phosphate dehydrogenase              93.2    4e-19   Loa loa
gb|AAF21599.1|AF006483_1  glyceraldehyde-3-phosphate dehydrogenase    93.2    4e-19   Phaffia rhodozyma
gb|AIM55468.1|  glyceraldehyde-3-phosphate dehydrogenase              89.4    4e-19   Cryptococcus gattii VGI
gb|ACV69976.1|  NAD-dependent glyceraldehyde 3-P dehydrogenase        93.2    4e-19   Solanum chacoense
ref|XP_004241503.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.2    4e-19   Solanum lycopersicum
dbj|BAE93607.1|  glyceraldehyde-3-phosphate dehydrogenase             93.2    4e-19   Ogataea minuta
ref|XP_002131224.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.2    4e-19   Ciona intestinalis [sea vase]
gb|EJD75047.1|  glyceraldehyde-3-phosphate dehydrogenase              93.2    4e-19   Loa loa
ref|XP_002508643.1|  glyceraldehyde-3-phosphate dehydrogenase         93.6    4e-19   Micromonas commoda
ref|XP_009171410.1|  hypothetical protein T265_07589                  93.2    5e-19   Opisthorchis viverrini [Southeast Asian liver fluke]
gb|AFJ04516.1|  glyceraldehyde-3-phosphate dehydrogenase              92.8    5e-19   Vernicia fordii [tung oil tree]
sp|O13507.1|G3P_PHARH  RecName: Full=Glyceraldehyde-3-phosphate d...  93.2    5e-19   Xanthophyllomyces dendrorhous
ref|XP_010033372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.2    5e-19   Eucalyptus grandis [rose gum]
ref|XP_001783115.1|  predicted protein                                93.2    5e-19   
ref|NP_001237544.1|  glyceraldehyde-3-dehydrogenase C subunit         92.8    5e-19   
gb|EYU22565.1|  hypothetical protein MIMGU_mgv1a009585mg              92.8    5e-19   Erythranthe guttata [common monkey flower]
gb|AHA84255.1|  glyceraldehyde-3-dehydrogenase C subunit              92.8    5e-19   Phaseolus vulgaris [French bean]
ref|NP_001236129.1|  glyceraldehyde-3-phosphate dehydrogenase         92.8    5e-19   Glycine max [soybeans]
gb|KHN31915.1|  Glyceraldehyde-3-phosphate dehydrogenase              92.8    5e-19   Glycine soja [wild soybean]
ref|XP_003523131.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.8    5e-19   
ref|XP_006578692.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.8    5e-19   
ref|XP_003526975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.8    5e-19   Glycine max [soybeans]
gb|KDO36893.1|  hypothetical protein CISIN_1g024629mg                 90.9    5e-19   Citrus sinensis [apfelsine]
gb|ERG79426.1|  glyceraldehyde-3-phosphate dehydrogenase              92.8    5e-19   
gb|AFK45399.1|  unknown                                               92.8    6e-19   Lotus japonicus
ref|XP_006219891.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.8    6e-19   Vicugna pacos
gb|KDO36874.1|  hypothetical protein CISIN_1g024565mg                 90.9    6e-19   Citrus sinensis [apfelsine]
gb|ABR24229.1|  gyceraldehyde-3-phosphate dehydrogenase               92.8    6e-19   Taenia solium [pig tapeworm]
ref|XP_007509837.1|  glyceraldehyde-3-phosphate dehydrogenase         93.6    6e-19   Bathycoccus prasinos
gb|KDO36891.1|  hypothetical protein CISIN_1g024629mg                 91.7    7e-19   Citrus sinensis [apfelsine]
ref|XP_003059267.1|  hypothetical protein MICPUCDRAFT_27359           93.2    7e-19   Micromonas pusilla CCMP1545
gb|AGL39758.1|  glyceraldehyde-3-phosphate dehydrogenase              92.4    7e-19   Ogataea thermomethanolica
gb|KDP30962.1|  hypothetical protein JCGZ_11338                       92.4    7e-19   Jatropha curcas
ref|XP_002975979.1|  hypothetical protein SELMODRAFT_175430           92.4    7e-19   Selaginella moellendorffii
dbj|GAA28380.1|  glyceraldehyde 3-phosphate dehydrogenase             92.4    8e-19   Clonorchis sinensis [oriental liver fluke]
ref|XP_002265988.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.4    8e-19   Vitis vinifera
gb|KDO36890.1|  hypothetical protein CISIN_1g024629mg                 91.3    8e-19   Citrus sinensis [apfelsine]
gb|AIT71762.1|  glyceraldehyde 4 phosphate dehydrogenase              92.4    8e-19   Anisakis simplex
dbj|BAO45907.1|  glyceraldehyde-3 phosphate dehydrogenase             92.4    8e-19   Acacia mangium
ref|XP_006438115.1|  hypothetical protein CICLE_v10032014mg           91.7    9e-19   
gb|KIZ01541.1|  glyceraldehyde 3-phosphatedehydrogenase               92.0    9e-19   Monoraphidium neglectum
gb|AIC84504.1|  glyceraldehyde-3-phosphate dehydrogenase              88.2    9e-19   Cryptococcus gattii VGI
dbj|BAB68543.1|  glyceraldehyde-3-phosphate dehydrogenase             92.0    1e-18   Ascaris suum
ref|XP_002318114.1|  glyceraldehyde-3-phosphate dehydrogenase fam...  92.0    1e-18   Populus trichocarpa [western balsam poplar]
gb|KDO36892.1|  hypothetical protein CISIN_1g024629mg                 91.3    1e-18   Citrus sinensis [apfelsine]
gb|ESZ92004.1|  glyceraldehyde 3-phosphate dehydrogenase              92.0    1e-18   Sclerotinia borealis F-4128
gb|KDO82023.1|  hypothetical protein CISIN_1g019445mg                 91.7    1e-18   Citrus sinensis [apfelsine]
ref|XP_002968506.1|  hypothetical protein SELMODRAFT_169833           92.0    1e-18   Selaginella moellendorffii
ref|NP_001275277.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...  92.0    1e-18   Solanum tuberosum [potatoes]
gb|AIC84477.1|  glyceraldehyde-3-phosphate dehydrogenase              88.2    1e-18   Cryptococcus gattii VGI
sp|O01360.1|G3P_ONCVO  RecName: Full=Glyceraldehyde-3-phosphate d...  92.0    1e-18   Onchocerca volvulus
gb|AEK51008.1|  glyceraldehyde-3-phosphate dehydrogenase              92.0    1e-18   Rhizoctonia solani
gb|KDO36888.1|  hypothetical protein CISIN_1g024629mg                 91.3    1e-18   Citrus sinensis [apfelsine]
dbj|BAJ10716.1|  glyceraldehyde-3-phosphate dehydrogenase             92.0    1e-18   Cladopus doianus
ref|XP_010494704.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.0    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006438114.1|  hypothetical protein CICLE_v10032014mg           92.0    1e-18   Citrus clementina [clementine]
gb|KDO36873.1|  hypothetical protein CISIN_1g024565mg                 91.3    1e-18   Citrus sinensis [apfelsine]
ref|XP_002835820.1|  hypothetical protein                             90.1    1e-18   Tuber melanosporum Mel28
gb|ACX49537.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    1e-18   Cucumis sativus [cucumbers]
sp|Q42671.1|G3PC_CRAPL  RecName: Full=Glyceraldehyde-3-phosphate ...  91.7    1e-18   Craterostigma plantagineum
gb|KDO82024.1|  hypothetical protein CISIN_1g019445mg                 91.3    1e-18   Citrus sinensis [apfelsine]
ref|XP_010556366.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.7    1e-18   Tarenaya hassleriana [spider flower]
dbj|BAJ10715.1|  glyceraldehyde-3-phosphate dehydrogenase             91.7    1e-18   Hydrobryum japonicum
gb|AGY14240.1|  glyceraldehyde 3-phosphate dehydrogenase              91.7    1e-18   Eschenbachia blinii
gb|AAB52599.1|  glyceraldehyde-3-phosphate dehydrogenase              91.7    1e-18   Onchocerca volvulus
dbj|BAJ17660.1|  glyceraldehyde 3-phosphate dehydrogenase             91.7    1e-18   Gynura bicolor
gb|EPS63876.1|  hypothetical protein M569_10906                       90.1    1e-18   Genlisea aurea
gb|AIL56405.1|  glyceraldehyde-3-phosphate dehydrogenase              91.7    1e-18   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABV02033.1|  glyceraldehyde 3-phosphate dehydrogenase              91.7    1e-18   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_011073006.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.7    1e-18   Sesamum indicum [beniseed]
gb|AGX26868.1|  glyceraldehyde-3-phosphate dehydrogenase              91.3    1e-18   Saussurea involucrata
emb|CBY18513.1|  unnamed protein product                              93.2    1e-18   Oikopleura dioica
ref|XP_004138468.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.3    1e-18   
ref|XP_006476982.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.7    1e-18   Citrus sinensis [apfelsine]
ref|XP_009606469.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.7    1e-18   Nicotiana tomentosiformis
ref|XP_009597424.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.7    2e-18   Nicotiana tomentosiformis
ref|XP_009787576.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.7    2e-18   Nicotiana sylvestris
gb|KJB76420.1|  hypothetical protein B456_012G089500                  91.3    2e-18   Gossypium raimondii
gb|AFL46382.1|  glyceraldehyde 3 phosphate dehydrogenase              91.7    2e-18   Dirofilaria immitis [canine heartworm nematode]
ref|XP_006440049.1|  hypothetical protein CICLE_v10021037mg           91.7    2e-18   Citrus clementina [clementine]
gb|EIF47503.1|  glyceraldehyde-3-phosphate dehydrogenase              91.7    2e-18   Brettanomyces bruxellensis AWRI1499
ref|XP_009792011.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.7    2e-18   Nicotiana sylvestris
ref|XP_001386460.1|  Glyceraldehyde-3-phosphate dehydrogenase         91.3    2e-18   Scheffersomyces stipitis CBS 6054
emb|CDY29987.1|  BnaC01g40210D                                        91.7    2e-18   Brassica napus [oilseed rape]
gb|KEH31729.1|  glyceraldehyde-3-phosphate dehydrogenase              90.9    2e-18   Medicago truncatula
ref|XP_004179108.1|  hypothetical protein TBLA_0B07730                91.3    2e-18   Tetrapisispora blattae CBS 6284
gb|KJB40008.1|  hypothetical protein B456_007G041900                  91.3    2e-18   Gossypium raimondii
emb|CAB39974.1|  glyceraldehyde-3-phosphate dehydrogenase             91.3    2e-18   
ref|XP_007151567.1|  hypothetical protein PHAVU_004G057700g           91.3    2e-18   
gb|AGW24628.1|  glyceraldehyde 3-phosphate dehydrogenase              91.3    2e-18   
ref|XP_007151566.1|  hypothetical protein PHAVU_004G057600g           91.3    2e-18   
ref|XP_009616068.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.3    2e-18   
gb|KHN89029.1|  Glyceraldehyde-3-phosphate dehydrogenase 3            91.3    2e-18   
emb|CBX89318.1|  cytosolic glyceraldehyde 3-phosphate dehydrogenase   90.9    2e-18   
ref|XP_004138467.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.3    2e-18   
gb|ACJ11728.1|  glyceraldehyde-3-phosphate dehydrogenase              91.3    2e-18   
emb|CBX89319.1|  cytosolic glyceraldehyde 3-phosphate dehydrogenase   90.9    2e-18   
sp|P26518.1|G3PC_MAGLI  RecName: Full=Glyceraldehyde-3-phosphate ...  91.3    2e-18   
ref|XP_007037904.1|  Glyceraldehyde-3-phosphate dehydrogenase C s...  91.3    2e-18   
ref|XP_003524483.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.3    2e-18   
emb|CDY21135.1|  BnaA01g33660D                                        91.3    2e-18   
ref|XP_009134752.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.9    2e-18   
ref|XP_008341346.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.3    2e-18   
ref|XP_006374556.1|  hypothetical protein POPTR_0015s10330g           91.3    2e-18   
ref|XP_004515830.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.3    2e-18   
ref|XP_011097322.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.3    2e-18   
sp|Q96US8.1|G3P_SCLSC  RecName: Full=Glyceraldehyde-3-phosphate d...  91.3    2e-18   
emb|CBX89320.1|  cytosolic glyceraldehyde 3-phosphate dehydrogenase   90.5    2e-18   
emb|CBI14856.3|  unnamed protein product                              91.3    2e-18   
gb|ETE65633.1|  Glyceraldehyde-3-phosphate dehydrogenase              90.9    2e-18   
ref|XP_010528059.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  91.3    2e-18   
ref|XP_002321679.1|  glyceraldehyde-3-phosphate dehydrogenase fam...  91.3    2e-18   
ref|XP_007376574.1|  glyceraldehyde-3-phosphate dehydrogenase         91.3    2e-18   
gb|ABK96222.1|  unknown                                               91.3    2e-18   
emb|CBX89317.1|  cytosolic glyceraldehyde 3-phosphate dehydrogenase   90.5    2e-18   
sp|P26520.1|G3PC_PETHY  RecName: Full=Glyceraldehyde-3-phosphate ...  91.3    2e-18   
sp|P49644.1|G3PC_CHLRE  RecName: Full=Glyceraldehyde-3-phosphate ...  91.3    2e-18   
gb|AAB59010.1|  glyceraldehyde-3-phosphate-dehydrogenase              91.3    2e-18   
gb|EYU23146.1|  hypothetical protein MIMGU_mgv1a009579mg              90.9    2e-18   
emb|CDS31614.1|  glyceraldehyde 3 phosphate dehydrogenase             90.9    2e-18   
gb|KHG04963.1|  Glyceraldehyde-3-phosphate dehydrogenase              90.9    2e-18   
gb|KJB76419.1|  hypothetical protein B456_012G089500                  90.9    2e-18   
ref|XP_010682871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.9    2e-18   
ref|XP_001382928.1|  Glyceraldehyde-3-phosphate dehydrogenase         90.9    2e-18   
ref|XP_001591173.1|  glyceraldehyde-3-phosphate dehydrogenase         90.9    2e-18   
emb|CDY42906.1|  BnaC05g47450D                                        91.3    2e-18   
ref|XP_001703199.1|  glyceraldehyde 3-phosphate dehydrogenase, do...  91.3    2e-18   
sp|P34922.1|G3PC_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...  90.9    2e-18   
ref|XP_009125005.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.9    2e-18   
ref|XP_009134751.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.9    2e-18   
ref|XP_004502328.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.9    2e-18   
ref|WP_001693358.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  90.9    2e-18   
emb|CAA42103.1|  glycolytic glyceraldehyde 3-phosphate dehydrogenase  90.9    2e-18   
ref|XP_004169444.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.9    2e-18   
sp|P25861.1|G3PC_ANTMA  RecName: Full=Glyceraldehyde-3-phosphate ...  90.9    3e-18   
ref|XP_008340167.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.9    3e-18   
gb|AAR84410.2|  glyceraldehyde 3-phosphate dehydrogenase              90.9    3e-18   
emb|CDY49358.1|  BnaA05g33200D                                        90.9    3e-18   
gb|AAC49800.1|  glyceraldehyde-3-phosphate dehydrogenase              90.9    3e-18   
ref|XP_009124017.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.9    3e-18   
ref|WP_001695069.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  90.9    3e-18   
gb|KIH59904.1|  glyceraldehyde-3-phosphate dehydrogenase, type I      90.9    3e-18   
gb|AAK15538.1|AF339927_1  glyceraldehyde-3-phosphate dehydrogenase    90.9    3e-18   
gb|KJB76417.1|  hypothetical protein B456_012G089500                  90.5    3e-18   
gb|ACJ11752.1|  glyceraldehyde-3-phosphate dehydrogenase C subunit    90.9    3e-18   
ref|XP_003608875.1|  Glyceraldehyde-3-phosphate dehydrogenase         90.9    3e-18   
dbj|BAA90773.1|  glyceraldehyde-3-phosphate dehydrogenase             90.9    3e-18   
emb|CDX74199.1|  BnaA03g28480D                                        90.9    3e-18   
gb|AIC33039.1|  glyceraldehyde-3-phosphate dehydrogenase              90.5    3e-18   
ref|NP_001289219.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...  90.9    3e-18   
emb|CDX92059.1|  BnaC03g33610D                                        90.9    3e-18   
ref|XP_001549547.1|  glyceraldehyde 3-phosphate dehydrogenase         90.9    3e-18   
gb|AEQ75490.1|  glyeraldehyde 3-phosphate dehydrogenase               90.5    3e-18   
ref|XP_008439417.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.5    3e-18   
gb|AIX10772.1|  glyceraldehyde-3-phosphate dehydrogenase              90.5    3e-18   
ref|XP_001834159.2|  glyceraldehyde-3-phosphate dehydrogenase         90.5    3e-18   
ref|XP_008379147.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.5    3e-18   
ref|NP_001267672.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...  90.5    3e-18   
gb|AIX10973.1|  glyceraldehyde-3-phosphate dehydrogenase              90.5    3e-18   
gb|AGV15451.1|  glyceraldehyde-3-phosphate dehydrogenase              90.5    3e-18   
ref|XP_001485646.1|  glyceraldehyde-3-phosphate dehydrogenase         90.5    3e-18   
emb|CAX80262.1|  glyceraldehyde 3-phosphate dehydrogenase             87.8    3e-18   
gb|KDP46338.1|  hypothetical protein JCGZ_10178                       90.5    4e-18   
gb|AAD29256.1|  glyceraldehyde-3-phosphate dehydrogenase              90.5    4e-18   
gb|AAB35209.1|  glyceraldehyde-3-phosphate dehydrogenase type 2       90.5    4e-18   
emb|CDP13300.1|  unnamed protein product                              90.5    4e-18   
sp|Q01077.2|G3P2_KLUMA  RecName: Full=Glyceraldehyde-3-phosphate ...  90.5    4e-18   
gb|AEK81537.1|  glyceraldehyde-3-phosphate dehydrogenase              90.5    4e-18   
sp|P84999.1|G3P3_KLUMA  RecName: Full=Glyceraldehyde-3-phosphate ...  90.5    4e-18   
ref|XP_571627.1|  glyceraldehyde-3-phosphate dehydrogenase            90.5    4e-18   
gb|AEB98919.1|  glyceraldehyde-3-phosphate dehydrogenase              90.5    4e-18   
emb|CCX06445.1|  Similar to Glyceraldehyde-3-phosphate dehydrogen...  90.5    4e-18   
ref|XP_002616258.1|  glyceraldehyde-3-phosphate dehydrogenase         90.1    4e-18   
ref|XP_005845921.1|  hypothetical protein CHLNCDRAFT_36383            90.1    4e-18   
ref|XP_003194693.1|  glyceraldehyde-3-phosphate dehydrogenase         90.1    4e-18   
emb|CCD47375.1|  hypothetical protein BofuT4_P005340.1                90.9    4e-18   
ref|XP_009586920.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.1    4e-18   
gb|AEO72143.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    4e-18   
ref|XP_008086288.1|  Glyceraldehyde-3-phosphate dehydrogenase-lik...  90.1    4e-18   
ref|XP_009789769.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.1    4e-18   
gb|KIR52536.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    4e-18   
gb|KIR45609.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    4e-18   
ref|XP_006848723.1|  hypothetical protein AMTR_s00177p00047570        89.4    4e-18   
gb|AAA32794.1|  cystolic glyceraldehyde-3-phosphate dehydrogenase     90.1    4e-18   
gb|AFR95986.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    4e-18   
gb|KIR84063.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    4e-18   
ref|XP_006484037.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.1    5e-18   
gb|AEK51003.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    5e-18   
ref|NP_001077530.1|  glyceraldehyde 3-phosphate dehydrogenase GAPC2   90.1    5e-18   
ref|XP_003115753.1|  hypothetical protein CRE_18669                   90.1    5e-18   
gb|ACN59434.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    5e-18   
ref|XP_010318401.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...  90.1    5e-18   
dbj|BAP90376.1|  glyceraldehyde-3 phosphate dehydrogenase             90.1    5e-18   
ref|XP_002511235.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  90.1    5e-18   
gb|KGB76028.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    5e-18   
dbj|BAH56909.1|  AT1G13440                                            90.1    5e-18   
gb|AJG44465.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    5e-18   
ref|NP_187062.1|  glyceraldehyde-3-phosphate dehydrogenase C subu...  90.1    5e-18   
gb|AFK36966.1|  unknown                                               88.6    5e-18   
gb|KHJ87118.1|  glyceraldehyde 3-phosphate dehydrogenase domain p...  89.7    5e-18   
gb|KIR28306.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    5e-18   
ref|XP_002892749.1|  GAPC-2                                           90.1    5e-18   
gb|AAT70328.1|  glyceraldehyde 3-phosphate dehydrogenase              89.7    5e-18   
ref|XP_009169164.1|  hypothetical protein T265_05806                  90.1    5e-18   
gb|KIV87253.1|  glyceraldehyde-3-phosphate dehydrogenase              90.1    5e-18   
ref|XP_011041572.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.1    5e-18   
gb|AAM65189.1|  glyceraldehyde-3-phosphate dehydrogenase C subuni...  90.1    5e-18   
ref|WP_014119526.1|  glyceraldehyde-3-phosphate dehydrogenase         90.1    5e-18   
ref|NP_172801.1|  glyceraldehyde 3-phosphate dehydrogenase GAPC2      90.1    5e-18   
ref|WP_040658858.1|  glyceraldehyde-3-phosphate dehydrogenase         89.7    6e-18   
emb|CAC80383.1|  glyceraldehyde-3-phosphate dehydrogenase             89.7    6e-18   
gb|AAK15537.1|AF339926_1  glyceraldehyde-3-phosphate dehydrogenase    90.1    6e-18   
dbj|BAI49952.1|  glyceraldehyde 3-phosphate dehydrogenase             89.7    6e-18   
gb|ACN59435.1|  glyceraldehyde-3-phosphate dehydrogenase              89.7    6e-18   
ref|XP_002312644.2|  glyceraldehyde 3-phosphate dehydrogenase fam...  89.7    6e-18   
ref|XP_009384257.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    6e-18   
ref|XP_006408221.1|  hypothetical protein EUTSA_v10021083mg           89.7    6e-18   
dbj|BAJ33926.1|  unnamed protein product                              89.7    6e-18   
ref|XP_451516.1|  hypothetical protein                                89.7    6e-18   
ref|XP_001382655.1|  glyceraldehyde-3-phosphate dehydrogenase         89.7    6e-18   
ref|XP_006355964.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    6e-18   
dbj|BAG61421.1|  unnamed protein product                              88.6    6e-18   
dbj|BAN89461.1|  glyceraldehyde-3-phosphate dehydrogenase C           89.7    6e-18   
emb|CAX80249.1|  glyceraldehyde 3-phosphate dehydrogenase             88.2    6e-18   
ref|XP_002551876.1|  KLTH0B01958p                                     89.7    6e-18   
ref|XP_006004763.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    6e-18   
ref|XP_006378281.1|  hypothetical protein POPTR_0010s06560g           89.4    6e-18   
ref|XP_001632905.1|  predicted protein                                89.7    6e-18   
ref|XP_002551368.1|  glyceraldehyde-3-phosphate dehydrogenase         89.7    6e-18   
ref|XP_007217558.1|  hypothetical protein PRUPE_ppa022368mg           89.7    6e-18   
ref|XP_004239353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    6e-18   
gb|KFD55150.1|  hypothetical protein M513_04068                       89.7    6e-18   
gb|EGT37203.1|  hypothetical protein CAEBREN_13477                    89.7    6e-18   
ref|XP_007044991.1|  Glyceraldehyde-3-phosphate dehydrogenase C2 ...  89.4    7e-18   
gb|AFD62268.1|  glyceraldehyde-3-phosphate dehydrogenase              89.7    7e-18   
gb|EEC73541.1|  hypothetical protein OsI_07948                        89.7    7e-18   
gb|AID52923.1|  cytosolic glyceraldehyde-3-phosphate dehydrogenase    89.7    7e-18   
gb|EGT35461.1|  hypothetical protein CAEBREN_22900                    89.7    7e-18   
ref|XP_008441373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    7e-18   
ref|XP_003115497.1|  hypothetical protein CRE_18959                   89.7    7e-18   
ref|XP_007044990.1|  Glyceraldehyde-3-phosphate dehydrogenase C2 ...  89.4    7e-18   
gb|KFK37847.1|  hypothetical protein AALP_AA3G036600                  89.7    7e-18   
gb|KJB30970.1|  hypothetical protein B456_005G172100                  89.7    7e-18   
ref|XP_007210523.1|  hypothetical protein PRUPE_ppa008250mg           89.7    7e-18   
emb|CDW59946.1|  glyceraldehyde 3 phosphate dehydrogenase             89.7    7e-18   
ref|XP_007222473.1|  hypothetical protein PRUPE_ppa008227mg           89.4    7e-18   
ref|NP_001125767.1|  glyceraldehyde-3-phosphate dehydrogenase         89.7    7e-18   
ref|XP_011045198.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    7e-18   
gb|ADU86892.1|  glyceraldehyde 3-phosphate dehydrogenase              89.7    7e-18   
ref|XP_009383337.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    7e-18   
gb|ACV86035.1|  glyceraldehyde-3-phosphate dehydrogenase 2            89.7    7e-18   
ref|XP_002298594.1|  glyceraldehyde 3-phosphate dehydrogenase fam...  89.7    7e-18   
gb|KIM71472.1|  hypothetical protein PILCRDRAFT_99460                 89.7    7e-18   
ref|XP_009245622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    7e-18   
gb|KIV98677.1|  glyceraldehyde-3-phosphate dehydrogenase              89.7    7e-18   
gb|ABE97135.1|  glyceraldehyde-3-phosphate dehydrogenase              85.1    7e-18   
gb|AEK51010.1|  glyceraldehyde-3-phosphate dehydrogenase              89.7    7e-18   
gb|KJB11619.1|  hypothetical protein B456_001G268500                  89.4    7e-18   
gb|AJR55726.1|  Tdh1p                                                 86.3    7e-18   
gb|ETN81063.1|  glyceraldehyde-3-phosphate dehydrogenase, type I      89.7    7e-18   
gb|AAB19105.1|  glyceraldehyde 3-phosphate dehydrogenase              85.1    7e-18   
ref|XP_010320598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.4    8e-18   
gb|AGK63074.1|  glyceraldehyde-3-phosphate dehydrogenase              89.4    8e-18   
gb|EJT46801.1|  glyceraldehyde-3-phosphate dehydrogenase              89.4    8e-18   
dbj|BAM34536.1|  glyceraldehyde 3-phosphate dehydrogenase             89.4    8e-18   
ref|XP_002315632.1|  glyceraldehyde 3-phosphate dehydrogenase fam...  89.4    8e-18   
ref|XP_460571.1|  DEHA2F04796p                                        89.4    8e-18   
gb|ABU87583.1|  glyceraldehyde-3-phosphate dehydrogenase              89.4    8e-18   
emb|CEF59358.1|  Glyceraldehyde-3-phosphate dehydrogenase,testis-...  89.4    8e-18   
gb|AGB67762.1|  glyceraldehyde-3-phosphate dehydrogenase              89.4    8e-18   
gb|ABA03227.1|  glyceraldehyde-3-phosphate dehydrogenase              89.4    8e-18   
dbj|BAE72987.1|  hypothetical protein                                 89.4    8e-18   
ref|XP_009001754.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  89.4    8e-18   
dbj|BAO40242.1|  glyceraldehyde-3-phosphate dehydrogenase 1           89.4    8e-18   
gb|EPS61158.1|  hypothetical protein M569_13641                       89.4    8e-18   
sp|P84998.1|G3P1_KLUMA  RecName: Full=Glyceraldehyde-3-phosphate ...  89.4    9e-18   
ref|XP_008389804.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.4    9e-18   
ref|XP_006686440.1|  hypothetical protein CANTEDRAFT_105339           89.4    9e-18   
gb|EYU34780.1|  hypothetical protein MIMGU_mgv1a009577mg              89.4    9e-18   
gb|KHJ79267.1|  glyceraldehyde 3-phosphate dehydrogenase domain p...  89.0    9e-18   
ref|XP_007044989.1|  Glyceraldehyde-3-phosphate dehydrogenase C2 ...  89.4    9e-18   
gb|ESA03415.1|  hypothetical protein GLOINDRAFT_334053                89.4    9e-18   
ref|XP_447731.1|  hypothetical protein                                89.4    9e-18   
gb|AJA37895.1|  glyceraldehyde-3-phosphate dehydrogenase              89.4    9e-18   
gb|AHW48354.1|  glyceraldehyde-3-phosphate dehydrogenase C2-like ...  89.4    9e-18   
ref|XP_010494703.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    9e-18   
dbj|BAN45710.1|  putative glycelaldehyde-3-phosphate dehydrogenase    89.4    9e-18   
ref|XP_007008285.1|  hypothetical protein TREMEDRAFT_46109            89.4    9e-18   
ref|XP_005569968.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.4    9e-18   
pdb|2I5P|O  Chain O, Crystal Structure Of Glyceraldehyde-3-Phosph...  89.4    9e-18   
ref|XP_009336547.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.4    9e-18   
gb|ADQ43814.1|  glyceraldehyde-3-phosphate dehydrogenase              89.4    9e-18   
gb|EDK40498.2|  glyceraldehyde-3-phosphate dehydrogenase              89.4    9e-18   
dbj|GAA97972.1|  hypothetical protein E5Q_04652                       91.7    9e-18   
gb|EXX77548.1|  glyceraldehyde-3-phosphate dehydrogenase (phospho...  89.4    9e-18   
ref|XP_003573324.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.4    9e-18   
ref|XP_010384249.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  89.4    9e-18   
gb|KHG23352.1|  Glyceraldehyde-3-phosphate dehydrogenase-2C cytos...  88.6    9e-18   
emb|CAX83053.1|  glyceraldehyde 3-phosphate dehydrogenase             88.2    9e-18   
ref|XP_004310041.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.4    1e-17   
emb|CCE42318.1|  hypothetical protein CPAR2_808670                    89.4    1e-17   
gb|KJB33927.1|  hypothetical protein B456_006G038900                  89.0    1e-17   
ref|XP_005569970.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.0    1e-17   
emb|CAX80239.1|  glyceraldehyde 3-phosphate dehydrogenase             88.6    1e-17   
ref|NP_001241184.1|  uncharacterized protein LOC100807342             89.4    1e-17   
emb|CAX72611.1|  glyceraldehyde 3-phosphate dehydrogenase             88.2    1e-17   
ref|XP_011049071.1|  glyceraldehyde-3-phosphate dehydrogenase Tdh1    89.4    1e-17   
ref|XP_006455566.1|  glyceraldehyde-3-phosphate dehydrogenase 2       89.4    1e-17   



