BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I18

Length=481
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO58581.1|  chalcone-flavanone isomerase family protein            233   1e-74   Ipomoea nil [qian niu]
dbj|BAO58577.1|  chalcone-flavanone isomerase family protein            233   2e-74   Ipomoea nil [qian niu]
ref|XP_009627241.1|  PREDICTED: probable chalcone--flavonone isom...    189   5e-57   Nicotiana tomentosiformis
gb|AGE10598.1|  chalcone isomerase                                      187   3e-56   Lonicera japonica [Japanese honeysuckle]
ref|XP_011001399.1|  PREDICTED: probable chalcone--flavonone isom...    187   3e-56   Populus euphratica
gb|AIY53017.1|  chalcone isomerase                                      186   6e-56   Actinidia chrysantha
ref|XP_009804396.1|  PREDICTED: probable chalcone--flavonone isom...    186   9e-56   Nicotiana sylvestris
gb|AIC33515.1|  CHI                                                     185   1e-55   Lycium chinense [Chinese boxthorn]
ref|XP_006371287.1|  hypothetical protein POPTR_0019s08610g             184   1e-55   
ref|XP_002325926.1|  hypothetical protein POPTR_0019s08610g             185   1e-55   Populus trichocarpa [western balsam poplar]
gb|ADG27840.1|  chalcone isomerase                                      185   2e-55   Gossypium hirsutum [American cotton]
ref|XP_010252061.1|  PREDICTED: probable chalcone--flavonone isom...    184   3e-55   Nelumbo nucifera [Indian lotus]
ref|XP_006435919.1|  hypothetical protein CICLE_v10032749mg             184   3e-55   Citrus clementina [clementine]
gb|AFQ92051.1|  chalcone isomerase                                      184   3e-55   Pyrus pyrifolia [sha li]
dbj|BAJ10400.1|  enhancer of flavonoid production                       184   4e-55   Petunia x hybrida [garden petunia]
ref|XP_010321455.1|  PREDICTED: probable chalcone--flavonone isom...    184   5e-55   Solanum lycopersicum
gb|AGV53050.1|  chalcone isomerase                                      184   5e-55   Actinidia chinensis
ref|XP_007011312.1|  Chalcone-flavanone isomerase family protein        185   6e-55   
ref|XP_008233882.1|  PREDICTED: probable chalcone--flavonone isom...    183   6e-55   Prunus mume [ume]
gb|KJB74932.1|  hypothetical protein B456_012G014600                    183   6e-55   Gossypium raimondii
ref|XP_006365329.1|  PREDICTED: probable chalcone--flavonone isom...    182   1e-54   Solanum tuberosum [potatoes]
ref|XP_010253088.1|  PREDICTED: probable chalcone--flavonone isom...    182   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_008366803.1|  PREDICTED: probable chalcone--flavonone isom...    182   2e-54   Malus domestica [apple tree]
gb|AIC73814.1|  chalcone isomerase                                      182   3e-54   Hibiscus cannabinus [bimli-jute]
ref|XP_009349075.1|  PREDICTED: probable chalcone--flavonone isom...    183   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_009349076.1|  PREDICTED: probable chalcone--flavonone isom...    182   4e-54   Pyrus x bretschneideri [bai li]
emb|CBI25366.3|  unnamed protein product                                181   7e-54   Vitis vinifera
ref|XP_007218407.1|  hypothetical protein PRUPE_ppa011476mg             181   9e-54   Prunus persica
ref|XP_002280158.1|  PREDICTED: probable chalcone--flavonone isom...    181   9e-54   Vitis vinifera
ref|XP_009363797.1|  PREDICTED: probable chalcone--flavonone isom...    180   1e-53   Pyrus x bretschneideri [bai li]
gb|AHA61355.1|  chalcone isomerase                                      180   1e-53   Phyllanthus emblica [amla]
emb|CDP13908.1|  unnamed protein product                                181   2e-53   Coffea canephora [robusta coffee]
gb|KJB74930.1|  hypothetical protein B456_012G014600                    177   1e-52   Gossypium raimondii
gb|KDP21650.1|  hypothetical protein JCGZ_03321                         177   2e-52   Jatropha curcas
ref|XP_004307734.1|  PREDICTED: probable chalcone--flavonone isom...    177   3e-52   Fragaria vesca subsp. vesca
gb|ACM62743.1|  chalcone isomerase                                      176   7e-52   Garcinia mangostana [mangosteen]
ref|XP_008369367.1|  PREDICTED: probable chalcone--flavonone isom...    174   2e-51   Malus domestica [apple tree]
dbj|BAJ10401.1|  enhancer of flavonoid production                       174   5e-51   Torenia hybrid cultivar
emb|CAN70349.1|  hypothetical protein VITISV_012581                     172   2e-50   Vitis vinifera
ref|XP_009122136.1|  PREDICTED: probable chalcone--flavonone isom...    172   2e-50   Brassica rapa
dbj|BAJ10402.1|  enhancer of flavonoid production                       171   6e-50   Torenia hybrid cultivar
ref|XP_011084819.1|  PREDICTED: probable chalcone--flavonone isom...    171   7e-50   Sesamum indicum [beniseed]
gb|KCW65781.1|  hypothetical protein EUGRSUZ_G03138                     168   1e-49   Eucalyptus grandis [rose gum]
ref|XP_010067614.1|  PREDICTED: probable chalcone--flavonone isom...    169   3e-49   Eucalyptus grandis [rose gum]
gb|EYU35208.1|  hypothetical protein MIMGU_mgv1a024098mg                173   3e-49   Erythranthe guttata [common monkey flower]
ref|XP_006398989.1|  hypothetical protein EUTSA_v10014675mg             168   5e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010922741.1|  PREDICTED: probable chalcone--flavonone isom...    168   6e-49   Elaeis guineensis
ref|NP_568154.1|  Chalcone-flavanone isomerase family protein           168   7e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288659.1|  hypothetical protein CARUB_v10001966mg             167   1e-48   Capsella rubella
ref|XP_010931364.1|  PREDICTED: probable chalcone--flavonone isom...    166   3e-48   Elaeis guineensis
ref|XP_010103648.1|  Chalcone--flavonone isomerase                      167   3e-48   
ref|XP_002871147.1|  chalcone-flavanone isomerase family protein        166   4e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_002520870.1|  Chalcone--flavonone isomerase, putative            166   4e-48   
ref|XP_004502829.1|  PREDICTED: chalcone--flavonone isomerase-like      164   1e-47   Cicer arietinum [garbanzo]
ref|XP_008456952.1|  PREDICTED: probable chalcone--flavonone isom...    164   4e-47   Cucumis melo [Oriental melon]
emb|CDX70163.1|  BnaA10g25120D                                          163   4e-47   
ref|XP_004171055.1|  PREDICTED: chalcone--flavonone isomerase-like      163   6e-47   
gb|KCW65779.1|  hypothetical protein EUGRSUZ_G03138                     162   1e-46   Eucalyptus grandis [rose gum]
gb|KGN50734.1|  hypothetical protein Csa_5G221960                       163   2e-46   Cucumis sativus [cucumbers]
emb|CDX98830.1|  BnaC09g50050D                                          161   3e-46   
pdb|4DOK|A  Chain A, Crystal Structure Of Arabidopsis Thaliana Ch...    161   4e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AHL83557.1|  chalcone isomerase type 4                               160   4e-46   Iris x hollandica [Dutch iris]
dbj|BAO32071.1|  chalcone isomerase Type4                               160   6e-46   Antirrhinum majus [garden snapdragon]
ref|XP_009384767.1|  PREDICTED: probable chalcone--flavonone isom...    160   6e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHL83555.1|  chalcone isomerase type 4                               160   6e-46   Iris x hollandica [Dutch iris]
ref|XP_011084820.1|  PREDICTED: probable chalcone--flavonone isom...    160   8e-46   Sesamum indicum [beniseed]
ref|XP_006398990.1|  hypothetical protein EUTSA_v10014675mg             159   1e-45   Eutrema salsugineum [saltwater cress]
gb|KEH35546.1|  chalcone-flavanone isomerase family protein             158   1e-45   Medicago truncatula
gb|AFK36813.1|  unknown                                                 159   1e-45   Medicago truncatula
dbj|BAB09970.1|  unnamed protein product                                159   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146474.1|  PREDICTED: chalcone--flavonone isomerase-like      161   2e-45   
ref|XP_009384766.1|  PREDICTED: probable chalcone--flavonone isom...    159   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006842472.1|  hypothetical protein AMTR_s00077p00075600          158   7e-45   
ref|XP_008792229.1|  PREDICTED: probable chalcone--flavonone isom...    157   1e-44   
gb|KEH35544.1|  chalcone-flavanone isomerase family protein             157   1e-44   Medicago truncatula
gb|AFK33841.1|  unknown                                                 156   2e-44   Medicago truncatula
ref|XP_007137637.1|  hypothetical protein PHAVU_009G143100g             156   2e-44   Phaseolus vulgaris [French bean]
gb|ABK23299.1|  unknown                                                 156   3e-44   Picea sitchensis
emb|CCM80406.1|  chalcone isomerase 2                                   155   9e-44   Lupinus angustifolius
emb|CCM80407.1|  chalcone isomerase 1                                   154   1e-43   Lupinus angustifolius
gb|ACN40662.1|  unknown                                                 154   1e-43   Picea sitchensis
ref|XP_010543680.1|  PREDICTED: probable chalcone--flavonone isom...    154   2e-43   Tarenaya hassleriana [spider flower]
ref|NP_001065990.1|  Os12g0115700                                       153   6e-43   
gb|AIU39024.1|  chalcone isomerase 2                                    152   1e-42   Narcissus tazetta subsp. chinensis
gb|AHY20030.1|  chalcone isomerase                                      151   2e-42   Tulipa fosteriana
ref|XP_006663745.1|  PREDICTED: probable chalcone--flavonone isom...    150   4e-42   Oryza brachyantha
ref|NP_001065587.1|  Os11g0116300                                       150   4e-42   
ref|XP_006435917.1|  hypothetical protein CICLE_v10032749mg             149   1e-41   
gb|EEC67544.1|  hypothetical protein OsI_34872                          149   2e-41   Oryza sativa Indica Group [Indian rice]
gb|EEE51527.1|  hypothetical protein OsJ_32725                          149   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977383.1|  PREDICTED: probable chalcone--flavonone isom...    148   5e-41   
ref|XP_006577878.1|  PREDICTED: chalcone isomerase 4B isoform X1        147   6e-41   
ref|XP_010452429.1|  PREDICTED: probable chalcone--flavonone isom...    147   7e-41   Camelina sativa [gold-of-pleasure]
ref|NP_001236782.1|  chalcone isomerase 4-like                          147   1e-40   Glycine max [soybeans]
gb|AHC07954.1|  CHI                                                     147   1e-40   Indosasa hispida
gb|EAZ19439.1|  hypothetical protein OsJ_35000                          146   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662673.1|  PREDICTED: probable chalcone--flavonone isom...    146   2e-40   Oryza brachyantha
gb|AFK43525.1|  unknown                                                 146   2e-40   Lotus japonicus
ref|XP_010491060.1|  PREDICTED: probable chalcone--flavonone isom...    146   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010238805.1|  PREDICTED: probable chalcone--flavonone isom...    146   2e-40   Brachypodium distachyon [annual false brome]
ref|NP_001242041.1|  chalcone isomerase 4B                              146   3e-40   
ref|XP_004978529.1|  PREDICTED: probable chalcone--flavonone isom...    145   3e-40   
gb|AAT94363.1|  chalcone isomerase 4B                                   143   4e-40   Glycine max [soybeans]
gb|ACU16129.1|  unknown                                                 145   5e-40   Glycine max [soybeans]
ref|XP_010423486.1|  PREDICTED: probable chalcone--flavonone isom...    144   1e-39   Camelina sativa [gold-of-pleasure]
gb|EAY82043.1|  hypothetical protein OsI_37230                          144   2e-39   Oryza sativa Indica Group [Indian rice]
gb|KHN25809.1|  Chalcone--flavonone isomerase                           144   4e-39   Glycine soja [wild soybean]
ref|XP_010670602.1|  PREDICTED: probable chalcone--flavonone isom...    142   8e-39   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ95751.1|  predicted protein                                      142   9e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006662674.1|  PREDICTED: probable chalcone--flavonone isom...    140   3e-38   Oryza brachyantha
gb|AGY46121.1|  chalcone isomerase 2                                    140   4e-38   Dendrobium hybrid cultivar
gb|AIS35913.1|  chalcone isomerase                                      139   7e-38   Phalaenopsis equestris
gb|AGY46120.1|  chalcone isomerase 1                                    138   3e-37   Dendrobium hybrid cultivar
gb|EPS69369.1|  hypothetical protein M569_05397                         141   3e-37   Genlisea aurea
gb|AEO17326.1|  chalcone isomerase                                      138   3e-37   Arachis hypogaea [goober]
gb|AHZ08832.1|  CHI-ACAD                                                137   4e-37   Allium cepa
gb|KCW65780.1|  hypothetical protein EUGRSUZ_G03138                     135   1e-36   Eucalyptus grandis [rose gum]
gb|ABS58500.1|  chalcone isomerase                                      135   4e-36   Oncidium hybrid cultivar
ref|XP_008809461.1|  PREDICTED: probable chalcone--flavonone isom...    134   7e-36   Phoenix dactylifera
ref|NP_001151452.1|  chalcone--flavonone isomerase                      131   2e-34   Zea mays [maize]
ref|NP_001170075.1|  uncharacterized protein LOC100383992               130   4e-34   Zea mays [maize]
ref|NP_001150388.1|  chalcone--flavonone isomerase                      129   1e-33   
gb|AGQ53961.1|  chalcone isomerase                                      123   2e-32   Dendrobium hybrid cultivar
gb|KEH35545.1|  chalcone-flavanone isomerase family protein             121   4e-31   Medicago truncatula
gb|EMT19676.1|  Chalcone--flavonone isomerase                           120   1e-30   
gb|EMS63262.1|  Vacuolar-sorting receptor 1                             117   4e-27   Triticum urartu
gb|KJB74931.1|  hypothetical protein B456_012G014600                    105   3e-25   Gossypium raimondii
dbj|BAH89258.1|  putative chalcone isomerase fragment                 97.8    3e-23   Diospyros kaki [Japanese persimmon]
dbj|BAO58582.1|  chalcone-flavanone isomerase family protein          95.9    9e-22   Ipomoea nil [qian niu]
ref|XP_001769093.1|  predicted protein                                95.5    5e-21   
ref|XP_001773128.1|  predicted protein                                95.5    6e-21   
gb|AIE16875.1|  chalcone isomerase                                    88.2    7e-19   Glycine max [soybeans]
ref|XP_002963874.1|  hypothetical protein SELMODRAFT_227414           81.6    6e-16   
ref|XP_002988277.1|  hypothetical protein SELMODRAFT_447240           79.7    3e-15   
ref|XP_011079722.1|  PREDICTED: chalcone--flavonone isomerase         75.9    8e-14   Sesamum indicum [beniseed]
gb|AEK70330.1|  chalcone isomerase                                    75.1    1e-13   Paeonia suffruticosa [moutan peony]
sp|Q2PF16.1|CFI_VERHY  RecName: Full=Chalcone--flavonone isomeras...  74.7    2e-13   Glandularia x hybrida [garden verbena]
ref|XP_002529711.1|  Chalcone--flavonone isomerase, putative          73.9    3e-13   
sp|O65333.1|CFI_ELAUM  RecName: Full=Chalcone--flavonone isomeras...  74.3    3e-13   Elaeagnus umbellata [aki-gumi]
ref|XP_006850685.1|  hypothetical protein AMTR_s00034p00233920        73.9    4e-13   Amborella trichopoda
gb|AIU98511.1|  chalcone isomerase                                    73.6    6e-13   Paeonia suffruticosa [moutan peony]
gb|AJR10104.1|  chalcone flavanone isomerase                          73.2    7e-13   Scutellaria baicalensis [Baikal skullcap]
gb|AEK32592.1|  chalcone isomerase                                    73.2    7e-13   Paeonia lactiflora [common garden peony]
ref|XP_001764300.1|  predicted protein                                73.2    8e-13   
gb|AAZ80911.1|  chalcone isomerase                                    72.8    1e-12   Canna x generalis
ref|XP_010259992.1|  PREDICTED: chalcone--flavonone isomerase 2-like  74.7    1e-12   Nelumbo nucifera [Indian lotus]
gb|ADQ13184.1|  chalcone isomerase                                    72.4    1e-12   Scutellaria baicalensis [Baikal skullcap]
sp|Q3Y4F4.1|CFI_CANGE  RecName: Full=Chalcone--flavonone isomeras...  72.4    1e-12   Canna x generalis
gb|ADK55061.1|  chalcone isomerase                                    72.4    1e-12   Paeonia suffruticosa [moutan peony]
gb|KDP46099.1|  hypothetical protein JCGZ_06610                       72.0    2e-12   Jatropha curcas
gb|ADP07932.1|  chalcone isomerase 2                                  68.6    2e-12   Vitis vinifera
gb|AHZ31749.1|  chalcone isomerase                                    71.2    3e-12   Viola x wittrockiana
ref|XP_010063418.1|  PREDICTED: chalcone--flavonone isomerase-like    71.2    3e-12   Eucalyptus grandis [rose gum]
sp|A7ISP6.1|CFI3_SOYBN  RecName: Full=Chalcone--flavonone isomera...  70.9    5e-12   Glycine max [soybeans]
ref|XP_011027080.1|  PREDICTED: chalcone--flavonone isomerase-like    70.5    5e-12   Populus euphratica
dbj|BAG14301.1|  chalcone isomerase                                   70.5    6e-12   Perilla frutescens var. crispa
gb|ACU13680.1|  unknown                                               70.5    7e-12   Glycine max [soybeans]
ref|NP_001236768.1|  chalcone--flavonone isomerase 2-A                70.1    7e-12   
ref|XP_002315258.1|  chalcone isomerase family protein                70.1    7e-12   Populus trichocarpa [western balsam poplar]
gb|ACN60401.1|  chalcone isomerase                                    69.7    1e-11   Capsicum annuum
ref|XP_007159893.1|  hypothetical protein PHAVU_002G276500g           69.7    1e-11   Phaseolus vulgaris [French bean]
gb|ADG21950.1|  chalcone isomerase                                    67.4    1e-11   Morella rubra [Chinese arbutus]
ref|XP_010555785.1|  PREDICTED: chalcone--flavonone isomerase-like    69.3    2e-11   Tarenaya hassleriana [spider flower]
sp|A5ANT9.1|CFI2_VITVI  RecName: Full=Chalcone--flavonone isomera...  68.9    2e-11   Vitis vinifera
ref|XP_008233532.1|  PREDICTED: chalcone--flavonone isomerase         68.9    2e-11   Prunus mume [ume]
prf||1807331A  chalcone flavanone isomerase                           69.7    2e-11
sp|P11650.1|CFI1_PETHY  RecName: Full=Chalcone--flavonone isomera...  68.9    2e-11   Petunia x hybrida [garden petunia]
gb|ABA55017.2|  chalcone isomerase                                    68.9    2e-11   Astragalus mongholicus
sp|Q9M5B3.1|CFI3_PETHY  RecName: Full=Chalcone--flavonone isomera...  68.9    2e-11   Petunia x hybrida [garden petunia]
ref|XP_009344896.1|  PREDICTED: chalcone--flavonone isomerase iso...  68.6    3e-11   
gb|AEV53926.1|  chalcone isomerase                                    68.9    3e-11   Brunfelsia brasiliensis subsp. macrocalyx
sp|Q6BEH3.1|CFI_EUSER  RecName: Full=Chalcone--flavonone isomeras...  68.2    3e-11   Eustoma exaltatum subsp. russellianum [bluebells]
ref|NP_001268033.1|  chalcone--flavonone isomerase 2                  68.6    3e-11   Vitis vinifera
gb|ACS36662.1|  CHI protein                                           68.6    3e-11   Vitis labrusca [Concord grape]
gb|AGL81346.1|  chalcone isomerase                                    68.2    3e-11   Pyrus communis
gb|AGL50916.1|  chalcone synthase                                     68.2    4e-11   Pyrus communis
ref|XP_008349840.1|  PREDICTED: LOW QUALITY PROTEIN: chalcone--fl...  69.3    4e-11   
gb|ADP09377.1|  chalcone isomerase                                    68.2    4e-11   Pyrus pyrifolia [sha li]
gb|AHZ97871.1|  chalcone isomerase                                    68.2    4e-11   Punica granatum [granado]
gb|AEJ86531.1|  chalcone isomerase protein                            67.4    4e-11   Pyrus x bretschneideri [bai li]
sp|A5HBK6.1|CFI_PYRCO  RecName: Full=Chalcone--flavonone isomeras...  67.8    4e-11   Pyrus communis
sp|A2IBF8.1|CFI_GOSHI  RecName: Full=Chalcone--flavonone isomeras...  68.2    4e-11   Gossypium hirsutum [American cotton]
ref|XP_010101513.1|  Chalcone--flavonone isomerase                    67.0    7e-11   
ref|XP_007142689.1|  hypothetical protein PHAVU_007G008500g           67.4    7e-11   Phaseolus vulgaris [French bean]
gb|KCW51671.1|  hypothetical protein EUGRSUZ_J01153                   66.6    8e-11   Eucalyptus grandis [rose gum]
dbj|BAJ21533.1|  chalcone isomerase                                   67.4    8e-11   Dahlia pinnata
gb|AGM46640.1|  chalcone isomerase protein                            67.0    8e-11   Apium graveolens
ref|XP_008343525.1|  PREDICTED: chalcone--flavonone isomerase-like    66.6    8e-11   
ref|XP_008370149.1|  PREDICTED: chalcone--flavonone isomerase-lik...  69.3    8e-11   
ref|XP_010669773.1|  PREDICTED: chalcone--flavonone isomerase-like    67.0    9e-11   Beta vulgaris subsp. vulgaris [field beet]
sp|Q4AE12.1|CFI2_FRAAN  RecName: Full=Chalcone--flavonone isomera...  67.0    9e-11   Fragaria x ananassa
sp|Q43754.1|CFI_DIACA  RecName: Full=Chalcone--flavonone isomeras...  67.0    1e-10   Dianthus caryophyllus [carnation]
gb|AJO67975.1|  chalcone isomerase                                    67.0    1e-10   Prunus avium [gean]
gb|KJB78871.1|  hypothetical protein B456_013G023400                  67.4    1e-10   Gossypium raimondii
ref|XP_008776249.1|  PREDICTED: LOW QUALITY PROTEIN: chalcone--fl...  67.0    1e-10   Phoenix dactylifera
gb|ADZ54781.1|  chalcone isomerase                                    67.0    1e-10   Prunus avium [gean]
gb|AJO67964.1|  chalcone isomerase                                    66.6    1e-10   Prunus avium [gean]
gb|ACB37366.1|  chalcone isomerase 1                                  66.6    1e-10   Glycine max [soybeans]
dbj|BAO32070.1|  chalcone isomerase Type1                             66.6    1e-10   Antirrhinum majus [garden snapdragon]
gb|ACR38773.1|  unknown                                               66.6    1e-10   Zea mays [maize]
gb|KHG18033.1|  Chalcone--flavonone isomerase                         66.6    1e-10   Gossypium arboreum [tree cotton]
ref|XP_002980623.1|  hypothetical protein SELMODRAFT_444624           66.6    1e-10   Selaginella moellendorffii
gb|AFA55178.1|  chalcone isomerase                                    66.6    2e-10   Acacia confusa
ref|XP_004307451.1|  PREDICTED: chalcone--flavonone isomerase 1       66.6    2e-10   Fragaria vesca subsp. vesca
sp|Q4AE11.1|CFI1_FRAAN  RecName: Full=Chalcone--flavonone isomera...  66.6    2e-10   Fragaria x ananassa
gb|AEO36980.1|  chalcone isomerase                                    66.6    2e-10   Dimocarpus longan [longan]
ref|XP_010034339.1|  PREDICTED: chalcone--flavonone isomerase-like    66.6    2e-10   Eucalyptus grandis [rose gum]
ref|XP_009344895.1|  PREDICTED: chalcone--flavonone isomerase iso...  68.6    2e-10   Pyrus x bretschneideri [bai li]
gb|ADE76284.1|  unknown                                               67.0    2e-10   Picea sitchensis
gb|AHI86005.1|  chalcone isomerase                                    66.2    2e-10   Olea europaea
ref|XP_003592764.1|  Chalcone-flavonone isomerase 1B-1                65.9    2e-10   
gb|ACP30360.1|  chalcone isomerase protein                            65.9    2e-10   Malus hybrid cultivar
ref|XP_008386466.1|  PREDICTED: chalcone--flavonone isomerase         65.9    2e-10   
ref|XP_009335926.1|  PREDICTED: chalcone--flavonone isomerase-like    67.8    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_010910012.1|  PREDICTED: chalcone--flavonone isomerase         65.5    3e-10   Elaeis guineensis
sp|Q45QI7.2|CFI_CAMSI  RecName: Full=Chalcone--flavonone isomeras...  65.5    3e-10   Camellia sinensis [black tea]
gb|ACQ41836.1|  chalcone-flavanone isomerase                          65.5    3e-10   Elaeis oleifera
ref|XP_008370163.1|  PREDICTED: chalcone--flavonone isomerase-lik...  67.8    3e-10   
sp|Q565D8.1|CFI_GENTR  RecName: Full=Chalcone--flavonone isomeras...  65.5    3e-10   Gentiana triflora
gb|AHJ80977.1|  chalcone isomerase                                    65.5    3e-10   Erythranthe lewisii
gb|EPS73111.1|  chalcone--flavonone isomerase                         65.5    3e-10   Genlisea aurea
gb|AFM29131.1|  chalcone isomerase                                    65.5    4e-10   Morus alba
gb|AFH02720.1|  chalcone isomerase                                    65.1    4e-10   Lonicera japonica [Japanese honeysuckle]
gb|ADZ28513.1|  chalcone isomerase                                    65.5    4e-10   Camellia nitidissima
ref|XP_008370159.1|  PREDICTED: chalcone--flavonone isomerase-lik...  67.4    4e-10   
gb|AGE10599.1|  chalcone isomerase                                    65.5    4e-10   Lonicera japonica [Japanese honeysuckle]
ref|XP_008370152.1|  PREDICTED: chalcone--flavonone isomerase-lik...  67.4    4e-10   