>ref|XP_009766349.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Nicotiana sylvestris]
Length=419

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 111/141 (79%), Gaps = 5/141 (4%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  372
            M FSSLL+     P       SHR Q S AG +Q   SVK +SSIFG A+  +  SS+Q 
Sbjct  1    MAFSSLLK-----PTASFVRPSHRSQTSCAGLHQSANSVKLQSSIFGDAVSVMQCSSLQK  55

Query  373  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVND  552
            SG+ SIQPV+ATATELPPT+PKS+T+GKTR+GINGFGRIGRLVLR+AT RDDI+VVAVND
Sbjct  56   SGACSIQPVRATATELPPTVPKSRTSGKTRIGINGFGRIGRLVLRVATFRDDIEVVAVND  115

Query  553  PFIDANYMAYMFKYDSTHGVF  615
            PFIDA YMAYMFKYDSTHGV+
Sbjct  116  PFIDAKYMAYMFKYDSTHGVY  136



>ref|XP_009593112.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=418

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +1

Query  283  GFNQGCTSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTR  462
            G +Q   SVK +SSIFG A+  +  SS+Q SG+ SIQPV+ATATELPPT+PKS+T+GKTR
Sbjct  25   GLHQSANSVKLQSSIFGDAVSVMQCSSLQKSGAGSIQPVRATATELPPTVPKSRTSGKTR  84

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            +GINGFGRIGRLVLRIAT RDDI+VVAVNDPFIDA YMAYMFKYDSTHGV+
Sbjct  85   IGINGFGRIGRLVLRIATFRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGVY  135



>ref|XP_006352588.1| PREDICTED: glyceraldehyde 3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Solanum tuberosum]
Length=419

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 110/141 (78%), Gaps = 5/141 (4%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  372
            M FSSLL+     P       SHR QAS AG +    SVK +SS+FG A+  + SSS+Q 
Sbjct  1    MAFSSLLK-----PTASLVRPSHRSQASCAGLHHSSNSVKLQSSVFGDAVTILQSSSLQK  55

Query  373  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVND  552
            SG+ SIQP++ATATELPPT+P+SQT GKTR+GINGFGRIGRLVLRIAT RDDIDVVAVND
Sbjct  56   SGACSIQPIRATATELPPTVPRSQTGGKTRIGINGFGRIGRLVLRIATFRDDIDVVAVND  115

Query  553  PFIDANYMAYMFKYDSTHGVF  615
            PFIDA YMAYM KYDSTHGV+
Sbjct  116  PFIDAKYMAYMLKYDSTHGVY  136



>ref|XP_004248314.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Solanum lycopersicum]
Length=419

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 109/141 (77%), Gaps = 5/141 (4%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  372
            M FSSLL+     P       SHR Q S AG +    SVK +SSIFG A+  + SSS+Q 
Sbjct  1    MAFSSLLK-----PAASFVRPSHRSQVSCAGLHHSSNSVKLQSSIFGDAVTILQSSSLQK  55

Query  373  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVND  552
            SG+ SIQP++ATATELPPT+P+SQT GKTRVGINGFGRIGRLVLRIAT RDDI+VVAVND
Sbjct  56   SGACSIQPIRATATELPPTVPRSQTGGKTRVGINGFGRIGRLVLRIATFRDDIEVVAVND  115

Query  553  PFIDANYMAYMFKYDSTHGVF  615
            PFIDA YMAYM KYDSTHGV+
Sbjct  116  PFIDAKYMAYMLKYDSTHGVY  136



>emb|CAC80377.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
 emb|CAC88118.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=419

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 107/142 (75%), Gaps = 5/142 (4%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  372
            M FSSLL+     P       SHR QAS  G      SVK +S+IFG  +    SSS+Q 
Sbjct  1    MAFSSLLK-----PTASLVRPSHRSQASCVGLQHSSNSVKLQSAIFGDVVSIAQSSSLQN  55

Query  373  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVND  552
            SG+ SIQP++ATATELPPT+PKSQT GKTRVGINGFGRIGRLVLRIAT RDDI+VVAVND
Sbjct  56   SGACSIQPIRATATELPPTVPKSQTGGKTRVGINGFGRIGRLVLRIATFRDDIEVVAVND  115

Query  553  PFIDANYMAYMFKYDSTHGVFK  618
            PFIDA YMAYM KYDSTHGVF+
Sbjct  116  PFIDAKYMAYMLKYDSTHGVFR  137



>ref|XP_011095736.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Sesamum indicum]
Length=426

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 112/145 (77%), Gaps = 4/145 (3%)
 Frame = +1

Query  193  MGFSS-LLRSVPASPVLhasss--shrhqaslaGFNQGCTSVKFESSIFGSALPNVHsss  363
            M FSS LLRS P SPVL A +   S R + S  G NQ   +VKF+SS+FG ++    S  
Sbjct  1    MAFSSSLLRSAP-SPVLDADAFCPSDRLKVSCGGLNQNVNAVKFQSSVFGISITLDSSLP  59

Query  364  vqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVA  543
            +Q S +  IQP+KATATE+PPT+ KS+++GKT++GINGFGRIGRLVLRIAT R+DI+VVA
Sbjct  60   LQKSTTRCIQPIKATATEIPPTVQKSRSSGKTKIGINGFGRIGRLVLRIATFRNDIEVVA  119

Query  544  VNDPFIDANYMAYMFKYDSTHGVFK  618
            VNDPFIDA YMAYMFKYDSTHG +K
Sbjct  120  VNDPFIDAKYMAYMFKYDSTHGPYK  144



>ref|XP_002315071.2| hypothetical protein POPTR_0010s17930g [Populus trichocarpa]
 gb|ABK95756.1| unknown [Populus trichocarpa]
 gb|EEF01242.2| hypothetical protein POPTR_0010s17930g [Populus trichocarpa]
Length=422

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 103/141 (73%), Gaps = 2/141 (1%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  372
            M FS LLRS PA+P L  +S S    +    F     S     SIFG+++P   SSS Q 
Sbjct  1    MAFSCLLRSTPAAP-LVEASRSDFSPSPSDRFKVSSVSFNSLKSIFGTSIP-TGSSSSQT  58

Query  373  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVND  552
                SIQP+KATATE+PPT+ KS+  GKT++GINGFGRIGRLVLR+AT RDDIDVVAVND
Sbjct  59   CSGRSIQPIKATATEMPPTVLKSRADGKTKIGINGFGRIGRLVLRVATFRDDIDVVAVND  118

Query  553  PFIDANYMAYMFKYDSTHGVF  615
            PFIDANYMAYMFKYDSTHGVF
Sbjct  119  PFIDANYMAYMFKYDSTHGVF  139



>ref|XP_010276220.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Nelumbo nucifera]
Length=430

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 110/151 (73%), Gaps = 12/151 (8%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrh---------qaslaGFNQGCTSVKFESSIFGSALP  345
            M FS+L+RSV  +PV   S               Q S AG N+   S + ++S+FG+A+P
Sbjct  1    MAFSTLIRSV--TPVTQGSLCEVSQIDCRARAPGQVSCAGVNRNLNSARIQTSLFGTAVP  58

Query  346  NVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRD  525
               SSS+Q     SIQP++ATATE+PP I KS++ GKTR+GINGFGRIGRLVLR+A+SRD
Sbjct  59   G-ESSSLQKCSVRSIQPIRATATEIPPAIQKSRSGGKTRIGINGFGRIGRLVLRVASSRD  117

Query  526  DIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            DI+VVAVNDPFIDA YMAYMFKYDSTHGVFK
Sbjct  118  DIEVVAVNDPFIDAKYMAYMFKYDSTHGVFK  148



>ref|XP_011086336.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Sesamum indicum]
Length=425

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +1

Query  283  GFNQGCTSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTR  462
            G N    +VKF+SSIFG+ + +V SSS+Q S + SIQP+KATATE+PPT+ KS+++GKT+
Sbjct  33   GHNHNVNAVKFQSSIFGTNV-SVDSSSLQKSTARSIQPIKATATEIPPTVAKSRSSGKTK  91

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VGINGFGRIGRLVLRIAT RDDIDVVAVNDPF+DA YMAYMFKYDSTHG +K
Sbjct  92   VGINGFGRIGRLVLRIATFRDDIDVVAVNDPFVDAKYMAYMFKYDSTHGPYK  143



>ref|XP_002263263.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Vitis vinifera]
 emb|CBI24168.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 113/149 (76%), Gaps = 9/149 (6%)
 Frame = +1

Query  193  MGFSSLLRSVPAS------PVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNV-  351
            M   SL RS P++       V+ +S  S R + S  GFN    S+K +++IFG+  P + 
Sbjct  1    MALYSLFRSAPSAAAAAAATVVDSSRPSDRCKVSCIGFNSNADSLKVQTTIFGT--PCIG  58

Query  352  HsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDI  531
            +SSS+Q   + S+QP+KATATELPPT+ KS ++G+T++GINGFGRIGRLVLR+ATSRDDI
Sbjct  59   NSSSLQKCSARSLQPIKATATELPPTVQKSWSSGQTKIGINGFGRIGRLVLRVATSRDDI  118

Query  532  DVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            DVVAVNDPF+DA YMAYMFKYDSTHGVFK
Sbjct  119  DVVAVNDPFVDAKYMAYMFKYDSTHGVFK  147



>gb|EYU27576.1| hypothetical protein MIMGU_mgv1a020814mg, partial [Erythranthe 
guttata]
Length=392

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 106/143 (74%), Gaps = 4/143 (3%)
 Frame = +1

Query  193  MGFSS-LLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvq  369
            M FSS L RS P SPV   +           G N    +VKF+SSIFG+ + +V SSS+Q
Sbjct  1    MAFSSSLTRSAP-SPV-QDTFRFTDRSKVSCGLNSNANAVKFQSSIFGTNV-SVDSSSLQ  57

Query  370  gsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVN  549
                 SI+P++ATATE+PPT+ KS ++GKT++GINGFGRIGRLVLRIAT RDDIDVVAVN
Sbjct  58   KVMCRSIKPIRATATEIPPTVTKSHSSGKTKIGINGFGRIGRLVLRIATFRDDIDVVAVN  117

Query  550  DPFIDANYMAYMFKYDSTHGVFK  618
            DPFIDA YMAYMFKYDSTHG +K
Sbjct  118  DPFIDATYMAYMFKYDSTHGPYK  140



>ref|XP_011013977.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Populus euphratica]
Length=422

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 103/141 (73%), Gaps = 2/141 (1%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  372
            M FS LLRS PA+P L  +S S    +    F     S     SIFG+++P   SSS+Q 
Sbjct  1    MAFSCLLRSTPAAP-LVEASRSDFSPSPSDRFKVSSVSFNSLKSIFGTSIP-TGSSSLQT  58

Query  373  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVND  552
                SIQP+KATA E+PPT+ KS+  GKT++GINGFGRIGRLVLR+AT RDDIDVVAVND
Sbjct  59   CSGRSIQPIKATAIEMPPTVLKSRADGKTKIGINGFGRIGRLVLRVATFRDDIDVVAVND  118

Query  553  PFIDANYMAYMFKYDSTHGVF  615
            PFIDANYMAYMFKYDSTHGVF
Sbjct  119  PFIDANYMAYMFKYDSTHGVF  139



>ref|XP_008226146.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Prunus mume]
Length=428

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 112/147 (76%), Gaps = 7/147 (5%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLha------sssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M  SSLLRS  ++P++ A      +SSS   + S  GF +     K +SSIFG+++P+  
Sbjct  1    MAASSLLRSTASAPLIEALRAELAASSSASFKVSSVGFGRNLNCPKVQSSIFGTSIPS-R  59

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            SSS+Q   + S+QP+KATATELPPTI +S + GKT+VGINGFGRIGRLVLR+ATSRDD++
Sbjct  60   SSSLQICSARSVQPIKATATELPPTIQRSGSGGKTKVGINGFGRIGRLVLRVATSRDDME  119

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVF  615
            VVAVNDP +DA YMAYMFKYDSTHGVF
Sbjct  120  VVAVNDPLVDAKYMAYMFKYDSTHGVF  146



>ref|XP_007214718.1| hypothetical protein PRUPE_ppa006087mg [Prunus persica]
 gb|EMJ15917.1| hypothetical protein PRUPE_ppa006087mg [Prunus persica]
Length=428

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 110/147 (75%), Gaps = 7/147 (5%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqasl------aGFNQGCTSVKFESSIFGSALPNVH  354
            M  SSLLRS  ++P++ AS +     +S        GF +     K +SSIFG+++P+  
Sbjct  1    MAASSLLRSTASAPLIEASRAELAASSSASFKVSSVGFGRNLNCPKVQSSIFGTSIPS-G  59

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            SSS+Q   + S+QP+KATATELPPTI +S + GKT+VGINGFGRIGRLVLR+ATSRDDI+
Sbjct  60   SSSLQICSARSVQPIKATATELPPTIQRSGSGGKTKVGINGFGRIGRLVLRVATSRDDIE  119

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVF  615
            VVAVNDP +DA YMAYMFKYDSTHGVF
Sbjct  120  VVAVNDPLVDAKYMAYMFKYDSTHGVF  146



>ref|XP_002312235.1| glyceraldehyde 3-phosphate dehydrogenase 1 family protein [Populus 
trichocarpa]
 gb|EEE89602.1| glyceraldehyde 3-phosphate dehydrogenase 1 family protein [Populus 
trichocarpa]
Length=422

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 109/143 (76%), Gaps = 6/143 (4%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESS--IFGSALPNVHsssv  366
            M FS+LLRS PA+P++ AS S      S   F    +S++F SS  IFG+++P   SSS+
Sbjct  1    MAFSTLLRSTPAAPLIEASRSDFSPSPSDR-FE--VSSIRFNSSKSIFGASVP-TGSSSL  56

Query  367  qgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAV  546
                  SIQP+KATATE+PPT+ +S+  GKT++GINGFGRIGRLVLR+AT RDDIDVVAV
Sbjct  57   HTCSGRSIQPIKATATEMPPTVLRSRADGKTKIGINGFGRIGRLVLRVATFRDDIDVVAV  116

Query  547  NDPFIDANYMAYMFKYDSTHGVF  615
            NDPFIDA YMAYMF+YDSTHGVF
Sbjct  117  NDPFIDAEYMAYMFRYDSTHGVF  139



>ref|XP_011016312.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Populus euphratica]
Length=422

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 108/143 (76%), Gaps = 6/143 (4%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESS--IFGSALPNVHsssv  366
            M FS+LLRS PA+P++ A  S      S   F    +S++F SS  IFG+++P   SSS+
Sbjct  1    MAFSTLLRSTPAAPLIEACRSDFSPSPSDR-FE--VSSIRFNSSKSIFGASVP-TGSSSL  56

Query  367  qgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAV  546
                  SIQP+KATATE+PPT+ +S+  GKT++GINGFGRIGRLVLR+AT RDDIDVVAV
Sbjct  57   HKCSGRSIQPIKATATEMPPTVLRSRADGKTKIGINGFGRIGRLVLRVATFRDDIDVVAV  116

Query  547  NDPFIDANYMAYMFKYDSTHGVF  615
            NDPFIDA YMAYMF+YDSTHGVF
Sbjct  117  NDPFIDAEYMAYMFRYDSTHGVF  139



>ref|XP_007022675.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
3, partial [Theobroma cacao]
 gb|EOY14200.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
3, partial [Theobroma cacao]
Length=350

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +1

Query  322  SIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLV  501
            SIFG+A+    SSS++   S SIQP+KATATE+PPT+PKS+++GKT+VGINGFGRIGRLV
Sbjct  1    SIFGAAVSTGSSSSLRKCNSRSIQPIKATATEIPPTVPKSRSSGKTKVGINGFGRIGRLV  60

Query  502  LRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            LR+AT+RDDIDVVAVNDPF+DA YMAYMFKYDSTHG FK
Sbjct  61   LRVATARDDIDVVAVNDPFVDAKYMAYMFKYDSTHGNFK  99



>ref|XP_004139839.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cucumis sativus]
 ref|XP_004159163.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cucumis sativus]
 gb|KGN44292.1| hypothetical protein Csa_7G239050 [Cucumis sativus]
Length=422

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +1

Query  304  SVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  483
            S+KF+SSIFG+ + +  SSS+Q   S +IQP+KATATELPPT+ KS++ GKT+VGINGFG
Sbjct  37   SLKFQSSIFGAQVSS-GSSSLQLRRSHNIQPIKATATELPPTVQKSRSGGKTKVGINGFG  95

Query  484  RIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            RIGRLVLRIATSRDDIDVVAVNDPF+DA YMAYMFK+DSTHG FK
Sbjct  96   RIGRLVLRIATSRDDIDVVAVNDPFVDAKYMAYMFKFDSTHGNFK  140



>gb|EYU33796.1| hypothetical protein MIMGU_mgv1a006939mg [Erythranthe guttata]
Length=425

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 111/145 (77%), Gaps = 5/145 (3%)
 Frame = +1

Query  193  MGFSS-LLRSVPASPVLhass--sshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsss  363
            M FSS +LRS P SPV+ A +   S   + S    N    S+KF+SSIFG+ +   +SSS
Sbjct  1    MAFSSSILRSAP-SPVVDADAFRHSDISKVSCRHLNHNANSMKFQSSIFGTNIL-AYSSS  58

Query  364  vqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVA  543
            ++   + S+QP++ATATE+P T+PKS+ +GKT++GINGFGRIGRLVLRIAT RDDI+VVA
Sbjct  59   LEKVTARSVQPIRATATEIPQTLPKSRGSGKTKIGINGFGRIGRLVLRIATFRDDIEVVA  118

Query  544  VNDPFIDANYMAYMFKYDSTHGVFK  618
            VNDPFIDA YMAYMFKYDSTHG +K
Sbjct  119  VNDPFIDAKYMAYMFKYDSTHGPYK  143



>ref|XP_010941678.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Elaeis guineensis]
Length=429

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  301  TSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGF  480
            +S +  S IFGS L +V SS  Q   + SIQP+KATATE PP +P+S   GKT+VGINGF
Sbjct  42   SSAQICSGIFGSCLSSVESSLSQKPSARSIQPIKATATEAPPVVPRSSAGGKTKVGINGF  101

Query  481  GRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GRIGRLVLRIAT+RDDI+VVA+NDPFIDA YMAYMFKYDSTHG+FK
Sbjct  102  GRIGRLVLRIATTRDDIEVVALNDPFIDAKYMAYMFKYDSTHGIFK  147



>ref|XP_010095945.1| Glyceraldehyde-3-phosphate dehydrogenase [Morus notabilis]
 gb|EXB62638.1| Glyceraldehyde-3-phosphate dehydrogenase [Morus notabilis]
Length=440

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 107/162 (66%), Gaps = 25/162 (15%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasss-----------shrhqaslaGFNQGCTSVKFESSIFGSA  339
            M FSSLLRS   + ++ AS +             +   S  GF +     K +SS+FG+A
Sbjct  1    MAFSSLLRSTTGTALIEASRADFSSSPSSSNNPPKVSTSCIGFTR-----KTQSSMFGTA  55

Query  340  LPNVHsssvqgsg---------sssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIG  492
            + +  S++              +  IQP+KATATELPPT+PKSQ  GKT+VGINGFGRIG
Sbjct  56   VTSGSSATQLSVAIFLNPLRCNARKIQPIKATATELPPTVPKSQKGGKTKVGINGFGRIG  115

Query  493  RLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            RLVLR+A SRDDIDVVAVNDPFIDA YMAYMFKYDSTHG+FK
Sbjct  116  RLVLRVAASRDDIDVVAVNDPFIDAKYMAYMFKYDSTHGLFK  157



>ref|XP_010914235.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Elaeis guineensis]
Length=429

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 105/149 (70%), Gaps = 9/149 (6%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasss---shrhqaslaGFNQGCT----SVKFESSIFGSALPNV  351
            M FS+L+RS  A+P++  S     S     +   F   C     S +  SSIFG AL + 
Sbjct  1    MAFSTLVRS--ATPLIGGSRGCFPSDSGAQARESFKISCVRSSISAQIRSSIFGLALSSA  58

Query  352  HsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDI  531
             SS  Q   + SIQP+KATATE PP +P+S T GKT+VGINGFGRIGRLVLR+ATSRDDI
Sbjct  59   ESSLSQKPSARSIQPIKATATEAPPVVPRSSTGGKTKVGINGFGRIGRLVLRMATSRDDI  118

Query  532  DVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +VVAVNDPFIDA YMAYMFKYDSTHG+FK
Sbjct  119  EVVAVNDPFIDAKYMAYMFKYDSTHGIFK  147



>ref|XP_008383156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Malus domestica]
Length=427

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 109/147 (74%), Gaps = 7/147 (5%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqasl------aGFNQGCTSVKFESSIFGSALPNVH  354
            M  SSLLRS  ++P++ AS +     AS        GF++     K +SSIFG+++P+  
Sbjct  1    MAASSLLRSTVSAPLIEASRADLAASASASFKVSSVGFSRNLNCPKVQSSIFGTSIPS-G  59

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
             SS+Q   + S+QP+KATATELPPT+ KS + GKT++GINGFGRIGRLVLRIAT+RDDI+
Sbjct  60   LSSLQICSARSVQPIKATATELPPTVQKSGSGGKTKIGINGFGRIGRLVLRIATTRDDIE  119

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVF  615
            VVAVNDP +D  YMAYMFKYDSTHG+F
Sbjct  120  VVAVNDPLVDPKYMAYMFKYDSTHGIF  146



>ref|XP_009350183.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=427

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 112/147 (76%), Gaps = 7/147 (5%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLha------sssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M  SSLLRS  ++P++ A      +S+S   + S  GF++     K +SSIFG+++P+  
Sbjct  1    MAASSLLRSTVSAPLIEASRPDLAASASACFKVSSVGFSRNLNCPKVQSSIFGTSIPS-G  59

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            SSS+Q   + S+QP+KATATELPPT+ KS + GKT++GINGFGRIGRLVLRIAT+RDDI+
Sbjct  60   SSSLQICSARSVQPIKATATELPPTVQKSGSGGKTKIGINGFGRIGRLVLRIATTRDDIE  119

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVF  615
            VVAVNDP +D  YMAYMFK+DSTHG+F
Sbjct  120  VVAVNDPLVDPKYMAYMFKFDSTHGIF  146



>emb|CDP13563.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +1

Query  304  SVKFESSIFGSA-LPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGF  480
            +V+F+SSI G+  L    S     + + SIQP+KATATE+PPTI KS + GKT+VGINGF
Sbjct  39   NVRFQSSIHGNRILAQSSSLQKCSTTARSIQPIKATATEIPPTISKSSSGGKTKVGINGF  98

Query  481  GRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GRIGRLVLRIATSRDDI+VVAVNDPFIDA YMAYMFKYDSTHG FK
Sbjct  99   GRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGAFK  144



>ref|XP_008447086.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Cucumis melo]
Length=422

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  372
            M  +SL RS PA+  + +S S      S A       S+KF+SSIFG+ + +  SSS+Q 
Sbjct  1    MAATSLFRSAPAASFVQSSPSFSSPDQSTASC-VNLNSLKFQSSIFGAQVSS-GSSSLQL  58

Query  373  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVND  552
              S +IQP+KATATELPPT+ KS++ GKT+VGINGFGRIGRLVLR ATSRDDIDVVAVND
Sbjct  59   RRSHNIQPIKATATELPPTVQKSRSGGKTKVGINGFGRIGRLVLRNATSRDDIDVVAVND  118

Query  553  PFIDANYMAYMFKYDSTHGVFK  618
            PF+DA YMAYMFK+DSTHG FK
Sbjct  119  PFVDAKYMAYMFKFDSTHGNFK  140



>gb|AJA29689.1| glyceraldehyde-3-phosphate dehydrogenase [Betula luminifera]
Length=426

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 106/145 (73%), Gaps = 4/145 (3%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaG---FNQGCTSVKFESSIFGSALPNVHsss  363
            M  SSLLRS   +P++ AS +    + S       N+     K +SSIFG+++ +  SSS
Sbjct  1    MASSSLLRSTAMAPLVEASRAEPSDRFSKVARVRSNRNLNCCKLQSSIFGTSV-SSGSSS  59

Query  364  vqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVA  543
            +Q     SIQPVKA ATE+PPT+ KS+T GKT+VGINGFGRIGRLVLRIA+SRDDIDVVA
Sbjct  60   LQKCTVRSIQPVKAIATEIPPTVQKSRTGGKTKVGINGFGRIGRLVLRIASSRDDIDVVA  119

Query  544  VNDPFIDANYMAYMFKYDSTHGVFK  618
            VNDPFID  YMAYM KYDSTHG+FK
Sbjct  120  VNDPFIDVKYMAYMLKYDSTHGIFK  144



>ref|XP_009414498.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=429

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 105/149 (70%), Gaps = 9/149 (6%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasss---shrhqaslaGFNQGCT----SVKFESSIFGSALPNV  351
            M FSSLLRS  A+  L  S     S     + A F   C     SV+  S + GSALP+V
Sbjct  1    MAFSSLLRS--ATSALGGSRDCFPSGCGTLAPASFKISCVGSPKSVEIRSGVLGSALPSV  58

Query  352  HsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDI  531
             ++S Q S +  IQPVKATATE+PP + +S + G+T++GINGFGRIGRLVLRIAT+RDD+
Sbjct  59   EANSSQRSRARGIQPVKATATEVPPAVRRSSSGGRTKIGINGFGRIGRLVLRIATTRDDV  118

Query  532  DVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +VVAVNDPFIDA YMAYM KYDSTHG FK
Sbjct  119  EVVAVNDPFIDAKYMAYMLKYDSTHGNFK  147



>gb|KJB45877.1| hypothetical protein B456_007G336900 [Gossypium raimondii]
Length=418

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            IQP++ATATE+PPTIPKS+++GKT++GINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA
Sbjct  71   IQPIQATATEIPPTIPKSRSSGKTKIGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  130

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  131  KYMAYMFKYDSTHGPFK  147



>gb|KJB45876.1| hypothetical protein B456_007G336900 [Gossypium raimondii]
Length=430

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            IQP++ATATE+PPTIPKS+++GKT++GINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA
Sbjct  71   IQPIQATATEIPPTIPKSRSSGKTKIGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  130

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  131  KYMAYMFKYDSTHGPFK  147



>gb|KJB45878.1| hypothetical protein B456_007G336900 [Gossypium raimondii]
Length=428

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            IQP++ATATE+PPTIPKS+++GKT++GINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA
Sbjct  71   IQPIQATATEIPPTIPKSRSSGKTKIGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  130

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  131  KYMAYMFKYDSTHGPFK  147



>gb|KJB14046.1| hypothetical protein B456_002G108700 [Gossypium raimondii]
Length=426

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 111/146 (76%), Gaps = 7/146 (5%)
 Frame = +1

Query  193  MGFSSLLRSVPA-SPVLhasssshrhqaslaGFNQGCTSVKFE---SSIFGSALPNVHss  360
            M FSSL+RS  A SP+L AS+ S    +    +    +S+ F    +S FG+A+ +  SS
Sbjct  1    MAFSSLIRSTAAVSPLLQASARSDLSPSPS--YRLKVSSIGFGGNLNSFFGAAV-STKSS  57

Query  361  svqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVV  540
            S+Q   S SIQP+KATATE+PPTI +S+++GKT+VGINGFGRIGRLVLR+A +RDD DVV
Sbjct  58   SLQKCNSRSIQPIKATATEIPPTIARSRSSGKTKVGINGFGRIGRLVLRVAIARDDFDVV  117

Query  541  AVNDPFIDANYMAYMFKYDSTHGVFK  618
            AVNDPFIDANYMAYMFKYDSTHG FK
Sbjct  118  AVNDPFIDANYMAYMFKYDSTHGGFK  143



>ref|XP_008371994.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Malus domestica]
Length=427

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 109/147 (74%), Gaps = 7/147 (5%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqasl------aGFNQGCTSVKFESSIFGSALPNVH  354
            M  SSLLRS  ++P++ AS +     A+        GF++     K +S IFG+++P+  
Sbjct  1    MAASSLLRSTVSAPLIEASRADLAASAAASFXVSSVGFSRNLNCPKVQSXIFGTSIPS-G  59

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            SSS+Q   + S+QP+KATATELPPT+ +S + GKT++GINGFGRIGRLVLRIA++RDDI+
Sbjct  60   SSSLQICSARSVQPIKATATELPPTVQRSGSGGKTKIGINGFGRIGRLVLRIASTRDDIE  119

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVF  615
            VVAVNDP +D  YMAYMFKYDSTHG+F
Sbjct  120  VVAVNDPLVDPKYMAYMFKYDSTHGIF  146



>ref|XP_007022674.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
2, partial [Theobroma cacao]
 gb|EOY14199.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
2, partial [Theobroma cacao]
Length=387

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 108/150 (72%), Gaps = 10/150 (7%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  369
            M FSSL+RS  A+     S+ S    +         +S+ F  +SIFG+A+    SSS++
Sbjct  1    MAFSSLIRSTAAASTPLDSARSDLSPSPSDRLK--VSSIGFSGNSIFGAAVSTGSSSSLR  58

Query  370  gsgsssIQPVKATATELPPTIP-------KSQTTGKTRVGINGFGRIGRLVLRIATSRDD  528
               S SIQP+KATATE+PPT+P       +S+++GKT+VGINGFGRIGRLVLR+AT+RDD
Sbjct  59   KCNSRSIQPIKATATEIPPTVPSLFLICLESRSSGKTKVGINGFGRIGRLVLRVATARDD  118

Query  529  IDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            IDVVAVNDPF+DA YMAYMFKYDSTHG FK
Sbjct  119  IDVVAVNDPFVDAKYMAYMFKYDSTHGNFK  148



>gb|KDP25059.1| hypothetical protein JCGZ_22594 [Jatropha curcas]
Length=426

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSV----KFESSIFGSALPNVHss  360
            M FSSLLRS  A+P++  S +     +S   F     +V    K   SIFG++L    SS
Sbjct  1    MAFSSLLRSTTAAPLIDDSLAELSSSSSDR-FKVSSVNVNRDLKSSKSIFGTSL-TTGSS  58

Query  361  svqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVV  540
            S+Q   + S QP+KATATE+PPTI KS+  GKT++GINGFGRIGRLV+RIAT RDDIDVV
Sbjct  59   SLQACCTRSFQPIKATATEMPPTILKSRNDGKTKIGINGFGRIGRLVMRIATFRDDIDVV  118

Query  541  AVNDPFIDANYMAYMFKYDSTHGVFK  618
            AVNDPFID  YMAYMFKYDSTHG +K
Sbjct  119  AVNDPFIDTKYMAYMFKYDSTHGGYK  144



>ref|XP_008456299.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Cucumis melo]
Length=425

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  301  TSVKFESSIFGSALPN-VHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGING  477
            +S+K +S +FG+ + + V S  ++ S + ++QP+KATATE PP I K+ ++GKT++GING
Sbjct  37   SSLKLQSGVFGTTVSSGVSSLQLRSSSNRTVQPIKATATEAPPAIQKTPSSGKTKIGING  96

Query  478  FGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            FGRIGRLVLR+ATSRDDIDVVAVNDPF+DA YMAYMFKYDS+HGVF
Sbjct  97   FGRIGRLVLRVATSRDDIDVVAVNDPFVDAKYMAYMFKYDSSHGVF  142



>ref|XP_010537806.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=423

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 99/145 (68%), Gaps = 7/145 (5%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaG---FNQGCTSVKFESSIFGSALPNVHsss  363
            M FSS LRS  A+P +   S        ++    F+   TS  F       AL    S S
Sbjct  1    MTFSSFLRSSAAAPCVDFFSPPSSDHFKVSSCLVFSHNLTSSNFSDP----ALSTGSSLS  56