ref|XP_004497326.1|  PREDICTED: chalcone--flavonone isomerase 1-like  65.1    4e-10   Cicer arietinum [garbanzo]
ref|XP_003592763.1|  Chalcone-flavonone isomerase 2-B                 65.1    5e-10   Medicago truncatula
gb|AES63015.2|  chalcone-flavanone isomerase family protein           65.1    5e-10   Medicago truncatula
gb|AFP33452.1|  type I chalcone isomerase                             65.1    5e-10   Arachis hypogaea [goober]
ref|XP_008392235.1|  PREDICTED: chalcone--flavonone isomerase-like    64.7    5e-10   Malus domestica [apple tree]
ref|XP_008385653.1|  PREDICTED: chalcone--flavonone isomerase-like    66.2    5e-10   
gb|AIE16819.1|  chalcone isomerase                                    63.9    6e-10   Glycine soja [wild soybean]
gb|AFI25035.1|  chalcone isomerase                                    63.9    6e-10   Populus deltoides x Populus tremuloides
gb|AIY22761.1|  chalcone flavanone isomerase                          64.7    6e-10   Iochroma cyaneum
gb|AIE16811.1|  chalcone isomerase                                    63.9    6e-10   Glycine max [soybeans]
gb|AIE16809.1|  chalcone isomerase                                    63.5    7e-10   Glycine max [soybeans]
gb|AEO79980.1|  chalcone isomerase                                    64.7    7e-10   Prunus avium [gean]
ref|XP_006403490.1|  hypothetical protein EUTSA_v10010658mg           64.7    8e-10   Eutrema salsugineum [saltwater cress]
gb|AHY35310.1|  chalcone isomerase                                    64.3    8e-10   Morus notabilis
gb|ADK97764.1|  chalcone isomerase                                    64.3    8e-10   Eclipta alba
ref|XP_010101512.1|  Chalcone--flavonone isomerase                    64.3    9e-10   
gb|AGH13331.1|  chalcone isomerase                                    64.3    1e-09   Rhus chinensis
gb|ADT63063.1|  chalcone isomerase                                    64.3    1e-09   Fagopyrum esculentum
gb|ADO95199.1|  chalcone isomerase                                    62.4    1e-09   Litchi chinensis [litchi]
ref|XP_008370145.1|  PREDICTED: uncharacterized protein LOC103433...  66.6    1e-09   
ref|XP_007218371.1|  hypothetical protein PRUPE_ppa011276mg           63.9    1e-09   Prunus persica
dbj|BAO50257.1|  chalcone isomerase                                   63.9    1e-09   Tricyrtis sp. Shinonome
ref|XP_008370172.1|  PREDICTED: chalcone--flavonone isomerase-lik...  65.1    1e-09   
emb|CDP00020.1|  unnamed protein product                              64.3    1e-09   Coffea canephora [robusta coffee]
sp|Q8LKP9.1|CFI_SAUME  RecName: Full=Chalcone--flavonone isomeras...  63.9    1e-09   Saussurea medusa
ref|XP_003592768.1|  Chalcone-flavonone isomerase                     63.5    1e-09   
gb|AIT52345.1|  chalcone-flavonone isomerase 1                        63.9    1e-09   Daucus carota [carrots]
ref|XP_004238994.1|  PREDICTED: chalcone--flavonone isomerase         63.5    1e-09   
gb|AHH84790.1|  chalcone isomerase                                    63.9    1e-09   Fagopyrum dibotrys [jin qiao]
gb|ACG36556.1|  hypothetical protein                                  63.5    1e-09   Zea mays [maize]
gb|AES63019.2|  chalcone-flavanone isomerase family protein           63.5    2e-09   Medicago truncatula
ref|NP_001275866.1|  chalcone--flavonone isomerase                    63.5    2e-09   Citrus sinensis [apfelsine]
gb|KDO67822.1|  hypothetical protein CISIN_1g027531mg                 63.5    2e-09   Citrus sinensis [apfelsine]
gb|AJO67976.1|  chalcone isomerase                                    63.5    2e-09   Prunus cerasus [pie cherry]
sp|Q08704.1|CFI_MAIZE  RecName: Full=Chalcone--flavonone isomeras...  63.5    2e-09   Zea mays [maize]
gb|AIE16818.1|  chalcone isomerase                                    62.4    2e-09   Glycine soja [wild soybean]
gb|AIY22760.1|  chalcone flavanone isomerase                          63.5    2e-09   Iochroma calycinum
ref|XP_006348611.1|  PREDICTED: chalcone--flavonone isomerase-lik...  63.5    2e-09   Solanum tuberosum [potatoes]
gb|AIY22759.1|  chalcone flavanone isomerase                          63.5    2e-09   Iochroma calycinum
ref|XP_010669790.1|  PREDICTED: chalcone--flavonone isomerase-like    63.5    2e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|AJA79071.1|  chalcone isomerase                                    63.2    2e-09   Prunus persica
gb|KEH44523.1|  chalcone-flavanone isomerase family protein           62.8    2e-09   Medicago truncatula
ref|XP_002463631.1|  hypothetical protein SORBIDRAFT_01g003330        63.2    2e-09   Sorghum bicolor [broomcorn]
ref|XP_010032256.1|  PREDICTED: chalcone--flavonone isomerase-like    63.2    2e-09   Eucalyptus grandis [rose gum]
ref|XP_009587034.1|  PREDICTED: chalcone--flavonone isomerase         63.2    2e-09   Nicotiana tomentosiformis
gb|AGO02170.1|  chalcone isomerase                                    62.4    2e-09   Nekemias grossedentata
gb|ABY89684.1|  chalcone-flavanone isomerase 2 protein                63.2    3e-09   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_007009589.1|  Chalcone-flavanone isomerase family protein      63.5    3e-09   
dbj|BAJ17665.1|  chalcone isomerase                                   62.8    3e-09   Gynura bicolor
ref|XP_004497328.1|  PREDICTED: chalcone--flavonone isomerase 2-like  62.4    4e-09   Cicer arietinum [garbanzo]
ref|XP_006650802.1|  PREDICTED: chalcone--flavonone isomerase-like    62.8    4e-09   Oryza brachyantha
gb|ADB92596.1|  chalcone isomerase                                    62.4    4e-09   Citrus maxima [buntan]
gb|KCW67632.1|  hypothetical protein EUGRSUZ_F01378                   62.8    4e-09   
emb|CDY53696.1|  BnaA07g37900D                                        62.0    4e-09   
gb|ACF85686.1|  unknown                                               62.4    4e-09   
gb|AIE16814.1|  chalcone isomerase                                    61.2    4e-09   
gb|ACG37192.1|  hypothetical protein                                  62.4    4e-09   
ref|XP_003592761.1|  Chalcone-flavonone isomerase                     62.4    4e-09   
ref|XP_008463530.1|  PREDICTED: chalcone--flavonone isomerase-like    62.4    4e-09   
sp|P28012.1|CFI1_MEDSA  RecName: Full=Chalcone--flavonone isomera...  62.0    5e-09   
sp|P11651.1|CFI2_PETHY  RecName: Full=Chalcone--flavonone isomera...  62.0    5e-09   
gb|ABY89683.1|  chalcone-flavanone isomerase 1 protein                62.4    6e-09   
ref|XP_010060771.1|  PREDICTED: fatty-acid-binding protein 3 isof...  62.8    6e-09   
ref|XP_010060770.1|  PREDICTED: fatty-acid-binding protein 3 isof...  62.8    6e-09   
gb|AAU11844.1|  chalcone isomerase                                    61.6    7e-09   
sp|Q6QHK0.1|CFI_ALLCE  RecName: Full=Chalcone--flavonone isomeras...  61.6    7e-09   
gb|AGK90268.1|  chalcone isomerase                                    61.2    8e-09   
gb|AAU11843.1|  chalcone isomerase                                    61.6    8e-09   
gb|AGG40806.1|  chalcone isomerase                                    62.0    8e-09   
gb|AII80421.1|  chalcone isomerase                                    61.6    8e-09   
ref|XP_011009097.1|  PREDICTED: fatty-acid-binding protein 3          62.4    8e-09   
ref|XP_006377696.1|  hypothetical protein POPTR_0011s10330g           62.0    9e-09   
emb|CDP06071.1|  unnamed protein product                              62.0    9e-09   
ref|XP_004981264.1|  PREDICTED: chalcone--flavonone isomerase-like    61.2    1e-08   
sp|A1E261.1|CFI2_CHRMO  RecName: Full=Chalcone--flavonone isomera...  61.2    1e-08   
ref|XP_010034338.1|  PREDICTED: chalcone--flavonone isomerase-like    61.2    1e-08   
sp|A1E260.2|CFI1_CHRMO  RecName: Full=Chalcone--flavonone isomera...  61.2    1e-08   
gb|KFK34755.1|  hypothetical protein AALP_AA5G189500                  61.6    1e-08   
emb|CDX73402.1|  BnaC08g26010D                                        61.6    1e-08   
ref|XP_009116213.1|  PREDICTED: chalcone--flavonone isomerase         61.2    1e-08   
gb|ADE77594.1|  unknown                                               62.8    1e-08   
gb|AGJ50586.1|  CHI                                                   60.8    2e-08   
gb|AEO36936.1|  CHI                                                   60.5    2e-08   
ref|XP_011098156.1|  PREDICTED: fatty-acid-binding protein 3          61.6    2e-08   
gb|AEP37358.1|  chalcone isomerase                                    60.8    2e-08   
sp|Q8S3X0.1|CFI_HORVU  RecName: Full=Chalcone--flavonone isomeras...  60.5    2e-08   
pdb|1JX0|A  Chain A, Chalcone Isomerase--y106f Mutant                 60.5    2e-08   
sp|P28013.1|CFI2_MEDSA  RecName: Full=Chalcone--flavonone isomera...  60.1    2e-08   
gb|AID60040.1|  chalcone isomerase                                    60.5    2e-08   
sp|O22651.1|CFI_RAPSA  RecName: Full=Chalcone--flavonone isomeras...  60.8    2e-08   
ref|NP_001051714.1|  Os03g0819600                                     60.5    2e-08   
gb|AAM13448.1|AF474922_1  chalcone isomerase                          60.5    2e-08   
pdb|1JX1|A  Chain A, Chalcone Isomerase--T48a Mutant                  60.1    2e-08   
ref|NP_001144002.1|  chalcone flavanone isomerase1                    60.5    2e-08   
emb|CDY65002.1|  BnaCnng45660D                                        60.1    2e-08   
sp|Q33DL3.1|CFI_TOBAC  RecName: Full=Chalcone--flavonone isomeras...  60.5    3e-08   
gb|AHE41428.1|  chalcone isomerase                                    59.3    3e-08   
ref|XP_009804110.1|  PREDICTED: chalcone--flavonone isomerase         60.5    3e-08   
ref|XP_010427266.1|  PREDICTED: chalcone--flavonone isomerase 1-like  60.1    3e-08   
gb|KEH44525.1|  chalcone-flavanone isomerase family protein           60.1    3e-08   
gb|AGP25596.1|  chalcone isomerase                                    59.7    3e-08   
gb|AFL72080.1|  chalcone isomerase                                    60.1    3e-08   
sp|A4F1Q8.1|CFI_CLITE  RecName: Full=Chalcone--flavonone isomeras...  59.7    3e-08   
gb|ADB45305.1|  chalcone-flavanone isomerase                          60.1    4e-08   
gb|ADV71377.1|  chalcone isomerase 2                                  59.3    4e-08   
gb|AFJ38180.1|  chalcone flavanone isomerase                          59.7    4e-08   
emb|CAD69022.1|  chalcone isomerase                                   59.3    4e-08   
gb|AFJ38178.1|  chalcone flavanone isomerase                          59.3    5e-08   
gb|ADB43597.1|  chalcone isomerase                                    58.5    5e-08   
ref|XP_009396862.1|  PREDICTED: chalcone--flavonone isomerase         59.3    5e-08   
ref|NP_001236097.1|  chalcone--flavonone isomerase 1B-2               59.3    5e-08   
emb|CDY40202.1|  BnaA09g34840D                                        59.7    5e-08   
gb|EYU26287.1|  hypothetical protein MIMGU_mgv1a0115041mg             58.5    5e-08   
gb|KDO52113.1|  hypothetical protein CISIN_1g023649mg                 60.1    6e-08   
emb|CBX44252.1|  chalcone isomerase I                                 59.3    6e-08   
ref|XP_006442319.1|  hypothetical protein CICLE_v10021578mg           59.7    6e-08   
gb|KHN37310.1|  Chalcone--flavonone isomerase 1B-2                    58.9    6e-08   
sp|Q8H0G2.1|CFI1_LOTJA  RecName: Full=Chalcone--flavonone isomera...  58.9    6e-08   
ref|XP_006477800.1|  PREDICTED: fatty-acid-binding protein 3-like...  59.7    6e-08   
gb|ABW69691.1|  chalcone isomerase                                    59.3    6e-08   
ref|XP_004497327.1|  PREDICTED: chalcone--flavonone isomerase 1B-...  58.9    7e-08   
dbj|BAF96948.1|  chalcone isomerase                                   58.2    7e-08   
sp|A7ISP5.1|CFI2B_SOYBN  RecName: Full=Chalcone--flavonone isomer...  58.9    8e-08   
ref|NP_001236755.1|  chalcone--flavonone isomerase 1B-1               58.5    9e-08   
ref|XP_007212009.1|  hypothetical protein PRUPE_ppa011189mg           58.2    1e-07   
ref|XP_010516069.1|  PREDICTED: chalcone--flavonone isomerase 1       58.5    1e-07   
ref|XP_010694734.1|  PREDICTED: fatty-acid-binding protein 3 isof...  59.3    1e-07   
ref|XP_007142690.1|  hypothetical protein PHAVU_007G008600g           58.2    1e-07   
gb|EYU26288.1|  hypothetical protein MIMGU_mgv1a0115041mg             57.8    1e-07   
sp|Q8S911.1|CFI_IPOBA  RecName: Full=Chalcone--flavonone isomeras...  58.5    1e-07   
gb|AEK81535.1|  chalcone isomerase                                    58.5    1e-07   
ref|XP_006348610.1|  PREDICTED: chalcone--flavonone isomerase-like    58.2    1e-07   
gb|ACB42446.1|  chalcone isomerase                                    58.2    1e-07   
dbj|BAA90334.1|  chalcone isomerase                                   58.2    2e-07   
gb|ABW69677.1|  chalcone isomerase                                    58.2    2e-07   
sp|O22604.1|CFI_IPOPU  RecName: Full=Chalcone--flavonone isomeras...  58.2    2e-07   
gb|ABW69676.1|  chalcone isomerase                                    58.2    2e-07   
ref|XP_006293143.1|  hypothetical protein CARUB_v10019455mg           58.2    2e-07   
gb|KDP39780.1|  hypothetical protein JCGZ_04939                       58.2    2e-07   
gb|ABY73742.1|  chalcone isomerase                                    56.6    3e-07   
ref|XP_002976903.1|  hypothetical protein SELMODRAFT_151616           57.4    3e-07   
ref|XP_004239430.1|  PREDICTED: chalcone--flavonone isomerase-like    57.0    3e-07   
pir||S14705  chalcone isomerase (EC 5.5.1.6) - kidney bean (fragm...  57.0    3e-07
ref|XP_006665212.1|  PREDICTED: probable chalcone--flavonone isom...  55.5    4e-07   
ref|XP_008226205.1|  PREDICTED: fatty-acid-binding protein 3          57.8    4e-07   
ref|XP_002878019.1|  chalcone--flavonone isomerase                    57.0    4e-07   
ref|XP_004149817.1|  PREDICTED: chalcone--flavonone isomerase-like    57.0    4e-07   
sp|Q43056.1|CFI_PUEML  RecName: Full=Chalcone--flavonone isomeras...  56.6    4e-07   
gb|AJF45950.1|  type II chalcone isomerase                            56.6    4e-07   
ref|XP_010106740.1|  Chalcone--flavonone isomerase                    57.4    4e-07   
gb|AFW67165.1|  hypothetical protein ZEAMMB73_484762                  57.0    4e-07   
gb|ACB37367.1|  chalcone isomerase 2                                  56.6    4e-07   
ref|XP_010427262.1|  PREDICTED: chalcone--flavonone isomerase 1-like  56.6    5e-07   
ref|XP_010241349.1|  PREDICTED: fatty-acid-binding protein 3          57.4    5e-07   
ref|XP_009103952.1|  PREDICTED: chalcone--flavonone isomerase-like    57.0    5e-07   
sp|Q8H0F6.1|CFI3_LOTJA  RecName: Full=Chalcone--flavonone isomera...  56.2    6e-07   
ref|XP_009625508.1|  PREDICTED: fatty-acid-binding protein 3          57.0    6e-07   
gb|ABM66533.1|  chalcone isomerase                                    56.2    6e-07   
ref|NP_001235219.1|  chalcone--flavonone isomerase 1A                 56.2    6e-07   
gb|ACU13322.1|  unknown                                               56.2    6e-07   
ref|XP_007155613.1|  hypothetical protein PHAVU_003G216600g           56.2    7e-07   
dbj|BAD89981.1|  mutant protein of chalcone isomerase                 55.1    7e-07   
gb|EEE60187.1|  hypothetical protein OsJ_13133                        55.8    7e-07   
gb|AGO18337.1|  chalcone isomerase                                    55.5    7e-07   
gb|AHG95985.1|  chalcone isomerase                                    55.8    8e-07   
ref|XP_006370052.1|  hypothetical protein POPTR_0001s38970g           55.5    8e-07   
gb|AEF30419.1|  chalcone isomerase                                    55.1    8e-07   
ref|XP_008349841.1|  PREDICTED: chalcone--flavonone isomerase-like    54.7    8e-07   
sp|Q8H0G1.1|CFI2_LOTJA  RecName: Full=Chalcone--flavonone isomera...  55.8    9e-07   
ref|XP_003592766.1|  Chalcone-flavonone isomerase                     55.5    1e-06   
gb|ACA04009.1|  chalcone isomerase                                    55.1    1e-06   
sp|Q9LKC3.1|CFI_ARALP  RecName: Full=Chalcone--flavonone isomeras...  55.8    1e-06   
gb|AHY24650.1|  chalcone isomerase                                    54.7    1e-06   
sp|Q42663.1|CFI_CALCH  RecName: Full=Chalcone--flavonone isomeras...  55.5    1e-06   
ref|XP_010419421.1|  PREDICTED: chalcone--flavonone isomerase-like    55.8    1e-06   
ref|XP_002894446.1|  hypothetical protein ARALYDRAFT_474480           55.8    2e-06   
gb|ACT66123.1|  chalcone isomerase                                    54.3    2e-06   
gb|ADB28939.1|  chalcone isomerase                                    55.1    2e-06   
ref|XP_008784382.1|  PREDICTED: fatty-acid-binding protein 3 isof...  55.1    2e-06   
gb|KJB82093.1|  hypothetical protein B456_013G176000                  55.5    2e-06   
gb|KJB82094.1|  hypothetical protein B456_013G176000                  55.5    2e-06   
gb|KFK35722.1|  hypothetical protein AALP_AA4G028300                  55.5    2e-06   
gb|ABI54176.1|  chalcone isomerase A                                  54.7    2e-06   
gb|AFK46681.1|  unknown                                               54.7    2e-06   
ref|XP_010479918.1|  PREDICTED: fatty-acid-binding protein 3-like...  55.5    2e-06   
ref|XP_009413396.1|  PREDICTED: fatty-acid-binding protein 3          55.5    2e-06   
ref|XP_010479919.1|  PREDICTED: fatty-acid-binding protein 3-like...  55.5    2e-06   
emb|CEL26666.1|  chalcone isomerase                                   53.9    2e-06   
ref|XP_010501004.1|  PREDICTED: fatty-acid-binding protein 3-like     55.1    3e-06   
gb|KCW67630.1|  hypothetical protein EUGRSUZ_F01378                   55.1    3e-06   
ref|XP_008784378.1|  PREDICTED: fatty-acid-binding protein 3 isof...  54.7    3e-06   
ref|XP_010427261.1|  PREDICTED: chalcone--flavonone isomerase 1-like  54.3    4e-06   
ref|NP_191072.1|  chalcone--flavonone isomerase 1                     54.3    4e-06   
emb|CAB94970.1|  chalcone flavanone isomerase                         54.3    4e-06   
emb|CAB94981.1|  chalcone flavanone isomerase                         54.3    4e-06   
gb|AAA32766.1|  chalcone isomerase                                    54.3    4e-06   
emb|CDX73401.1|  BnaC08g26020D                                        55.1    4e-06   
ref|XP_006348346.1|  PREDICTED: fatty-acid-binding protein 3-like     54.7    4e-06   
ref|XP_010253382.1|  PREDICTED: chalcone--flavonone isomerase-like    54.3    4e-06   
emb|CEL26668.1|  chalcone isomerase                                   53.5    4e-06   
gb|AAM61303.1|  chalcone isomerase, putative                          54.7    4e-06   
dbj|BAC58031.1|  chalcone flavanone isomerase                         53.1    5e-06   
ref|XP_006850621.1|  hypothetical protein AMTR_s00034p00169430        53.9    5e-06   
ref|XP_002283758.2|  PREDICTED: fatty-acid-binding protein 3          54.3    5e-06   
ref|XP_010495213.1|  PREDICTED: chalcone--flavonone isomerase-like    53.5    5e-06   
emb|CCD74527.1|  NAC domain containing protein 24                     55.1    6e-06   
ref|XP_009769181.1|  PREDICTED: fatty-acid-binding protein 3          54.3    6e-06   
ref|XP_004244307.1|  PREDICTED: fatty-acid-binding protein 3          53.9    7e-06   
ref|XP_010462251.1|  PREDICTED: fatty-acid-binding protein 3-like     53.9    7e-06   
emb|CEL26667.1|  chalcone isomerase                                   52.8    8e-06   
gb|AAK49089.1|AF258297_1  chalcone flavonone synthase                 50.8    8e-06   
gb|AAK49088.1|AF258296_1  chalcone flavonone synthase                 50.4    1e-05   
ref|XP_006281010.1|  hypothetical protein CARUB_v10027024mg           53.1    1e-05   
gb|AEQ38547.1|  chalcone isomerase                                    50.8    1e-05   
ref|XP_004294183.1|  PREDICTED: fatty-acid-binding protein 3          53.5    1e-05   
ref|XP_006392782.1|  hypothetical protein EUTSA_v10011696mg           53.5    1e-05   
ref|XP_009339359.1|  PREDICTED: fatty-acid-binding protein 3-like...  53.1    1e-05   
pdb|4DOL|A  Chain A, Crystal Structure Of Arabidopsis Thaliana Fa...  52.8    1e-05   
ref|XP_010916104.1|  PREDICTED: fatty-acid-binding protein 3 isof...  53.1    1e-05   
ref|XP_009339358.1|  PREDICTED: fatty-acid-binding protein 3-like...  53.1    1e-05   
ref|XP_008370182.1|  PREDICTED: chalcone--flavonone isomerase-like    50.8    1e-05   
ref|XP_010694735.1|  PREDICTED: fatty-acid-binding protein 3 isof...  52.0    1e-05   
ref|XP_004488681.1|  PREDICTED: chalcone--flavonone isomerase-like    53.1    1e-05   
dbj|BAF03075.1|  chalcone isomerase                                   50.8    2e-05   
gb|KJB82095.1|  hypothetical protein B456_013G176000                  52.8    2e-05   
gb|AJF45951.1|  type II chalcone isomerase                            52.4    2e-05   
emb|CDY24090.1|  BnaA06g00880D                                        52.8    2e-05   
gb|AAF78437.1|AC018748_16  Contains a weak similarity to chalcone...  52.4    2e-05   
ref|XP_008357371.1|  PREDICTED: chalcone--flavonone isomerase         52.0    2e-05   
ref|NP_175757.1|  fatty-acid-binding protein 3                        52.8    2e-05   
ref|XP_010427268.1|  PREDICTED: chalcone--flavonone isomerase 1-l...  52.0    2e-05   
ref|XP_009147594.1|  PREDICTED: fatty-acid-binding protein 3          52.4    3e-05   
ref|XP_004146009.1|  PREDICTED: chalcone--flavonone isomerase 2-like  52.4    3e-05   
ref|XP_010535016.1|  PREDICTED: fatty-acid-binding protein 3          52.4    3e-05   
dbj|BAC98341.2|  chalcone isomerase                                   48.9    3e-05   
gb|AFM36773.1|  chalcone isomerase                                    51.6    4e-05   
ref|XP_004960880.1|  PREDICTED: chalcone--flavonone isomerase-like    52.4    4e-05   
sp|P41089.1|CFI_PEA  RecName: Full=Chalcone--flavonone isomerase;...  51.2    4e-05   
ref|XP_008452432.1|  PREDICTED: fatty-acid-binding protein 3 isof...  52.0    4e-05   
ref|XP_010427267.1|  PREDICTED: chalcone--flavonone isomerase 1-l...  51.6    4e-05   
ref|XP_008452433.1|  PREDICTED: fatty-acid-binding protein 3 isof...  52.0    4e-05   
ref|XP_008346589.1|  PREDICTED: LOW QUALITY PROTEIN: fatty-acid-b...  51.2    4e-05   
gb|ABA86593.1|  putative chalcone isomerase                           50.1    5e-05   
ref|XP_007022087.1|  Chalcone-flavanone isomerase family protein ...  50.8    5e-05   
gb|ABY55859.1|  CHIcm                                                 50.4    6e-05   
ref|XP_008784381.1|  PREDICTED: fatty-acid-binding protein 3 isof...  50.8    7e-05   
sp|O81980.1|CFI1_SOYBN  RecName: Full=Chalcone--flavonone isomera...  49.7    8e-05   
gb|AFM36772.1|  chalcone isomerase                                    50.8    8e-05   
gb|AFC75728.1|  chalcone isomerase                                    50.4    8e-05   
gb|AAK49085.1|AF258293_1  chalcone flavonone synthase                 47.8    9e-05   
ref|XP_005837532.1|  hypothetical protein GUITHDRAFT_151184           50.1    9e-05   
gb|KEH38484.1|  chalcone-flavanone isomerase family protein           50.8    1e-04   
ref|XP_007022085.1|  Chalcone-flavanone isomerase family protein ...  50.4    1e-04   
gb|AFK39093.1|  unknown                                               50.4    1e-04   
emb|CDY45118.1|  BnaC06g06390D                                        50.4    1e-04   
ref|XP_008366525.1|  PREDICTED: fatty-acid-binding protein 3-like     50.4    1e-04   
ref|XP_010916109.1|  PREDICTED: fatty-acid-binding protein 3 isof...  50.1    1e-04   
ref|XP_006305475.1|  hypothetical protein CARUB_v10009906mg           50.4    1e-04   
ref|XP_006850622.1|  hypothetical protein AMTR_s00034p00169920        49.7    1e-04   
ref|XP_004166149.1|  PREDICTED: LOW QUALITY PROTEIN: chalcone--fl...  49.7    2e-04   
gb|AAK49086.1|AF258294_1  chalcone flavonone synthase                 47.0    2e-04   
gb|AFC75729.1|  chalcone isomerase                                    49.7    2e-04   
ref|XP_010427260.1|  PREDICTED: chalcone--flavonone isomerase 1-like  49.3    2e-04   
emb|CAN75399.1|  hypothetical protein VITISV_004495                   49.3    2e-04   
gb|AFQ92050.1|  chalcone isomerase                                    47.8    3e-04   
gb|ADA60161.1|  chalcone isomerase                                    48.5    3e-04   
ref|XP_006593488.1|  PREDICTED: chalcone isomerase 3-like isoform X1  49.3    3e-04   
ref|NP_001238390.1|  chalcone isomerase 3-like                        49.3    3e-04   
gb|ACU19407.1|  unknown                                               49.3    3e-04   
gb|AHI94943.1|  chalcone-flavanone isomerase                          48.9    3e-04   
gb|AFM36771.1|  chalcone isomerase                                    48.9    3e-04   
gb|AEN03361.1|  chalcone isomerase                                    48.5    5e-04   
ref|XP_001759646.1|  predicted protein                                47.8    5e-04   