Query  364  vqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVA  543
            +Q   + S+QP+KATATE+PP + +S ++GKTRVGINGFGRIGRLVLRIAT RDDIDVVA
Sbjct  57   LQKCNTRSMQPIKATATEVPPAVQRSDSSGKTRVGINGFGRIGRLVLRIATFRDDIDVVA  116

Query  544  VNDPFIDANYMAYMFKYDSTHGVFK  618
            VNDPFIDA YMAYMFKYDSTHGVFK
Sbjct  117  VNDPFIDAKYMAYMFKYDSTHGVFK  141



>ref|XP_009408252.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=429

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 102/149 (68%), Gaps = 9/149 (6%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqasla---GFNQGCT----SVKFESSIFGSALPNV  351
            M FS+LLRS  A+P L  S       +       F   C     S    SSIFGS+ P+V
Sbjct  1    MAFSTLLRS--AAPALGGSRDRFPSDSGAPIPPSFKISCIRSPRSAGNRSSIFGSSFPSV  58

Query  352  HsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDI  531
             + S Q SG+ + QP+KATATE PP +  S + G+T+VGINGFGRIGRLVLRIAT+RDDI
Sbjct  59   EAYSSQRSGARNNQPIKATATEAPPFVKSSPSGGRTKVGINGFGRIGRLVLRIATTRDDI  118

Query  532  DVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +VVAVNDPFIDA YMAYM KYDSTHG+FK
Sbjct  119  EVVAVNDPFIDAKYMAYMLKYDSTHGIFK  147



>ref|XP_007022673.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
1 [Theobroma cacao]
 gb|EOY14198.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
1 [Theobroma cacao]
Length=438

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 108/157 (69%), Gaps = 17/157 (11%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  369
            M FSSL+RS  A+     S+ S    +         +S+ F  +SIFG+A+    SSS++
Sbjct  1    MAFSSLIRSTAAASTPLDSARSDLSPSPSDRLK--VSSIGFSGNSIFGAAVSTGSSSSLR  58

Query  370  gsgsssIQPVKATATELPPTIPKSQTTGKTRVGING--------------FGRIGRLVLR  507
               S SIQP+KATATE+PPT+PKS+++GKT+VGING              FGRIGRLVLR
Sbjct  59   KCNSRSIQPIKATATEIPPTVPKSRSSGKTKVGINGGAEIILGILLGGPGFGRIGRLVLR  118

Query  508  IATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +AT+RDDIDVVAVNDPF+DA YMAYMFKYDSTHG FK
Sbjct  119  VATARDDIDVVAVNDPFVDAKYMAYMFKYDSTHGNFK  155



>ref|XP_008776392.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Phoenix dactylifera]
Length=429

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 100/147 (68%), Gaps = 5/147 (3%)
 Frame = +1

Query  193  MGFSSLLRSV-PASPVLhasssshrhqaslaGFNQGC----TSVKFESSIFGSALPNVHs  357
            M FS LLRS  P +        S     +   F   C    +S +  SSIFGS L +V S
Sbjct  1    MAFSMLLRSATPLTGGWRDCFPSDFDARAPESFKISCMRIPSSAQIRSSIFGSVLSSVES  60

Query  358  ssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDV  537
            SS Q   +  IQP+KATATE PP +P+S    KT+VGINGFGRIGRLVLRIAT+RDDI+V
Sbjct  61   SSSQKPSARGIQPIKATATEAPPVVPRSSAGAKTKVGINGFGRIGRLVLRIATARDDIEV  120

Query  538  VAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VA+NDPFIDA YMAYMFKYDSTHG+FK
Sbjct  121  VALNDPFIDAKYMAYMFKYDSTHGIFK  147



>ref|XP_006307603.1| hypothetical protein CARUB_v10009227mg [Capsella rubella]
 gb|EOA40501.1| hypothetical protein CARUB_v10009227mg [Capsella rubella]
Length=425

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 102/147 (69%), Gaps = 9/147 (6%)
 Frame = +1

Query  193  MGFSSLLRSVPASPV-----LhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHs  357
            M FS LLRS   S       L+ SSS    Q +  GF+   TS +F     G+AL    S
Sbjct  1    MAFSFLLRSAATSAAAPRLELYPSSSYEHSQVTSVGFSHNLTSSRFS----GAALSTGSS  56

Query  358  ssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDV  537
            SS+    + S+QP+KATAT  PP + +S+++GKT+VGINGFGRIGRLVLRIAT RDDI+V
Sbjct  57   SSLHKCNARSVQPIKATATASPPAVQRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIEV  116

Query  538  VAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VAVNDPFIDA YMAYMFKYDSTHG +K
Sbjct  117  VAVNDPFIDAKYMAYMFKYDSTHGNYK  143



>emb|CDY35080.1| BnaA06g10900D [Brassica napus]
Length=426

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 104/148 (70%), Gaps = 10/148 (7%)
 Frame = +1

Query  193  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M  SSLLRS       P   +  + S  H    S  GF++  TS +F     G+A+    
Sbjct  1    MACSSLLRSAATSAAAPRVELHTSPSYGHSQVTSSLGFSRNLTSSRFS----GAAVSTGS  56

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            SSS+Q   + S+QP+KATATE PPT+ +S+++GKT+VGINGFGRIGRLVLRIAT RDDI+
Sbjct  57   SSSLQICNARSVQPIKATATEAPPTVYRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIE  116

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFIDA YMAYMFKYDSTHG +K
Sbjct  117  VVAVNDPFIDAKYMAYMFKYDSTHGNYK  144



>gb|EPS71916.1| hypothetical protein M569_02842, partial [Genlisea aurea]
Length=398

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  304  SVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  483
            +VKF SSI GS  P +HS S Q +   ++QPVKATATE P TIP S+ +   +VGINGFG
Sbjct  15   TVKFMSSIVGSVAP-LHSFSKQNAAGHAVQPVKATATEAPTTIPISRDSRTNKVGINGFG  73

Query  484  RIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            RIGRLVLRIAT+RDDIDVVAVNDPFIDA YMAYMFKYDSTHG F
Sbjct  74   RIGRLVLRIATARDDIDVVAVNDPFIDAKYMAYMFKYDSTHGSF  117



>ref|XP_007149305.1| hypothetical protein PHAVU_005G059200g [Phaseolus vulgaris]
 gb|ESW21299.1| hypothetical protein PHAVU_005G059200g [Phaseolus vulgaris]
Length=418

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +1

Query  304  SVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  483
            S+  ESSIFG+++    S  +Q   +  IQP+K+TATE+P    +S++TGKTRVGINGFG
Sbjct  33   SMGLESSIFGNSI-QCDSLVLQNYTARGIQPIKSTATEIPLPTQQSRSTGKTRVGINGFG  91

Query  484  RIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            RIGRLVLR+ATSRDDIDVVA+NDPF+DA YMAYMFKYDSTHG FK
Sbjct  92   RIGRLVLRVATSRDDIDVVAINDPFVDAKYMAYMFKYDSTHGPFK  136



>ref|XP_010531997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Tarenaya hassleriana]
Length=359

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATATE+PP + +S ++GKT++GINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA
Sbjct  1    MQPIKATATEVPPAVQRSGSSGKTKIGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  60

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHGVFK
Sbjct  61   KYMAYMLKYDSTHGVFK  77



>gb|KHG14985.1| Glyceraldehyde-3-phosphate dehydrogenase [Gossypium arboreum]
Length=377

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 108/146 (74%), Gaps = 7/146 (5%)
 Frame = +1

Query  193  MGFSSLLRSVPAS-PVLhasssshrhqaslaGFNQGCTSVKFE---SSIFGSALPNVHss  360
            M FSSL+RS  A+ P+L AS+ +    +         +S+ F    +S FG A+ +  SS
Sbjct  1    MAFSSLIRSTAAAYPLLEASARTDLSPSPSHRLK--VSSIGFGGNLNSFFGPAV-STKSS  57

Query  361  svqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVV  540
            S+Q   S SIQP+KATATE+P TI +S+++GKT+VGINGFGRIGRLVLR+A +RDD DVV
Sbjct  58   SLQKCNSRSIQPIKATATEIPTTIARSRSSGKTKVGINGFGRIGRLVLRVAIARDDFDVV  117

Query  541  AVNDPFIDANYMAYMFKYDSTHGVFK  618
            AVNDPFIDANYMAYMFKYDSTHG FK
Sbjct  118  AVNDPFIDANYMAYMFKYDSTHGGFK  143



>ref|XP_004140018.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Cucumis 
sativus]
Length=415

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 87/105 (83%), Gaps = 1/105 (1%)
 Frame = +1

Query  304  SVKFESSIFGSALPN-VHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGF  480
            S+K +S +FG+ + +   S  ++ S + ++QP+KATATE PP I K+  +GKT++GINGF
Sbjct  38   SLKLQSGLFGTTVSSGASSLQLRSSNNRTVQPIKATATEAPPAIQKTPRSGKTKIGINGF  97

Query  481  GRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            GRIGRLVLR+ATSRDDIDVVAVNDPF+DA YMAYMFKYDS+HGVF
Sbjct  98   GRIGRLVLRVATSRDDIDVVAVNDPFVDAKYMAYMFKYDSSHGVF  142



>ref|XP_004154566.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cucumis sativus]
Length=425

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 87/105 (83%), Gaps = 1/105 (1%)
 Frame = +1

Query  304  SVKFESSIFGSALPN-VHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGF  480
            S+K +S +FG+ + +   S  ++ S + ++QP+KATATE PP I K+  +GKT++GINGF
Sbjct  38   SLKLQSGLFGTTVSSGASSLQLRSSNNRTVQPIKATATEAPPAIQKTPRSGKTKIGINGF  97

Query  481  GRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            GRIGRLVLR+ATSRDDIDVVAVNDPF+DA YMAYMFKYDS+HGVF
Sbjct  98   GRIGRLVLRVATSRDDIDVVAVNDPFVDAKYMAYMFKYDSSHGVF  142



>emb|CDY33343.1| BnaC05g12400D [Brassica napus]
Length=426

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 102/148 (69%), Gaps = 10/148 (7%)
 Frame = +1

Query  193  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M FSSLLRS       P   +  + S  H    S  GF+   TS +F     G+A+    
Sbjct  1    MAFSSLLRSAATSAAAPRVELYTSPSYDHFQVTSSLGFSHNLTSSRFS----GAAVSTDS  56

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            SSS+Q   + S+QP+KATATE PP + + +++GKT+VGINGFGRIGRLVLRIAT RDDI+
Sbjct  57   SSSLQICNARSVQPIKATATEAPPAVYRPRSSGKTKVGINGFGRIGRLVLRIATFRDDIE  116

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFIDA YMAYMFKYDSTHG +K
Sbjct  117  VVAVNDPFIDAKYMAYMFKYDSTHGNYK  144



>ref|XP_004488757.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X3 [Cicer arietinum]
Length=373

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +1

Query  310  KFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRI  489
            +  +SIFG+++ +  S  +Q   + SIQP++ATATE+P  + KS + GKTRVGINGFGRI
Sbjct  37   RLHNSIFGTSI-SCESIVLQNCNARSIQPIRATATEIPLPVQKSSSAGKTRVGINGFGRI  95

Query  490  GRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GRLVLR+ATSRDDIDVVA+NDPFIDA YMAYMFKYDSTHG FK
Sbjct  96   GRLVLRVATSRDDIDVVAINDPFIDAKYMAYMFKYDSTHGPFK  138



>ref|XP_004306563.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=426

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +1

Query  283  GFNQGCTSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTR  462
            GF +     K +SSIFG+++ +  SSS+Q S + S+QP+KATATE+PPT  +S ++GK +
Sbjct  36   GFGRNLNCSKVQSSIFGASI-STGSSSLQTSSARSVQPIKATATEIPPTYQRSGSSGKIK  94

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            +GINGFGRIGRLVLRIAT+RDDI+VVAVNDP +D  YMAYMFKYDSTHGVF
Sbjct  95   IGINGFGRIGRLVLRIATARDDIEVVAVNDPMVDPKYMAYMFKYDSTHGVF  145



>gb|AAM67077.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
Length=420

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 96/148 (65%), Gaps = 16/148 (11%)
 Frame = +1

Query  193  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M  SSLLRS       P   +  +SS +H    S  GF+   TS +F  +   +   N  
Sbjct  1    MALSSLLRSAATSAAAPRVELYPSSSYNHSQVTSSLGFSHSLTSSRFSGAAVSTGKYNAK  60

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
                       +QP+KATATE PP + +S+++GKT+VGINGFGRIGRLVLRIAT RDDI+
Sbjct  61   R----------VQPIKATATEAPPAVHRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIE  110

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFIDA YMAYMFKYDSTHG +K
Sbjct  111  VVAVNDPFIDAKYMAYMFKYDSTHGNYK  138



>ref|XP_003596040.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES66291.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=405

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 103/143 (72%), Gaps = 8/143 (6%)
 Frame = +1

Query  193  MGFSSLLRS-VPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvq  369
            M  SSLLRS + +SP      SS R Q    G +    S + +++IFG+++P   S  +Q
Sbjct  1    MAASSLLRSAIVSSP------SSDRFQVLGNGSSISSKSTRLQNNIFGTSIP-CDSLVLQ  53

Query  370  gsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVN  549
               + S+QP++ATATE+P  +  S +TGKTRVGINGFGRIGRLVLR+AT RDDIDVVA+N
Sbjct  54   NCNARSMQPIRATATEIPLPVQNSSSTGKTRVGINGFGRIGRLVLRVATFRDDIDVVAIN  113

Query  550  DPFIDANYMAYMFKYDSTHGVFK  618
            DPFIDA YMAYMFKYDSTHG FK
Sbjct  114  DPFIDAKYMAYMFKYDSTHGPFK  136



>ref|NP_173080.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 sp|Q5E924.1|G3PP2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPCP2, 
chloroplastic; AltName: Full=Glyceraldehyde-3-phosphate dehydrogenase 
of plastid 2; AltName: Full=NAD-dependent glyceraldehydephosphate 
dehydrogenase chloroplastic 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAX12866.1| At1g16300 [Arabidopsis thaliana]
 gb|AEE29433.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
Length=420

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 96/148 (65%), Gaps = 16/148 (11%)
 Frame = +1

Query  193  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M  SSLLRS       P   +  +SS +H    S  GF+   TS +F  +   +   N  
Sbjct  1    MALSSLLRSAATSAAAPRVELYPSSSYNHSQVTSSLGFSHSLTSSRFSGAAVSTGKYNAK  60

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
                       +QP+KATATE PP + +S+++GKT+VGINGFGRIGRLVLRIAT RDDI+
Sbjct  61   R----------VQPIKATATEAPPAVHRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIE  110

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFIDA YMAYMFKYDSTHG +K
Sbjct  111  VVAVNDPFIDAKYMAYMFKYDSTHGNYK  138



>ref|XP_003596038.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES66289.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=418

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 103/143 (72%), Gaps = 8/143 (6%)
 Frame = +1

Query  193  MGFSSLLRS-VPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvq  369
            M  SSLLRS + +SP      SS R Q    G +    S + +++IFG+++P   S  +Q
Sbjct  1    MAASSLLRSAIVSSP------SSDRFQVLGNGSSISSKSTRLQNNIFGTSIP-CDSLVLQ  53

Query  370  gsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVN  549
               + S+QP++ATATE+P  +  S +TGKTRVGINGFGRIGRLVLR+AT RDDIDVVA+N
Sbjct  54   NCNARSMQPIRATATEIPLPVQNSSSTGKTRVGINGFGRIGRLVLRVATFRDDIDVVAIN  113

Query  550  DPFIDANYMAYMFKYDSTHGVFK  618
            DPFIDA YMAYMFKYDSTHG FK
Sbjct  114  DPFIDAKYMAYMFKYDSTHGPFK  136



>ref|XP_004488755.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X1 [Cicer arietinum]
Length=420

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +1

Query  310  KFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRI  489
            +  +SIFG+++ +  S  +Q   + SIQP++ATATE+P  + KS + GKTRVGINGFGRI
Sbjct  37   RLHNSIFGTSI-SCESIVLQNCNARSIQPIRATATEIPLPVQKSSSAGKTRVGINGFGRI  95

Query  490  GRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GRLVLR+ATSRDDIDVVA+NDPFIDA YMAYMFKYDSTHG FK
Sbjct  96   GRLVLRVATSRDDIDVVAINDPFIDAKYMAYMFKYDSTHGPFK  138



>gb|KGN46796.1| hypothetical protein Csa_6G136010 [Cucumis sativus]
Length=524

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 87/105 (83%), Gaps = 1/105 (1%)
 Frame = +1

Query  304  SVKFESSIFGSALPN-VHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGF  480
            S+K +S +FG+ + +   S  ++ S + ++QP+KATATE PP I K+  +GKT++GINGF
Sbjct  137  SLKLQSGLFGTTVSSGASSLQLRSSNNRTVQPIKATATEAPPAIQKTPRSGKTKIGINGF  196

Query  481  GRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            GRIGRLVLR+ATSRDDIDVVAVNDPF+DA YMAYMFKYDS+HGVF
Sbjct  197  GRIGRLVLRVATSRDDIDVVAVNDPFVDAKYMAYMFKYDSSHGVF  241



>gb|KFK42362.1| hypothetical protein AALP_AA2G245800 [Arabis alpina]
Length=249

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATAT++PP + +S ++GKT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  61   VQPIKATATQVPPVVQRSGSSGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  120

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG FK
Sbjct  121  KYMAYMLKYDSTHGNFK  137



>ref|XP_002890157.1| GAPCP-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66416.1| GAPCP-2 [Arabidopsis lyrata subsp. lyrata]
Length=420

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 95/148 (64%), Gaps = 16/148 (11%)
 Frame = +1

Query  193  MGFSSLLRSVPASP------VLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M FSSLLRS   S       +  +SS  H    S  GF     S +F  +   +   N  
Sbjct  1    MAFSSLLRSAATSAAAPRFQLYPSSSYDHSQVTSSLGFTHNLASSRFSGAAVSTGKCNAK  60

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            S          +QP+KATATE PP + +S+++GKT+VGINGFGRIGRLVLRIAT RDDI+
Sbjct  61   S----------VQPIKATATEAPPIVHRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIE  110

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFIDA YMAYMFKYDSTHG +K
Sbjct  111  VVAVNDPFIDAKYMAYMFKYDSTHGNYK  138



>emb|CDY25342.1| BnaC01g30110D [Brassica napus]
Length=415

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATAT+ PP + +S +TGKT+VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA
Sbjct  57   LQPIKATATQAPPAVQRSSSTGKTKVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  116

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG FK
Sbjct  117  KYMAYMLKYDSTHGNFK  133



>emb|CDY22281.1| BnaC02g25850D [Brassica napus]
Length=419

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATAT+ PP + +S +TGKT+VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA
Sbjct  61   LQPIKATATQAPPAVQRSSSTGKTKVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  120

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG FK
Sbjct  121  KYMAYMLKYDSTHGNFK  137



>ref|XP_009128365.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Brassica rapa]
Length=415

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATAT+ PP + +S +TGKT+VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA
Sbjct  57   LQPIKATATQAPPAVQRSSSTGKTKVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  116

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG FK
Sbjct  117  KYMAYMLKYDSTHGNFK  133



>gb|KFK42359.1| hypothetical protein AALP_AA2G245800 [Arabis alpina]
Length=275

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATAT++PP + +S ++GKT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  61   VQPIKATATQVPPVVQRSGSSGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  120

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG FK
Sbjct  121  KYMAYMLKYDSTHGNFK  137



>ref|XP_010417619.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like, 
partial [Camelina sativa]
Length=399

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATATE+PP + +S ++GKT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  66   VQPIKATATEVPPAVKRSSSSGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  125

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG FK
Sbjct  126  KYMAYMLKYDSTHGNFK  142



>gb|KHG16589.1| Glyceraldehyde-3-phosphate dehydrogenase-2C cytosolic [Gossypium 
arboreum]
Length=374

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = +1

Query  319  SSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRL  498
            +SIFG+AL    S S+Q   S SIQP+KATA ++PP  PKS+ +GKT++GINGFGRIGRL
Sbjct  42   NSIFGAALSTT-SVSLQKCNSRSIQPIKATAAKIPPAAPKSRKSGKTKIGINGFGRIGRL  100

Query  499  VLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VLR+A SRDDI+VVAVNDPFIDA YM YMFKYDSTHG FK
Sbjct  101  VLRVANSRDDIEVVAVNDPFIDAKYMTYMFKYDSTHGGFK  140



>ref|XP_010417618.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Camelina sativa]
Length=423

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATATE+PP + +S ++GKT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  66   VQPIKATATEVPPAVKRSSSSGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  125

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG FK
Sbjct  126  KYMAYMLKYDSTHGNFK  142



>ref|XP_010429843.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Camelina sativa]
Length=423