>dbj|BAO58581.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
Length=191

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/138 (100%), Positives = 138/138 (100%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK
Sbjct  1    MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  60

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDLLAEVDKYE
Sbjct  61   WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDLLAEVDKYE  120

Query  426  eeeeaalekvvdFFQSKY  479
            EEEEAALEKVVDFFQSKY
Sbjct  121  EEEEAALEKVVDFFQSKY  138



>dbj|BAO58577.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
 dbj|BAO58578.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
 dbj|BAO58579.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
 dbj|BAO58580.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
Length=206

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/138 (100%), Positives = 138/138 (100%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK
Sbjct  1    MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  60

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDLLAEVDKYE
Sbjct  61   WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDLLAEVDKYE  120

Query  426  eeeeaalekvvdFFQSKY  479
            EEEEAALEKVVDFFQSKY
Sbjct  121  EEEEAALEKVVDFFQSKY  138



>ref|XP_009627241.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nicotiana 
tomentosiformis]
Length=210

 Score =   189 bits (480),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG   VMVDE PFP Q  ++ K LSLMGHGITD+EIHFLQIK+TAIGVYLDPEIV+HLQ+
Sbjct  1    MGKNEVMVDEFPFPSQFMINTKPLSLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQ  60

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGKT  +L ++DDFFEAI+NAPVDK LRVVVIKEIKGSQYGVQLE++VRD LAEVDKYE
Sbjct  61   WKGKTGAELTENDDFFEAIVNAPVDKFLRVVVIKEIKGSQYGVQLESAVRDRLAEVDKYE  120

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+FFQSKY
Sbjct  121  EEEEEALEKIVEFFQSKY  138



>gb|AGE10598.1| chalcone isomerase [Lonicera japonica]
Length=208

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 125/138 (91%), Gaps = 2/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG+E VMVDE+PFPPQV +  K LSL+GHGITD+EIHFLQIK+TAIGVYLD EIVSHLQK
Sbjct  1    MGSE-VMVDEVPFPPQVTV-TKPLSLLGHGITDIEIHFLQIKFTAIGVYLDSEIVSHLQK  58

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGKT  +LA+DDDFF+++I+APVDK LRVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  59   WKGKTGTELAEDDDFFDSLISAPVDKCLRVVVIKEIKGSQYGVQLESAVRDRLAAADKYE  118

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALE++V+FFQSKY
Sbjct  119  EEEEEALEQLVEFFQSKY  136



>ref|XP_011001399.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Populus 
euphratica]
Length=210

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTEMV VDEIPFPPQ+ +  K LSL+GHGITD+EIHFLQIK+TAIGVYL+PEIV HLQ+
Sbjct  1    MGTEMVNVDEIPFPPQIAIATKPLSLLGHGITDIEIHFLQIKFTAIGVYLEPEIVGHLQQ  60

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +LA++DDFFEA+I APV+K LRVVVIKEIKGSQYGVQLE+ VRD LAE DKYE
Sbjct  61   WKGKPGNELAENDDFFEALIAAPVEKFLRVVVIKEIKGSQYGVQLESVVRDRLAEADKYE  120

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+FFQSKY
Sbjct  121  EEEEEALEKIVEFFQSKY  138



>gb|AIY53017.1| chalcone isomerase [Actinidia chrysantha]
Length=210

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 124/139 (89%), Gaps = 2/139 (1%)
 Frame = +3

Query  66   MGTEMVMV-DEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ  242
            MG+EMVMV DEIPFPPQV    K LSL+GHGITD+EIHFLQIK+TAIGVYLD EIV HLQ
Sbjct  1    MGSEMVMVADEIPFPPQVTT-TKPLSLLGHGITDIEIHFLQIKFTAIGVYLDCEIVGHLQ  59

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
            +WKGKT  DLA+DDDFFEA+++APV+K LRVVVIKEIKGSQYGVQLE++VRD LA  DKY
Sbjct  60   QWKGKTGKDLAEDDDFFEALVSAPVEKFLRVVVIKEIKGSQYGVQLESAVRDRLAADDKY  119

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEEAALE VV+FFQSKY
Sbjct  120  EEEEEAALELVVEFFQSKY  138



>ref|XP_009804396.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nicotiana 
sylvestris]
Length=210

 Score =   186 bits (471),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG   VM+DE PFP Q  ++ K LSLMG+GITD+EIHFLQIK+TAIGVYLDPEIV+HLQ+
Sbjct  1    MGKNEVMMDEFPFPSQFMINTKPLSLMGYGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQ  60

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGKT  +L ++DDFFEAI+NAPVDK LRVVVIKEIKGSQYGVQLE++VRD LAEVDKYE
Sbjct  61   WKGKTGTELTENDDFFEAIVNAPVDKFLRVVVIKEIKGSQYGVQLESAVRDRLAEVDKYE  120

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+FFQSKY
Sbjct  121  EEEEEALEKIVEFFQSKY  138



>gb|AIC33515.1| CHI [Lycium chinense]
Length=210

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG   VMVDEIPFP +  ++ K L LMGHGITD+EIHFLQIK+TAIGVYLDPEIVSHLQ+
Sbjct  1    MGKNEVMVDEIPFPSEFMMNTKPLPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVSHLQQ  60

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGKT   L ++D+FFEAI+NAPVDK LRVVVIKEIKGSQYGVQLE+++RD LAEVDKYE
Sbjct  61   WKGKTGAGLTENDEFFEAIVNAPVDKFLRVVVIKEIKGSQYGVQLESAIRDRLAEVDKYE  120

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+FFQSKY
Sbjct  121  EEEEEALEKIVEFFQSKY  138



>ref|XP_006371287.1| hypothetical protein POPTR_0019s08610g [Populus trichocarpa]
 gb|ERP49084.1| hypothetical protein POPTR_0019s08610g [Populus trichocarpa]
Length=160

 Score =   184 bits (466),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTEMV VDEIPFPPQ+ +  K LSL+GHGITD+EIHFLQIK+TAIGVYL+P+IV HLQ+
Sbjct  1    MGTEMVNVDEIPFPPQIAIATKPLSLLGHGITDIEIHFLQIKFTAIGVYLEPKIVGHLQQ  60

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +LA++DDFFEA+I APV+K LRVVVIKEIKGSQYGVQLE+ VRD LA+ DKYE
Sbjct  61   WKGKPGNELAENDDFFEALIAAPVEKFLRVVVIKEIKGSQYGVQLESVVRDRLADADKYE  120

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+FFQSKY
Sbjct  121  EEEEEALEKIVEFFQSKY  138



>ref|XP_002325926.1| hypothetical protein POPTR_0019s08610g [Populus trichocarpa]
 gb|ABK96098.1| unknown [Populus trichocarpa]
 gb|EEF00308.1| hypothetical protein POPTR_0019s08610g [Populus trichocarpa]
Length=210

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTEMV VDEIPFPPQ+ +  K LSL+GHGITD+EIHFLQIK+TAIGVYL+P+IV HLQ+
Sbjct  1    MGTEMVNVDEIPFPPQIAIATKPLSLLGHGITDIEIHFLQIKFTAIGVYLEPKIVGHLQQ  60

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +LA++DDFFEA+I APV+K LRVVVIKEIKGSQYGVQLE+ VRD LA+ DKYE
Sbjct  61   WKGKPGNELAENDDFFEALIAAPVEKFLRVVVIKEIKGSQYGVQLESVVRDRLADADKYE  120

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+FFQSKY
Sbjct  121  EEEEEALEKIVEFFQSKY  138



>gb|ADG27840.1| chalcone isomerase [Gossypium hirsutum]
 gb|KHG08378.1| Chalcone--flavonone isomerase [Gossypium arboreum]
Length=209

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TEMVMVDE+PFPPQ+    K LSL+GHGITD+EIHFLQIK+TAIGVYL+PE+V HLQ+
Sbjct  1    MTTEMVMVDEVPFPPQIT-TTKPLSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVGHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK    LA+DDDFFEA+INAPV+K LRVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKGKPGNVLAEDDDFFEALINAPVEKFLRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKVV+FFQSKY
Sbjct  120  EEEEEALEKVVEFFQSKY  137



>ref|XP_010252061.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nelumbo 
nucifera]
Length=209

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TE VMVDEIPFPP+++   K LSL+GHGITD+EIHFLQIK+TAIGVYLDPEIVSHLQ+
Sbjct  1    MSTETVMVDEIPFPPEIS-TLKPLSLIGHGITDIEIHFLQIKFTAIGVYLDPEIVSHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK+  +LA++DDFF+A+I+APVDK++RVVVIKEIKGSQYGVQLE++VRD LAEVDKYE
Sbjct  60   WKGKSGNELAKNDDFFDALISAPVDKLVRVVVIKEIKGSQYGVQLESAVRDRLAEVDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK++ FFQSKY
Sbjct  120  EEEEEALEKLIQFFQSKY  137



>ref|XP_006435919.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 ref|XP_006486169.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Citrus 
sinensis]
 gb|ESR49159.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
Length=209

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TE+VMVDEIPFPPQ+    K L+L+GHG+TD+EIHFLQIK+TAIGVYLDPEI+SHLQ+
Sbjct  1    MATEVVMVDEIPFPPQIT-TTKPLNLLGHGLTDIEIHFLQIKFTAIGVYLDPEILSHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK    LAQDDDFF+A+++APV+K LR+VVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKGKQGSSLAQDDDFFDALVSAPVEKFLRIVVIKEIKGSQYGVQLESAVRDRLAGADKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE+ALEK+V+FFQSKY
Sbjct  120  EEEESALEKIVEFFQSKY  137



>gb|AFQ92051.1| chalcone isomerase [Pyrus pyrifolia]
Length=209

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTE+VMVDE+PFPPQ+    KLLSL+G GITD+EIHFLQIK+TAIGVYLDPE+ SHLQ+
Sbjct  1    MGTEVVMVDEVPFPPQITT-TKLLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVASHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WK K   +LA+DDDFF+A+I+APV+K +RVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKAKKADELAEDDDFFDALISAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKVV+FFQSKY
Sbjct  120  EEEEEALEKVVEFFQSKY  137



>dbj|BAJ10400.1| enhancer of flavonoid production [Petunia x hybrida]
Length=210

 Score =   184 bits (466),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG   VMVDEIPFP Q  +  K L LMGHGITD+EIHFLQIK+TAIGVYLDPEIV+HLQ+
Sbjct  1    MGKNEVMVDEIPFPSQFMMTTKPLPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQ  60

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK+  +L ++D+FFEAI+NAPVDK LRVVVIKEIKGSQYGVQLE++VRD LAEVDKYE
Sbjct  61   WKGKSGAELIENDEFFEAIVNAPVDKFLRVVVIKEIKGSQYGVQLESAVRDRLAEVDKYE  120

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+FFQSKY
Sbjct  121  EEEEEALEKIVEFFQSKY  138



>ref|XP_010321455.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Solanum 
lycopersicum]
Length=210

 Score =   184 bits (466),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKT  260
            VMVDEIPFP Q  ++NK L LMGHGITD+EIHFLQIK+TAIGVYLDPEIV+HLQ+WKGKT
Sbjct  6    VMVDEIPFPSQFMVNNKPLPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKT  65

Query  261  PVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeeea  440
              +L ++D+FFEAI+NAPVDK LRVVVIKEIKGSQYGVQLE+++RD LAEVDKYEEEEE 
Sbjct  66   GAELTENDEFFEAIVNAPVDKFLRVVVIKEIKGSQYGVQLESAIRDRLAEVDKYEEEEEE  125

Query  441  alekvvdFFQSKY  479
            ALEK+V+FFQSKY
Sbjct  126  ALEKIVEFFQSKY  138



>gb|AGV53050.1| chalcone isomerase [Actinidia chinensis]
Length=210

 Score =   184 bits (466),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 123/139 (88%), Gaps = 2/139 (1%)
 Frame = +3

Query  66   MGTEMVMV-DEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ  242
            MG+EMVMV DEIPFPPQV    K LSL+GHGI D+EIHFLQIK+TAIGVYLD EIV HLQ
Sbjct  1    MGSEMVMVADEIPFPPQVTT-TKPLSLLGHGIADIEIHFLQIKFTAIGVYLDCEIVGHLQ  59

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
            +WKGKT  DLA+DDDFFEA+++APV+K LRVVVIKE+KGSQYGVQLE++VRD LA  DKY
Sbjct  60   QWKGKTGKDLAEDDDFFEALVSAPVEKFLRVVVIKEVKGSQYGVQLESAVRDRLAADDKY  119

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEEAALE VV+FFQSKY
Sbjct  120  EEEEEAALELVVEFFQSKY  138



>ref|XP_007011312.1| Chalcone-flavanone isomerase family protein [Theobroma cacao]
 gb|EOY20122.1| Chalcone-flavanone isomerase family protein [Theobroma cacao]
Length=264

 Score =   185 bits (470),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTEMVMVDEIPFPPQ+    K LSL+G+GITD+EIHFLQIK+TAIGVYL+PE+  HLQ+
Sbjct  56   MGTEMVMVDEIPFPPQIT-TTKPLSLLGYGITDIEIHFLQIKFTAIGVYLEPEVAGHLQQ  114

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK    LA+DDDFFEA+INAPV+K LRVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  115  WKGKPGNVLAEDDDFFEALINAPVEKFLRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  174

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKVV+FFQSKY
Sbjct  175  EEEEEALEKVVEFFQSKY  192



>ref|XP_008233882.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Prunus mume]
Length=209

 Score =   183 bits (465),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTE+V+VDE+PFPPQ+    K LSL+GHGITD+EIHFLQIK+TAIGVYLDPE+VSHLQ+
Sbjct  1    MGTEVVLVDEVPFPPQITT-TKPLSLLGHGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WK K   +LA+DDDFF A+I+APV+K LRVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKTKQANELAEDDDFFGALISAPVEKFLRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+FFQSKY
Sbjct  120  EEEEEALEKIVEFFQSKY  137



>gb|KJB74932.1| hypothetical protein B456_012G014600 [Gossypium raimondii]
Length=209

 Score =   183 bits (465),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TEMVMVDE+PFPPQ+    K LSL+GHGITD+EIHFLQIK+TAIGVYL+PE+V HLQ+
Sbjct  1    MTTEMVMVDEVPFPPQIT-TTKPLSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVGHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK    LA+DD+FFEA+INAPV+K LRVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKGKPGNVLAEDDNFFEALINAPVEKFLRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKVV+FFQSKY
Sbjct  120  EEEEEALEKVVEFFQSKY  137



>ref|XP_006365329.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Solanum 
tuberosum]
Length=210

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKT  260
            VMVDEIPFP Q  ++NK L LMGHGITD+EIHFLQIK+TAIGVYLDPEIV+HLQ+WKGKT
Sbjct  6    VMVDEIPFPSQFMVNNKPLPLMGHGITDIEIHFLQIKFTAIGVYLDPEIVTHLQQWKGKT  65

Query  261  PVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeeea  440
              +L ++D+FFEAI+NAPVDK LRVVVIKEIKGSQYGVQLE+++RD LAEVDKYEE+EE 
Sbjct  66   GEELTENDEFFEAIVNAPVDKFLRVVVIKEIKGSQYGVQLESAIRDRLAEVDKYEEDEEE  125

Query  441  alekvvdFFQSKY  479
            ALEK+V+FFQSKY
Sbjct  126  ALEKIVEFFQSKY  138



>ref|XP_010253088.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Nelumbo 
nucifera]
Length=212

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTE VMVD+IPF P+++  +K LSL+GHGITD+EIHFLQIK+TAIGVYL+PE+V+HLQ+
Sbjct  1    MGTETVMVDDIPFLPEIS-TSKPLSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVAHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK+  +LAQDDDFFEA+I+APV+K++RVVVIKEIKGSQYGVQ+E++VRD LA VDKYE
Sbjct  60   WKGKSGNELAQDDDFFEALISAPVEKIVRVVVIKEIKGSQYGVQIESAVRDRLAAVDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALE ++ FFQSKY
Sbjct  120  EEEEEALENIIQFFQSKY  137



>ref|XP_008366803.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Malus domestica]
Length=209

 Score =   182 bits (462),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTE+VMVDE+PFPPQ+    K LSL+G GITD+EIHFLQIK+TAIGVYLDPE+VSHLQ+
Sbjct  1    MGTEVVMVDEVPFPPQITT-TKPLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WK K   +LA+DDDFF+A+I+APV+K +RVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKAKKADELAEDDDFFDALISAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKVV+FFQSKY
Sbjct  120  EEEEEALEKVVEFFQSKY  137



>gb|AIC73814.1| chalcone isomerase [Hibiscus cannabinus]
Length=209

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TEMVMVDEIPFPPQ+    K LSL GHGITD+EIHFLQIK+TAIGVYL+P++V HLQ+
Sbjct  1    MSTEMVMVDEIPFPPQIT-TTKPLSLFGHGITDIEIHFLQIKFTAIGVYLEPQVVGHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK    LA+DDDFFEA+INAPV+K +RVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKGKPGNVLAEDDDFFEALINAPVEKFVRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKVV+FFQSKY
Sbjct  120  EEEEEALEKVVEFFQSKY  137



>ref|XP_009349075.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X1 
[Pyrus x bretschneideri]
Length=242

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 125/139 (90%), Gaps = 1/139 (1%)
 Frame = +3

Query  63   EMGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ  242
            +MGTE+VMVDE+PFPPQ+   +K LSL+G GITD+EIHFLQIK+TAIGVYLDPE+VSHLQ
Sbjct  33   KMGTEVVMVDEVPFPPQIT-TSKPLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVVSHLQ  91

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
            +WK K   +LA+DDDFF+A+I+APV+K +RVVVIKEIKGSQYGVQLE++VRD LA  DKY
Sbjct  92   QWKAKKADELAEDDDFFDALISAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRLAADDKY  151

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEE ALEKVV+FFQSKY
Sbjct  152  EEEEEEALEKVVEFFQSKY  170



>ref|XP_009349076.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X2 
[Pyrus x bretschneideri]
Length=240

 Score =   182 bits (463),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTE+VMVDE+PFPPQ+   +K LSL+G GITD+EIHFLQIK+TAIGVYLDPE+VSHLQ+
Sbjct  32   MGTEVVMVDEVPFPPQIT-TSKPLSLLGQGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQ  90

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WK K   +LA+DDDFF+A+I+APV+K +RVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  91   WKAKKADELAEDDDFFDALISAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  150

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKVV+FFQSKY
Sbjct  151  EEEEEALEKVVEFFQSKY  168



>emb|CBI25366.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   181 bits (459),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTEMVMVDEIPFPPQ+    K L L+G+GITD+EIHFLQIK+TAIGVYL+PEIV HLQ 
Sbjct  10   MGTEMVMVDEIPFPPQIT-TAKPLCLLGYGITDIEIHFLQIKFTAIGVYLEPEIVGHLQP  68

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK+  +LA++DDFFEA+I+AP +K LR+VVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  69   WKGKSGKELAENDDFFEALISAPGEKFLRIVVIKEIKGSQYGVQLESAVRDRLAADDKYE  128

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKVV+FFQSKY
Sbjct  129  EEEEEALEKVVEFFQSKY  146



>ref|XP_007218407.1| hypothetical protein PRUPE_ppa011476mg [Prunus persica]
 gb|AEJ88218.1| chalcone flavonone isomerase [Prunus persica]
 gb|EMJ19606.1| hypothetical protein PRUPE_ppa011476mg [Prunus persica]
Length=209

 Score =   181 bits (458),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTE+V+VD++PFP Q+    K LSL+GHGITD+EIHFLQIK+TAIGVYLDPE+VSHLQ+
Sbjct  1    MGTEVVLVDDVPFPSQITT-TKPLSLLGHGITDIEIHFLQIKFTAIGVYLDPEVVSHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WK K   +LA+DDDFF+A+I+APV+K LRVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKTKKANELAEDDDFFDALISAPVEKFLRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+FFQSKY
Sbjct  120  EEEEEALEKIVEFFQSKY  137



>ref|XP_002280158.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Vitis vinifera]
Length=209

 Score =   181 bits (458),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTEMVMVDEIPFPPQ+    K L L+G+GITD+EIHFLQIK+TAIGVYL+PEIV HLQ 
Sbjct  1    MGTEMVMVDEIPFPPQIT-TAKPLCLLGYGITDIEIHFLQIKFTAIGVYLEPEIVGHLQP  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK+  +LA++DDFFEA+I+AP +K LR+VVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKGKSGKELAENDDFFEALISAPGEKFLRIVVIKEIKGSQYGVQLESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKVV+FFQSKY
Sbjct  120  EEEEEALEKVVEFFQSKY  137



>ref|XP_009363797.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Pyrus x 
bretschneideri]
 ref|XP_009363878.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Pyrus x 
bretschneideri]
Length=209

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTE+VMVDE+PFPPQ+    K LSL+G GITD+EIHFLQIK+TAIGVYLD EIVSHLQ+
Sbjct  1    MGTEVVMVDEVPFPPQITT-TKPLSLLGQGITDIEIHFLQIKFTAIGVYLDAEIVSHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WK K   +LA+DDDFF+A+++APV+K +RVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKAKKASELAEDDDFFDALVSAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKVV+FFQSKY
Sbjct  120  EEEEEALEKVVEFFQSKY  137



>gb|AHA61355.1| chalcone isomerase [Phyllanthus emblica]
Length=209

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTE+VMVDEI FPPQ+    K LSL+GHGITD+EIHFLQIK+TAIGVYL+PEIV+HLQK
Sbjct  1    MGTEIVMVDEIAFPPQIT-TTKPLSLVGHGITDIEIHFLQIKFTAIGVYLEPEIVNHLQK  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            W GK+  +L +DDDFF A+I+APV+K LRVVVIKEIKGSQYGVQLE++VRD LAE DKYE
Sbjct  60   WNGKSGNELQEDDDFFAALIDAPVEKFLRVVVIKEIKGSQYGVQLESAVRDRLAEDDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEEAALEK+V+FFQSKY
Sbjct  120  EEEEAALEKLVEFFQSKY  137



>emb|CDP13908.1| unnamed protein product [Coffea canephora]
Length=244

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = +3

Query  63   EMGTEMVMVDEIPFPPQVN-LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHL  239
            +MGTE+V VDEIPFP QV     K LSL+GHGITD+EIHFLQIK+TAIGVY+D EIV++L
Sbjct  31   QMGTEVVKVDEIPFPLQVTPSTTKPLSLLGHGITDIEIHFLQIKFTAIGVYMDSEIVTYL  90

Query  240  QKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdk  419
            Q+WKGK   DLA+DDDFFEAII+APVDK LR+VVIKEIKGSQYGVQLE++VRD LA  D+
Sbjct  91   QQWKGKKCTDLAEDDDFFEAIISAPVDKFLRIVVIKEIKGSQYGVQLESAVRDRLAADDR  150