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATATE+PP + +S ++GKT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  65   VQPIKATATEVPPAVKRSSSSGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  124

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG FK
Sbjct  125  KYMAYMLKYDSTHGNFK  141



>gb|AAO22684.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
Length=420

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 96/148 (65%), Gaps = 16/148 (11%)
 Frame = +1

Query  193  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M  SSLLRS       P   +  +SS +H    S  GF+   TS +F  +   +      
Sbjct  1    MALSSLLRSAATSAAAPRVELYPSSSYNHSQVTSSLGFSHSLTSSRFSGAAVSTG-----  55

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
                    +  +QP+KATATE PP + +S+++GKT+VGINGFGRIGRLVLRIAT RDDI+
Sbjct  56   -----KYSAKRVQPIKATATEAPPAVHRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIE  110

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFIDA YMAYMFKYDSTHG +K
Sbjct  111  VVAVNDPFIDAKYMAYMFKYDSTHGNYK  138



>ref|XP_010693410.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=419

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +1

Query  301  TSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGF  480
            +S+K +S+IFG+A+ N  SS +Q S  +S+QP+KATATE+PPT+ ++++  K ++GINGF
Sbjct  34   SSLKIQSNIFGTAV-NGGSSCIQESRLTSMQPIKATATEIPPTVQRTRSGAKIKIGINGF  92

Query  481  GRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            GRIGRLVLR+ATSRDD++VVAVNDPF+DA YMAYMFKYDSTHG F
Sbjct  93   GRIGRLVLRVATSRDDLEVVAVNDPFVDAKYMAYMFKYDSTHGPF  137



>ref|XP_006389879.1| hypothetical protein EUTSA_v10018604mg [Eutrema salsugineum]
 gb|ESQ27165.1| hypothetical protein EUTSA_v10018604mg [Eutrema salsugineum]
Length=426

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 98/149 (66%), Gaps = 12/149 (8%)
 Frame = +1

Query  193  MGFSSLLRSVPASPV-------LhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNV  351
            M FSSL+RS  AS V         + +  H   +S  GF     S   +SS F  A    
Sbjct  1    MAFSSLVRSAAASTVAAPRADFFSSPARDHSKVSSSLGF-----SCNLKSSRFSGAAVAT  55

Query  352  HsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDI  531
              SS     + ++QP+KATATE+P  + +S ++GKT+VGINGFGRIGRLVLRIATSRDD+
Sbjct  56   GPSSSLQKRNRNVQPIKATATEVPYAVQRSSSSGKTKVGINGFGRIGRLVLRIATSRDDM  115

Query  532  DVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +VVAVNDPFIDA YMAYM KYDSTHG FK
Sbjct  116  EVVAVNDPFIDAKYMAYMLKYDSTHGNFK  144



>ref|XP_010537807.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=421

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 97/145 (67%), Gaps = 9/145 (6%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaG---FNQGCTSVKFESSIFGSALPNVHsss  363
            M FSS LRS  A+P +   S        ++    F+   TS  F       AL    S S
Sbjct  1    MTFSSFLRSSAAAPCVDFFSPPSSDHFKVSSCLVFSHNLTSSNFSDP----ALSTGSSLS  56

Query  364  vqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVA  543
            +Q   + S+QP+KATATE+PP +  S  +GKTRVGINGFGRIGRLVLRIAT RDDIDVVA
Sbjct  57   LQKCNTRSMQPIKATATEVPPAVQNS--SGKTRVGINGFGRIGRLVLRIATFRDDIDVVA  114

Query  544  VNDPFIDANYMAYMFKYDSTHGVFK  618
            VNDPFIDA YMAYMFKYDSTHGVFK
Sbjct  115  VNDPFIDAKYMAYMFKYDSTHGVFK  139



>ref|XP_003547755.1| PREDICTED: glyceraldehyde 3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Glycine max]
 gb|KHN00002.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Glycine 
soja]
Length=418

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +1

Query  295  GCT--SVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVG  468
            GC   S   ++SIFG+++    S  +Q   +  IQ +KATATE+P    +S++TGKTRVG
Sbjct  28   GCNLKSKGLQTSIFGTSI-QCDSLVLQNCNARHIQRIKATATEIPLPTQQSRSTGKTRVG  86

Query  469  INGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            INGFGRIGRLVLR+ATSRDD+DVVA+NDPFIDA YMAYMFKYDSTHG FK
Sbjct  87   INGFGRIGRLVLRVATSRDDVDVVAINDPFIDAKYMAYMFKYDSTHGPFK  136



>ref|XP_010472812.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Camelina sativa]
Length=424

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATATE+PP   +S ++GKT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  66   VQPIKATATEVPPAFKRSSSSGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  125

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG FK
Sbjct  126  KYMAYMLKYDSTHGNFK  142



>gb|ADJ96634.1| glyceraldehyde-3-phosphate dehydrogenase [Guzmania wittmackii 
x Guzmania lingulata]
Length=421

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 89/111 (80%), Gaps = 4/111 (4%)
 Frame = +1

Query  286  FNQGCTSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRV  465
            + +  +S    S +FG+A+    S+S + SG+ SIQP+KATAT  PP++PK  + GKT+V
Sbjct  33   YVRSLSSAPNHSRVFGAAI----STSSRKSGARSIQPIKATATAAPPSVPKLSSGGKTKV  88

Query  466  GINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GINGFGRIGRLVLRIAT+RDDI+VVAVNDPF+DA YMAYM KYDSTHG+FK
Sbjct  89   GINGFGRIGRLVLRIATARDDIEVVAVNDPFVDAKYMAYMLKYDSTHGLFK  139



>ref|XP_004488756.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X2 [Cicer arietinum]
Length=373

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            IQP++ATATE+P  + KS + GKTRVGINGFGRIGRLVLR+ATSRDDIDVVA+NDPFIDA
Sbjct  15   IQPIRATATEIPLPVQKSSSAGKTRVGINGFGRIGRLVLRVATSRDDIDVVAINDPFIDA  74

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  75   KYMAYMFKYDSTHGPFK  91



>gb|KHN22160.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Glycine 
soja]
Length=418

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 96/142 (68%), Gaps = 6/142 (4%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  372
            M  SSLLRS   +P     SS  R +      +    S    SSIFG+++    S  +Q 
Sbjct  1    MAASSLLRSALLAP-----SSCDRPKVYTNASSSNLKSKGLHSSIFGTSI-QCDSLVLQN  54

Query  373  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVND  552
                 IQP+KATATE+P    +S++TGKTRVGINGFGRIGRLVLR+AT RDD+DVVA+ND
Sbjct  55   CNGRGIQPIKATATEIPLPTQQSRSTGKTRVGINGFGRIGRLVLRVATFRDDVDVVAIND  114

Query  553  PFIDANYMAYMFKYDSTHGVFK  618
            PFIDA YMAYMFKYDSTHG FK
Sbjct  115  PFIDAKYMAYMFKYDSTHGPFK  136



>emb|CDX79324.1| BnaC06g19790D [Brassica napus]
Length=421

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATAT++PP + +S +TGKT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  63   VQPIKATATQVPPAVQRSSSTGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  122

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM +YDSTHG FK
Sbjct  123  KYMAYMLRYDSTHGNFK  139



>ref|XP_009399260.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=423

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +1

Query  328  FGSALPNVHs-ssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVL  504
            FGS+L +V   SS +     SIQPVKATATE PP +  S   GKT++GINGFGRIGRLV+
Sbjct  44   FGSSLTSVDIYSSHKHVARRSIQPVKATATEAPPVVKSSSRGGKTKIGINGFGRIGRLVM  103

Query  505  RIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            RIAT+RDDI+VVAVNDPFIDA YMAYM KYDSTHGVFK
Sbjct  104  RIATTRDDIEVVAVNDPFIDAKYMAYMLKYDSTHGVFK  141



>gb|AIX10972.1| glyceraldehyde-3-phosphate dehydrogenase [Ornithogalum saundersiae]
Length=433

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 96/152 (63%), Gaps = 13/152 (9%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasss----shrhqaslaGFNQGCTSVKFESS-------IFGSA  339
            M FS+ LRS  A+P++  S      S     +   F   C S K           I G++
Sbjct  1    MAFSTALRS--AAPLVDGSRDLFPFSDSTIRASDSFKVSCHSTKSSLRSASVSSSIVGAS  58

Query  340  LPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATS  519
            +  +     Q S    IQPVKATATE PP + +S + GKT++GINGFGRIGRLVLRIATS
Sbjct  59   ISPLEVVPSQISSGRVIQPVKATATEAPPAVARSSSGGKTKIGINGFGRIGRLVLRIATS  118

Query  520  RDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            RDD++VVAVNDPFIDA YMAYM KYDSTHG+F
Sbjct  119  RDDVEVVAVNDPFIDAKYMAYMLKYDSTHGLF  150



>ref|XP_006416830.1| hypothetical protein EUTSA_v10007716mg [Eutrema salsugineum]
 gb|ESQ35183.1| hypothetical protein EUTSA_v10007716mg [Eutrema salsugineum]
Length=423

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 100/148 (68%), Gaps = 10/148 (7%)
 Frame = +1

Query  193  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M FSSLLRS       P   +  + S  H    S  G +   TS +F       A+  + 
Sbjct  1    MAFSSLLRSAATSAAPPRLELYTSPSYDHFQVTSSLGLSHNLTSSRFSDV----AVSTMS  56

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            SSS+Q   + ++QP+KATATE PP + +S+++GKT+VGINGFGRIGRLVLRIAT RDDI+
Sbjct  57   SSSLQKCNARTVQPIKATATEAPPAVQRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIE  116

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFI A YMAYMF+YDSTHG +K
Sbjct  117  VVAVNDPFIGAKYMAYMFRYDSTHGNYK  144



>ref|NP_178071.1| glyceraldehyde-3-phosphate dehydrogenase GAPCP1 [Arabidopsis 
thaliana]
 sp|Q9SAJ6.1|G3PP1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPCP1, 
chloroplastic; AltName: Full=Glyceraldehyde-3-phosphate dehydrogenase 
of plastid 1; AltName: Full=NAD-dependent glyceraldehydephosphate 
dehydrogenase chloroplastic 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD30223.1|AC007202_5 Is a member of the PF|00044 glyceraldehyde 3-phosphate dehydrogenase 
family. ESTs gb|T43985, gb|N38667, gb|N65037, gb|AA713069 
and gb|AI099548 come from this gene [Arabidopsis thaliana]
 gb|AAK15554.1|AF348583_1 putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 dbj|BAC42558.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36260.1| glyceraldehyde-3-phosphate dehydrogenase of plastid [Arabidopsis 
thaliana]
Length=422

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATATE+P  + +S ++GKT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  64   VQPIKATATEVPSAVRRSSSSGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  123

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG FK
Sbjct  124  KYMAYMLKYDSTHGNFK  140



>ref|XP_002889251.1| GAPCP-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65510.1| GAPCP-1 [Arabidopsis lyrata subsp. lyrata]
Length=422

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATAT++P  + +S ++GKT+VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA
Sbjct  64   VQPIKATATQVPSAVRRSSSSGKTKVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  123

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG FK
Sbjct  124  KYMAYMLKYDSTHGNFK  140



>ref|NP_001242854.1| uncharacterized protein LOC100804853 [Glycine max]
 gb|ACU21330.1| unknown [Glycine max]
Length=418

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 95/142 (67%), Gaps = 6/142 (4%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  372
            M  SSLLRS   +P     SS  R +      +    S    SSIFG+++    S  +Q 
Sbjct  1    MAASSLLRSALLAP-----SSCDRPKVYTNASSSNLKSKGLHSSIFGTSI-QCDSLVLQN  54

Query  373  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVND  552
                 IQP+KATATE+P    +S++TGKTRVGINGFGRIGRLVLR+AT RDD+DVVA+ND
Sbjct  55   CNGRGIQPIKATATEIPLPTQQSRSTGKTRVGINGFGRIGRLVLRVATFRDDVDVVAIND  114

Query  553  PFIDANYMAYMFKYDSTHGVFK  618
            PF DA YMAYMFKYDSTHG FK
Sbjct  115  PFTDAKYMAYMFKYDSTHGPFK  136



>ref|XP_009149063.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Brassica rapa]
Length=427

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATATE PP + +S+++GKT+VGINGFGRIGRLVLRIAT RDDI+VVAVNDPFIDA
Sbjct  69   VQPIKATATEAPPAVYRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIEVVAVNDPFIDA  128

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG +K
Sbjct  129  KYMAYMFKYDSTHGNYK  145



>gb|AFK39182.1| unknown [Medicago truncatula]
 gb|AES66290.2| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=359

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP++ATATE+P  +  S +TGKTRVGINGFGRIGRLVLR+AT RDDIDVVA+NDPFIDA
Sbjct  1    MQPIRATATEIPLPVQNSSSTGKTRVGINGFGRIGRLVLRVATFRDDIDVVAINDPFIDA  60

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  61   KYMAYMFKYDSTHGPFK  77



>emb|CDX67990.1| BnaA07g20300D [Brassica napus]
Length=421

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATAT++P  + +S +TGKT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  63   VQPIKATATQVPAAVQRSSSTGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  122

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM +YDSTHG FK
Sbjct  123  KYMAYMLRYDSTHGNFK  139



>ref|XP_009104524.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Brassica rapa]
Length=421

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP+KATAT++P  + +S +TGKT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  63   VQPIKATATQVPAAVQRSSSTGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  122

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM +YDSTHG FK
Sbjct  123  KYMAYMLRYDSTHGNFK  139



>ref|XP_006302200.1| hypothetical protein CARUB_v10020208mg, partial [Capsella rubella]
 gb|EOA35098.1| hypothetical protein CARUB_v10020208mg, partial [Capsella rubella]
Length=483

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 102/142 (72%), Gaps = 2/142 (1%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  372
            M FSSLLRS  AS V  A+  +    +  +  ++  +++ F  ++  S   +  SSS+Q 
Sbjct  62   MAFSSLLRSAAASTV--AAPRNDSFSSPPSDHSKVSSNLGFSGNLKSSKFSSGISSSLQK  119

Query  373  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVND  552
              + S+QP+KATATE+P  + +S ++ KT+VGINGFGRIGRLVLRIATSRDDI+VVAVND
Sbjct  120  CNARSVQPIKATATEVPSAVQRSGSSAKTKVGINGFGRIGRLVLRIATSRDDIEVVAVND  179

Query  553  PFIDANYMAYMFKYDSTHGVFK  618
            PFIDA YMAYM KYDSTHG FK
Sbjct  180  PFIDAKYMAYMLKYDSTHGNFK  201



>gb|ABK24753.1| unknown [Picea sitchensis]
 gb|ACN41144.1| unknown [Picea sitchensis]
Length=433

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  313  FESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIG  492
            F S+ FGS       S++Q   + ++QPV+ATATE PP + KS    ++++GINGFGRIG
Sbjct  50   FGSNFFGSTAQFCQGSALQSQSARTLQPVRATATETPPRVQKSSGKERSKIGINGFGRIG  109

Query  493  RLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            RLVLR+A SR+DI+VVA+NDPFIDA YMAYMFKYDSTHGV+K
Sbjct  110  RLVLRVALSREDIEVVAINDPFIDAKYMAYMFKYDSTHGVYK  151



>ref|XP_010240502.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Brachypodium distachyon]
Length=407

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            ++PV+ATAT+ PP  P+S +  KT+VGINGFGRIGRLVLRIA SRDDI+VVAVNDPFIDA
Sbjct  51   LEPVRATATQAPPATPQSSSGEKTKVGINGFGRIGRLVLRIAVSRDDIEVVAVNDPFIDA  110

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  111  KYMAYMFKYDSTHGPFK  127



>ref|XP_010064086.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW71396.1| hypothetical protein EUGRSUZ_F04466 [Eucalyptus grandis]
Length=422

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            IQPV+ATA ++ P +P+S  + KT++GINGFGRIGRLVLRIAT+RDDIDVV+VNDPFIDA
Sbjct  64   IQPVRATAVDVRPIVPRSDGSNKTKIGINGFGRIGRLVLRIATARDDIDVVSVNDPFIDA  123

Query  568  NYMAYMFKYDSTHGVF  615
             YMAYMFKYDSTHGVF
Sbjct  124  KYMAYMFKYDSTHGVF  139



>gb|ACN40575.1| unknown [Picea sitchensis]
Length=400

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  313  FESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIG  492
            F S+ FGS       S++Q   + ++QPV+ATATE PP + KS    ++++GINGFGRIG
Sbjct  17   FGSNFFGSTAQFYQGSALQSQSARTLQPVRATATETPPRVQKSSGKERSKIGINGFGRIG  76

Query  493  RLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            RLVLR+A SR+DI+VVA+NDPFIDA YMAYMFKYDSTHGV+K
Sbjct  77   RLVLRVALSREDIEVVAINDPFIDAKYMAYMFKYDSTHGVYK  118



>ref|XP_002451619.1| hypothetical protein SORBIDRAFT_04g004750 [Sorghum bicolor]
 gb|EES04595.1| hypothetical protein SORBIDRAFT_04g004750 [Sorghum bicolor]
Length=413

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +1

Query  319  SSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRL  498
            S+ FG A P++   +   S + +I+P++A AT+ PP +P+  +  KT++GINGFGRIGRL
Sbjct  35   SAHFGCAFPSI---TASSSVARNIEPLRAIATQAPPAVPQYSSGEKTKIGINGFGRIGRL  91

Query  499  VLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VLRIATSRDDI+VVAVNDPF+DA YMAYMFKYDSTHG FK
Sbjct  92   VLRIATSRDDIEVVAVNDPFVDAKYMAYMFKYDSTHGPFK  131



>ref|NP_001130796.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Zea mays]
 gb|ACF79152.1| unknown [Zea mays]
 gb|ACG33133.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Zea mays]
 gb|ACG34828.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Zea mays]
 gb|AFW66370.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Zea mays]
Length=412

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 3/100 (3%)
 Frame = +1

Query  319  SSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRL  498
            S+ FG A P+V   +V    +  I+P++A AT+ PP +P+  +  KT++GINGFGRIGRL
Sbjct  32   SAHFGRAFPSV---AVSSLAARHIEPMRAIATQAPPAVPQYLSGEKTKIGINGFGRIGRL  88

Query  499  VLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VLRIATSRDDI+VVAVNDPF+DA YMAYMFKYDSTHG FK
Sbjct  89   VLRIATSRDDIEVVAVNDPFVDAKYMAYMFKYDSTHGPFK  128



>gb|ACL54292.1| unknown [Zea mays]
Length=411

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = +1

Query  319  SSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRL  498
            S+ FG A P + +SS        ++P++A AT+ PP +P+  +  KT++GINGFGRIGRL
Sbjct  33   SAHFGCAFPYIRASSSAARN---LEPLRAIATQAPPAMPQYSSGEKTKIGINGFGRIGRL  89

Query  499  VLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VLRIATSRDDI+VVAVNDPFIDA YMAYMFKYDSTHG FK
Sbjct  90   VLRIATSRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGPFK  129



>ref|XP_006853569.1| hypothetical protein AMTR_s00032p00242890 [Amborella trichopoda]
 gb|ERN15036.1| hypothetical protein AMTR_s00032p00242890 [Amborella trichopoda]
Length=473

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +Q +K+TATE PPTI +S T  +T++GINGFGRIGRLVLR+AT RDD++VVAVNDPFIDA
Sbjct  59   VQHIKSTATEAPPTIHRSSTGPRTKIGINGFGRIGRLVLRVATKRDDVEVVAVNDPFIDA  118

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHGVFK
Sbjct  119  KYMAYMFKYDSTHGVFK  135



>ref|NP_001149357.1| LOC100282981 [Zea mays]
 gb|ACG35141.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Zea mays]
 gb|ACG40188.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Zea mays]
 gb|AFW70292.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Zea mays]
Length=411

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = +1

Query  319  SSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRL  498
            S+ FG A P + +SS        ++P++A AT+ PP +P+  +  KT++GINGFGRIGRL
Sbjct  33   SAHFGCAFPYIRASSSAARN---LEPLRAIATQAPPAMPQYSSGEKTKIGINGFGRIGRL  89

Query  499  VLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VLRIATSRDDI+VVAVNDPFIDA YMAYMFKYDSTHG FK
Sbjct  90   VLRIATSRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGPFK  129



>ref|XP_006646946.1| PREDICTED: glyceraldehyde 3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Oryza brachyantha]
Length=380

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            I+P++A AT+ PP +P+  +  KT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  22   IEPLRAIATQAPPAVPQYSSGEKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  81

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  82   KYMAYMFKYDSTHGPFK  98



>ref|NP_001046031.1| Os02g0171100 [Oryza sativa Japonica Group]
 dbj|BAD25496.1| putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 dbj|BAD25194.1| putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 dbj|BAF07945.1| Os02g0171100 [Oryza sativa Japonica Group]
 dbj|BAG91733.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72581.1| hypothetical protein OsI_06028 [Oryza sativa Indica Group]
 gb|EEE56402.1| hypothetical protein OsJ_05558 [Oryza sativa Japonica Group]
Length=411