Query  420  yeeeeeaalekvvdFFQSKY  479
            YE+EEEAALE++++FFQ KY
Sbjct  151  YEDEEEAALEELIEFFQPKY  170



>gb|KJB74930.1| hypothetical protein B456_012G014600 [Gossypium raimondii]
Length=205

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 1/134 (1%)
 Frame = +3

Query  78   MVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGK  257
            MVMVDE+PFPPQ+    K LSL+GHGITD+EIHFLQIK+TAIGVYL+PE+V HLQ+WKGK
Sbjct  1    MVMVDEVPFPPQIT-TTKPLSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVGHLQQWKGK  59

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeee  437
                LA+DD+FFEA+INAPV+K LRVVVIKEIKGSQYGVQLE++VRD LA  DKYEEEEE
Sbjct  60   PGNVLAEDDNFFEALINAPVEKFLRVVVIKEIKGSQYGVQLESAVRDRLAADDKYEEEEE  119

Query  438  aalekvvdFFQSKY  479
             ALEKVV+FFQSKY
Sbjct  120  EALEKVVEFFQSKY  133



>gb|KDP21650.1| hypothetical protein JCGZ_03321 [Jatropha curcas]
Length=214

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +3

Query  69   GTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKW  248
            GTE+V+VDE+PFP ++    K LSL+GHGITD+EIHFLQIK+TAIGVYLDPEIV HLQ+W
Sbjct  7    GTEVVLVDEVPFPSKIT-TTKPLSLLGHGITDIEIHFLQIKFTAIGVYLDPEIVGHLQQW  65

Query  249  KGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyee  428
            KGK    LA+DDDFFEA+I APV+K LRVVVIKEIKGSQYGVQLE++VRD LA  DKYEE
Sbjct  66   KGKPGNHLAEDDDFFEALIAAPVEKFLRVVVIKEIKGSQYGVQLESAVRDRLAADDKYEE  125

Query  429  eeeaalekvvdFFQSKY  479
            EEE ALEKVV+FFQSKY
Sbjct  126  EEEEALEKVVEFFQSKY  142



>ref|XP_004307734.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Fragaria 
vesca subsp. vesca]
Length=212

 Score =   177 bits (448),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            +G+E+V+VDEIPFP  +   +K L+L+GHGITD+EIHFLQIK+TAIGVYLDPEIV HLQK
Sbjct  4    VGSEVVLVDEIPFPSVIT-TSKPLALLGHGITDIEIHFLQIKFTAIGVYLDPEIVGHLQK  62

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WK K   +LA+DDDFF+A+I+APV+K LRVVVIKEIKGSQYGVQLE+SVRD LA  DKYE
Sbjct  63   WKTKKGTELAEDDDFFDALISAPVEKFLRVVVIKEIKGSQYGVQLESSVRDRLAADDKYE  122

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+FFQSKY
Sbjct  123  EEEEEALEKIVEFFQSKY  140



>gb|ACM62743.1| chalcone isomerase [Garcinia mangostana]
Length=209

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TE+VMVDE+ FPPQ+    K LSL+GHG+TD+EIHFLQIK TAIGVYL+PE++SHLQK
Sbjct  1    MATEVVMVDEVSFPPQIT-TTKPLSLLGHGMTDIEIHFLQIKLTAIGVYLEPEVLSHLQK  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +LA++D+FF+A+I APV+K LRVV+IKEIKGSQYGVQLE+SVRD LAE DKYE
Sbjct  60   WKGKPGNELAENDEFFDALIAAPVEKFLRVVIIKEIKGSQYGVQLESSVRDRLAEEDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+FFQSKY
Sbjct  120  EEEEEALEKIVEFFQSKY  137



>ref|XP_008369367.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X1 
[Malus domestica]
 ref|XP_008369368.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X2 
[Malus domestica]
Length=209

 Score =   174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTE+V+VDE+PFP ++    K LSL+G GITD+EIHFLQIK+TAIGVYLD EIVSHLQ+
Sbjct  1    MGTEVVLVDEVPFPSKITT-TKPLSLLGQGITDIEIHFLQIKFTAIGVYLDAEIVSHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WK K   +LA+DDDFF+A+++APV+K +RVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKAKKANELAEDDDFFDALVSAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE  LEKVV+FFQSKY
Sbjct  120  EEEEETLEKVVEFFQSKY  137



>dbj|BAJ10401.1| enhancer of flavonoid production [Torenia hybrid cultivar]
Length=214

 Score =   174 bits (440),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = +3

Query  75   EMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKG  254
            E VMVDEI FP Q+ +  + LSL+GHGITD+EIHFLQIK+TAIG+YLD +I+ HLQKWKG
Sbjct  7    ETVMVDEISFPRQIQI-TRPLSLLGHGITDIEIHFLQIKFTAIGIYLDLQILDHLQKWKG  65

Query  255  KTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeee  434
            K+  +LAQDDDFFEAI++APV+K +RVVVIKEIKGSQYGVQLE++VRD LAE DKYEEEE
Sbjct  66   KSETELAQDDDFFEAIVSAPVEKFIRVVVIKEIKGSQYGVQLESAVRDRLAEEDKYEEEE  125

Query  435  eaalekvvdFFQSKY  479
            E++LEKVVDFFQSKY
Sbjct  126  ESSLEKVVDFFQSKY  140



>emb|CAN70349.1| hypothetical protein VITISV_012581 [Vitis vinifera]
Length=205

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = +3

Query  78   MVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGK  257
            MVMVDEIPFPPQ+    K L L+G+GITD+EIHFLQIK+TAIGVYL+PEIV HLQ WKGK
Sbjct  1    MVMVDEIPFPPQIT-TAKPLCLLGYGITDIEIHFLQIKFTAIGVYLEPEIVGHLQPWKGK  59

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeee  437
            +  +LA++DDFFEA+I+AP +K LR+VVIKEIKGSQYGVQLE++VRD LA  DKYEEEEE
Sbjct  60   SGKELAENDDFFEALISAPGEKFLRIVVIKEIKGSQYGVQLESAVRDRLAADDKYEEEEE  119

Query  438  aalekvvdFFQSKY  479
             ALEKVV+FFQSKY
Sbjct  120  EALEKVVEFFQSKY  133



>ref|XP_009122136.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Brassica 
rapa]
Length=209

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDP-EIVSHLQ  242
            MGTEMVMV E+PFPPQ+ + +K LSL+G GITD+EIHFLQ+K+TAIGVYLDP ++ +HL 
Sbjct  1    MGTEMVMVHEVPFPPQI-ITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLD  59

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
            KWKGKT  DLA DDDFF+A+ +  ++KV+RVVVIKEIKG+QYGVQLENSVRD LA  DKY
Sbjct  60   KWKGKTGKDLAGDDDFFDALASGEIEKVIRVVVIKEIKGAQYGVQLENSVRDRLAAEDKY  119

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEE  LEKVV FFQSKY
Sbjct  120  EEEEETELEKVVGFFQSKY  138



>dbj|BAJ10402.1| enhancer of flavonoid production [Torenia hybrid cultivar]
Length=214

 Score =   171 bits (433),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = +3

Query  75   EMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKG  254
            E V VDEI FP QV +  K LSL+GHGITD+EIHFLQIK+TAIG+YLD +IV HLQKWKG
Sbjct  7    ETVTVDEISFPRQVQI-TKPLSLVGHGITDIEIHFLQIKFTAIGIYLDLQIVDHLQKWKG  65

Query  255  KTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeee  434
            K+  +LA+DDDFFEAI++APV+K  RVVVIKEIKGSQYGVQLE++VRD LAE DKYEEEE
Sbjct  66   KSETELAKDDDFFEAIVSAPVEKFFRVVVIKEIKGSQYGVQLESAVRDRLAEEDKYEEEE  125

Query  435  eaalekvvdFFQSKY  479
            E +LEKVV+FFQSKY
Sbjct  126  EESLEKVVEFFQSKY  140



>ref|XP_011084819.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Sesamum 
indicum]
Length=213

 Score =   171 bits (432),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 123/140 (88%), Gaps = 3/140 (2%)
 Frame = +3

Query  66   MGTE--MVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHL  239
            MGTE  +VMVD IPFP  VN+  K LSL+GHGITD+EIHFLQIK+TAIGVYLDP+IVSHL
Sbjct  1    MGTEAEVVMVDGIPFPSLVNV-TKPLSLLGHGITDIEIHFLQIKFTAIGVYLDPQIVSHL  59

Query  240  QKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdk  419
             KWKGK+  +L QD  FF+ II+APVDK++RVVVIKEIKGSQ+GVQ+E++VRD LAE+DK
Sbjct  60   HKWKGKSAAELTQDHHFFQTIISAPVDKLVRVVVIKEIKGSQFGVQIESAVRDRLAEIDK  119

Query  420  yeeeeeaalekvvdFFQSKY  479
            YEEEEE ALE++V+FFQSKY
Sbjct  120  YEEEEEEALEQLVEFFQSKY  139



>gb|KCW65781.1| hypothetical protein EUGRSUZ_G03138 [Eucalyptus grandis]
Length=165

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG+EMVMVDE PFP Q+    K LSL+GHGITD+EIHFLQIK+TAIGVYLDPEIV HL++
Sbjct  1    MGSEMVMVDEFPFPSQIT-TTKPLSLLGHGITDMEIHFLQIKFTAIGVYLDPEIVGHLKQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK    LA+DDDFF+A+ +APV+K  R+VVIKEIKGSQYG  LE +VRD LA  DKYE
Sbjct  60   WKGKPGKVLAEDDDFFDAVASAPVEKFFRIVVIKEIKGSQYGGLLEGAVRDRLAAEDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEEAALEKVV+FFQSKY
Sbjct  120  EEEEAALEKVVEFFQSKY  137



>ref|XP_010067614.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Eucalyptus 
grandis]
 gb|KCW65777.1| hypothetical protein EUGRSUZ_G03138 [Eucalyptus grandis]
 gb|KCW65778.1| hypothetical protein EUGRSUZ_G03138 [Eucalyptus grandis]
Length=209

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG+EMVMVDE PFP Q+    K LSL+GHGITD+EIHFLQIK+TAIGVYLDPEIV HL++
Sbjct  1    MGSEMVMVDEFPFPSQIT-TTKPLSLLGHGITDMEIHFLQIKFTAIGVYLDPEIVGHLKQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK    LA+DDDFF+A+ +APV+K  R+VVIKEIKGSQYG  LE +VRD LA  DKYE
Sbjct  60   WKGKPGKVLAEDDDFFDAVASAPVEKFFRIVVIKEIKGSQYGGLLEGAVRDRLAAEDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEEAALEKVV+FFQSKY
Sbjct  120  EEEEAALEKVVEFFQSKY  137



>gb|EYU35208.1| hypothetical protein MIMGU_mgv1a024098mg [Erythranthe guttata]
Length=365

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = +3

Query  75   EMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKG  254
            E VMVDE+PFP Q+    K L L+ +GITD+EIHFLQIK+TAIGVYLDPEIV+HL KWKG
Sbjct  160  ESVMVDEVPFPSQIT-TTKTLPLLANGITDIEIHFLQIKFTAIGVYLDPEIVTHLIKWKG  218

Query  255  KTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeee  434
            K+  DLA+DDDFFEAII+APV+K++RVVVIKEIKGSQ+GVQ+E++VRD LAEVDK+EEEE
Sbjct  219  KSAADLAKDDDFFEAIISAPVEKLIRVVVIKEIKGSQFGVQIESAVRDRLAEVDKFEEEE  278

Query  435  eaalekvvdFFQSKY  479
            E ALE++VDFFQSKY
Sbjct  279  EEALEQLVDFFQSKY  293



>ref|XP_006398989.1| hypothetical protein EUTSA_v10014675mg [Eutrema salsugineum]
 gb|ESQ40442.1| hypothetical protein EUTSA_v10014675mg [Eutrema salsugineum]
Length=209

 Score =   168 bits (426),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLD-PEIVSHLQ  242
            MGTEMVMV E+PFPPQ+ + +K LSL+G GITD+EIHFLQ+K+TAIGVYLD  ++ ++L+
Sbjct  1    MGTEMVMVHEVPFPPQI-ITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDHSDVKTNLE  59

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
             WKGKT  DLA DDDFF+A+ +A V+KV+RVVVIKEIKGSQYGVQLEN+VRD LA  DKY
Sbjct  60   NWKGKTGKDLAGDDDFFDALASAEVEKVIRVVVIKEIKGSQYGVQLENAVRDRLAAEDKY  119

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEE  LEKVV FFQSKY
Sbjct  120  EEEEETELEKVVGFFQSKY  138



>ref|XP_010922741.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Elaeis guineensis]
Length=209

 Score =   168 bits (425),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG+EMVMVD +PFPP++    K L+L+GHGITD+EIHFLQIKY AIG+Y++  I+ HL  
Sbjct  1    MGSEMVMVDGVPFPPEITA-AKSLALLGHGITDIEIHFLQIKYNAIGIYMEKNIIEHLGN  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +LA+DD FFEA++ APVDK  R++VIKEIKGSQYGVQLE++VRD LA +DKYE
Sbjct  60   WKGKKGAELAEDDLFFEALVAAPVDKFFRIMVIKEIKGSQYGVQLESAVRDRLAAIDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV  FFQSKY
Sbjct  120  EEEEEALEKVSTFFQSKY  137



>ref|NP_568154.1| Chalcone-flavanone isomerase family protein [Arabidopsis thaliana]
 ref|NP_850770.1| Chalcone-flavanone isomerase family protein [Arabidopsis thaliana]
 sp|Q8VZW3.1|CFI3_ARATH RecName: Full=Probable chalcone--flavonone isomerase 3; Short=Chalcone 
isomerase 3; AltName: Full=Chalcone isomerase-like 
1 [Arabidopsis thaliana]
 gb|AAL36093.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20088.1| unknown protein [Arabidopsis thaliana]
 gb|AAM65565.1| contains similarity to chalcone-flavonone isomerase (chalcone 
isomerase) [Arabidopsis thaliana]
 gb|AED90848.1| Chalcone-flavanone isomerase family protein [Arabidopsis thaliana]
 gb|AED90849.1| Chalcone-flavanone isomerase family protein [Arabidopsis thaliana]
Length=209

 Score =   168 bits (425),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDP-EIVSHLQ  242
            MGTEMVMV E+PFPPQ+ + +K LSL+G GITD+EIHFLQ+K+TAIGVYLDP ++ +HL 
Sbjct  1    MGTEMVMVHEVPFPPQI-ITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLD  59

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
             WKGKT  +LA DDDFF+A+ +A ++KV+RVVVIKEIKG+QYGVQLEN+VRD LAE DKY
Sbjct  60   NWKGKTGKELAGDDDFFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTVRDRLAEEDKY  119

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEE  LEKVV FFQSKY
Sbjct  120  EEEEETELEKVVGFFQSKY  138



>ref|XP_006288659.1| hypothetical protein CARUB_v10001966mg [Capsella rubella]
 gb|EOA21557.1| hypothetical protein CARUB_v10001966mg [Capsella rubella]
Length=209

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDP-EIVSHLQ  242
            MGTEMVMV E+PFPPQ+ + +K LSL+G GITD+EIHFLQ+K+TAIGVYLDP ++ +HL 
Sbjct  1    MGTEMVMVHEVPFPPQI-ITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLV  59

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
             WKGKT  DLA DDDFF+A+ +  ++KV+RVVVIKEIKG+QYGVQLEN+VRD LA  DKY
Sbjct  60   NWKGKTSEDLAGDDDFFDALASGEMEKVIRVVVIKEIKGAQYGVQLENAVRDRLAAEDKY  119

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEE  LEKVV FFQSKY
Sbjct  120  EEEEETELEKVVGFFQSKY  138



>ref|XP_010931364.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Elaeis guineensis]
Length=209

 Score =   166 bits (421),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG+EMVMVD +PFPP+V +  K L+L+GHGITD+EIHFLQIKY AIG+Y++  IV HL  
Sbjct  1    MGSEMVMVDGVPFPPEVTV-AKPLALLGHGITDIEIHFLQIKYNAIGIYMEKNIVEHLGS  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +LA+DD FFEA+  APVDK  R+VVIKEIKGSQYGVQLE++VRD LA +DKYE
Sbjct  60   WKGKKGAELAEDDLFFEALAAAPVDKFFRIVVIKEIKGSQYGVQLESAVRDRLAAIDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            E EE ALEKV +FFQ+KY
Sbjct  120  EGEEEALEKVSEFFQTKY  137



>ref|XP_010103648.1| Chalcone--flavonone isomerase [Morus notabilis]
 gb|EXB96531.1| Chalcone--flavonone isomerase [Morus notabilis]
Length=229

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            +G+E+V+VDEIPFP ++ +  K L+L+GHGITD+E+HFLQIK+TAIGVYLD  +V+HL++
Sbjct  22   VGSEVVIVDEIPFPKEITI-TKPLALLGHGITDIEVHFLQIKFTAIGVYLDSVVVNHLEQ  80

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGKT  +LA+DDDFF A+I+APV+K++R+VVIKEIKG+QYGVQ+E+++RD LA  DKYE
Sbjct  81   WKGKTGNELAKDDDFFTALISAPVEKLVRIVVIKEIKGAQYGVQIESALRDRLAADDKYE  140

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+VDFFQSKY
Sbjct  141  EEEEEALEKIVDFFQSKY  158



>ref|XP_002871147.1| chalcone-flavanone isomerase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47406.1| chalcone-flavanone isomerase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=209

 Score =   166 bits (420),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDP-EIVSHLQ  242
            MGTEMVMV ++PFPPQ+ + +K LSL+G GITD+EIHFLQ+K+TAIGVYLDP ++ +HL 
Sbjct  1    MGTEMVMVHDVPFPPQI-ITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLD  59

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
             WKGKT  +LA DDDFF+A+ +A ++KV+RVVVIKEIKG+QYGVQLEN+VRD LAE DKY
Sbjct  60   NWKGKTGQELAGDDDFFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTVRDRLAEEDKY  119

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEE  LEKVV FFQSKY
Sbjct  120  EEEEETELEKVVGFFQSKY  138



>ref|XP_002520870.1| Chalcone--flavonone isomerase, putative [Ricinus communis]
 gb|EEF41579.1| Chalcone--flavonone isomerase, putative [Ricinus communis]
Length=204

 Score =   166 bits (419),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = +3

Query  84   MVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTP  263
            MV ++PFPPQ+    K LSL+GHGITD+EIHFLQIK+TAIGVYLDP+IV HLQ+WKGK  
Sbjct  1    MVHDVPFPPQIT-TLKPLSLLGHGITDIEIHFLQIKFTAIGVYLDPQIVGHLQQWKGKPG  59

Query  264  VDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeeeaa  443
              LA+DDDFF+A+I APV+K+LRVVVIKEIKGSQYGVQLE++VRD LAEVDKYEEEEE A
Sbjct  60   NQLAEDDDFFDALIAAPVEKLLRVVVIKEIKGSQYGVQLESAVRDRLAEVDKYEEEEEEA  119

Query  444  lekvvdFFQSKY  479
            LEKV +FFQSK+
Sbjct  120  LEKVTEFFQSKF  131



>ref|XP_004502829.1| PREDICTED: chalcone--flavonone isomerase-like [Cicer arietinum]
Length=209

 Score =   164 bits (416),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M +E V+VDEIP+P ++    K LSL+GHGITD+EIHFLQ+K+ +IGVYLDPE+V HLQ+
Sbjct  1    MASETVLVDEIPYPSKIT-TTKPLSLLGHGITDMEIHFLQVKFYSIGVYLDPEVVGHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +L  +DDFF+A+I+APV+KV+R+VVIKEIKGSQYGVQ+E +VRD LA  DKYE
Sbjct  60   WKGKPAKELENNDDFFDALISAPVEKVIRLVVIKEIKGSQYGVQIETAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKVV+FFQSKY
Sbjct  120  EEEEEALEKVVEFFQSKY  137



>ref|XP_008456952.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Cucumis 
melo]
Length=242

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 122/148 (82%), Gaps = 5/148 (3%)
 Frame = +3

Query  36   LSPSAF*D*EMGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYL  215
            LSPS      MG+E+ +V +I FP Q+ +  K LSL+GHG T++EIHFL+IK TAIGVYL
Sbjct  28   LSPSPI----MGSEVEVVADIAFPKQI-VKAKPLSLLGHGTTEIEIHFLEIKLTAIGVYL  82

Query  216  DPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVR  395
            +P +V HLQ+WKGK   DL +DDDFF+AI++APV+KV+RVVVIKEIKGSQYGVQLE++VR
Sbjct  83   EPSVVEHLQQWKGKAAKDLVEDDDFFQAIVSAPVEKVIRVVVIKEIKGSQYGVQLESAVR  142

Query  396  DllaevdkyeeeeeaalekvvdFFQSKY  479
            D LA  DKYE+EEEA LEK+V+FFQSKY
Sbjct  143  DRLAADDKYEDEEEAQLEKIVEFFQSKY  170



>emb|CDX70163.1| BnaA10g25120D [Brassica napus]
Length=205

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +3

Query  78   MVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDP-EIVSHLQKWKG  254
            MVMV E+PFPPQ+ + +K LSL+G GITD+EIHFLQ+K+TAIGVYLDP ++ +HL KWKG
Sbjct  1    MVMVHEVPFPPQI-ITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDKWKG  59

Query  255  KTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeee  434
            KT  DLA DDDFF+A+ +  ++KV+RVVVIKEIKG+QYGVQLENSVRD LA  DKYEEEE
Sbjct  60   KTGKDLAGDDDFFDALASGEIEKVIRVVVIKEIKGAQYGVQLENSVRDRLAAEDKYEEEE  119

Query  435  eaalekvvdFFQSKY  479
            E  LEKVV FFQSKY
Sbjct  120  ETELEKVVGFFQSKY  134



>ref|XP_004171055.1| PREDICTED: chalcone--flavonone isomerase-like [Cucumis sativus]
Length=209

 Score =   163 bits (412),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG+E+ +V +I FP Q+ +  K LSL+GHG T++EIHFL+IK TAIGVYL+P IV HLQ+
Sbjct  1    MGSEVEVVADIDFPKQI-VKAKPLSLLGHGSTEIEIHFLEIKLTAIGVYLEPSIVEHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   DL +DDDFF+AII+APV+KV+RVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  60   WKGKAAKDLEEDDDFFQAIISAPVEKVIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            +EEEA LEK+V+FFQSKY
Sbjct  120  DEEEAQLEKIVEFFQSKY  137



>gb|KCW65779.1| hypothetical protein EUGRSUZ_G03138 [Eucalyptus grandis]
Length=205

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 113/134 (84%), Gaps = 1/134 (1%)
 Frame = +3

Query  78   MVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGK  257
            MVMVDE PFP Q+    K LSL+GHGITD+EIHFLQIK+TAIGVYLDPEIV HL++WKGK
Sbjct  1    MVMVDEFPFPSQIT-TTKPLSLLGHGITDMEIHFLQIKFTAIGVYLDPEIVGHLKQWKGK  59

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeee  437
                LA+DDDFF+A+ +APV+K  R+VVIKEIKGSQYG  LE +VRD LA  DKYEEEEE
Sbjct  60   PGKVLAEDDDFFDAVASAPVEKFFRIVVIKEIKGSQYGGLLEGAVRDRLAAEDKYEEEEE  119

Query  438  aalekvvdFFQSKY  479
            AALEKVV+FFQSKY
Sbjct  120  AALEKVVEFFQSKY  133



>gb|KGN50734.1| hypothetical protein Csa_5G221960 [Cucumis sativus]
Length=242

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG+E+ +V +I FP Q+ +  K LSL+GHG T++EIHFL+IK TAIGVYL+P IV HLQ+
Sbjct  34   MGSEVEVVADIDFPKQI-VKAKPLSLLGHGSTEIEIHFLEIKLTAIGVYLEPSIVEHLQQ  92

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   DL +DDDFF+AII+APV+KV+RVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  93   WKGKAAKDLEEDDDFFQAIISAPVEKVIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  152

Query  426  eeeeaalekvvdFFQSKY  479
            +EEEA LEK+V+FFQSKY
Sbjct  153  DEEEAQLEKIVEFFQSKY  170



>emb|CDX98830.1| BnaC09g50050D [Brassica napus]
Length=205

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 2/135 (1%)
 Frame = +3

Query  78   MVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDP-EIVSHLQKWKG  254
            MVM+ E+PFPPQ+ + +K  SL+G GITD+EIHFLQ+K+TAIGVYLDP ++ +HL KWKG
Sbjct  1    MVMIHEVPFPPQI-ITSKPFSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDKWKG  59

Query  255  KTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeee  434
            KT  DLA DDDFF+A+ +  ++KV+RVVVIKEIKG+QYGVQLENSVRD LA  DKYEEEE
Sbjct  60   KTGKDLAGDDDFFDALASGEIEKVIRVVVIKEIKGAQYGVQLENSVRDRLAAEDKYEEEE  119

Query  435  eaalekvvdFFQSKY  479
            E  LEKVV FFQSKY
Sbjct  120  ENELEKVVGFFQSKY  134



>pdb|4DOK|A Chain A, Crystal Structure Of Arabidopsis Thaliana Chalcone-Isomerase 
Like Protein At5g05270 (Atchil)
 pdb|4DOK|B Chain B, Crystal Structure Of Arabidopsis Thaliana Chalcone-Isomerase 
Like Protein At5g05270 (Atchil)
Length=208

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 117/137 (85%), Gaps = 2/137 (1%)
 Frame = +3

Query  72   TEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDP-EIVSHLQKW  248
            T MVMV E+PFPPQ+ + +K LSL+G GITD+EIHFLQ+K+TAIGVYLDP ++ +HL  W
Sbjct  2    TGMVMVHEVPFPPQI-ITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDNW  60