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            I+P++A AT+ PP +P+  +  KT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  53   IEPLRAIATQAPPAVPQYSSGEKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  112

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  113  KYMAYMFKYDSTHGPFK  129



>gb|EMS57422.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Triticum 
urartu]
Length=418

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            I+PV+ATAT+ PP  P+S +  KT+VGINGFGRIGRLVLRIA  RDDI+VVAVNDPFIDA
Sbjct  55   IEPVRATATQAPPATPQSSSGEKTKVGINGFGRIGRLVLRIAIDRDDIEVVAVNDPFIDA  114

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  115  KYMAYMFKYDSTHGPFK  131



>ref|XP_003570206.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Brachypodium distachyon]
Length=417

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            IQP++A AT+ PP +P+  +  KT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPF+DA
Sbjct  59   IQPLRAIATQAPPVVPQYSSGEKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFVDA  118

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  119  KYMAYMFKYDSTHGPFK  135



>gb|AIZ74327.1| NAD+-dependent glyceraldehyde-3-phosphate dehydrogenase [Pinus 
massoniana]
Length=433

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  313  FESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIG  492
            F S+ FGS       S++Q   + ++QPV+ATATE PP + +S    +T++GINGFGRIG
Sbjct  50   FGSNFFGSTAEFGQGSALQCQSARTLQPVRATATEAPPRVQRSSGKERTKIGINGFGRIG  109

Query  493  RLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            RLVLR+A S++DI+VVA+NDPFIDA YMAYMFKYDSTHGV+K
Sbjct  110  RLVLRVALSKEDIEVVAINDPFIDAKYMAYMFKYDSTHGVYK  151



>gb|AAD10215.1| glyceraldehyde-3-phosphate dehydrogenase [Pinus sylvestris]
Length=433

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  313  FESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIG  492
            F S+ FGS       S++Q   + ++QPV+ATATE PP + +S    +T++GINGFGRIG
Sbjct  50   FGSNFFGSTAEFGQGSALQCQSARTLQPVRATATEAPPRVQRSSGKERTKIGINGFGRIG  109

Query  493  RLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            RLVLR+A S++DI+VVA+NDPFIDA YMAYMFKYDSTHGV+K
Sbjct  110  RLVLRVALSKEDIEVVAINDPFIDAKYMAYMFKYDSTHGVYK  151



>dbj|BAJ86344.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92721.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=407

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            I+PV+ATAT+ PP  P S +  KT+VGINGFGRIGRLVLRIA  RDDI+VVAVNDPFIDA
Sbjct  51   IEPVRATATQAPPATPSSSSGEKTKVGINGFGRIGRLVLRIAIDRDDIEVVAVNDPFIDA  110

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  111  KYMAYMFKYDSTHGPFK  127



>gb|AAD10214.1| glyceraldehyde-3-phosphate dehydrogenase [Pinus sylvestris]
Length=433

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  313  FESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIG  492
            F S+ FGS       S++Q   + ++QPV+ATATE PP + +S    +T++GINGFGRIG
Sbjct  50   FGSNFFGSTAEFGQGSALQCQSARTLQPVRATATEAPPRVQRSSGKERTKIGINGFGRIG  109

Query  493  RLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            RLVLR+A S++DI VVA+NDPFIDA YMAYMFKYDSTHGV+K
Sbjct  110  RLVLRVALSKEDIQVVAINDPFIDAKYMAYMFKYDSTHGVYK  151



>gb|EMS45411.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Triticum 
urartu]
Length=446

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            I+P++A AT+ PP +P+  +  KT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  74   IEPLRAIATQAPPAVPQYLSGEKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  133

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  134  KYMAYMFKYDSTHGPFK  150



>ref|XP_004951761.1| PREDICTED: glyceraldehyde 3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Setaria italica]
Length=412

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            ++P++A AT+ PP +P+  +  KT++GINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  54   VEPLRAIATQAPPAVPQYSSGEKTKIGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  113

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  114  KYMAYMFKYDSTHGPFK  130



>gb|AIX97549.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Myrciaria 
dubia]
Length=421

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            IQPVKATA ++ P +P+S  + KT++GINGFGRIGRLVLRIAT RDDIDVVAVNDPFIDA
Sbjct  63   IQPVKATAVDVRPIVPRSDGSNKTKIGINGFGRIGRLVLRIATFRDDIDVVAVNDPFIDA  122

Query  568  NYMAYMFKYDSTHGVF  615
             YMAYM +YDSTHGV+
Sbjct  123  KYMAYMLRYDSTHGVY  138



>emb|CAA04942.1| NAD-dependent glyceraldehyde-3-phosphate dehydrogenase [Pinus 
sylvestris]
Length=365

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QPV+ATATE PP + +S    +T++GINGFGRIGRLVLR+A S++DI+VVA+NDPFIDA
Sbjct  7    LQPVRATATEAPPRVQRSSGKERTKIGINGFGRIGRLVLRVALSKEDIEVVAINDPFIDA  66

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHGV+K
Sbjct  67   KYMAYMFKYDSTHGVYK  83



>gb|EAZ37938.1| hypothetical protein OsJ_22288 [Oryza sativa Japonica Group]
Length=403

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            ++PV+ATAT+ P    +S +T KT+VGINGFGRIGRLVLRIAT+RDDI+VVAVNDPFIDA
Sbjct  57   VEPVRATATQAPLATHQSSSTEKTKVGINGFGRIGRLVLRIATNRDDIEVVAVNDPFIDA  116

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  117  KYMAYMFKYDSTHGPFK  133



>ref|NP_001058309.1| Os06g0666600 [Oryza sativa Japonica Group]
 dbj|BAD45405.1| putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 dbj|BAF20223.1| Os06g0666600 [Oryza sativa Japonica Group]
 gb|EAZ02005.1| hypothetical protein OsI_24036 [Oryza sativa Indica Group]
 dbj|BAG97846.1| unnamed protein product [Oryza sativa Japonica Group]
Length=415

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            ++PV+ATAT+ P    +S +T KT+VGINGFGRIGRLVLRIAT+RDDI+VVAVNDPFIDA
Sbjct  57   VEPVRATATQAPLATHQSSSTEKTKVGINGFGRIGRLVLRIATNRDDIEVVAVNDPFIDA  116

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  117  KYMAYMFKYDSTHGPFK  133



>ref|XP_010476736.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Camelina sativa]
Length=426

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 103/148 (70%), Gaps = 10/148 (7%)
 Frame = +1

Query  193  MGFSSLLRSVP---ASPVLh---asssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M FSSLLRS     A+P L    +SS  H    S  GF+   TS +F     G+A+    
Sbjct  1    MAFSSLLRSAATSAAAPRLELYPSSSYDHSQVTSSLGFSHNLTSSRFS----GAAVSTGS  56

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            SSS+Q   +  +QP+KATAT  PP + +S+++GKT+VGINGFGRIGRLVLRI T RDDI+
Sbjct  57   SSSLQKCNARRVQPIKATATAAPPAVQRSRSSGKTKVGINGFGRIGRLVLRIGTFRDDIE  116

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFIDA YMAYMFKYDSTHG +K
Sbjct  117  VVAVNDPFIDAKYMAYMFKYDSTHGNYK  144



>ref|XP_010459169.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
isoform X2 [Camelina sativa]
Length=420

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 95/148 (64%), Gaps = 16/148 (11%)
 Frame = +1

Query  193  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M FSSLLRS       P   +  +SS  H    S  GF+   TS +F  +   +   N  
Sbjct  1    MAFSSLLRSAATSAAAPRVELYPSSSYDHSQGTSSLGFSHNLTSSRFSGAAVSAGKSNAR  60

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
                       +QP+KATAT  PP + +S+++GKT+VGINGFGRIGRLVLRIAT RDDI+
Sbjct  61   R----------VQPIKATATAAPPAVQRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIE  110

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFIDA YMAYMFKYDSTHG +K
Sbjct  111  VVAVNDPFIDAKYMAYMFKYDSTHGNYK  138



>ref|XP_010459168.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
isoform X1 [Camelina sativa]
Length=426

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 101/148 (68%), Gaps = 10/148 (7%)
 Frame = +1

Query  193  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M FSSLLRS       P   +  +SS  H    S  GF+   TS +F  +    A+    
Sbjct  1    MAFSSLLRSAATSAAAPRVELYPSSSYDHSQGTSSLGFSHNLTSSRFSGA----AVSAGS  56

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            +SS+  S +  +QP+KATAT  PP + +S+++GKT+VGINGFGRIGRLVLRIAT RDDI+
Sbjct  57   ASSLLKSNARRVQPIKATATAAPPAVQRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIE  116

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFIDA YMAYMFKYDSTHG +K
Sbjct  117  VVAVNDPFIDAKYMAYMFKYDSTHGNYK  144



>ref|XP_002513328.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF48731.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=426

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 106/148 (72%), Gaps = 10/148 (7%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshr------hqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M FS +LRS   SP++ AS S          QAS   FN+    +K   S FG+++P   
Sbjct  1    MAFSCILRSTATSPLIEASRSDLSPSPSDPLQASSVNFNR---DLKASKSFFGTSVPTA-  56

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            SSS++   + S+QP+KAT TE+PPTI KS++ G+T++GINGFGRIGRLVLRIAT RDD+D
Sbjct  57   SSSLEACSARSLQPIKATVTEMPPTILKSRSDGRTKIGINGFGRIGRLVLRIATLRDDVD  116

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFID  YMAYM KYDSTHG+FK
Sbjct  117  VVAVNDPFIDTKYMAYMLKYDSTHGLFK  144



>ref|XP_006422270.1| hypothetical protein CICLE_v10005029mg [Citrus clementina]
 ref|XP_006493767.1| PREDICTED: glyceraldehyde 3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR35510.1| hypothetical protein CICLE_v10005029mg [Citrus clementina]
Length=425

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  369
            M FSSLLRS  AS  L  +  +      + G +    S     SSIFG+++P+  SSS  
Sbjct  1    MAFSSLLRST-ASASLVRADLTSSPSDRVKGSSTAAFSRNLNTSSIFGTSVPSGSSSSSL  59

Query  370  gs-gsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAV  546
             +  + SIQP++ATATE+PPTI KS++ G T+VGINGFGRIGRLVLR+A  RDD+DVVAV
Sbjct  60   QTCAAKSIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLVLRVAAFRDDVDVVAV  119

Query  547  NDPFIDANYMAYMFKYDSTHGVFK  618
            NDPFIDA YMAYMFKYDSTHGVFK
Sbjct  120  NDPFIDAKYMAYMFKYDSTHGVFK  143



>emb|CAA06030.1| glyeraldehyde-3-phosphate dehydrogenase, partial [Marsilea quadrifolia]
Length=368

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +1

Query  397  VKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYM  576
            VKATATE+P  + KS +    R+GINGFGRIGRL LR+A +RDDI+VVAVNDPFID  YM
Sbjct  10   VKATATEIPSKVHKSSSKNVVRIGINGFGRIGRLCLRVALARDDIEVVAVNDPFIDTKYM  69

Query  577  AYMFKYDSTHGVFK  618
            AYMFKYDSTHG++K
Sbjct  70   AYMFKYDSTHGIYK  83



>gb|KDO61570.1| hypothetical protein CISIN_1g014424mg [Citrus sinensis]
Length=334

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 103/144 (72%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  369
            M FSSLLRS  AS  L  +  +      + G      S     SSIFG+++P+  SSS  
Sbjct  1    MAFSSLLRST-ASASLVRADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSSSL  59

Query  370  gsgsss-IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAV  546
             + ++  IQP++ATATE+PPTI KS++ G T+VGINGFGRIGRLVLR+A  RDD+DVVAV
Sbjct  60   QTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLVLRVAAFRDDVDVVAV  119

Query  547  NDPFIDANYMAYMFKYDSTHGVFK  618
            NDPFIDA YMAYMFKYDSTHGVFK
Sbjct  120  NDPFIDAKYMAYMFKYDSTHGVFK  143



>gb|KDO61569.1| hypothetical protein CISIN_1g014424mg [Citrus sinensis]
Length=389

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 103/144 (72%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  369
            M FSSLLRS  AS  L  +  +      + G      S     SSIFG+++P+  SSS  
Sbjct  1    MAFSSLLRST-ASASLVRADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSSSL  59

Query  370  gsgsss-IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAV  546
             + ++  IQP++ATATE+PPTI KS++ G T+VGINGFGRIGRLVLR+A  RDD+DVVAV
Sbjct  60   QTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLVLRVAAFRDDVDVVAV  119

Query  547  NDPFIDANYMAYMFKYDSTHGVFK  618
            NDPFIDA YMAYMFKYDSTHGVFK
Sbjct  120  NDPFIDAKYMAYMFKYDSTHGVFK  143



>gb|KDO61568.1| hypothetical protein CISIN_1g014424mg [Citrus sinensis]
Length=425

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 103/144 (72%), Gaps = 3/144 (2%)
 Frame = +1

Query  193  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  369
            M FSSLLRS  AS  L  +  +      + G      S     SSIFG+++P+  SSS  
Sbjct  1    MAFSSLLRST-ASASLVRADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSSSL  59

Query  370  gsgsss-IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAV  546
             + ++  IQP++ATATE+PPTI KS++ G T+VGINGFGRIGRLVLR+A  RDD+DVVAV
Sbjct  60   QTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLVLRVAAFRDDVDVVAV  119

Query  547  NDPFIDANYMAYMFKYDSTHGVFK  618
            NDPFIDA YMAYMFKYDSTHGVFK
Sbjct  120  NDPFIDAKYMAYMFKYDSTHGVFK  143



>ref|XP_006854435.1| hypothetical protein AMTR_s00039p00217390 [Amborella trichopoda]
 gb|ERN15902.1| hypothetical protein AMTR_s00039p00217390 [Amborella trichopoda]
Length=427

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            +QP++ATATE+P  +  S ++ K ++GINGFGRIGRLVLR+A   D ++VVAVNDPFIDA
Sbjct  69   MQPIRATATEIPSRVHHSPSSDKIKIGINGFGRIGRLVLRVAVEGDGVEVVAVNDPFIDA  128

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYM KYDSTHG+FK
Sbjct  129  KYMAYMLKYDSTHGLFK  145



>ref|XP_006656350.1| PREDICTED: glyceraldehyde 3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Oryza brachyantha]
Length=407

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            ++PV+ATAT+ PP   +S +  KT+VGINGFGRIGRLVLRIATSRD+I+VVAVNDPFIDA
Sbjct  49   VEPVRATATQAPPAAHQSSSAEKTKVGINGFGRIGRLVLRIATSRDNIEVVAVNDPFIDA  108

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG+FK
Sbjct  109  KYMAYMFKYDSTHGLFK  125



>gb|EMT03645.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Aegilops 
tauschii]
Length=406

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            I+PV+ATAT+ PP   +S +  KT+VGINGFGRIGRLVLRIA  RDDI+VVAVNDPFIDA
Sbjct  51   IEPVRATATQAPPASSQSSSGEKTKVGINGFGRIGRLVLRIAIDRDDIEVVAVNDPFIDA  110

Query  568  NYMAYMFKYDSTHGVFK  618
             YMAYMFKYDSTHG FK
Sbjct  111  KYMAYMFKYDSTHGPFK  127



>ref|XP_008666027.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
Length=253

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 76/125 (61%), Gaps = 28/125 (22%)
 Frame = +1

Query  319  SSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQT-----------------  447
            S+ FG A P V +SS        ++P++  AT+ PP +   QT                 
Sbjct  105  SAHFGCAFPYVRASSSAARN---LEPLRVIATQAPPAVLPDQTFHVSCAACGGFIIFFFL  161

Query  448  --------TGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDST  603
                      KT++GINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA YMAYMFKYDST
Sbjct  162  YFSVEYSSGDKTKIGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMFKYDST  221

Query  604  HGVFK  618
            HG FK
Sbjct  222  HGPFK  226



>gb|KJB81433.1| hypothetical protein B456_013G145400 [Gossypium raimondii]
Length=423

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +1

Query  319  SSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRL  498
            +SIFG+AL    S S+Q     SIQP+KA A ++PP  PKS+ +GKT++GINGFGRIGRL
Sbjct  42   NSIFGAALSTT-SVSLQKCNLRSIQPIKAIAAKIPPAAPKSRKSGKTKIGINGFGRIGRL  100

Query  499  VLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VLR+A SRDDI+VVAVNDPFIDA YMAYMFKYDSTHG FK
Sbjct  101  VLRVANSRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGGFK  140



>gb|AAD34682.1|AC006341_10 Similar to gb|AJ001706 NAD-dependent glyceraldehyde-3-phosphate 
dehydrogenase (GapCp1) from Pinus sylvestris and is a member 
of the PF|00044 glyceraldehyde 3-phosphate dehydrogenase 
family. ESTs gb|H37679, gb|R83939 and gb|R30214 come from this 
gene [Arabidopsis thaliana]
Length=407

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 83/148 (56%), Gaps = 29/148 (20%)
 Frame = +1

Query  193  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M  SSLLRS       P   +  +SS +H    S  GF+   TS +F  +   +   N  
Sbjct  1    MALSSLLRSAATSAAAPRVELYPSSSYNHSQVTSSLGFSHSLTSSRFSGAAVSTGKYNAK  60

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
                       +QP+KATATE PP              ++ FGRIGRLVLRIAT RDDI+
Sbjct  61   R----------VQPIKATATEAPP-------------AVHSFGRIGRLVLRIATFRDDIE  97

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VVAVNDPFIDA YMAYMFKYDSTHG +K
Sbjct  98   VVAVNDPFIDAKYMAYMFKYDSTHGNYK  125



>ref|XP_002982970.1| hypothetical protein SELMODRAFT_234134 [Selaginella moellendorffii]
 gb|EFJ15779.1| hypothetical protein SELMODRAFT_234134 [Selaginella moellendorffii]
Length=371

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 2/74 (3%)
 Frame = +1

Query  397  VKATATELPPTIPKSQ-TTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANY  573
            V+A   E  PT PKS  T GKTR+GINGFGRIGRLVLR+A +RDDI+VVAVNDPF  A Y
Sbjct  4    VRAALAE-APTKPKSAGTKGKTRIGINGFGRIGRLVLRVALTRDDIEVVAVNDPFTSAKY  62

Query  574  MAYMFKYDSTHGVF  615
            MAY+FKYDSTHG+F
Sbjct  63   MAYLFKYDSTHGIF  76



>emb|CAC80386.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=432

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +1

Query  394  PVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANY  573
            P++ATAT+ P    KS +  K ++GINGFGRIGRLVLRIA SRDD++VVAVNDPF+ A+Y
Sbjct  74   PIRATATQTPTISKKSGSKEKAKIGINGFGRIGRLVLRIALSRDDVEVVAVNDPFLTADY  133

Query  574  MAYMFKYDSTHGVF  615
            + Y+FKYDSTHGV+
Sbjct  134  VRYLFKYDSTHGVY  147



>ref|XP_002965494.1| hypothetical protein SELMODRAFT_439282 [Selaginella moellendorffii]
 gb|EFJ32914.1| hypothetical protein SELMODRAFT_439282 [Selaginella moellendorffii]
Length=518

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 2/74 (3%)
 Frame = +1

Query  397  VKATATELPPTIPKSQ-TTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANY  573
            V+A   E  PT PKS  T GKTR+GINGFGRIGRLVLR+A +RDDI+VVAVNDPF  A Y
Sbjct  108  VRAALAE-APTKPKSAGTKGKTRIGINGFGRIGRLVLRVALTRDDIEVVAVNDPFTSAKY  166

Query  574  MAYMFKYDSTHGVF  615
            MAY+FKYDSTHG+F
Sbjct  167  MAYLFKYDSTHGIF  180



>ref|XP_010023558.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW59858.1| hypothetical protein EUGRSUZ_H02597 [Eucalyptus grandis]
 gb|KCW59859.1| hypothetical protein EUGRSUZ_H02597 [Eucalyptus grandis]
 gb|KCW59860.1| hypothetical protein EUGRSUZ_H02597 [Eucalyptus grandis]
 gb|KCW59861.1| hypothetical protein EUGRSUZ_H02597 [Eucalyptus grandis]
Length=188

 Score =   106 bits (265),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  442  QTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            Q     ++GINGFGRIGRLVLRIAT+RDDIDVVAVNDPFIDA YMAYM KYDSTHGVF
Sbjct  7    QMAATRQIGINGFGRIGRLVLRIATARDDIDVVAVNDPFIDAKYMAYMLKYDSTHGVF  64



>gb|KCW59857.1| hypothetical protein EUGRSUZ_H02597 [Eucalyptus grandis]
Length=239