Query  249  KGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyee  428
            KGKT  +LA DDDFF+A+ +A ++KV+RVVVIKEIKG+QYGVQLEN+VRD LAE DKYEE
Sbjct  61   KGKTGKELAGDDDFFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTVRDRLAEEDKYEE  120

Query  429  eeeaalekvvdFFQSKY  479
            EEE  LEKVV FFQSKY
Sbjct  121  EEETELEKVVGFFQSKY  137



>gb|AHL83557.1| chalcone isomerase type 4 [Iris x hollandica]
Length=209

 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M +EMVMVD +PFP Q+ +  K L+L+G G+TD+E+HFLQIKY AIG+YL+  +V H+  
Sbjct  1    MASEMVMVDAVPFPTQITI-TKPLALLGTGLTDIEVHFLQIKYNAIGIYLEEAVVEHVGD  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +LA+DDDFFEAI++APV+K+ RVV+IKEIKG+QYGVQLE+ VRD LA  DKYE
Sbjct  60   WKGKKGGELAEDDDFFEAIVSAPVEKLFRVVIIKEIKGAQYGVQLESGVRDRLAAADKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV DFFQSKY
Sbjct  120  EEEEEALEKVSDFFQSKY  137



>dbj|BAO32071.1| chalcone isomerase Type4 [Antirrhinum majus]
Length=212

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = +3

Query  99   PFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQ  278
            PFP ++    K LSL+GHG+TD+EIHFLQIK+TAIGVYLDPEIV+HL KWKGK   +LA+
Sbjct  15   PFPSKITF-AKPLSLLGHGLTDIEIHFLQIKFTAIGVYLDPEIVAHLLKWKGKPATELAE  73

Query  279  DDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeeeaalekvv  458
            DDD F+AII+APVDK++RVVVIKEIKGSQYGVQLE++VRD LA+ DKYE+EEE ALE+++
Sbjct  74   DDDLFDAIISAPVDKIVRVVVIKEIKGSQYGVQLESAVRDRLADEDKYEDEEEEALEQII  133

Query  459  dFFQSKY  479
            DF QSKY
Sbjct  134  DFLQSKY  140



>ref|XP_009384767.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009384768.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X3 
[Musa acuminata subsp. malaccensis]
Length=209

 Score =   160 bits (405),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG+E VMVD++PF P++ +  K LSL+G+G+TD+EIHFLQIKY AIG+Y++ EI+ HL  
Sbjct  1    MGSETVMVDQVPFAPEITV-TKPLSLLGYGVTDIEIHFLQIKYNAIGIYMEKEIIQHLAD  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +LA+DD FF+A+++APV+K  R+VVIKEIKGSQYGVQLE++VRD LA +DKYE
Sbjct  60   WKGKKGSELAEDDVFFDAVVSAPVEKYFRIVVIKEIKGSQYGVQLESAVRDRLAAIDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV +FFQ KY
Sbjct  120  EEEEEALEKVTEFFQKKY  137



>gb|AHL83555.1| chalcone isomerase type 4 [Iris x hollandica]
Length=209

 Score =   160 bits (405),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M +E+VMVD +PFP Q+ +  K L+L+G G+TD+E+HFLQIKY AIG+YL+  +V HL  
Sbjct  1    MASEIVMVDAVPFPTQITI-TKPLALLGTGLTDIEVHFLQIKYNAIGIYLEEAVVEHLGD  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +LA+DDDFFEAI++APV+K+ RVV+IKEIKG+QYGVQLE+ VRD LA VDKYE
Sbjct  60   WKGKKGGELAEDDDFFEAIVSAPVEKLFRVVIIKEIKGAQYGVQLESGVRDRLAAVDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV +FFQSKY
Sbjct  120  EEEEEALEKVSEFFQSKY  137



>ref|XP_011084820.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Sesamum 
indicum]
Length=219

 Score =   160 bits (405),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = +3

Query  63   EMGTEM--VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSH  236
            +MGTE+  VMVDEIPFPP VN+  K LSL+GHG+T VE+  ++IK+TAIGVYLDP+IV H
Sbjct  6    KMGTEVEDVMVDEIPFPPLVNI-TKPLSLLGHGVTAVEMLSIEIKFTAIGVYLDPQIVFH  64

Query  237  LQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevd  416
            L KWKGK+  +L QD  FF+AII+ PVDK++RVVVIKEIKGSQ+GVQ+E++VRD LAE+D
Sbjct  65   LHKWKGKSAAELTQDHHFFQAIISGPVDKLVRVVVIKEIKGSQFGVQIESAVRDRLAEID  124

Query  417  kyeeeeeaalekvvdFFQSKY  479
            KYEEEEE A+E++V+FFQSKY
Sbjct  125  KYEEEEEEAVEQLVEFFQSKY  145



>ref|XP_006398990.1| hypothetical protein EUTSA_v10014675mg [Eutrema salsugineum]
 gb|ESQ40443.1| hypothetical protein EUTSA_v10014675mg [Eutrema salsugineum]
Length=205

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +3

Query  78   MVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLD-PEIVSHLQKWKG  254
            MVMV E+PFPPQ+ + +K LSL+G GITD+EIHFLQ+K+TAIGVYLD  ++ ++L+ WKG
Sbjct  1    MVMVHEVPFPPQI-ITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDHSDVKTNLENWKG  59

Query  255  KTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeee  434
            KT  DLA DDDFF+A+ +A V+KV+RVVVIKEIKGSQYGVQLEN+VRD LA  DKYEEEE
Sbjct  60   KTGKDLAGDDDFFDALASAEVEKVIRVVVIKEIKGSQYGVQLENAVRDRLAAEDKYEEEE  119

Query  435  eaalekvvdFFQSKY  479
            E  LEKVV FFQSKY
Sbjct  120  ETELEKVVGFFQSKY  134



>gb|KEH35546.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=158

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M +E V+VDEI +P ++   NK LSL+GHGITD+EIHFLQ+K+ +IGVYL+PE+V+HLQ+
Sbjct  1    MASETVLVDEISYPSKIT-TNKPLSLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +L  +DDFF+A+I++PV+K +R+VVIKEIKG+QYGVQ+E +VRD LA  DKYE
Sbjct  60   WKGKPAKELEDNDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            +EEE ALEKV++FFQSKY
Sbjct  120  DEEEEALEKVIEFFQSKY  137



>gb|AFK36813.1| unknown [Medicago truncatula]
Length=209

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M +E V+VDEI +P ++   NK LSL+GHGITD+EIHFLQ+K+ +IGVYL+PE+V+HLQ+
Sbjct  1    MASETVLVDEISYPSKIT-TNKPLSLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +L  +DDFF+A+I++PV+K +R+VVIKEIKG+QYGVQ+E +VRD LA  DKYE
Sbjct  60   WKGKPAKELEDNDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            +EEE ALEKV++FFQSKY
Sbjct  120  DEEEEALEKVIEFFQSKY  137



>dbj|BAB09970.1| unnamed protein product [Arabidopsis thaliana]
Length=205

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 116/135 (86%), Gaps = 2/135 (1%)
 Frame = +3

Query  78   MVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDP-EIVSHLQKWKG  254
            MVMV E+PFPPQ+ + +K LSL+G GITD+EIHFLQ+K+TAIGVYLDP ++ +HL  WKG
Sbjct  1    MVMVHEVPFPPQI-ITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDNWKG  59

Query  255  KTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeee  434
            KT  +LA DDDFF+A+ +A ++KV+RVVVIKEIKG+QYGVQLEN+VRD LAE DKYEEEE
Sbjct  60   KTGKELAGDDDFFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTVRDRLAEEDKYEEEE  119

Query  435  eaalekvvdFFQSKY  479
            E  LEKVV FFQSKY
Sbjct  120  ETELEKVVGFFQSKY  134



>ref|XP_004146474.1| PREDICTED: chalcone--flavonone isomerase-like [Cucumis sativus]
Length=291

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG+E+ +V +I FP Q+ +  K LSL+GHG T++EIHFL+IK TAIGVYL+P IV HLQ+
Sbjct  83   MGSEVEVVADIDFPKQI-VKAKPLSLLGHGDTEIEIHFLEIKLTAIGVYLEPSIVEHLQQ  141

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   DL +DDDFF+AII+APV+KV+RVVVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  142  WKGKAAKDLEEDDDFFQAIISAPVEKVIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYE  201

Query  426  eeeeaalekvvdFFQSKY  479
            +EEEA LEK+V+FFQSKY
Sbjct  202  DEEEAQLEKIVEFFQSKY  219



>ref|XP_009384766.1| PREDICTED: probable chalcone--flavonone isomerase 3 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=211

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            +G+E VMVD++PF P++ +  K LSL+G+G+TD+EIHFLQIKY AIG+Y++ EI+ HL  
Sbjct  3    VGSETVMVDQVPFAPEITV-TKPLSLLGYGVTDIEIHFLQIKYNAIGIYMEKEIIQHLAD  61

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +LA+DD FF+A+++APV+K  R+VVIKEIKGSQYGVQLE++VRD LA +DKYE
Sbjct  62   WKGKKGSELAEDDVFFDAVVSAPVEKYFRIVVIKEIKGSQYGVQLESAVRDRLAAIDKYE  121

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV +FFQ KY
Sbjct  122  EEEEEALEKVTEFFQKKY  139



>ref|XP_006842472.1| hypothetical protein AMTR_s00077p00075600 [Amborella trichopoda]
 gb|ERN04147.1| hypothetical protein AMTR_s00077p00075600 [Amborella trichopoda]
Length=216

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            +G+E+VMVDE PFP +V   +K L L+GHGITD+EIHFLQIK+TAIG+YLD ++V+HLQ 
Sbjct  8    VGSEIVMVDEFPFPSEVTA-SKPLHLLGHGITDIEIHFLQIKFTAIGIYLDSDVVNHLQS  66

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            +KG T  +LA+DD F +A+I APV+K  R+VVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  67   FKGTTGAELAEDDSFSDALIQAPVEKFFRIVVIKEIKGSQYGVQLESAVRDRLAAEDKYE  126

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+++FFQ K+
Sbjct  127  EEEEEALEKLLEFFQGKF  144



>ref|XP_008792229.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Phoenix 
dactylifera]
Length=205

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 113/134 (84%), Gaps = 1/134 (1%)
 Frame = +3

Query  78   MVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGK  257
            MVMVD +PFPP+V +  K L+L+GHGITD+EIHFLQIKY AIG+Y++  IV HL  W+GK
Sbjct  1    MVMVDGVPFPPEVTI-AKPLALLGHGITDIEIHFLQIKYNAIGIYMEKHIVEHLGNWRGK  59

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeee  437
               +LA+D+ FFEA++ APVDK  R+VVIKEIKGSQYGVQLE++VRD LA++DKYEEEEE
Sbjct  60   KGAELAKDNLFFEALVAAPVDKFFRIVVIKEIKGSQYGVQLESAVRDRLADIDKYEEEEE  119

Query  438  aalekvvdFFQSKY  479
             ALEKV +FFQ+KY
Sbjct  120  EALEKVSEFFQTKY  133



>gb|KEH35544.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=229

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            + +E V+VDEI +P ++   NK LSL+GHGITD+EIHFLQ+K+ +IGVYL+PE+V+HLQ+
Sbjct  21   LASETVLVDEISYPSKIT-TNKPLSLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQ  79

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +L  +DDFF+A+I++PV+K +R+VVIKEIKG+QYGVQ+E +VRD LA  DKYE
Sbjct  80   WKGKPAKELEDNDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAVRDRLAADDKYE  139

Query  426  eeeeaalekvvdFFQSKY  479
            +EEE ALEKV++FFQSKY
Sbjct  140  DEEEEALEKVIEFFQSKY  157



>gb|AFK33841.1| unknown [Medicago truncatula]
Length=209

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M +E V+VDEI +P ++   NK L L+GHGITD+EIHFLQ+K+ +IGVYL+PE+V+HLQ+
Sbjct  1    MASETVLVDEISYPSKIT-TNKPLFLLGHGITDMEIHFLQVKFYSIGVYLEPEVVNHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +L  +DDFF+A+I++PV+K +R+VVIKEIKG+QYGVQ+E +VRD LA  DKYE
Sbjct  60   WKGKPAKELEDNDDFFDALISSPVEKAIRLVVIKEIKGAQYGVQIETAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            +EEE ALEKV++FFQSKY
Sbjct  120  DEEEEALEKVIEFFQSKY  137



>ref|XP_007137637.1| hypothetical protein PHAVU_009G143100g [Phaseolus vulgaris]
 gb|ESW09631.1| hypothetical protein PHAVU_009G143100g [Phaseolus vulgaris]
Length=209

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TE V+VDEIP+P ++    K LSL+GHGITD+EIHF+ +K+ +IGVY +PE+VSHLQ+
Sbjct  1    MATEQVLVDEIPYPSKIT-TTKPLSLLGHGITDMEIHFIHVKFYSIGVYFEPEVVSHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            +KGK   +L Q+D+FF+A+I+APV+K +R+VVIKEIKG+QYGVQ+E++VRD LA  DKYE
Sbjct  60   FKGKPAKELEQNDEFFDALISAPVEKFIRLVVIKEIKGAQYGVQIESAVRDRLAAEDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV++FFQSKY
Sbjct  120  EEEEEALEKVIEFFQSKY  137



>gb|ABK23299.1| unknown [Picea sitchensis]
Length=214

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVN-LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ  242
            M +E+VMVDE  FP  +    +K L L+G+GITD+EIHFLQIK+TAIG+YL+ E+ SHLQ
Sbjct  1    MASEVVMVDEFQFPKSIAPTASKALHLVGYGITDMEIHFLQIKFTAIGIYLNAEVASHLQ  60

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
             WKGK+  ++  DDDFF+++  APVDK +RVVVIKE+KG+QYG+QLEN+VRD LA +DK+
Sbjct  61   GWKGKSGAEILADDDFFDSLCGAPVDKFIRVVVIKELKGAQYGLQLENAVRDRLAAIDKF  120

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEE ALEK+V+FFQ KY
Sbjct  121  EEEEEEALEKLVEFFQGKY  139



>emb|CCM80406.1| chalcone isomerase 2 [Lupinus angustifolius]
Length=214

 Score =   155 bits (391),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = +3

Query  75   EMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKG  254
            E+V+VDEIP+P +     K LSL+GHGITD+EIHFLQ+K+ +IGVYLDPEIV HLQ+WKG
Sbjct  9    EVVLVDEIPYPSKYT-TTKPLSLLGHGITDMEIHFLQVKFYSIGVYLDPEIVGHLQQWKG  67

Query  255  KTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeee  434
            K+  +L ++D FF+++I APV+KV+R+VVIKEIKG+QYGVQ+E++VRD LA  DKYEEEE
Sbjct  68   KSAKELEENDGFFDSVIFAPVEKVVRLVVIKEIKGAQYGVQIESAVRDRLAADDKYEEEE  127

Query  435  eaalekvvdFFQSKY  479
            E ALEK+V+F QSKY
Sbjct  128  EEALEKIVEFLQSKY  142



>emb|CCM80407.1| chalcone isomerase 1 [Lupinus angustifolius]
Length=209

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M  E+V+VDEI +P +     K L L+GHGITD+EIHFLQ+K+ +IGVYLDPEIV HLQ+
Sbjct  1    MADEVVLVDEISYPSKYTT-TKPLPLLGHGITDMEIHFLQVKFYSIGVYLDPEIVGHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK+  +L ++D+FF+A+++APV+KV+R+VVIKEIKG+QYGVQ+E++VRD LA  DKYE
Sbjct  60   WKGKSAKELEENDEFFDALVSAPVEKVVRLVVIKEIKGAQYGVQIESAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+V+F QSKY
Sbjct  120  EEEEEALEKIVEFLQSKY  137



>gb|ACN40662.1| unknown [Picea sitchensis]
Length=214

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVN-LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ  242
            M +E+V VDE  FP  +    +K L L+G+GITD+EIHFLQIK+TAIG+YL+ E+ SHLQ
Sbjct  1    MASEVVTVDEFQFPKSITPTASKALHLVGYGITDMEIHFLQIKFTAIGIYLNAEVASHLQ  60

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
             WKGK+  ++  DDDFF+++  APVDK +RVVVIKE+KG+QYG+QLEN+VRD LA +DK+
Sbjct  61   GWKGKSGAEILADDDFFDSLCGAPVDKFIRVVVIKELKGAQYGLQLENAVRDRLAAIDKF  120

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEE ALEK+V+FFQ KY
Sbjct  121  EEEEEEALEKLVEFFQGKY  139



>ref|XP_010543680.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Tarenaya 
hassleriana]
Length=209

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVS-HLQ  242
            MG+E+VMV E+PFP Q+ + +K LSL+G GITD+EIHFLQ+K+TAIGVY+D   V  HL 
Sbjct  1    MGSEVVMVHEVPFPSQI-VTSKPLSLIGQGITDIEIHFLQVKFTAIGVYVDSSDVGPHLG  59

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
             WKGK    L  DDDFF A+++APV+K++RVVVIKEIKGSQYGVQ+EN+VRD LAE DKY
Sbjct  60   NWKGKPGNALVDDDDFFHALVSAPVEKIVRVVVIKEIKGSQYGVQMENAVRDRLAEEDKY  119

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEEAALEKVV+FFQSKY
Sbjct  120  EEEEEAALEKVVEFFQSKY  138



>ref|NP_001065990.1| Os12g0115700 [Oryza sativa Japonica Group]
 gb|ABA96289.1| Chalcone-flavanone isomerase family protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA96290.1| Chalcone-flavanone isomerase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29009.1| Os12g0115700 [Oryza sativa Japonica Group]
Length=212

 Score =   153 bits (386),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 116/141 (82%), Gaps = 4/141 (3%)
 Frame = +3

Query  66   MGTEM--VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE-IVSH  236
            MGTEM  V V+ IPFP ++ + +K LSL+ HGITD+EIHFLQIKY AIGVYL+ + ++ H
Sbjct  1    MGTEMATVEVEGIPFPQEITV-SKPLSLLAHGITDIEIHFLQIKYNAIGVYLEKDNVLGH  59

Query  237  LQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevd  416
            L+ WKGK   +L QDD FF+A+++APV+K+ R+VVIKEIKGSQYGVQLE+SVRD L  VD
Sbjct  60   LESWKGKKAEELVQDDGFFQALVSAPVEKLFRIVVIKEIKGSQYGVQLESSVRDRLVSVD  119

Query  417  kyeeeeeaalekvvdFFQSKY  479
            KYE+EEE +LEKV +FFQSKY
Sbjct  120  KYEDEEEESLEKVTEFFQSKY  140



>gb|AIU39024.1| chalcone isomerase 2 [Narcissus tazetta var. chinensis]
Length=216

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            +G+EMVMVDEIPFPPQ+    K L L+G GITD+ IHFLQIK+ AIG+YLD  IV HL  
Sbjct  7    VGSEMVMVDEIPFPPQIT-TTKPLPLVGSGITDIVIHFLQIKHNAIGIYLDDNIVEHLGN  65

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKG+   +LA+DDDFF+A+I+AP +K  RVV+IKEIKG+Q+G+QLE+++RD L  VD+YE
Sbjct  66   WKGRKGSELAEDDDFFDALISAPTEKYFRVVIIKEIKGAQFGLQLESALRDRLVSVDRYE  125

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE  +EK+  FFQ+ Y
Sbjct  126  EEEEEQVEKIAHFFQAPY  143



>gb|AHY20030.1| chalcone isomerase [Tulipa fosteriana]
Length=207

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 113/138 (82%), Gaps = 3/138 (2%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG+EMV  DE+P+P ++   +K LSL+G G+TD+EIHFLQIK+ A+G+YL+ EI+ HL K
Sbjct  1    MGSEMV--DEVPYPSEITT-SKPLSLLGKGLTDIEIHFLQIKFNAVGIYLEKEIIDHLGK  57

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +L +DD FFE I++APV+K  R+VVIKEIKGSQYGVQLE++VRD LA  DKYE
Sbjct  58   WKGKKGSELVEDDLFFEDIVSAPVEKFFRIVVIKEIKGSQYGVQLESAVRDRLAADDKYE  117

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEK+ +FFQ+KY
Sbjct  118  EEEEEALEKITEFFQTKY  135



>ref|XP_006663745.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Oryza 
brachyantha]
Length=212

 Score =   150 bits (380),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 112/141 (79%), Gaps = 4/141 (3%)
 Frame = +3

Query  66   MGTEM--VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE-IVSH  236
            MGTEM  V V+ IPFP ++    K LS + HG+TD+EIHFLQIKY AIGVYLD E ++ H
Sbjct  1    MGTEMATVEVEGIPFPQEIT-GTKPLSFLAHGVTDIEIHFLQIKYNAIGVYLDKESVLGH  59

Query  237  LQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevd  416
            L+ WKGK   +L QDD FF+A+++APV+K+ R+VVIKEIKGSQYGVQLE+SVRD L  VD
Sbjct  60   LESWKGKKAEELVQDDGFFQALVSAPVEKLFRIVVIKEIKGSQYGVQLESSVRDRLVAVD  119

Query  417  kyeeeeeaalekvvdFFQSKY  479
            K+EEEEE ALEKV +FFQ KY
Sbjct  120  KFEEEEEEALEKVTEFFQYKY  140



>ref|NP_001065587.1| Os11g0116300 [Oryza sativa Japonica Group]
 gb|ABA91231.2| Chalcone-flavanone isomerase family protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABG22338.1| Chalcone-flavanone isomerase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27432.1| Os11g0116300 [Oryza sativa Japonica Group]
 dbj|BAG87002.1| unnamed protein product [Oryza sativa Japonica Group]
Length=212

 Score =   150 bits (380),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 118/141 (84%), Gaps = 4/141 (3%)
 Frame = +3

Query  66   MGTEM--VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE-IVSH  236
            MGTE+  V V+ IPFP ++ + +K LSL+ +GITD+EIHFLQIKY AIGVYL+ + +++H
Sbjct  1    MGTEIATVEVEGIPFPQEITV-SKPLSLLANGITDIEIHFLQIKYNAIGVYLEKDNVLAH  59

Query  237  LQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevd  416
            L+ WKGK   +L QDD FF+A+++APV+K+LR+VVIKEIKGSQYGVQLE+SVRD L  VD
Sbjct  60   LESWKGKKAEELVQDDGFFQALVSAPVEKLLRIVVIKEIKGSQYGVQLESSVRDRLVSVD  119

Query  417  kyeeeeeaalekvvdFFQSKY  479
            KYEE+EE ALEKV +FFQSKY
Sbjct  120  KYEEDEEEALEKVTEFFQSKY  140



>ref|XP_006435917.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 ref|XP_006435918.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 gb|ESR49157.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
 gb|ESR49158.1| hypothetical protein CICLE_v10032749mg [Citrus clementina]
Length=197

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +3

Query  141  LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAPVD  320
            L+  G+TD+EIHFLQIK+TAIGVYLDPEI+SHLQ+WKGK    LAQDDDFF+A+++APV+
Sbjct  13   LLATGLTDIEIHFLQIKFTAIGVYLDPEILSHLQQWKGKQGSSLAQDDDFFDALVSAPVE  72

Query  321  KVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeeeaalekvvdFFQSKY  479
            K LR+VVIKEIKGSQYGVQLE++VRD LA  DKYEEEEE+ALEK+V+FFQSKY
Sbjct  73   KFLRIVVIKEIKGSQYGVQLESAVRDRLAGADKYEEEEESALEKIVEFFQSKY  125



>gb|EEC67544.1| hypothetical protein OsI_34872 [Oryza sativa Indica Group]
Length=218

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 118/141 (84%), Gaps = 4/141 (3%)
 Frame = +3

Query  66   MGTEM--VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE-IVSH  236
            +GTE+  V V+ IPFP ++ + +K LSL+ +GITD+EIHFLQIKY AIGVYL+ + +++H
Sbjct  7    VGTEIATVEVEGIPFPQEITV-SKPLSLLANGITDIEIHFLQIKYNAIGVYLEKDNVLAH  65

Query  237  LQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevd  416
            L+ WKGK   +L QDD FF+A+++APV+K+LR+VVIKEIKGSQYGVQLE+SVRD L  VD
Sbjct  66   LESWKGKKAEELVQDDGFFQALVSAPVEKLLRIVVIKEIKGSQYGVQLESSVRDRLVSVD  125

Query  417  kyeeeeeaalekvvdFFQSKY  479
            KYEE+EE ALEKV +FFQSKY
Sbjct  126  KYEEDEEEALEKVTEFFQSKY  146



>gb|EEE51527.1| hypothetical protein OsJ_32725 [Oryza sativa Japonica Group]
Length=218

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 118/141 (84%), Gaps = 4/141 (3%)
 Frame = +3

Query  66   MGTEM--VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE-IVSH  236
            +GTE+  V V+ IPFP ++ + +K LSL+ +GITD+EIHFLQIKY AIGVYL+ + +++H
Sbjct  7    VGTEIATVEVEGIPFPQEITV-SKPLSLLANGITDIEIHFLQIKYNAIGVYLEKDNVLAH  65

Query  237  LQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevd  416
            L+ WKGK   +L QDD FF+A+++APV+K+LR+VVIKEIKGSQYGVQLE+SVRD L  VD
Sbjct  66   LESWKGKKAEELVQDDGFFQALVSAPVEKLLRIVVIKEIKGSQYGVQLESSVRDRLVSVD  125

Query  417  kyeeeeeaalekvvdFFQSKY  479
            KYEE+EE ALEKV +FFQSKY
Sbjct  126  KYEEDEEEALEKVTEFFQSKY  146



>ref|XP_004977383.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Setaria 
italica]
Length=215

 Score =   148 bits (373),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (79%), Gaps = 3/138 (2%)
 Frame = +3

Query  72   TEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYL--DPEIVSHLQK  245
            TE V V+ IPFP ++ + N L SL+ +GITD+EIHFLQIKY AIG+YL  +  ++ HLQ 
Sbjct  5    TETVTVEGIPFPAEITVGNPL-SLLANGITDIEIHFLQIKYNAIGIYLHNNHALLHHLQS  63

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGKT  +L  DD FF+A+++APV+K+ RVVVIKEIKGSQYGVQLE+SVRD L   DKY+
Sbjct  64   WKGKTADELLGDDAFFQALVSAPVEKLFRVVVIKEIKGSQYGVQLESSVRDRLVAADKYD  123

Query  426  eeeeaalekvvdFFQSKY  479
            +EEE  LEKV +FFQSKY
Sbjct  124  DEEEEVLEKVAEFFQSKY  141



>ref|XP_006577878.1| PREDICTED: chalcone isomerase 4B isoform X1 [Glycine max]
Length=209

 Score =   147 bits (372),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TE V+VDEI +P ++    K LSL+GHGITD+EIHF+ +K+ +IG+YL+PE+V HL++
Sbjct  1    MATEEVLVDEITYPSKIT-TTKPLSLLGHGITDMEIHFIHVKFYSIGIYLEPEVVGHLEQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            +KG +  +L ++D+FF A+I+APV+K +R+VVIKEIKG+QYGVQ+E +VRD LA  DKYE
Sbjct  60   FKGISAKELEENDEFFNALISAPVEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV++FFQSKY
Sbjct  120  EEEEEALEKVIEFFQSKY  137



>ref|XP_010452429.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Camelina 
sativa]
Length=210

 Score =   147 bits (371),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDP-EIVSHLQ  242
            MGTEMVMV E+PFPPQ+   +K LSL+G GITD+EIHFLQ+K+TAIGVYLDP ++ +HL 
Sbjct  1    MGTEMVMVHEVPFPPQIITASKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLV  60

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
             WKGKT  DLA DDDFF+A+ +A ++KV+RVVVIKEIKG+QYGVQLEN+VRD LA  DKY
Sbjct  61   NWKGKTGKDLADDDDFFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTVRDRLAAEDKY  120

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEE  LEKVV FFQSKY
Sbjct  121  EEEEETELEKVVGFFQSKY  139



>ref|NP_001236782.1| chalcone isomerase 4-like [Glycine max]
 gb|AAT94362.1| putative chalcone isomerase 4 [Glycine max]
Length=209

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TE V+VDEI +P ++    K LSL+GHGITD+EIHF+ +K+ +IGVYL+PE+V HL +
Sbjct  1    MATEEVLVDEITYPTKIT-TTKPLSLLGHGITDMEIHFIHVKFYSIGVYLEPEVVGHLDQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            +KGK+  +L  +++FF A+I+APV+K +R+VVIKEIKG+QYGVQ+E +VRD LA  DKYE
Sbjct  60   FKGKSAKELEDNEEFFNALISAPVEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV++FFQSKY
Sbjct  120  EEEEEALEKVIEFFQSKY  137



>gb|AHC07954.1| CHI [Indosasa hispida]
Length=213

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 115/142 (81%), Gaps = 5/142 (4%)
 Frame = +3

Query  66   MGTEM---VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE-IVS  233
            MG+E    V V+ IPF P++ +  K LSL+GHGITD+EIHFLQIKY AIG+YL+ + ++ 
Sbjct  1    MGSETAVTVEVEGIPFLPEITV-AKPLSLVGHGITDIEIHFLQIKYNAIGLYLEKDNVLE  59

Query  234  HLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaev  413
            HL+ WKG+  V+L +DD FF+A+++APV+K+ R+VVIKEIKGSQYGVQLE+SVRD L   
Sbjct  60   HLEDWKGRKAVELVEDDAFFQALVSAPVEKLFRIVVIKEIKGSQYGVQLESSVRDRLVSA  119

Query  414  dkyeeeeeaalekvvdFFQSKY  479
            DKY+++EE ALEKV DFFQSKY
Sbjct  120  DKYDDDEEEALEKVTDFFQSKY  141



>gb|EAZ19439.1| hypothetical protein OsJ_35000 [Oryza sativa Japonica Group]
Length=208

 Score =   146 bits (369),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 111/134 (83%), Gaps = 2/134 (1%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE-IVSHLQKWKGK  257
            V V+ IPFP ++ + +K LSL+ HGITD+EIHFLQIKY AIGVYL+ + ++ HL+ WKGK
Sbjct  4    VEVEGIPFPQEITV-SKPLSLLAHGITDIEIHFLQIKYNAIGVYLEKDNVLGHLESWKGK  62

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeee  437
               +L QDD FF+A+++APV+K+ R+VVIKEIKGSQYGVQLE+SVRD L  VDKYE+EEE
Sbjct  63   KAEELVQDDGFFQALVSAPVEKLFRIVVIKEIKGSQYGVQLESSVRDRLVSVDKYEDEEE  122

Query  438  aalekvvdFFQSKY  479
             +LEKV +FFQSKY
Sbjct  123  ESLEKVTEFFQSKY  136



>ref|XP_006662673.1| PREDICTED: probable chalcone--flavonone isomerase 3-like isoform 
X1 [Oryza brachyantha]
Length=212

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 110/141 (78%), Gaps = 4/141 (3%)
 Frame = +3

Query  66   MGTEM--VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE-IVSH  236
            MGTEM  V V+ IPFP ++    K LS + HG+TD+EIHFLQIKY AIGVYLD E ++ H
Sbjct  1    MGTEMATVEVEGIPFPQEIT-RTKPLSFLAHGVTDIEIHFLQIKYNAIGVYLDKESVLGH  59

Query  237  LQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevd  416
            L+ WKGK   +L QD  FF+A++ APV+K+ R+VVIKEIKGSQYGVQLE+SVRD L  VD
Sbjct  60   LESWKGKKAEELVQDAGFFQALVFAPVEKLFRIVVIKEIKGSQYGVQLESSVRDRLVAVD  119

Query  417  kyeeeeeaalekvvdFFQSKY  479
            K+EEEEE ALEKV +FFQ KY
Sbjct  120  KFEEEEEEALEKVTEFFQYKY  140



>gb|AFK43525.1| unknown [Lotus japonicus]
Length=217

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M +E V+VDEI +P ++    K LSL+G+G+ D+ IHFLQ+K+  IGVYLDPE+V HLQ+
Sbjct  1    MASETVLVDEITYPSKITT-TKPLSLLGYGLNDMVIHFLQVKFYTIGVYLDPEVVGHLQQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKG    +L + DDFF+A+I+APV+K +R+VV+KEIKG+QYGVQ+E +VRD L   DKYE
Sbjct  60   WKGTPAKELEEKDDFFDALISAPVEKAIRLVVMKEIKGAQYGVQIETAVRDRLVNDDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            +EEEAALE+VV+FFQSKY
Sbjct  120  DEEEAALEQVVEFFQSKY  137



>ref|XP_010491060.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Camelina 
sativa]
Length=209

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDP-EIVSHLQ  242
            MGTEMVMV E+PFPPQ+ + +K LSL+G GITD+EIHFLQ+K+TAIGVYLDP ++ +HL 
Sbjct  1    MGTEMVMVHEVPFPPQI-ITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLV  59

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
             WKGKT  DLA DDDFF+A+ +A ++KV+RVVVIKEIKG+QYGVQLENSVRD LA  DKY
Sbjct  60   NWKGKTGKDLADDDDFFDALASAEMEKVIRVVVIKEIKGAQYGVQLENSVRDRLAAEDKY  119

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEE  LEKVV FFQSKY
Sbjct  120  EEEEETELEKVVGFFQSKY  138



>ref|XP_010238805.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Brachypodium 
distachyon]
Length=219

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = +3

Query  72   TEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE-IVSHLQKW  248
            T  V V+ IPFP ++    K LSL+GHG+TD+EIHFLQIK+ AIGVYLD   I+ HLQ W
Sbjct  12   TATVEVEGIPFPQEIA-GAKTLSLVGHGVTDIEIHFLQIKFNAIGVYLDEGGIMEHLQSW  70

Query  249  KGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyee  428
            KGK  + + +DD FF A+++APV+KVLRVVVIKEIKGSQYGVQLE+SVRD L   D+Y++
Sbjct  71   KGKDQLQV-EDDAFFSALVSAPVEKVLRVVVIKEIKGSQYGVQLESSVRDRLVAADRYDD  129

Query  429  eeeaalekvvdFFQSKY  479
            +EE ALEKV +FFQSKY
Sbjct  130  DEEEALEKVAEFFQSKY  146



>ref|NP_001242041.1| chalcone isomerase 4B [Glycine max]
 gb|ACU13171.1| unknown [Glycine max]
Length=227

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TE V+VDEI +P ++    K LSL+GHGITD+EIHF+ +K+ +IG+YL+PE+V HL++
Sbjct  1    MATEEVLVDEITYPSKIT-TTKPLSLLGHGITDMEIHFIHVKFYSIGIYLEPEVVGHLEQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            +KG +  +L ++D+FF A+I+APV+K +R+VVIKEIKG+QYGVQ+E +VRD LA  DKYE
Sbjct  60   FKGISAKELEENDEFFNALISAPVEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV++FFQSKY
Sbjct  120  EEEEEALEKVIEFFQSKY  137



>ref|XP_004978529.1| PREDICTED: probable chalcone--flavonone isomerase 3-like [Setaria 
italica]
Length=216

 Score =   145 bits (367),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 109/139 (78%), Gaps = 4/139 (3%)
 Frame = +3

Query  72   TEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYL--DPEIVSHLQK  245
            TE V V+ IPFP ++ + N L SL+ +GITD+EIHFLQIKY AIG+YL  +  ++ HLQ 
Sbjct  6    TETVTVEGIPFPAEITVGNPL-SLLANGITDIEIHFLQIKYNAIGIYLHSNDALLHHLQS  64

Query  246  WKGKTPVD-LAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
            WKGKT  D L  DD FF+A+++APV+K+ RVVVIKEIKGSQYGVQLE+SVRD L   DKY
Sbjct  65   WKGKTTADELLGDDAFFQALVSAPVEKLFRVVVIKEIKGSQYGVQLESSVRDRLVAADKY  124

Query  423  eeeeeaalekvvdFFQSKY  479
            +++EE  LEKV +FFQSKY
Sbjct  125  DDDEEEVLEKVAEFFQSKY  143



>gb|AAT94363.1| chalcone isomerase 4B [Glycine max]
Length=137

 Score =   143 bits (361),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 114/137 (83%), Gaps = 1/137 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TE V+VDEI +P ++    K LSL+GHGITD+EIHF+ +K+ +IG+YL+PE+V HL++
Sbjct  1    MATEEVLVDEITYPSKIT-TTKPLSLLGHGITDMEIHFIHVKFYSIGIYLEPEVVGHLEQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            +KG +  +L ++D+FF A+I+APV+K +R+VVIKEIKG+QYGVQ+E +VRD LA  DKYE
Sbjct  60   FKGISAKELEENDEFFNALISAPVEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYE  119

Query  426  eeeeaalekvvdFFQSK  476
            EEEE ALEKV++FFQSK
Sbjct  120  EEEEEALEKVIEFFQSK  136



>gb|ACU16129.1| unknown [Glycine max]
Length=210

 Score =   145 bits (366),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TE V+VDEI +P ++    K LSL+GHGITD+EIHF+ +K+ +IGVYL+PE+V HL +
Sbjct  1    MATEEVLVDEITYPTKIT-TTKPLSLLGHGITDMEIHFIHVKFYSIGVYLEPEVVGHLDQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            +KGK+  +L  +++FF A+I+AP++K +R+VVIKEIKG+QYGVQ+E +VRD LA  DKYE
Sbjct  60   FKGKSAKELEDNEEFFNALISAPMEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV++FFQSKY
Sbjct  120  EEEEEALEKVIEFFQSKY  137



>ref|XP_010423486.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Camelina 
sativa]
Length=209

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDP-EIVSHLQ  242
            MGTEMVMV E+PFPPQ+ + +K LSL+G GITD+EIHFLQ+K+TAIGVYLDP ++ +HL 
Sbjct  1    MGTEMVMVHEVPFPPQI-ITSKPLSLIGKGITDIEIHFLQVKFTAIGVYLDPSDVKTHLV  59

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
             WKGKT  DLA DDDFF+A+ +A ++KV+RVVVIKEIKG+QYGVQLEN+VRD LA  DKY
Sbjct  60   NWKGKTGKDLADDDDFFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTVRDRLAAEDKY  119

Query  423  eeeeeaalekvvdFFQSKY  479
            EEEEE  LEKVV FFQSKY
Sbjct  120  EEEEETELEKVVGFFQSKY  138



>gb|EAY82043.1| hypothetical protein OsI_37230 [Oryza sativa Indica Group]
Length=208

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 110/134 (82%), Gaps = 2/134 (1%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE-IVSHLQKWKGK  257
            V V+ I FP ++ + +K LSL+ HGITD+EIHFLQIKY AIGVYL+ + ++ HL+ WKGK
Sbjct  4    VEVEGISFPQEITV-SKPLSLLAHGITDIEIHFLQIKYNAIGVYLEKDNVLGHLESWKGK  62

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeee  437
               +L QDD FF+A+++APV+K+ R+VVIKEIKGSQYGVQLE+SVRD L  VDKYE+EEE
Sbjct  63   KAEELVQDDGFFQALVSAPVEKLFRIVVIKEIKGSQYGVQLESSVRDRLVSVDKYEDEEE  122

Query  438  aalekvvdFFQSKY  479
             +LEKV +FFQSKY
Sbjct  123  ESLEKVTEFFQSKY  136



>gb|KHN25809.1| Chalcone--flavonone isomerase [Glycine soja]
Length=251

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            + TE V+VDEI +P ++    K LSL+GHGITD+EIHF+ +K+ +IGVYL+PE+V HL +
Sbjct  43   VATEEVLVDEITYPTKIT-TTKPLSLLGHGITDMEIHFIHVKFYSIGVYLEPEVVGHLDQ  101

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            +KGK+  +L  +++FF A+I+APV+K +R+VVIKEIKG+QYGVQ+E +VRD LA  DKYE
Sbjct  102  FKGKSAKELEDNEEFFNALISAPVEKFIRLVVIKEIKGAQYGVQIETAVRDRLAAEDKYE  161

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV++FFQSKY
Sbjct  162  EEEEEALEKVIEFFQSKY  179



>ref|XP_010670602.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Beta vulgaris 
subsp. vulgaris]
Length=207

 Score =   142 bits (358),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG + VMVD++ F P+  L  K LSL G+G T++EIH+LQIK+TAIGVYL+ E+V HLQK
Sbjct  1    MGND-VMVDDVAFAPEFTL-TKPLSLFGYGCTELEIHYLQIKFTAIGVYLEKEVVQHLQK  58

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK+  +LA DD+FF+A+  APV+ V++ VVIKEIK SQ G QLE SVRD LA +DKYE
Sbjct  59   WKGKSGKELADDDEFFDALAAAPVESVIKAVVIKEIKASQLGTQLEGSVRDRLAAIDKYE  118

Query  426  eeeeaalekvvdFFQSKY  479
            +EEE ALEKV +FF +KY
Sbjct  119  DEEEVALEKVAEFFPTKY  136



>dbj|BAJ95751.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=217

 Score =   142 bits (358),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 113/146 (77%), Gaps = 11/146 (8%)
 Frame = +3

Query  66   MGTE-------MVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE  224
            MG+E        V V+ IPFP ++    K LSL+GHG+TD+EIHFLQIK+ A+GVYLD +
Sbjct  1    MGSEQEKKPAATVEVEGIPFPREIA-GAKTLSLVGHGVTDIEIHFLQIKFNAVGVYLDVD  59

Query  225  -IVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDl  401
              + HLQ WKGK+   L +D+ FF+A+++APV+KVLRVVVIKEIKGSQYGVQLE+SVRD 
Sbjct  60   GAMEHLQGWKGKS--QLMEDEAFFDALVSAPVEKVLRVVVIKEIKGSQYGVQLESSVRDR  117

Query  402  laevdkyeeeeeaalekvvdFFQSKY  479
            L   DKY+++EE ALEKV DFFQSKY
Sbjct  118  LVAADKYDDDEEEALEKVSDFFQSKY  143



>ref|XP_006662674.1| PREDICTED: probable chalcone--flavonone isomerase 3-like isoform 
X2 [Oryza brachyantha]
Length=208

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPE-IVSHLQKWKGK  257
            V V+ IPFP ++    K LS + HG+TD+EIHFLQIKY AIGVYLD E ++ HL+ WKGK
Sbjct  4    VEVEGIPFPQEIT-RTKPLSFLAHGVTDIEIHFLQIKYNAIGVYLDKESVLGHLESWKGK  62

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeee  437
               +L QD  FF+A++ APV+K+ R+VVIKEIKGSQYGVQLE+SVRD L  VDK+EEEEE
Sbjct  63   KAEELVQDAGFFQALVFAPVEKLFRIVVIKEIKGSQYGVQLESSVRDRLVAVDKFEEEEE  122

Query  438  aalekvvdFFQSKY  479
             ALEKV +FFQ KY
Sbjct  123  EALEKVTEFFQYKY  136



>gb|AGY46121.1| chalcone isomerase 2 [Dendrobium hybrid cultivar]
Length=209

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M ++ V+VD IPFP ++    K L+L+G G+T VEIHFL+IKY AIG+Y+D ++  +L+ 
Sbjct  1    MSSKEVLVDGIPFPAEIT-RTKPLALVGQGMTSVEIHFLEIKYNAIGIYMDKDVTEYLKN  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            W+GKT  +L +DD FF A+  APV+KV R+VVIKEIKGSQYG+QLE++VRD LA VD+YE
Sbjct  60   WEGKTETELEEDDLFFAALFLAPVEKVFRIVVIKEIKGSQYGIQLESAVRDQLAAVDRYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV  FFQS Y
Sbjct  120  EEEEEALEKVTKFFQSIY  137



>gb|AIS35913.1| chalcone isomerase [Phalaenopsis equestris]
Length=209

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M ++ VM+DEIPFP ++    K L+L+G G+T +EIHFLQIK+ AIG+Y++ ++  HL+ 
Sbjct  1    MSSKEVMIDEIPFPVEIT-KTKPLALLGQGLTSLEIHFLQIKHNAIGIYIEKDVTQHLEN  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +L  D+ FF+A+++APV+K+ R+VVIKEIKGSQYGVQLE ++RD LA  +KYE
Sbjct  60   WKGKKRAELEDDNLFFDALVSAPVEKLFRIVVIKEIKGSQYGVQLEGAIRDQLAAAEKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV  FFQ+ Y
Sbjct  120  EEEEEALEKVAKFFQTLY  137



>gb|AGY46120.1| chalcone isomerase 1 [Dendrobium hybrid cultivar]
Length=209

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M ++ V++D IPFP ++    K L+L+G G+T VEIHFLQIKY AIG+Y+D ++  +L+ 
Sbjct  1    MSSKEVLIDGIPFPAEIT-RTKPLALVGQGMTSVEIHFLQIKYNAIGIYMDKDVTKYLKN  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            W+GK   +L +DD FF A+  APV+KV R+VVIKEIKGSQYG+QLE++VRD LA +D YE
Sbjct  60   WEGKKGTELEEDDLFFAALFLAPVEKVFRIVVIKEIKGSQYGIQLESAVRDQLAAIDHYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            EEEE ALEKV  FFQS Y
Sbjct  120  EEEEEALEKVTKFFQSIY  137



>gb|EPS69369.1| hypothetical protein M569_05397 [Genlisea aurea]
Length=351

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = +3

Query  63   EMGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ  242
            +MGTE+V+VD++PFP Q++    L+ L+ HGITD+EIH+LQIK+TAIGVYLDPEI +HLQ
Sbjct  143  KMGTEVVLVDDVPFPAQLSATKPLI-LLAHGITDLEIHYLQIKFTAIGVYLDPEISTHLQ  201

Query  243  KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdky  422
            +WKG+   DLAQDD+FF  +++A V+KV++VVVIKEIKGSQ+GVQLE++VRD LA+ D Y
Sbjct  202  RWKGRAAGDLAQDDEFFSDVVSAGVEKVVKVVVIKEIKGSQFGVQLESTVRDRLAQEDNY  261

Query  423  eeeeeaalekvvdFFQSKY  479
             ++EEA +E ++ FFQSKY
Sbjct  262  NDDEEACVEAILQFFQSKY  280



>gb|AEO17326.1| chalcone isomerase [Arachis hypogaea]
Length=209

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M +E VMVDEI +P  +    K LSL+GHGI D+EIHFLQ+K+  IGVYLDPEIV+HL +
Sbjct  1    MASETVMVDEISYPSTIT-TTKPLSLLGHGIKDMEIHFLQVKFYTIGVYLDPEIVNHLTQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKG  P +L + ++FF+ +I APV+KV+R+VVIKEIKG+QYGVQ+E +VRD LA  DKYE
Sbjct  60   WKGTPPKELEEKEEFFDGVIAAPVEKVIRLVVIKEIKGAQYGVQIETAVRDRLAADDKYE  119

Query  426  eeeeaalekvvdFFQSKY  479
            +EEEA LEK+V+FFQSKY
Sbjct  120  DEEEAELEKIVEFFQSKY  137



>gb|AHZ08832.1| CHI-ACAD [Allium cepa]
Length=210

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M ++M+MVDEIPFP ++    K L L+G GITD+EIHFLQIK+ AIG+YLD  ++  L  
Sbjct  1    MESKMIMVDEIPFPHEIT-TTKALPLLGCGITDIEIHFLQIKHNAIGIYLDECVLERLSN  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK   +LA DD+FF+AI++A V+K +RVV+IKEIKGSQ+G+Q+ +++RD L   DK+E
Sbjct  60   WKGKKGNELANDDEFFDAIVSADVEKFIRVVIIKEIKGSQFGLQVGSAIRDRLVSYDKFE  119

Query  426  eeeeaalekvvdFFQSKY  479
            +EE+  LEK+ +FFQ+ Y
Sbjct  120  DEEDEELEKITEFFQTPY  137



>gb|KCW65780.1| hypothetical protein EUGRSUZ_G03138 [Eucalyptus grandis]
Length=158

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 107/138 (78%), Gaps = 8/138 (6%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MG+EMVMVDE PFP Q+    K LSL+GHGITD+EIHFLQIK+TAIGVYLDPEIV HL++
Sbjct  1    MGSEMVMVDEFPFPSQIT-TTKPLSLLGHGITDMEIHFLQIKFTAIGVYLDPEIVGHLKQ  59

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
            WKGK    LA+DD       +    K  R+VVIKEIKGSQYG  LE +VRD LA  DKYE
Sbjct  60   WKGKPGKVLAEDD-------DFFDAKFFRIVVIKEIKGSQYGGLLEGAVRDRLAAEDKYE  112

Query  426  eeeeaalekvvdFFQSKY  479
            EEEEAALEKVV+FFQSKY
Sbjct  113  EEEEAALEKVVEFFQSKY  130



>gb|ABS58500.1| chalcone isomerase [Oncidium hybrid cultivar]
Length=219

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 113/148 (76%), Gaps = 11/148 (7%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSH---  236
            M ++ VM+DEIPFP ++N   + L+L+G G+T +EIHFL+IK  AIG+Y+D ++ +H   
Sbjct  1    MSSKEVMIDEIPFPVEIN-RTRPLALVGQGMTSLEIHFLEIKLNAIGIYMDKDVTNHIYM  59

Query  237  -------LQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVR  395
                   L+ WKGK   +L +D+ FF A+++APV+KV R+VVIKEIKGSQYGVQLE +VR
Sbjct  60   DKDVTQHLESWKGKKRAELEEDNLFFNALVSAPVEKVFRIVVIKEIKGSQYGVQLEGAVR  119

Query  396  DllaevdkyeeeeeaalekvvdFFQSKY  479
            D LAEVDKYEEEEEAALEKV +FFQS Y
Sbjct  120  DRLAEVDKYEEEEEAALEKVTEFFQSIY  147



>ref|XP_008809461.1| PREDICTED: probable chalcone--flavonone isomerase 3 [Phoenix 
dactylifera]
Length=192

 Score =   134 bits (337),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +3

Query  132  LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQDDDFFEAIINA  311
             L     GITD+EIHFLQIKY AIG+Y++  I+ HL  WKGK   +LA+DD FFEA++ A
Sbjct  5    CLVFSSSGITDIEIHFLQIKYNAIGIYMEKNIIEHLGNWKGKKGAELAEDDTFFEALVAA  64

Query  312  PVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeeeaalekvvdFFQSKY  479
            PVDK  R+VVIKEIKGSQYGVQLE++VRD LA +DKYEEEEE ALEKV  FFQSKY
Sbjct  65   PVDKFFRIVVIKEIKGSQYGVQLESAVRDRLAAIDKYEEEEEEALEKVSAFFQSKY  120



>ref|NP_001151452.1| chalcone--flavonone isomerase [Zea mays]
 gb|ACF88309.1| unknown [Zea mays]
 gb|ACG42924.1| chalcone--flavonone isomerase [Zea mays]
 gb|ACN33297.1| unknown [Zea mays]
 gb|ACR36618.1| unknown [Zea mays]
 tpg|DAA59281.1| TPA: chalcone--flavonone isomerase [Zea mays]
Length=227

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 106/145 (73%), Gaps = 10/145 (7%)
 Frame = +3

Query  72   TEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYL---------DPE  224
            TE V V+ IPFP ++ + N L SL+G GITD+EIHFLQIKY AIGVYL          P 
Sbjct  5    TETVNVEGIPFPAEITVGNPL-SLLGTGITDIEIHFLQIKYNAIGVYLHNAGGGDSTTPT  63