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 58/76 (76%), Gaps = 13/76 (17%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            IQPV+ATA ++ P +P+             FGRIGRLVLRIAT+RDDIDVVAVNDPFIDA
Sbjct  53   IQPVRATAVDVRPIVPR-------------FGRIGRLVLRIATARDDIDVVAVNDPFIDA  99

Query  568  NYMAYMFKYDSTHGVF  615
             YMAYM KYDSTHGVF
Sbjct  100  KYMAYMLKYDSTHGVF  115



>ref|XP_001781685.1| predicted protein [Physcomitrella patens]
 gb|EDQ53498.1| predicted protein [Physcomitrella patens]
Length=425

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  400  KATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMA  579
            +ATATE P    KS +  K R+GING GRIGRLVLR+  +RDD++VVAVNDPFID  YMA
Sbjct  70   RATATEFPTKTTKSGSQEKVRIGINGCGRIGRLVLRVILARDDVEVVAVNDPFIDTKYMA  129

Query  580  YMFKYDSTHGVFK  618
            YM KYDSTHG+ K
Sbjct  130  YMLKYDSTHGLLK  142



>gb|KCW59862.1| hypothetical protein EUGRSUZ_H02597 [Eucalyptus grandis]
Length=181

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            ++GINGFGRIGRLVLRIAT+RDDIDVVAVNDPFIDA YMAYM KYDSTHGVF
Sbjct  6    QIGINGFGRIGRLVLRIATARDDIDVVAVNDPFIDAKYMAYMLKYDSTHGVF  57



>ref|XP_001781691.1| predicted protein [Physcomitrella patens]
 gb|EDQ53504.1| predicted protein [Physcomitrella patens]
Length=425

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  397  VKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYM  576
            V+ATATE P    KS +  K R+GING GRIGRLVLR+  +RDD++VVAVNDPFID  YM
Sbjct  69   VRATATEFPVRTTKSGSQEKIRIGINGCGRIGRLVLRVILARDDVEVVAVNDPFIDTKYM  128

Query  577  AYMFKYDSTHGVFK  618
            AY+ KYDSTHG+ K
Sbjct  129  AYLLKYDSTHGLLK  142



>emb|CAC80387.1| glyceraldehyde-3-phosphate dehydrogenase [Physcomitrella patens]
Length=430

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  397  VKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYM  576
            V+ATATE P    KS +  K R+GING GRIGRLVLR+  +RDD++VVAVNDPFID  YM
Sbjct  74   VRATATEFPVRTTKSGSQEKIRIGINGCGRIGRLVLRVILARDDVEVVAVNDPFIDTKYM  133

Query  577  AYMFKYDSTHGVFK  618
            AY+ KYDSTHG+ K
Sbjct  134  AYLLKYDSTHGLLK  147



>gb|ABK00055.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Marchantia 
polymorpha]
Length=408

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +1

Query  394  PVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANY  573
            P++ATAT+ P    KS +  K ++GINGFGRIGRLVLRIA SRDD++V AVND F+ A+Y
Sbjct  62   PIRATATQTPTISKKSGSKEKAKIGINGFGRIGRLVLRIALSRDDVEVAAVNDSFLTADY  121

Query  574  MAYMFKYDSTHGVF  615
            + Y+FKYDSTHGV+
Sbjct  122  IRYLFKYDSTHGVY  135



>gb|EMT07642.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Aegilops 
tauschii]
Length=159

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  388  IQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDA  567
            I+P++A AT+ PP +P+  +  KT+VGINGFGRIGRLVLRIATSRDDI+VVAVNDPFIDA
Sbjct  94   IEPLRAIATQAPPAVPQYSSGEKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDA  153

Query  568  NYM  576
             YM
Sbjct  154  KYM  156



>emb|CAN71286.1| hypothetical protein VITISV_007003 [Vitis vinifera]
Length=367

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  478  FGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            FGRIGRLVLR+ATSRDDIDVVAVNDPF+DA YMAYMFKYDSTHGVFK
Sbjct  39   FGRIGRLVLRVATSRDDIDVVAVNDPFVDAKYMAYMFKYDSTHGVFK  85



>ref|XP_008809607.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Phoenix dactylifera]
Length=338

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  475  GFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GFGRIGRLVLRIATSRDDI+VVAVNDPFIDA YMAYMFKYDSTHG FK
Sbjct  9    GFGRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGTFK  56



>emb|CAC80385.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=348

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  427  TIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTH  606
            T P + ++GK ++GINGFGRIGRLV R+A  RDDI++VAVNDPFI   YMAYMFKYDS H
Sbjct  5    TEPSTISSGKVKIGINGFGRIGRLVARVALERDDIELVAVNDPFISTEYMAYMFKYDSVH  64

Query  607  GVF  615
            G +
Sbjct  65   GRY  67



>gb|ABK00054.1| cytosolic glyceraldehyde-3-phosphate dehydrogenase [Marchantia 
polymorpha]
Length=345

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  427  TIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTH  606
            T P + ++GK ++GINGFGRIGRLV R+A  RDDI++VAVNDPFI   YMAYMFKYDS H
Sbjct  5    TEPSTISSGKVKIGINGFGRIGRLVARVALERDDIELVAVNDPFISTEYMAYMFKYDSVH  64

Query  607  GVF  615
            G +
Sbjct  65   GRY  67



>gb|ABK24012.1| unknown [Picea sitchensis]
Length=340

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  445  TTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +TGK ++GINGFGRIGRLV R+A +RDDI++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  3    STGKIKIGINGFGRIGRLVARVALTRDDIELVAVNDPFISTDYMTYMFKYDSVHGQWK  60



>ref|XP_002511238.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF51840.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=72

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI   YM YMFKYD+ HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTEYMTYMFKYDTVHGQWK  57



>ref|XP_007137947.1| hypothetical protein PHAVU_009G1685000g, partial [Phaseolus vulgaris]
 gb|ESW09941.1| hypothetical protein PHAVU_009G1685000g, partial [Phaseolus vulgaris]
Length=102

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>sp|P34924.1|G3PC_PINSY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Pinus sylvestris]
 gb|AAA33779.1| glyceraldehyde-3-phosphate dehydrogenase [Pinus sylvestris]
Length=340

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  445  TTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +TGK ++GINGFGRIGRLV R+A +RDDI++V VNDPFI  +YM+YMFKYDS HG +K
Sbjct  3    STGKIKIGINGFGRIGRLVARVALTRDDIELVGVNDPFISTDYMSYMFKYDSVHGKWK  60



>gb|ERG80260.1| glyceraldehyde-3-phosphate dehydrogenase [Ascaris suum]
Length=374

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  436  KSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            +++T  K +VGINGFGRIGRLVLR A  +D ++VVAVNDPFI+ +YM YMFKYDSTHG F
Sbjct  31   RNETMSKPKVGINGFGRIGRLVLRAAVEKDTVEVVAVNDPFINIDYMVYMFKYDSTHGRF  90

Query  616  K  618
            K
Sbjct  91   K  91



>ref|NP_001291329.1| glyceraldehyde-3-phosphate dehydrogenase [Sesamum indicum]
 gb|AFJ42572.1| glyceraldehyde 3-phosphate dehydrogenase [Sesamum indicum]
Length=337

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDDID+VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVALQRDDIDLVAVNDPFISTDYMTYMFKYDSVHGHWK  57



>emb|CBY35474.1| unnamed protein product [Oikopleura dioica]
Length=333

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +GINGFGRIGRLV R + +RDD++VVA+NDPFID +YM YMFKYDSTHGVFK
Sbjct  4    IGINGFGRIGRLVCRASIARDDVNVVAINDPFIDLDYMVYMFKYDSTHGVFK  55



>sp|Q39769.1|G3PC_GINBI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Ginkgo biloba]
 gb|AAA33352.1| glyceraldehyde-phosphate dehydrogenase [Ginkgo biloba]
Length=340

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  442  QTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
             +TGK ++GINGFGRIGRLV R+A  RDDI++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    SSTGKIKIGINGFGRIGRLVARVALLRDDIELVAVNDPFISTDYMTYMFKYDSVHGQWK  60



>gb|AAC08320.1| glyceraldehyde 3-phosphate dehydrogenase [Ogataea angusta]
Length=335

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VGINGFGRIGRLVLRIA SRDDI+V+A+NDPFI  +Y AYMFKYDSTHG FK
Sbjct  5    VGINGFGRIGRLVLRIALSRDDINVIAINDPFIAPDYAAYMFKYDSTHGKFK  56



>ref|WP_043641218.1| glyceraldehyde-3-phosphate dehydrogenase [Desulfovibrio sp. TomC]
 sp|O59841.2|G3P_OGAPD RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH 
[Ogataea parapolymorpha DL-1]
 gb|ESX02203.1| Glyceraldehyde-3-phosphate dehydrogenase [Ogataea parapolymorpha 
DL-1]
Length=335

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VGINGFGRIGRLVLRIA SRDDI+V+A+NDPFI  +Y AYMFKYDSTHG FK
Sbjct  5    VGINGFGRIGRLVLRIALSRDDINVIAINDPFIAPDYAAYMFKYDSTHGKFK  56



>ref|XP_003147614.1| glyceraldehyde-3-phosphate dehydrogenase [Loa loa]
Length=168

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K +VGINGFGRIGRLVLR A  +D +DVVAVNDPFI+ +YM YMFKYDSTHG +K
Sbjct  3    KPKVGINGFGRIGRLVLRAAVEKDTVDVVAVNDPFINIDYMVYMFKYDSTHGRYK  57



>ref|XP_003142010.1| glyceraldehyde-3-phosphate dehydrogenase [Loa loa]
Length=189

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K ++GINGFGRIGRLVLR A  +D +DVVAVNDPFI+ +YM YMFKYDSTHG FK
Sbjct  3    KPKIGINGFGRIGRLVLRAAVEKDTVDVVAVNDPFINIDYMVYMFKYDSTHGRFK  57



>gb|KEH25421.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=323

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HGV K
Sbjct  2    GKIKIGINGFGRIGRLVARVALERDDVELVAVNDPFITTDYMTYMFKYDSVHGVLK  57



>gb|AIE44418.1| glyceraldehyde 3-phosphate dehydrogenase [Fasciola hepatica]
Length=338

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K +VGINGFGRIGRLVLR A  R  ++VVAVNDPFID NYM YMFKYDSTHG FK
Sbjct  3    KPKVGINGFGRIGRLVLRAAVERGTVEVVAVNDPFIDLNYMVYMFKYDSTHGTFK  57



>ref|XP_001526454.1| glyceraldehyde-3-phosphate dehydrogenase [Lodderomyces elongisporus 
NRRL YB-4239]
 gb|EDK44833.1| glyceraldehyde-3-phosphate dehydrogenase [Lodderomyces elongisporus 
NRRL YB-4239]
Length=337

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            ++GINGFGRIGRLVLR+A  R DIDVVAVNDPFI  +Y AYMFKYDSTHG++K
Sbjct  4    KIGINGFGRIGRLVLRVALQRKDIDVVAVNDPFIAPDYAAYMFKYDSTHGIYK  56



>ref|XP_001752151.1| predicted protein [Physcomitrella patens]
 gb|EDQ82884.1| predicted protein [Physcomitrella patens]
Length=342

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  448  TGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            + K ++GINGFGRIGRLV R+A  RDDI++VA+NDPFI   YMAYMFKYDSTHG +K
Sbjct  4    SAKIKIGINGFGRIGRLVARVALERDDIELVAINDPFITPEYMAYMFKYDSTHGQWK  60



>ref|XP_007137943.1| hypothetical protein PHAVU_009G1684000g, partial [Phaseolus vulgaris]
 gb|ESW09937.1| hypothetical protein PHAVU_009G1684000g, partial [Phaseolus vulgaris]
Length=180

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  448  TGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  50   SGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  106



>ref|XP_006684692.1| glyceraldehyde 3-phosphate dehydrogenase [Candida tenuis ATCC 
10573]
 ref|XP_006684693.1| hypothetical protein CANTEDRAFT_112531 [Candida tenuis ATCC 10573]
 gb|EGV66118.1| glyceraldehyde 3-phosphate dehydrogenase [Candida tenuis ATCC 
10573]
 gb|EGV66119.1| hypothetical protein CANTEDRAFT_112531 [Candida tenuis ATCC 10573]
Length=331

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            ++GINGFGRIGRLVLRIA +R DI+VVA+NDPFI A+Y AYMFKYDSTHG FK
Sbjct  2    KIGINGFGRIGRLVLRIAIARPDIEVVAINDPFIAADYAAYMFKYDSTHGRFK  54



>gb|AHB86970.1| glyceraldehyde 3-phosphate dehydrogenase [Sedum alfredii]
Length=337

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K ++GINGFGRIGRLV R+A  RDDI++VAVNDPFI+  YM YMFKYDSTHG +K
Sbjct  3    KIKIGINGFGRIGRLVARVALQRDDIELVAVNDPFINTEYMTYMFKYDSTHGQWK  57



>sp|P26521.1|G3PC_RANAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Ranunculus acris]
 emb|CAA42903.1| glyceraldehyde 3-phosphate dehydrogenase [Ranunculus acris]
Length=338

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  448  TGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            TGK ++GINGFGRIGRLV R+A +RDD+++VAVNDPFI  +YM YMFKYD+ HG +K
Sbjct  2    TGKIKIGINGFGRIGRLVARVALARDDVELVAVNDPFITTDYMTYMFKYDTVHGQWK  58



>gb|KCW83196.1| hypothetical protein EUGRSUZ_B00144 [Eucalyptus grandis]
Length=294

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK  57



>gb|KCW83197.1| hypothetical protein EUGRSUZ_B00144 [Eucalyptus grandis]
Length=272

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK  57



>ref|XP_004489569.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic-like 
[Cicer arietinum]
Length=338

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYD+ HG++K
Sbjct  3    GKIKIGINGFGRIGRLVARVALERDDVELVAVNDPFITTDYMTYMFKYDTVHGIWK  58



>ref|XP_010026741.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Eucalyptus grandis]
 gb|KCW83194.1| hypothetical protein EUGRSUZ_B00144 [Eucalyptus grandis]
Length=337

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK  57



>gb|KGK40669.1| hypothetical protein JL09_g247 [Pichia kudriavzevii]
Length=335

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VGINGFGRIGRLVLR+A SR DI+VVA+NDPFI A+Y AYMFKYDSTHG +K
Sbjct  5    VGINGFGRIGRLVLRVALSRSDINVVAINDPFIAADYAAYMFKYDSTHGKYK  56



>ref|XP_002419583.1| glyceraldehyde-3-phosphate dehydrogenase, putative [Candida dubliniensis 
CD36]
 emb|CAX43178.1| glyceraldehyde-3-phosphate dehydrogenase, putative [Candida dubliniensis 
CD36]
Length=335

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            ++GINGFGRIGRLVLR+A SR DI+VVAVNDPFI A+Y AYMFKYDSTHG ++
Sbjct  4    KIGINGFGRIGRLVLRVALSRKDIEVVAVNDPFIAADYAAYMFKYDSTHGRYQ  56



>gb|EMG45427.1| Glyceraldehyde-3-phosphate dehydrogenase [Candida maltosa Xu316]
Length=337

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            ++GINGFGRIGRLVLRIA  R DI+VVAVNDPFI A+Y AYMFKYDSTHG +K
Sbjct  4    KIGINGFGRIGRLVLRIALGRKDIEVVAVNDPFIAADYAAYMFKYDSTHGRYK  56



>gb|KHG15503.1| Glyceraldehyde-3-phosphate dehydrogenase-2C cytosolic [Gossypium 
arboreum]
Length=291

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>ref|XP_010025353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Eucalyptus grandis]
Length=337

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>ref|XP_005642719.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18175.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Coccomyxa subellipsoidea 
C-169]
Length=386

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = +1

Query  445  TTGKT-RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            ++G+T RVGINGFGRIGRLVLR A ++ +++VVA+NDPFI+ +Y+AYMFKYDSTHGVFK
Sbjct  49   SSGETIRVGINGFGRIGRLVLRAALAKPNVEVVAINDPFIENDYIAYMFKYDSTHGVFK  107



>sp|Q9Y796.1|G3P_CRYCU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH 
[Cryptococcus curvatus]
 gb|AAD25080.1|AF126158_1 glyceraldehyde 3-phosphate dehydrogenase [Cryptococcus curvatus]
Length=337

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  457  TRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            T+VGINGFGRIGR+VLR A    DIDVVA+NDPFID +YM YMFKYDSTHG FK
Sbjct  3    TKVGINGFGRIGRIVLRNALEHGDIDVVAINDPFIDLDYMVYMFKYDSTHGRFK  56



>sp|P48812.1|G3P_BRUMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH 
[Brugia malayi]
 gb|AAA57337.1| glyceraldehyde-3-phosphate dehydrogenase [Brugia malayi]
Length=339

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K +VGINGFGRIGRLVLR A  +D +DVVAVNDPFI+ +YM YMFKYDSTHG FK
Sbjct  3    KPKVGINGFGRIGRLVLRAAVEKDTVDVVAVNDPFINIDYMVYMFKYDSTHGRFK  57



>ref|XP_001899850.1| Glyceraldehyde 3-phosphate dehydrogenase [Brugia malayi]
Length=299

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K +VGINGFGRIGRLVLR A  +D +DVVAVNDPFI+ +YM YMFKYDSTHG FK
Sbjct  3    KPKVGINGFGRIGRLVLRAAVEKDTVDVVAVNDPFINIDYMVYMFKYDSTHGRFK  57



>ref|NP_001275344.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
 gb|ABB72804.1| glyceraldehyde 3-phosphate dehydrogenase-like protein [Solanum 
tuberosum]
 gb|ABB87128.1| glyceraldehyde 3-phosphate dehydrogenase-like [Solanum tuberosum]
Length=338

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  4    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK  59



>ref|XP_010320554.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase isoform X1 
[Solanum lycopersicum]
Length=338

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  4    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK  59



>gb|AAM92008.1|AF527779_1 glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum]
 gb|ABB55366.1| glyceraldehyde 3-phosphate dehydrogenase-like [Solanum tuberosum]
Length=338

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  4    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK  59



>ref|XP_001899849.1| Glyceraldehyde 3-phosphate dehydrogenase [Brugia malayi]
 emb|CDP97886.1| Protein Bm5699 [Brugia malayi]
Length=339

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K +VGINGFGRIGRLVLR A  +D +DVVAVNDPFI+ +YM YMFKYDSTHG FK
Sbjct  3    KPKVGINGFGRIGRLVLRAAVEKDTVDVVAVNDPFINIDYMVYMFKYDSTHGRFK  57



>pdb|4K9D|A Chain A, X-ray Crystal Structure Of A Glyceraldehyde 3-phosphate 
Dehydrogenase From Brugia Malayi Bound To The Co-factor 
Nad
 pdb|4K9D|B Chain B, X-ray Crystal Structure Of A Glyceraldehyde 3-phosphate 
Dehydrogenase From Brugia Malayi Bound To The Co-factor 
Nad
 pdb|4K9D|C Chain C, X-ray Crystal Structure Of A Glyceraldehyde 3-phosphate 
Dehydrogenase From Brugia Malayi Bound To The Co-factor 
Nad
 pdb|4K9D|D Chain D, X-ray Crystal Structure Of A Glyceraldehyde 3-phosphate 
Dehydrogenase From Brugia Malayi Bound To The Co-factor 
Nad
 pdb|4K9D|E Chain E, X-ray Crystal Structure Of A Glyceraldehyde 3-phosphate 
Dehydrogenase From Brugia Malayi Bound To The Co-factor 
Nad
 pdb|4K9D|F Chain F, X-ray Crystal Structure Of A Glyceraldehyde 3-phosphate 
Dehydrogenase From Brugia Malayi Bound To The Co-factor 
Nad
 pdb|4K9D|G Chain G, X-ray Crystal Structure Of A Glyceraldehyde 3-phosphate 
Dehydrogenase From Brugia Malayi Bound To The Co-factor 
Nad
 pdb|4K9D|H Chain H, X-ray Crystal Structure Of A Glyceraldehyde 3-phosphate 
Dehydrogenase From Brugia Malayi Bound To The Co-factor 
Nad
Length=347

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K +VGINGFGRIGRLVLR A  +D +DVVAVNDPFI+ +YM YMFKYDSTHG FK
Sbjct  11   KPKVGINGFGRIGRLVLRAAVEKDTVDVVAVNDPFINIDYMVYMFKYDSTHGRFK  65



>emb|CDK28313.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=333

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VGINGFGRIGRLVLRIA +R DI VVAVNDPFI A+Y AYMFKYDSTHG +K
Sbjct  5    VGINGFGRIGRLVLRIALTRSDIKVVAVNDPFITADYAAYMFKYDSTHGKYK  56



>gb|ACJ22876.1| glyceraldehyde 3-phosphate dehydrogenase [Candida tropicalis]
Length=338

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +VGINGFGRIGRLVLRIA +R DI+VVAVNDPFI A Y AYMFKYDSTH  FK
Sbjct  5    KVGINGFGRIGRLVLRIALTRKDIEVVAVNDPFIGAEYAAYMFKYDSTHRTFK  57