Query  225  IVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDll  404
            ++ HL  WKGKT  +L  D  F+ A++ APV+K+ RVVVIKEIKGSQYGVQLE+SVRD L
Sbjct  64   LLGHLGAWKGKTAEELLADAAFWAALVAAPVEKLFRVVVIKEIKGSQYGVQLESSVRDRL  123

Query  405  aevdkyeeeeeaalekvvdFFQSKY  479
            A  D YE++EE ALEKV DFFQSKY
Sbjct  124  AAADLYEDDEEEALEKVADFFQSKY  148



>ref|NP_001170075.1| uncharacterized protein LOC100383992 [Zea mays]
 gb|ACN35726.1| unknown [Zea mays]
Length=227

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 106/145 (73%), Gaps = 10/145 (7%)
 Frame = +3

Query  72   TEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYL---------DPE  224
            TE V V+ IPFP ++ + N L SL+G GITD+EIHFLQIKY AIGVYL          P 
Sbjct  5    TETVNVEGIPFPAEITVGNPL-SLLGTGITDIEIHFLQIKYNAIGVYLHNAGGGDSTTPT  63

Query  225  IVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDll  404
            ++ HL  WKGKT  +L  D  F+ A++ APV+K+ RVVVIKEIKGSQYGVQLE+SVRD L
Sbjct  64   LLGHLGAWKGKTAEELLADAAFWAALVAAPVEKLFRVVVIKEIKGSQYGVQLESSVRDRL  123

Query  405  aevdkyeeeeeaalekvvdFFQSKY  479
            A  D YE++EE ALEKV DFFQSKY
Sbjct  124  AAADLYEDDEEEALEKVADFFQSKY  148



>ref|NP_001150388.1| chalcone--flavonone isomerase [Zea mays]
 gb|ACG25205.1| chalcone--flavonone isomerase [Zea mays]
 gb|ACG38897.1| chalcone--flavonone isomerase [Zea mays]
Length=225

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 105/143 (73%), Gaps = 8/143 (6%)
 Frame = +3

Query  72   TEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYL-------DPEIV  230
            TE V V+ IPFP ++ + N L SL+G GITD+EIHFLQIKY AIGVYL          ++
Sbjct  5    TETVNVEGIPFPAEITVGNPL-SLLGTGITDIEIHFLQIKYNAIGVYLHNAGGGDSTTLL  63

Query  231  SHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllae  410
             HL  WKGKT  +L  D  F+ A++ APV+K+ RVVVIKEIKGSQYGVQLE+SVRD LA 
Sbjct  64   GHLGAWKGKTAEELLADAAFWAALVAAPVEKLFRVVVIKEIKGSQYGVQLESSVRDRLAA  123

Query  411  vdkyeeeeeaalekvvdFFQSKY  479
             D YE++EE ALEKV DFFQSKY
Sbjct  124  ADLYEDDEEEALEKVADFFQSKY  146



>gb|AGQ53961.1| chalcone isomerase, partial [Dendrobium hybrid cultivar]
Length=114

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  135  LSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAP  314
            L+L+G G+T VEIHFL+IKY AIG+Y+D ++  +L+ W+GKT  +L +DD FF A+  AP
Sbjct  7    LALVGQGMTSVEIHFLEIKYNAIGIYMDKDVTEYLKNWEGKTETELEEDDLFFAALFLAP  66

Query  315  VDKVLRVVVIKEIKGSQYGVQLENSVRD  398
            V+KV R+VVIKEIKGSQYG+QLE++VRD
Sbjct  67   VEKVFRIVVIKEIKGSQYGIQLESAVRD  94



>gb|KEH35545.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=177

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  165  VEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVI  344
            +EIHFLQ+K+ +IGVYL+PE+V+HLQ+WKGK   +L  +DDFF+A+I++PV+K +R+VVI
Sbjct  1    MEIHFLQVKFYSIGVYLEPEVVNHLQQWKGKPAKELEDNDDFFDALISSPVEKAIRLVVI  60

Query  345  KEIKGSQYGVQLENSVRDllaevdkyeeeeeaalekvvdFFQSKY  479
            KEIKG+QYGVQ+E +VRD LA  DKYE+EEE ALEKV++FFQSKY
Sbjct  61   KEIKGAQYGVQIETAVRDRLAADDKYEDEEEEALEKVIEFFQSKY  105



>gb|EMT19676.1| Chalcone--flavonone isomerase [Aegilops tauschii]
Length=184

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 3/110 (3%)
 Frame = +3

Query  153  GITDVEIHFLQIKYTAIGVYLDPE-IVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVL  329
             +TD+EIHFLQIK+ AIGVYLD +  + HLQ WKGK+   L +D+ FF+A+++APV+KVL
Sbjct  3    SVTDIEIHFLQIKFNAIGVYLDVDGAMEHLQGWKGKS--QLMEDEAFFDALVSAPVEKVL  60

Query  330  RVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeeeaalekvvdFFQSKY  479
            RVVVIKEIKGSQYGVQLE+SVRD L   DKYE++EE ALEKV DFFQSKY
Sbjct  61   RVVVIKEIKGSQYGVQLESSVRDRLVAADKYEDDEEEALEKVSDFFQSKY  110



>gb|EMS63262.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=864

 Score =   117 bits (293),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 84/157 (54%), Positives = 107/157 (68%), Gaps = 22/157 (14%)
 Frame = +3

Query  66   MGTEM-------VMVDEIPFPPQVNLDNKLLSLMGHG-------ITDVEIHFL----QIK  191
            MG+E        V V+ IPFP ++    K LSL+GHG          + +H      +IK
Sbjct  637  MGSEQEKKAAATVEVEGIPFPREI-AGAKALSLVGHGKHQNPGLTKPIRMHLFLFLTKIK  695

Query  192  YTAIGVYLDPE-IVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
            + A+GVYLD +  + HLQ WKGK+   L +D+ FF+A+++APV+KVLRVVVIKEIKGSQY
Sbjct  696  FNAVGVYLDVDGAMEHLQGWKGKS--QLMEDEAFFDALVSAPVEKVLRVVVIKEIKGSQY  753

Query  369  GVQLENSVRDllaevdkyeeeeeaalekvvdFFQSKY  479
            GVQLE+SVRD L   DKYE++EE ALEKV DFFQSKY
Sbjct  754  GVQLESSVRDRLVAADKYEDDEEEALEKVSDFFQSKY  790



>gb|KJB74931.1| hypothetical protein B456_012G014600 [Gossypium raimondii]
Length=169

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            M TEMVMVDE+PFPPQ+    K LSL+GHGITD+EIHFLQIK+TAIGVYL+PE+V HLQ+
Sbjct  1    MTTEMVMVDEVPFPPQIT-TTKPLSLLGHGITDIEIHFLQIKFTAIGVYLEPEVVGHLQQ  59

Query  246  WK  251
            WK
Sbjct  60   WK  61



>dbj|BAH89258.1| putative chalcone isomerase fragment [Diospyros kaki]
Length=67

 Score = 97.8 bits (242),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  198  AIGVYLDPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
            AIGVYLDP+IV HLQ WKGKT  +LA++DDFFEA+I+APV+KVLR+VVIKEIKGSQY
Sbjct  11   AIGVYLDPQIVGHLQPWKGKTGKELAENDDFFEALISAPVEKVLRIVVIKEIKGSQY  67



>dbj|BAO58582.1| chalcone-flavanone isomerase family protein [Ipomoea nil]
Length=133

 Score = 95.9 bits (237),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 85/138 (62%), Gaps = 52/138 (38%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQK  245
            MGTEMVMVDEIPFPPQVNLDNKLLSLMGH                               
Sbjct  1    MGTEMVMVDEIPFPPQVNLDNKLLSLMGHA------------------------------  30

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkye  425
                 PVD                 KVLRVVVIKEIKGSQYGVQLENSVRDLLAEVDKYE
Sbjct  31   -----PVD-----------------KVLRVVVIKEIKGSQYGVQLENSVRDLLAEVDKYE  68

Query  426  eeeeaalekvvdFFQSKY  479
            EEEEAALEKVVDFFQSKY
Sbjct  69   EEEEAALEKVVDFFQSKY  86



>ref|XP_001769093.1| predicted protein [Physcomitrella patens]
 gb|EDQ66067.1| predicted protein [Physcomitrella patens]
Length=212

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 75/117 (64%), Gaps = 9/117 (8%)
 Frame = +3

Query  66   MGTEMVMVDEIPF-----PPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIV  230
            MG ++V V+ I F     PP  + +   L L+GHG T +EI  ++I++TA+G Y +P I 
Sbjct  1    MGLQVVNVEGIDFATKFAPPTSSTE---LDLIGHGNTGMEIETVEIRFTAMGFYAEPSIS  57

Query  231  SHLQKWKGKTPVDLAQDDD-FFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRD  398
             HLQKWKGK   +L +DD  F + +I  PV+K +R+ +IK IKG  YG  L++S+RD
Sbjct  58   EHLQKWKGKAVSELVEDDSGFHKELIQVPVEKAVRISIIKGIKGLPYGSALQSSLRD  114



>ref|XP_001773128.1| predicted protein [Physcomitrella patens]
 gb|EDQ61981.1| predicted protein [Physcomitrella patens]
Length=209

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 76/117 (65%), Gaps = 9/117 (8%)
 Frame = +3

Query  66   MGTEMVMVDEIPF-----PPQVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIV  230
            MG ++V V++I F     PP  + +   L L+G+G T +EI  ++I++TAIG Y +P I 
Sbjct  1    MGPQVVKVEDIDFATKFTPPTGSTE---LDLIGYGNTGMEIETVEIRFTAIGFYAEPSIS  57

Query  231  SHLQKWKGKTPVDLAQDDD-FFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSVRD  398
             HLQKWKG    +L +DD  F + +I APV+K +R+ +IK IKG  YG  L++S+RD
Sbjct  58   EHLQKWKGTPSSNLVEDDSGFHKELIQAPVEKAVRISIIKGIKGLPYGSALQSSLRD  114



>gb|AIE16875.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16876.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16877.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16878.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16879.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16880.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16881.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16882.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16883.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16884.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16885.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16886.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16887.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16888.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16889.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16890.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16891.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16892.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16893.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16894.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16895.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16896.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16897.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16898.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16899.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16900.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16901.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16902.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16903.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16904.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16905.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16906.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16907.1| chalcone isomerase, partial [Glycine max]
Length=130

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  213  LDPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSV  392
            L+PE+V HL ++KGK+  +L  +++FF A+I+APV+K +R+VVIKEIKG+QYGVQ+E +V
Sbjct  1    LEPEVVGHLDQFKGKSAKELEDNEEFFNALISAPVEKFIRLVVIKEIKGAQYGVQIETAV  60

Query  393  RDllaevdkyeeeeeaalekvvdFFQSKY  479
            RD LA  DKYEEEEE ALEKV++FFQSKY
Sbjct  61   RDRLAAEDKYEEEEEEALEKVIEFFQSKY  89



>ref|XP_002963874.1| hypothetical protein SELMODRAFT_227414 [Selaginella moellendorffii]
 gb|EFJ35745.1| hypothetical protein SELMODRAFT_227414 [Selaginella moellendorffii]
Length=205

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +3

Query  123  DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQD-DDFFEA  299
             ++ L L+GHGITD+ I  + + +T IGVY  PE+  HLQ +K     +L +D  +FF+ 
Sbjct  16   SSETLILLGHGITDMTIETIHVIFTKIGVYFAPEVKDHLQSFKCLPVSELLKDGSEFFQQ  75

Query  300  IINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeeeaalekvvdFFQSK  476
            +I APV K+++++++K   GSQY   +E S+RD LA  DKYEE+EE AL  + +FFQSK
Sbjct  76   LIQAPVSKLIKILLVKGQLGSQYASTIETSIRDRLAYDDKYEEDEEIALANLCEFFQSK  134



>ref|XP_002988277.1| hypothetical protein SELMODRAFT_447240 [Selaginella moellendorffii]
 gb|EFJ10696.1| hypothetical protein SELMODRAFT_447240 [Selaginella moellendorffii]
Length=216

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = +3

Query  123  DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQDDD-FFEA  299
             ++ L L+GHGITD+ I  + + +T IGVY  P++  HLQ +K     +L +D   FF+ 
Sbjct  16   SSETLILLGHGITDMTIETIHVIFTKIGVYFAPQVKDHLQSFKCLPVSELLKDGSAFFQQ  75

Query  300  IINAPVDKVLRVVVIKEIKGSQYGVQLENSVRDllaevdkyeeeeeaalekvvdFFQSK  476
            +I APV K+++++++K   GSQY   +E SVRD LA  DKYEE+EE AL  + +FFQSK
Sbjct  76   LIQAPVSKLIKILLVKGQLGSQYASTIETSVRDRLAYDDKYEEDEEIALANLCEFFQSK  134



>ref|XP_011079722.1| PREDICTED: chalcone--flavonone isomerase [Sesamum indicum]
Length=222

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKLLS--LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V VD   FPP+V      ++  L G G+  +EI    +K+TAIGVYLD   VS L  KWK
Sbjct  10   VQVDSCVFPPEVKPPGSSMTFFLGGAGVRGLEIEGKFVKFTAIGVYLDGSAVSSLAAKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQ-LENSV  392
            GKT  +LA   DFF  I+  P +K  +V +I  + G QY  + +EN V
Sbjct  70   GKTADELADSVDFFGDIVAGPFEKFTKVTMILPLTGQQYSEKVVENCV  117



>gb|AEK70330.1| chalcone isomerase [Paeonia suffruticosa]
Length=217

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 62/109 (57%), Gaps = 5/109 (5%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQ-IKYTAIGVYLDPEIVSHLQ-KW  248
            V ++   FPP V      K L L G G+  +EI   Q +K+TAIGVYL+   ++ L  KW
Sbjct  10   VNIESYAFPPTVKPPGSTKTLFLGGAGVRGLEIPTGQFVKFTAIGVYLEDNAITSLAVKW  69

Query  249  KGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            KGKT  +L + DDFF  I+  P +K  RV +I  + G QY  ++ EN V
Sbjct  70   KGKTAEELTESDDFFRDIVTGPFEKFTRVTMILPLTGQQYSEKVTENCV  118



>sp|Q2PF16.1|CFI_VERHY RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Glandularia x hybrida]
 dbj|BAE72880.1| chalcone isomerase [Verbena x hybrida]
Length=222

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ + FPP V     +K   L G G+  +EI    IK+TAIGVYL+ + V+ L  KWK
Sbjct  10   VQVESVVFPPAVKPPGSDKTFFLGGAGVRGLEIEGKFIKFTAIGVYLENDAVTSLAAKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQ-LENSV  392
            GKT  ++A   DFF  I+  P +K  +V  I  + G QY  + +EN V
Sbjct  70   GKTAEEVADSGDFFAEIVTGPFEKFTKVTTILPLTGQQYSEKVVENCV  117



>ref|XP_002529711.1| Chalcone--flavonone isomerase, putative [Ricinus communis]
 gb|EEF32677.1| Chalcone--flavonone isomerase, putative [Ricinus communis]
Length=176

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 63/108 (58%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            ++++ + FPP V     +K L L G G+  +EI    +K+TAIGVYL+ + V  L  KWK
Sbjct  9    IVIEAVSFPPAVKPPASDKTLFLAGAGVRGLEIEGKFVKFTAIGVYLEDDAVPLLAVKWK  68

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L    +FF  I+  P +K +RV +I  + G QY  ++ EN V
Sbjct  69   GKTAQELTDSVEFFREIVTGPYEKFIRVTMILPLSGQQYSEKVAENCV  116



>sp|O65333.1|CFI_ELAUM RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Elaeagnus umbellata]
 gb|AAC16013.1| chalcone isomerase [Elaeagnus umbellata]
Length=256

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 62/108 (57%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ + FPP+V     +K L L G G+  +EI    IK+TAIGVYL+   V  L  KWK
Sbjct  11   VQVESVIFPPEVKPPGSSKTLFLGGAGVRGIEIQGKFIKFTAIGVYLEDNAVPSLAVKWK  70

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GK+  +L +  +FF  I+  P++K  RV  I  + G QY  ++ EN V
Sbjct  71   GKSAQELTESVEFFRDIVTGPMEKFTRVTTILPLTGQQYSEKVSENCV  118



>ref|XP_006850685.1| hypothetical protein AMTR_s00034p00233920 [Amborella trichopoda]
 gb|ERN12266.1| hypothetical protein AMTR_s00034p00233920 [Amborella trichopoda]
Length=235

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V     ++ L L   G+  +EI    IK+TAIGVYL+ + + HL  KWK
Sbjct  10   LRVEGYSFPPAVKPPGSSQSLFLAAAGVRGLEIQGKFIKFTAIGVYLETDAIPHLALKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GK+  +LA  D F+  +I  P +K  R+  I  + G QY  ++ ENSV
Sbjct  70   GKSAAELANSDQFYSDVIKCPFEKFTRITTILPLTGEQYSEKVAENSV  117



>gb|AIU98511.1| chalcone isomerase [Paeonia suffruticosa]
Length=217

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 62/109 (57%), Gaps = 5/109 (5%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQ-IKYTAIGVYLDPEIVSHLQ-KW  248
            V ++   FPP V      K L L G G+  +EI   Q +K+TAIGVYL+   ++ L  KW
Sbjct  10   VKIESYAFPPTVKPPGSTKTLFLGGAGVRGLEIPTGQFVKFTAIGVYLEDNAITSLAVKW  69

Query  249  KGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            KGKT  +L + DDFF  I+  P +K  +V +I  + G QY  ++ EN V
Sbjct  70   KGKTAEELTESDDFFRDIVTGPFEKFTQVTMILPLTGQQYSEKVTENCV  118



>gb|AJR10104.1| chalcone flavanone isomerase [Scutellaria baicalensis]
Length=215

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 61/109 (56%), Gaps = 6/109 (6%)
 Frame = +3

Query  81   VMVDEIPFPPQV---NLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KW  248
            V+V+ I F P        N LL L G G+  +EI    +K+TAIGVYL+   V  L   W
Sbjct  10   VLVESIEFSPAAKPPGSSNTLL-LGGAGVRGMEIQGNFVKFTAIGVYLEDSAVPSLAVNW  68

Query  249  KGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            KGKT  +L + DDFF  I++ P +K  +V +I  + G QY  ++ EN V
Sbjct  69   KGKTAEELTESDDFFREIVSGPFEKFTKVTMILPLTGKQYSEKVAENCV  117



>gb|AEK32592.1| chalcone isomerase [Paeonia lactiflora]
Length=217

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 62/109 (57%), Gaps = 5/109 (5%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQ-IKYTAIGVYLDPEIVSHLQ-KW  248
            V ++   FPP V      K L L G G+  +EI   Q +K+TAIGVYL+   ++ L  KW
Sbjct  10   VEIESYSFPPTVKPPGSTKTLFLGGAGVRGLEIPTGQFVKFTAIGVYLEDNAITSLAVKW  69

Query  249  KGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            KGKT  +L + DDFF  I+  P +K  +V +I  + G QY  ++ EN V
Sbjct  70   KGKTAEELTESDDFFRDIVTGPFEKFTQVTMILPLTGQQYSEKVTENCV  118



>ref|XP_001764300.1| predicted protein [Physcomitrella patens]
 gb|EDQ70854.1| predicted protein [Physcomitrella patens]
Length=217

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = +3

Query  123  DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQDDDFFEAI  302
             +  L+ +G G+ + +I FL++K  A+GVY  P++ + L  WKGK+  DL +D+  F+ +
Sbjct  30   SSNTLTFLGAGVREKQIAFLKVKVYAVGVYAQPDVAASLASWKGKSAADLVKDEALFQEL  89

Query  303  INAPVDKVLRVVVIKEIKGSQYGVQLENSV  392
              APV+K L++ + +++ G+ +   L+ ++
Sbjct  90   AQAPVEKALQIKLARDVDGATFWGALDEAL  119



>gb|AAZ80911.1| chalcone isomerase [Canna x generalis]
Length=226

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 3/107 (3%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            +++ E+ FPP       +  L L G G   +EI    + +TAIGVYL+   VS L  KWK
Sbjct  11   LVIGEVTFPPAAAPPGSSSSLFLAGAGERGLEIDRQFVVFTAIGVYLEDLAVSTLAPKWK  70

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSV  392
            GKT  DLA + DFF  I   P +K  R+ ++K + G QY  ++E + 
Sbjct  71   GKTADDLAGNSDFFRDIFTGPFEKFTRITMVKPLSGQQYSEKVEENC  117



>ref|XP_010259992.1| PREDICTED: chalcone--flavonone isomerase 2-like [Nelumbo nucifera]
Length=446

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +3

Query  36   LSPSAF*D*EMGTEMVMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGV  209
            +SP+ F         + V+   FPP V      K L L G G   +EI    IK+TAIG+
Sbjct  1    MSPAPF------VSGLQVESFSFPPTVKPPGSTKTLFLGGAGARGLEIQGQFIKFTAIGI  54

Query  210  YL-DPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-E  383
            YL D  I S   KWKGKT  +L    DFF  +++ P DK +RV +IK + G QY  ++ E
Sbjct  55   YLEDIAIPSLAVKWKGKTASELTDSIDFFRDVVSGPFDKFIRVTMIKPLTGHQYSEKVTE  114

Query  384  NSV  392
            N V
Sbjct  115  NCV  117


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = +3

Query  75   EMVMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-K  245
            E V V+   FPP V      K L L G G   +EI    IK+TAIGVYL+   V  L  K
Sbjct  236  EKVEVESFSFPPSVKPPGSTKTLFLGGAGSRGLEIQGQFIKFTAIGVYLEDSTVPSLAVK  295

Query  246  WKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            WKGKT  +L    +FF  II  P +K ++V +IK + G QY  ++ EN V
Sbjct  296  WKGKTADELTDSVEFFRDIITGPFEKFIQVTMIKPLTGQQYSEKVTENCV  345



>gb|ADQ13184.1| chalcone isomerase [Scutellaria baicalensis]
Length=215

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V+V+ I F P       +  L L G G+  +EI    +K+TAIGVYL+   V  L   WK
Sbjct  10   VLVESIEFSPAAKPPGSSNTLFLGGAGVRGMEIQGNFVKFTAIGVYLEDSAVPSLAVNWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L + DDFF  I++ P +K  +V +I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESDDFFREIVSGPFEKFTKVTMILPLTGKQYSEKVAENCV  117



>sp|Q3Y4F4.1|CFI_CANGE RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Canna x generalis]
 gb|AAZ80910.1| chalcone isomerase [Canna x generalis]
Length=226

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 3/107 (3%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            +++ E+ FPP       +  L L G G   +EI    + +TAIGVYL+   VS L  KWK
Sbjct  11   LVIGEVTFPPAAAPPGSSSSLFLAGAGERGLEIDRQFVVFTAIGVYLEDLAVSTLGPKWK  70

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSV  392
            GKT  DLA + DFF  I   P +K  R+ ++K + G QY  ++E + 
Sbjct  71   GKTADDLAGNSDFFRDIFTGPFEKFTRITMVKPLSGQQYSEKVEENC  117



>gb|ADK55061.1| chalcone isomerase [Paeonia suffruticosa]
Length=217

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 62/109 (57%), Gaps = 5/109 (5%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQ-IKYTAIGVYLDPEIVSHLQ-KW  248
            V ++   FPP V      K L L G G+  +E+   Q +K+TAIGVYL+   ++ L  KW
Sbjct  10   VNIESYAFPPTVKPPGSTKTLFLGGAGVRGLEVPTGQFVKFTAIGVYLEDNAITSLAVKW  69

Query  249  KGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            KGKT  +L + DDFF  I+  P +K  +V +I  + G QY  ++ EN V
Sbjct  70   KGKTAEELTESDDFFRDIVTGPFEKFTQVTMILPLTGQQYSEKVTENCV  118



>gb|KDP46099.1| hypothetical protein JCGZ_06610 [Jatropha curcas]
Length=253

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = +3

Query  36   LSPSAF*D*EMGTEMVMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGV  209
            +SP+A          + VD + F P V     NK L L G G   +EI    IK+TAIGV
Sbjct  1    MSPAA-----TSVTQIEVDTVTFSPAVKPPASNKTLFLGGAGARGLEIEGKFIKFTAIGV  55

Query  210  YLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-E  383
            YL+ E V  L  KWKGK+  +L     FF  I+  P +K +RV +I  + G QY  ++ E
Sbjct  56   YLEDEAVPLLAVKWKGKSAQELNDSVQFFREIVTGPFEKFIRVTMILPLTGQQYSEKVSE  115

Query  384  NSV  392
            N V
Sbjct  116  NCV  118



>gb|ADP07932.1| chalcone isomerase 2 [Vitis vinifera]
Length=42

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  183  QIKYTAIGVYLDPEIVSHLQKWKGKTPVDLAQDDDFFEAIIN  308
            QIK+TAIGVYL+PEIV HLQ WKGK+  +LA++DDFFEA+++
Sbjct  1    QIKFTAIGVYLEPEIVGHLQPWKGKSGKELAENDDFFEALVS  42



>gb|AHZ31749.1| chalcone isomerase [Viola x wittrockiana]
Length=216

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 65/109 (60%), Gaps = 6/109 (6%)
 Frame = +3

Query  81   VMVDEIPFPP--QVNLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHL--QKW  248
            + V+   FPP  + +  +KLL L G G+  +EI    IK+TAIGVYL+ +   HL   KW
Sbjct  10   IQVENFTFPPAEKPSSSDKLLFLGGAGVRGLEIEGRFIKFTAIGVYLE-DTAQHLLAPKW  68

Query  249  KGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            KGK+  +LA   +FF  +++ P +K ++V +I  + G QY  ++ EN V
Sbjct  69   KGKSAAELADSIEFFRDVVSGPFEKFIQVTMILPLTGHQYSEKVSENCV  117