>ref|XP_011086733.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Sesamum indicum]
Length=337

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGHWK  57



>gb|AGV54709.1| glyceraldehyde-3-dehydrogenase C subunit [Phaseolus vulgaris]
Length=338

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>gb|KHJ86520.1| putative glyceraldehyde-3-phosphate dehydrogenase, type I, partial 
[Oesophagostomum dentatum]
Length=238

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  433  PKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGV  612
            P S+   K +VGINGFGRIGRLVLR A  +D ++VVAVNDPFI+ +YM Y+F+YDSTHG 
Sbjct  41   PLSRNMVKPKVGINGFGRIGRLVLRAAVEKDTVEVVAVNDPFINIDYMVYLFQYDSTHGR  100

Query  613  FK  618
            FK
Sbjct  101  FK  102



>ref|XP_002263145.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Vitis vinifera]
Length=337

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>emb|CDP97885.1| Protein Bm5699, isoform a [Brugia malayi]
Length=368

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K +VGINGFGRIGRLVLR A  +D +DVVAVNDPFI+ +YM YMFKYDSTHG FK
Sbjct  32   KPKVGINGFGRIGRLVLRAAVEKDTVDVVAVNDPFINIDYMVYMFKYDSTHGRFK  86



>gb|ADR72970.1| glyceraldehyde-3-phosphate dehydrogenase [Candida tropicalis]
Length=338

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +VGINGFGRIGRLVLRIA +R DI+VVAVNDPFI A Y AYMFKYDSTH  FK
Sbjct  5    KVGINGFGRIGRLVLRIALTRKDIEVVAVNDPFIGAEYAAYMFKYDSTHRTFK  57



>gb|AGV54256.1| glyceraldehyde-3-phosphate dehydrogenase [Phaseolus vulgaris]
Length=338

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>ref|XP_010242342.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Nelumbo nucifera]
Length=337

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>ref|XP_010248871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nelumbo nucifera]
Length=337

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWK  57



>ref|XP_010248875.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Nelumbo nucifera]
Length=337

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWK  57



>ref|XP_006347401.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Solanum tuberosum]
Length=337

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI   YM YMFKYDS HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVEYMTYMFKYDSVHGQWK  57



>gb|EJD75049.1| glyceraldehyde-3-phosphate dehydrogenase [Loa loa]
Length=340

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K +VGINGFGRIGRLVLR A  +D +DVVAVNDPFI+ +YM YMFKYDSTHG +K
Sbjct  3    KPKVGINGFGRIGRLVLRAAVEKDTVDVVAVNDPFINIDYMVYMFKYDSTHGRYK  57



>gb|AAF21599.1|AF006483_1 glyceraldehyde-3-phosphate dehydrogenase [Phaffia rhodozyma]
Length=338

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +VGINGFGRIGR+VLR A    DIDVVA+NDPFID  YM YMFKYDSTHGVFK
Sbjct  4    KVGINGFGRIGRIVLRNAIIHGDIDVVAINDPFIDLEYMVYMFKYDSTHGVFK  56



>gb|AIM55468.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIM55469.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
Length=113

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +VGINGFGRIGR+VLR A    D++VVAVNDPFID +YM YMFKYDSTHG FK
Sbjct  4    KVGINGFGRIGRIVLRNAIEHGDLEVVAVNDPFIDLDYMVYMFKYDSTHGRFK  56



>gb|ACV69976.1| NAD-dependent glyceraldehyde 3-P dehydrogenase [Solanum chacoense]
Length=337

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI   YM YMFKYDS HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVEYMTYMFKYDSVHGQWK  57



>ref|XP_004241503.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Solanum lycopersicum]
Length=337

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI   YM YMFKYDS HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVEYMTYMFKYDSVHGQWK  57



>dbj|BAE93607.1| glyceraldehyde-3-phosphate dehydrogenase [Ogataea minuta]
 dbj|BAE94373.1| glyceraldehyde-3-phosphate dehydrogenase [Ogataea minuta var. 
minuta]
Length=336

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VGINGFGRIGRLVLRIA SR DI+VVAVNDPFI A Y AYMFKYDSTHG ++
Sbjct  5    VGINGFGRIGRLVLRIALSRKDINVVAVNDPFIAAEYAAYMFKYDSTHGRYQ  56



>ref|XP_002131224.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Ciona 
intestinalis]
Length=334

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            ++GINGFGRIGRLV R A  RDD++VV++NDPFID  YM YMFKYDSTHGVF
Sbjct  4    KIGINGFGRIGRLVTRAAAGRDDVEVVSINDPFIDLTYMVYMFKYDSTHGVF  55



>gb|EJD75047.1| glyceraldehyde-3-phosphate dehydrogenase [Loa loa]
Length=339

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K ++GINGFGRIGRLVLR A  +D +DVVAVNDPFI+ +YM YMFKYDSTHG FK
Sbjct  3    KPKIGINGFGRIGRLVLRAAVEKDTVDVVAVNDPFINIDYMVYMFKYDSTHGRFK  57



>ref|XP_002508643.1| glyceraldehyde-3-phosphate dehydrogenase [Micromonas sp. RCC299]
 gb|ACO69901.1| glyceraldehyde-3-phosphate dehydrogenase [Micromonas sp. RCC299]
Length=411

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            K RVGINGFGRIGRLV+R +  RDDI+VVAVNDPF+ A+YMAYMFKYD+ HG F
Sbjct  58   KIRVGINGFGRIGRLVMRASLVRDDIEVVAVNDPFVTADYMAYMFKYDTVHGQF  111



>ref|XP_009171410.1| hypothetical protein T265_07589 [Opisthorchis viverrini]
 gb|KER24861.1| hypothetical protein T265_07589 [Opisthorchis viverrini]
Length=337

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            K +VGINGFGRIGRLVLR A  +  ++VVAVNDPFID NYM YMFKYDSTHGVF
Sbjct  3    KPKVGINGFGRIGRLVLRAAIDKGTVEVVAVNDPFIDLNYMKYMFKYDSTHGVF  56



>gb|AFJ04516.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Vernicia fordii]
Length=277

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI   YM YMFKYD+ HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDTVHGQWK  57



>sp|O13507.1|G3P_PHARH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH 
[Xanthophyllomyces dendrorhous]
 emb|CAA69652.1| glyceraldehyde-3-phosphate dehydrogenase [Xanthophyllomyces dendrorhous]
Length=338

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +VGINGFGRIGR+VLR A    DIDVVA+NDPFID  YM YMFKYDSTHGVFK
Sbjct  4    KVGINGFGRIGRIVLRNAIIHGDIDVVAINDPFIDLEYMVYMFKYDSTHGVFK  56



>ref|XP_010033372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Eucalyptus grandis]
 gb|KCW52989.1| hypothetical protein EUGRSUZ_J02288 [Eucalyptus grandis]
Length=337

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMNYMFKYDSVHGQWK  57



>ref|XP_001783115.1| predicted protein [Physcomitrella patens]
 sp|P34923.1|G3PC_PHYPA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Physcomitrella patens]
 emb|CAA51071.1| glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [Physcomitrella 
patens]
 gb|EDQ52052.1| predicted protein [Physcomitrella patens]
Length=342

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  448  TGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            + K +VGINGFGRIGRLV R+A  RDDI++VA+NDPFI   YM YMFKYDSTHG +K
Sbjct  4    SAKIKVGINGFGRIGRLVARVALERDDIELVAINDPFITPEYMTYMFKYDSTHGQWK  60



>ref|NP_001237544.1| glyceraldehyde-3-dehydrogenase C subunit [Glycine max]
 gb|ABA07956.1| glyceraldehyde-3-dehydrogenase C subunit [Glycine max]
Length=338

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWK  57



>gb|EYU22565.1| hypothetical protein MIMGU_mgv1a009585mg [Erythranthe guttata]
Length=337

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWK  57



>gb|AHA84255.1| glyceraldehyde-3-dehydrogenase C subunit [Phaseolus vulgaris]
Length=339

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>ref|NP_001236129.1| glyceraldehyde-3-phosphate dehydrogenase [Glycine max]
 gb|ABC75834.1| glyceraldehyde-3-phosphate dehydrogenase [Glycine max]
 gb|KHN23268.1| Glyceraldehyde-3-phosphate dehydrogenase [Glycine soja]
Length=338

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWK  57



>gb|KHN31915.1| Glyceraldehyde-3-phosphate dehydrogenase [Glycine soja]
Length=336

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWK  57



>ref|XP_003523131.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Glycine max]
Length=338

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWK  57



>ref|XP_006578692.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Glycine 
max]
Length=338

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWK  57



>ref|XP_003526975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Glycine max]
 gb|KHN23267.1| Glyceraldehyde-3-phosphate dehydrogenase [Glycine soja]
Length=338

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWK  57



>gb|KDO36893.1| hypothetical protein CISIN_1g024629mg [Citrus sinensis]
Length=188

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+   RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>gb|ERG79426.1| glyceraldehyde-3-phosphate dehydrogenase [Ascaris suum]
Length=360

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  442  QTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
             T  K +VGINGFGRIGRLVLR A  +D ++VVAVNDPFI+ +YM YMFKYDSTHG FK
Sbjct  19   STMSKPKVGINGFGRIGRLVLRAAVEKDTVEVVAVNDPFINIDYMVYMFKYDSTHGRFK  77



>gb|AFK45399.1| unknown [Lotus japonicus]
Length=337

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A +RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVALTRDDVELVAVNDPFITTDYMTYMFKYDSVHGPWK  57



>ref|XP_006219891.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2-like [Vicugna 
pacos]
Length=341

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK +VGINGFGRIGRLVLR A  +D ++VV+VNDPFI+ +YM Y+FKYDSTHG FK
Sbjct  2    GKAKVGINGFGRIGRLVLRAAVEKDTVEVVSVNDPFINIDYMVYLFKYDSTHGRFK  57



>gb|KDO36874.1| hypothetical protein CISIN_1g024565mg [Citrus sinensis]
Length=188

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+   RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>gb|ABR24229.1| gyceraldehyde-3-phosphate dehydrogenase [Taenia solium]
Length=336

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K +VGINGFGRIGRLVLR A + + +DVVAVNDPFID  YM YMFKYDSTHG FK
Sbjct  2    KPQVGINGFGRIGRLVLRAAVASNTVDVVAVNDPFIDLEYMVYMFKYDSTHGRFK  56



>ref|XP_007509837.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18952.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=435

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            ++GINGFGRIGRLVLR A  R DI+VVA+NDPFI+A Y+AYMFKYDSTHG  K
Sbjct  69   KIGINGFGRIGRLVLRAALERSDIEVVAINDPFIEAEYLAYMFKYDSTHGNLK  121



>gb|KDO36891.1| hypothetical protein CISIN_1g024629mg [Citrus sinensis]
Length=227

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+   RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>ref|XP_003059267.1| hypothetical protein MICPUCDRAFT_27359 [Micromonas pusilla CCMP1545]
 gb|EEH56399.1| hypothetical protein MICPUCDRAFT_27359 [Micromonas pusilla CCMP1545]
Length=407

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            K RVGINGFGRIGRLV+R    RDDI+VVAVNDPF+ A+YMAYMFKYD+ HG F
Sbjct  58   KIRVGINGFGRIGRLVMRACLLRDDIEVVAVNDPFVTADYMAYMFKYDTVHGRF  111



>gb|AGL39758.1| glyceraldehyde-3-phosphate dehydrogenase [Ogataea thermomethanolica]
Length=335

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VGINGFGRIGRLVLRIA +R D+DV+A+NDPFI   Y AYMFKYDSTHG FK
Sbjct  5    VGINGFGRIGRLVLRIALTRKDVDVIAINDPFIAPEYAAYMFKYDSTHGKFK  56



>gb|KDP30962.1| hypothetical protein JCGZ_11338 [Jatropha curcas]
Length=337

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYD+ HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVDYMTYMFKYDTVHGQWK  57



>ref|XP_002975979.1| hypothetical protein SELMODRAFT_175430 [Selaginella moellendorffii]
 gb|EFJ22884.1| hypothetical protein SELMODRAFT_175430 [Selaginella moellendorffii]
Length=345

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K ++GINGFGRIGRLV R+A  RDDI++VAVNDPFI  +YMAYMFKYDS HG +K
Sbjct  7    KVKLGINGFGRIGRLVARVALFRDDIELVAVNDPFISTDYMAYMFKYDSVHGKWK  61



>dbj|GAA28380.1| glyceraldehyde 3-phosphate dehydrogenase [Clonorchis sinensis]
Length=337

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            K +VGINGFGRIGRLVLR A  +  ++VVAVNDPFID NYM YMFKYDSTHG+F
Sbjct  3    KPKVGINGFGRIGRLVLRAAIDKGTVEVVAVNDPFIDLNYMKYMFKYDSTHGIF  56



>ref|XP_002265988.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Vitis vinifera]
 emb|CBI40083.3| unnamed protein product [Vitis vinifera]
Length=337

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI+ +YM YMFKYDS HG +K
Sbjct  3    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFINTDYMTYMFKYDSVHGQWK  57



>gb|KDO36890.1| hypothetical protein CISIN_1g024629mg [Citrus sinensis]
Length=218

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+   RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>gb|AIT71762.1| glyceraldehyde 4 phosphate dehydrogenase [Anisakis simplex]
Length=340

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K +VGINGFGRIGRLVLR A  +D ++VVAVNDPFI+ +YM YMFKYDSTHG FK
Sbjct  3    KPKVGINGFGRIGRLVLRAAIEKDTVEVVAVNDPFINIDYMVYMFKYDSTHGRFK  57



>dbj|BAO45907.1| glyceraldehyde-3 phosphate dehydrogenase [Acacia mangium]
Length=337

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R++  RDDI++VA+NDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVSLQRDDIELVAINDPFITTDYMTYMFKYDSVHGQWK  57



>ref|XP_006438115.1| hypothetical protein CICLE_v10032014mg [Citrus clementina]
 gb|ESR51355.1| hypothetical protein CICLE_v10032014mg [Citrus clementina]
Length=268

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK  60



>gb|KIZ01541.1| glyceraldehyde 3-phosphatedehydrogenase [Monoraphidium neglectum]
Length=338

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  445  TTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVF  615
            T  K ++GINGFGRIGRLVLR    RDD++VVA+NDPFI+  YMAYMFKYDS HG +
Sbjct  29   TKDKIKIGINGFGRIGRLVLRTTLDRDDVEVVAINDPFIEGEYMAYMFKYDSVHGRW  85



>gb|AIC84504.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84505.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84506.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
Length=107

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VGINGFGRIGR+VLR A    D++VVAVNDPFID +YM YMFKYDSTHG FK
Sbjct  1    VGINGFGRIGRIVLRNAIEHGDLEVVAVNDPFIDLDYMVYMFKYDSTHGRFK  52



>dbj|BAB68543.1| glyceraldehyde-3-phosphate dehydrogenase [Ascaris suum]
Length=340

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K +VGINGFGRIGRLVLR A  +D ++VVAVNDPFI+ +YM YMFKYDSTHG FK
Sbjct  3    KPKVGINGFGRIGRLVLRAAVEKDTVEVVAVNDPFINIDYMVYMFKYDSTHGRFK  57



>ref|XP_002318114.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|ABK93203.1| unknown [Populus trichocarpa]
 gb|EEE96334.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=338

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYD+ HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGQWK  57



>gb|KDO36892.1| hypothetical protein CISIN_1g024629mg [Citrus sinensis]
Length=252

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+   RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>gb|ESZ92004.1| glyceraldehyde 3-phosphate dehydrogenase [Sclerotinia borealis 
F-4157]
Length=339

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  457  TRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            T+VGINGFGRIGR+V R A   DDID+VAVNDPFID  Y AYM KYDSTHG FK
Sbjct  4    TKVGINGFGRIGRIVFRNAIEHDDIDIVAVNDPFIDTKYAAYMLKYDSTHGQFK  57



>gb|KDO82023.1| hypothetical protein CISIN_1g019445mg [Citrus sinensis]
Length=296

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK  60



>ref|XP_002968506.1| hypothetical protein SELMODRAFT_169833 [Selaginella moellendorffii]
 gb|EFJ30760.1| hypothetical protein SELMODRAFT_169833 [Selaginella moellendorffii]
Length=349

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K ++GINGFGRIGRLV R+A  RDDI++VAVNDPFI  +YMAYMFKYDS HG +K
Sbjct  7    KVKLGINGFGRIGRLVARVALFRDDIELVAVNDPFISTDYMAYMFKYDSVHGKWK  61



>ref|NP_001275277.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like [Solanum 
tuberosum]
 gb|AFX67011.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum]
Length=337

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  3    KVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVDYMTYMFKYDSVHGQWK  57



>gb|AIC84477.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84478.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84479.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84480.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84481.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84482.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84483.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84484.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84485.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84486.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84487.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84489.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84490.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84491.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84492.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84493.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84494.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84495.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84496.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84497.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84498.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84499.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84500.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84501.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84502.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
 gb|AIC84503.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cryptococcus 
gattii]
Length=107

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  463  VGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            VGINGFGRIGR+VLR A    D++VVAVNDPFID +YM YMFKYDSTHG FK
Sbjct  1    VGINGFGRIGRIVLRNAIEHGDLEVVAVNDPFIDLDYMVYMFKYDSTHGRFK  52



>sp|O01360.1|G3P_ONCVO RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH; 
AltName: Full=Larval antigen OvB95 [Onchocerca volvulus]
 emb|CAA70607.1| glyceraldehyde-3-phosphate dehydrogenase [Onchocerca volvulus]
Length=339

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K ++GINGFGRIGRLVLR A  +D ++VVAVNDPFI+ +YM YMFKYDSTHG FK
Sbjct  3    KPKIGINGFGRIGRLVLRAAVEKDTVEVVAVNDPFINIDYMVYMFKYDSTHGRFK  57



>gb|AEK51008.1| glyceraldehyde-3-phosphate dehydrogenase [Rhizoctonia solani]
Length=342

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  460  RVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            +VGINGFGRIGR+VLR A    DIDVVAVNDPFID  YM YMFKYDSTHG FK
Sbjct  4    KVGINGFGRIGRIVLRNAIQHGDIDVVAVNDPFIDLEYMVYMFKYDSTHGRFK  56



>gb|KDO36888.1| hypothetical protein CISIN_1g024629mg [Citrus sinensis]
Length=265

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+   RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>dbj|BAJ10716.1| glyceraldehyde-3-phosphate dehydrogenase [Cladopus doianus]
Length=337

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI+ +YM YMFKYD+ HG +K
Sbjct  2    GKIKIGINGFGRIGRLVARVALLRDDVELVAVNDPFINTDYMTYMFKYDTVHGHWK  57



>ref|XP_010494704.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=375

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 90/148 (61%), Gaps = 24/148 (16%)
 Frame = +1

Query  193  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  354
            M FSSLLRS       P   +  +SS  H    S  GF+   TS +F     G+A+    
Sbjct  1    MAFSSLLRSAATSAAAPRVELYPSSSYDHSQVTSSLGFSHNLTSSRFS----GAAVSTGS  56

Query  355  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFGRIGRLVLRIATSRDDID  534
            SSS+Q   + S+QP+KATAT  PP + +S+++GKT+VGINGFGRIGRLVLRIAT RDDI+
Sbjct  57   SSSLQKCNARSVQPIKATATAAPPAVERSRSSGKTKVGINGFGRIGRLVLRIATFRDDIE  116

Query  535  VVAVNDPFIDANYMAYMFKYDSTHGVFK  618
                          AYMFKYDSTHG +K
Sbjct  117  --------------AYMFKYDSTHGNYK  130



>ref|XP_006438114.1| hypothetical protein CICLE_v10032014mg [Citrus clementina]
 gb|ESR51354.1| hypothetical protein CICLE_v10032014mg [Citrus clementina]
 gb|KDO82021.1| hypothetical protein CISIN_1g019445mg [Citrus sinensis]
Length=341

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  454  KTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            K ++GINGFGRIGRLV R+A  RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK  60



>gb|KDO36873.1| hypothetical protein CISIN_1g024565mg [Citrus sinensis]
Length=265

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  451  GKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFK  618
            GK ++GINGFGRIGRLV R+   RDD+++VAVNDPFI  +YM YMFKYDS HG +K
Sbjct  2    GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWK  57



>ref|XP_002835820.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ79977.1| unnamed protein product [Tuber melanosporum]
Length=184

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  433  PKSQTTGKTRVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDANYMAYMFKYDSTHGV  612
            P SQ      +GINGFGRIGRLVLR A  RDD+ VVAVNDPFID  Y  YMFKYDS HG 
Sbjct  71   PGSQFKMAVPIGINGFGRIGRLVLRNAAERDDVRVVAVNDPFIDPKYAVYMFKYDSAHGN  130

Query  613  FK  618
            FK
Sbjct  131  FK  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520