>ref|XP_010063418.1| PREDICTED: chalcone--flavonone isomerase-like [Eucalyptus grandis]
 ref|XP_010063419.1| PREDICTED: chalcone--flavonone isomerase-like [Eucalyptus grandis]
 gb|KCW70646.1| hypothetical protein EUGRSUZ_F03816 [Eucalyptus grandis]
Length=243

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 61/109 (56%), Gaps = 4/109 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYL-DPEIVSHLQKWK  251
            V V+ + FPP +      K+L L G G   +EI    IK+TAIGVYL D  + S   KW 
Sbjct  12   VQVESVKFPPSIKPPGSAKILFLGGAGARGLEIQGKFIKFTAIGVYLEDAALPSLAAKWS  71

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSVR  395
            GK+  +LA   +FF  ++  P +K  RV +I  + G+QY  ++ EN V+
Sbjct  72   GKSAEELADSVEFFRDVVTGPFEKFSRVTMILPLTGAQYAEKVTENCVK  120



>sp|A7ISP6.1|CFI3_SOYBN RecName: Full=Chalcone--flavonone isomerase 3; Short=Chalcone 
isomerase 3 [Glycine max]
 gb|ABA86742.1| chalcone isomerase 3 [Glycine max]
 gb|ABA86744.1| chalcone isomerase 3 [Glycine max]
Length=226

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ + FPP V          L G G+  ++IH   +K+TAI VYL  + +S L  KWK
Sbjct  9    VTVENVTFPPTVKPPCSPNTFFLAGAGVRGLQIHHAFVKFTAICVYLQYDALSFLSVKWK  68

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
             K+   L + D FF  I+  P +K ++V +IK + G QY  ++ EN V
Sbjct  69   TKSTHQLTESDQFFSDIVTGPFEKFMQVTMIKPLTGQQYSEKVAENCV  116



>ref|XP_011027080.1| PREDICTED: chalcone--flavonone isomerase-like [Populus euphratica]
Length=223

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYL-DPEIVSHLQKWK  251
            + V+ + FPP V     N  L L G G+  +EI    IK+TAIGVYL D  + S   KWK
Sbjct  10   IQVENVTFPPAVKPPASNNTLFLGGAGVRGLEIEGKFIKFTAIGVYLEDNSLQSLAAKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSVR  395
            GK+  +L    +FF  I+  P +K +RV +I  + G Q+  ++ EN V 
Sbjct  70   GKSAQELTDSVEFFRDIVRGPFEKFMRVTMILPLTGLQFSEKVAENCVN  118



>dbj|BAG14301.1| chalcone isomerase [Perilla frutescens var. crispa]
Length=214

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 55/104 (53%), Gaps = 3/104 (3%)
 Frame = +3

Query  66   MGTEMVMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHL  239
            M    V V+ + FPP V     N  L L G G+  +EI    +K+TAI VYL+   V  L
Sbjct  1    MSVTQVQVESLVFPPSVKPPGSNNTLFLGGAGVRGMEIQGNFVKFTAIAVYLEDTAVPAL  60

Query  240  Q-KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
              KWKGKT   LA  DDF   II  P +K+ +V +I  + G Q+
Sbjct  61   ALKWKGKTADQLADSDDFIAQIITGPFEKLTQVTMILPLTGQQF  104



>gb|ACU13680.1| unknown [Glycine max]
 gb|KHN20296.1| Chalcone--flavonone isomerase 2-A [Glycine soja]
Length=228

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ + FPP V          L G G+  ++IH   +K+TAI +YL  + +S L  KWK
Sbjct  11   VTVENVTFPPTVKPPCSPNTFFLAGAGVRGLQIHHAFVKFTAICIYLQYDALSFLSVKWK  70

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
             K+   L + D FF  I+  P +K ++V +IK + G QY  ++ EN V
Sbjct  71   TKSTHQLTESDQFFSDIVTGPFEKFMQVTMIKPLTGQQYSEKVAENCV  118



>ref|NP_001236768.1| chalcone--flavonone isomerase 2-A [Glycine max]
 sp|Q53B74.1|CFI2A_SOYBN RecName: Full=Chalcone--flavonone isomerase 2-A; Short=Chalcone 
isomerase 2-A [Glycine max]
 gb|AAT94360.1| chalcone isomerase 2 [Glycine max]
 gb|ACN81823.1| chalcone isomerase [Glycine max]
Length=226

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ + FPP V          L G G+  ++IH   +K+TAI +YL  + +S L  KWK
Sbjct  9    VTVENVTFPPTVKPPCSPNTFFLAGAGVRGLQIHHAFVKFTAICIYLQYDALSFLSVKWK  68

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
             K+   L + D FF  I+  P +K ++V +IK + G QY  ++ EN V
Sbjct  69   TKSTHQLTESDQFFSDIVTGPFEKFMQVTMIKPLTGQQYSEKVAENCV  116



>ref|XP_002315258.1| chalcone isomerase family protein [Populus trichocarpa]
 gb|ABK94676.1| unknown [Populus trichocarpa]
 gb|EEF01429.1| chalcone isomerase family protein [Populus trichocarpa]
Length=223

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYL-DPEIVSHLQKWK  251
            + ++ + FPP V     N  L L G G+  +EI    IK+TAIGVYL D  + S   KWK
Sbjct  10   IQIENVTFPPAVKPPASNNTLFLGGAGVRGLEIEGKFIKFTAIGVYLEDNSLQSLAAKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GK   +L    +FF  I+  P +K +RV +I  + G QY  ++ EN V
Sbjct  70   GKIAKELTDSVEFFRDIVRGPFEKFMRVTMILPLTGLQYSEKVAENCV  117



>gb|ACN60401.1| chalcone isomerase, partial [Capsicum annuum]
Length=226

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 58/111 (52%), Gaps = 5/111 (5%)
 Frame = +3

Query  81   VMVDEIPFPPQV---NLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KW  248
            V VD   FPP V      N  L L G GI  V+I    +K TAIGVY++   V  L  KW
Sbjct  1    VQVDNNVFPPSVVKPPGSNTTLFLAGAGIRGVDIEGKFVKCTAIGVYMEESAVPFLAAKW  60

Query  249  KGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSVRD  398
            KGK+  +L    +FF  I+  P +K  RV +I  + G QY  ++ EN V +
Sbjct  61   KGKSSKELTDSVEFFRDIVTGPFEKFFRVTMITPLTGKQYSEKVAENCVAN  111



>ref|XP_007159893.1| hypothetical protein PHAVU_002G276500g [Phaseolus vulgaris]
 gb|ESW31887.1| hypothetical protein PHAVU_002G276500g [Phaseolus vulgaris]
Length=265

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +3

Query  87   VDEIPFPPQVNLDNKLLS--LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGK  257
            VD + FPP VN  +   +  L G G+  ++I    +K+TAIGVYL P  V  L  KW GK
Sbjct  52   VDNVTFPPTVNPPSSATAFFLAGAGVRGLQIQDNFVKFTAIGVYLQPNAVPLLSVKWNGK  111

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            +  +L    +FF  II  P +K ++V +I  + G QY  ++ EN V
Sbjct  112  SAPELTDSVEFFRDIITGPFEKFMQVTMILPLTGQQYSEKVSENCV  157



>gb|ADG21950.1| chalcone isomerase, partial [Morella rubra]
Length=100

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +3

Query  141  LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIINAPV  317
            L G G   +EI    +K+TAIGVYL+   V  L  KW GK   +LA+ DDFF  +I  P 
Sbjct  2    LGGAGERGLEIQGNFVKFTAIGVYLEGNAVPSLAVKWGGKCAGELAESDDFFADVIRGPF  61

Query  318  DKVLRVVVIKEIKGSQYGVQL-ENSV  392
            +K +RV +I  + G+QY  ++ ENS+
Sbjct  62   EKFVRVTMILPLSGNQYSEKVSENSI  87



>ref|XP_010555785.1| PREDICTED: chalcone--flavonone isomerase-like [Tarenaya hassleriana]
Length=242

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 60/109 (55%), Gaps = 4/109 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + VD + FPP V     +K L L G G+  ++I    +K+TAIGVYL+   +  L  KW 
Sbjct  11   IQVDAVTFPPAVKPPASSKTLFLGGAGVRGLDIEGKFVKFTAIGVYLEDNALPLLSVKWS  70

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSVR  395
            G+T  +L     FF  ++  P +K +RV +I  + G QY  ++ EN VR
Sbjct  71   GRTAEELTDSVAFFRELVTGPFEKFVRVTMILPLTGVQYSEKVTENCVR  119



>sp|A5ANT9.1|CFI2_VITVI RecName: Full=Chalcone--flavonone isomerase 2; Short=Chalcone 
isomerase 2 [Vitis vinifera]
 emb|CAN60439.1| hypothetical protein VITISV_015868 [Vitis vinifera]
 emb|CAN74526.1| hypothetical protein VITISV_038602 [Vitis vinifera]
 emb|CBI25307.3| unnamed protein product [Vitis vinifera]
Length=234

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKL--LSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ + FPP V        L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   VQVENVLFPPSVKPPGSTNDLFLGGAGVRGLEIQGKFVKFTAIGVYLESSAVPTLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +LA   DFF  ++  P +K  +V  I  + G QY  ++ EN V
Sbjct  70   GKTVEELADSVDFFRDVVTGPFEKFTKVTTILPLTGRQYSDKVSENCV  117



>ref|XP_008233532.1| PREDICTED: chalcone--flavonone isomerase [Prunus mume]
Length=216

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNK--LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP V        L L G G   +EI    +K+TAIGVYL+ + V  L  KWK
Sbjct  10   LQIEATSFPPSVKPPGSANTLFLGGAGARGLEIQGNFVKFTAIGVYLEDKAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L + D+FF  I+  P +K  +V  I  + G QY  ++ EN V
Sbjct  70   GKTAQELTESDEFFREIVTGPFEKFTQVTTILPLTGKQYSEKVSENCV  117



>prf||1807331A chalcone flavanone isomerase
Length=297

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHL-QKWK  251
            + V+   F P VN       L L G G   +EI    +K+TAIGVYL+   +  L +KWK
Sbjct  66   MQVENYAFAPTVNPAGSTNTLFLAGAGHRGLEIEGKFVKFTAIGVYLEESAIPFLAEKWK  125

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKTP +L    +FF  ++  P +K  RV +I  + G QY  ++ EN V
Sbjct  126  GKTPQELTDSVEFFRDVVTGPFEKFTRVTMILPLTGKQYSEKVAENCV  173



>sp|P11650.1|CFI1_PETHY RecName: Full=Chalcone--flavonone isomerase A; Short=CHI-A; Short=Chalcone 
isomerase A [Petunia x hybrida]
 emb|CAA68769.1| unnamed protein product [Petunia x hybrida]
 emb|CAA32729.1| unnamed protein product [Petunia x hybrida]
Length=241

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHL-QKWK  251
            + V+   F P VN       L L G G   +EI    +K+TAIGVYL+   +  L +KWK
Sbjct  10   MQVENYAFAPTVNPAGSTNTLFLAGAGHRGLEIEGKFVKFTAIGVYLEESAIPFLAEKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKTP +L    +FF  ++  P +K  RV +I  + G QY  ++ EN V
Sbjct  70   GKTPQELTDSVEFFRDVVTGPFEKFTRVTMILPLTGKQYSEKVAENCV  117



>gb|ABA55017.2| chalcone isomerase [Astragalus mongholicus]
Length=219

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 3/99 (3%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKLLS--LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ + FPP V+      S  L G G+  ++I+   I +T IGVYL+   ++ L  KWK
Sbjct  10   VKVEFLEFPPVVSPPGSTKSYFLGGAGVRGLDINGQFITFTGIGVYLEENAIASLAPKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
            GKTP +L Q  DF+  II  P +K++R   +K++ G++Y
Sbjct  70   GKTPAELIQSLDFYRDIIKGPFEKLVRGSKLKKLDGNEY  108



>sp|Q9M5B3.1|CFI3_PETHY RecName: Full=Chalcone--flavonone isomerase C; Short=CHI-C; Short=Chalcone 
isomerase C [Petunia x hybrida]
 gb|AAF60296.1|AF233637_1 chalcone isomerase A [Petunia x hybrida]
Length=241

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 57/108 (53%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHL-QKWK  251
            + V+   F P VN       L L G G   +EI    +K+TAIGVYL+   +  L +KWK
Sbjct  10   MQVENYAFAPTVNPAGSTNTLFLAGAGHRGLEIEGKFVKFTAIGVYLEESAIPFLAEKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKTP +L    +FF  ++  P +K  RV  I  + G QY  ++ EN V
Sbjct  70   GKTPQELTDSVEFFRDVVTGPFEKFTRVTTILPLTGKQYSEKVAENCV  117



>ref|XP_009344896.1| PREDICTED: chalcone--flavonone isomerase isoform X2 [Pyrus x 
bretschneideri]
Length=233

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQIETTAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDSAVPQLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAKELTESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSEKVSENCV  117



>gb|AEV53926.1| chalcone isomerase [Brunfelsia brasiliensis subsp. macrocalyx]
Length=263

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+   FPP VN       L L G G   +EI    +K+TAIGVYL+   +  L  KWK
Sbjct  10   VQVENYVFPPTVNPTGSTNTLFLAGAGHRGLEIEGKFVKFTAIGVYLEESAIPFLADKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L Q  +FF  ++  P +K  RV +I  + G QY  ++ EN V
Sbjct  70   GKTVEELKQSVEFFRDVVTGPFEKFTRVTMILPLTGKQYSEKVAENCV  117



>sp|Q6BEH3.1|CFI_EUSER RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Eustoma exaltatum subsp. russellianum]
 dbj|BAD34458.1| chalcone isomerase [Eustoma grandiflorum]
Length=217

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 53/99 (54%), Gaps = 3/99 (3%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+   FPP +      K   L G G+  +EI    +K+TAIG+YLD   +  L  KWK
Sbjct  10   VQVESYLFPPTITPPASTKSFLLGGAGVRGLEIGGNFVKFTAIGIYLDETAIPWLAGKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
            GKT  +LA   DFF  II  P +K  +V +I  + G QY
Sbjct  70   GKTAEELADSVDFFADIITGPFEKFTQVTLILPLTGQQY  108



>ref|NP_001268033.1| chalcone--flavonone isomerase 2 [Vitis vinifera]
 sp|P51117.1|CFI1_VITVI RecName: Full=Chalcone--flavonone isomerase 1; Short=Chalcone 
isomerase 1 [Vitis vinifera]
 emb|CAA53577.1| chalcone isomerase [Vitis vinifera]
Length=234

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKL--LSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ + FPP V        L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   VQVENVLFPPSVKPPGSTNDLFLGGAGVRGLEIQGKFVKFTAIGVYLENSAVPTLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +LA   DFF  ++  P +K  +V  I  + G QY  ++ EN V
Sbjct  70   GKTVEELADSVDFFRDVVTGPFEKFTKVTTILPLTGRQYSDKVSENCV  117



>gb|ACS36662.1| CHI protein [Vitis labrusca]
Length=234

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKL--LSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ + FPP V        L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   VQVENVLFPPSVKPPGSTNDLFLGGAGVRGLEIQGKFVKFTAIGVYLENSAVPTLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +LA   DFF  ++  P +K  +V  I  + G QY  ++ EN V
Sbjct  70   GKTVEELADSVDFFRDVVTGPFEKFTKVTTILPLTGRQYSDKVSENCV  117



>gb|AGL81346.1| chalcone isomerase [Pyrus communis]
Length=233

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQIETTTFPPSVKPPGSSNTLFLGGGGVRGLEIQGNFVKFTAIGVYLEDSAVPQLAFKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAKELTESVEFFRDIVTGPFEKFIQVTTILPLTGRQYSEKVSENCV  117



>gb|AGL50916.1| chalcone synthase [Pyrus communis]
Length=219

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQVEATAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L++  +FF  I+  P +K ++V +I  + G QY  ++ EN V
Sbjct  70   GKTAEELSESVEFFRDIVTGPFEKFIQVTMILPLTGQQYSEKVSENCV  117



>ref|XP_008349840.1| PREDICTED: LOW QUALITY PROTEIN: chalcone--flavonone isomerase-like 
[Malus domestica]
Length=333

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V     +  L L G G+  +EI    +K+TAIGVYL+  +V  L  KWK
Sbjct  10   LQVETTAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNVVPQLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSHKVSENCV  117


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 36/63 (57%), Gaps = 1/63 (2%)
 Frame = +3

Query  135  LSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIINA  311
            L L G G+  +EI    +K+TAIGVYL+   V  L  KWKGKT  +L +  +FF  I+  
Sbjct  263  LFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPQLAVKWKGKTAKELTESVEFFRDIVTG  322

Query  312  PVD  320
              D
Sbjct  323  TTD  325



>gb|ADP09377.1| chalcone isomerase [Pyrus pyrifolia]
Length=233

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQIETTTFPPSVKPPGSSNTLFLGGAGVRGLEIRGNFVKFTAIGVYLEDNAVPQLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSEKVSENCV  117



>gb|AHZ97871.1| chalcone isomerase [Punica granatum]
Length=230

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDN--KLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+   FP  V      K L L G G   +EI    IK+TAIGVYL+   +  L  KWK
Sbjct  16   VQVESFTFPAAVKPQGSAKTLFLGGAGARGLEIEGKFIKFTAIGVYLEEAALPCLATKWK  75

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L    +FF  I+  P DK ++V +I  + G+QY  ++ EN V
Sbjct  76   GKTAEELTDSVEFFRDIVTGPYDKFMQVTMILPLTGAQYSEKVTENCV  123



>gb|AEJ86531.1| chalcone isomerase protein, partial [Pyrus x bretschneideri]
Length=148

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQIETTTFPPSVKPPGSSNTLFLGGGGVRGLEIQGNFVKFTAIGVYLEDSAVPQLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAKELTECVEFFRDIVTGPFEKFIQVTTILPLTGQQYSEKVSENCV  117



>sp|A5HBK6.1|CFI_PYRCO RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Pyrus communis]
 gb|ABQ08639.1| chalcone isomerase [Pyrus communis]
Length=219

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQVEATAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L++  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELSESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSEKVSENCV  117



>sp|A2IBF8.1|CFI_GOSHI RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Gossypium hirsutum]
 gb|ABM64798.1| chalcone isomerase [Gossypium hirsutum]
Length=227

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V      K L L G G   +EI    IK+TAIGVYL+   V+ L  KWK
Sbjct  10   LQVENFTFPPTVKPPGSTKTLFLGGAGERGLEIQGKFIKFTAIGVYLEDSAVNCLGVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GK+ V+L +  +FF  ++    +K +RV +I  + G QY  ++ EN V
Sbjct  70   GKSAVELTESVEFFRDVVTGDFEKFIRVTMILPLTGQQYSEKVSENCV  117



>ref|XP_010101513.1| Chalcone--flavonone isomerase [Morus notabilis]
 gb|EXB88510.1| Chalcone--flavonone isomerase [Morus notabilis]
Length=172

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (57%), Gaps = 3/92 (3%)
 Frame = +3

Query  102  FPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDL  272
            FPP+V      K   L G G   +E+    +K+T  GVYL  E VS L  KWKGKT  +L
Sbjct  21   FPPEVKPPGSAKTFFLAGAGWRGMEVDGKFVKFTTTGVYLKDEAVSWLAAKWKGKTAEEL  80

Query  273  AQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
             + D+FF+ I+  P +K  R+  I+ ++G ++
Sbjct  81   LESDEFFQDIVTGPFEKFYRLTHIRRLEGEEF  112



>ref|XP_007142689.1| hypothetical protein PHAVU_007G008500g [Phaseolus vulgaris]
 gb|ESW14683.1| hypothetical protein PHAVU_007G008500g [Phaseolus vulgaris]
Length=217

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 60/106 (57%), Gaps = 4/106 (4%)
 Frame = +3

Query  87   VDEIPFPPQVNLDNKLLS--LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGK  257
            VD + FPP VN  +  ++  L G G+  ++I    +K+TAIG+YL P+ V  L  KW  K
Sbjct  11   VDTVTFPPAVNPPSSSVAFFLAGAGVRGLQIQDKFVKFTAIGIYLQPDAVPLLSVKWNAK  70

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            +  +L    +FF  I+  P +K ++V +I  + G QY  ++ EN V
Sbjct  71   SAPELTDSVEFFRDIVTGPFEKFMQVTMILPLTGQQYSEKVSENCV  116



>gb|KCW51671.1| hypothetical protein EUGRSUZ_J01153 [Eucalyptus grandis]
Length=169

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 54/99 (55%), Gaps = 3/99 (3%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V        L L G G+  +E+    +KYTAIGVYL+ + V  L  KWK
Sbjct  12   IQVECFVFPPTVKPPGSGNTLFLSGAGVRGLEVDGKYVKYTAIGVYLEAKAVPILAAKWK  71

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
            GKT  +L    DFF  ++  P +K+ +V  I ++ G QY
Sbjct  72   GKTADELRDSIDFFRDVVTGPFEKLTQVSFITQLTGQQY  110



>dbj|BAJ21533.1| chalcone isomerase [Dahlia pinnata]
Length=224

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 58/106 (55%), Gaps = 4/106 (4%)
 Frame = +3

Query  87   VDEIPFPPQVNLDNKLLS--LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGK  257
            V+ I FPP V       +  L G G+  +EI    +K+T IG+YL+ + +S L  KWKGK
Sbjct  6    VESIVFPPSVKPPGATTTFFLAGAGVRGLEIQGNFVKFTGIGIYLEDKAISSLAVKWKGK  65

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            T  +L    DFF  I+  P +K  +V +I  + G QY  ++ EN V
Sbjct  66   TAHELTDSVDFFRDIVTGPFEKFSQVTMILPLTGQQYAEKVSENCV  111



>gb|AGM46640.1| chalcone isomerase protein, partial [Apium graveolens]
Length=210

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 58/110 (53%), Gaps = 4/110 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+   FPP V        L L G G+  +EI    +K+TAIGVYL+   V  L  KW 
Sbjct  4    VQVENYVFPPTVKPPASTNTLLLGGAGVRGLEIEGKFVKFTAIGVYLEENAVPLLAVKWN  63

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSVRD  398
            GKT  +L    DFF  I+  P +K ++V +I  + G QY  ++ EN V +
Sbjct  64   GKTAEELTDSVDFFRDIVTGPFEKFIQVTMILPLTGQQYSEKVSENCVAN  113



>ref|XP_008343525.1| PREDICTED: chalcone--flavonone isomerase-like [Malus domestica]
Length=167

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNK--LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V        L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQVETTAFPPSVKPPGSPNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEENAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSHKVSENCV  117



>ref|XP_008370149.1| PREDICTED: chalcone--flavonone isomerase-like isoform X2 [Malus 
domestica]
Length=466

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V     +  L L G G+  +EI    +K+TAIGVYL+  +V  L  KWK
Sbjct  10   LQVETTAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNVVPQLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSHKVSENCV  117


 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNK--LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V        L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  243  LQVETTAFPPSVKPPGSPNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPQLAVKWK  302

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN +
Sbjct  303  GKTAKELTESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSEKVSENCI  350



>ref|XP_010669773.1| PREDICTED: chalcone--flavonone isomerase-like [Beta vulgaris 
subsp. vulgaris]
Length=223

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 59/110 (54%), Gaps = 9/110 (8%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL----DNKLLSLMG-HGITDVEIHFLQIKYTAIGVYL--DPEIVSHL  239
            + V++  FPP V       N  L   G  G +D+E  +  +KYTAIGVYL  D    S  
Sbjct  7    LCVEDYVFPPMVKAPGSDKNFFLGGAGERGRSDLEGKY--VKYTAIGVYLEEDKATSSLA  64

Query  240  QKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENS  389
             KWKGK+ ++LA   DFF  II  P +K  ++ +I+ + G QY V +  +
Sbjct  65   AKWKGKSAIELADSVDFFRDIITGPFEKFTQITMIQPLTGQQYSVNMART  114



>sp|Q4AE12.1|CFI2_FRAAN RecName: Full=Chalcone--flavonone isomerase 2; Short=Chalcone 
isomerase 2 [Fragaria x ananassa]
 dbj|BAE17120.1| chalcone isomerase [Fragaria x ananassa]
Length=237

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + +    FPP V        L L G G+  +EI    +K+TAIGVYL+ + V  L  KWK
Sbjct  8    IQIGGTSFPPAVKPPGSGNTLFLGGAGVRGMEIQGNFVKFTAIGVYLEDKAVPALSVKWK  67

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K  +V +I  + G QY  ++ EN V
Sbjct  68   GKTAEELTESVEFFREIVTGPFEKFTQVTMILPLTGQQYSEKVSENCV  115



>sp|Q43754.1|CFI_DIACA RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Dianthus caryophyllus]
 emb|CAA91931.1| chalcone isomerase [Dianthus caryophyllus]
Length=221

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP+V     +K   L G G+  +EI    IK+TAI VY++ + VS L  KWK
Sbjct  7    IQVESHVFPPEVKPPGSDKTFFLGGAGVRGLEIQGKFIKFTAIAVYIEDDAVSSLAVKWK  66

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQ-LENSV  392
            GKT  +L    DFF+ I+  P +K  +V +I  + G QY  + +EN V
Sbjct  67   GKTADELTDSVDFFKDIVTGPFEKFTQVTMILPLTGQQYSEKVVENCV  114



>gb|AJO67975.1| chalcone isomerase [Prunus avium]
Length=232

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNK--LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP V        L L G G+  +EI    +K+TAIGVYL+ + V  L  KWK
Sbjct  10   LQIEATSFPPSVKPPGSANTLFLGGAGVRGLEIQGNFVKFTAIGVYLEEKAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K  +V  I  + G QY  ++ EN V
Sbjct  70   GKTAQELTESVEFFREIVTGPFEKFTQVTTILPLTGQQYSEKVSENCV  117



>gb|KJB78871.1| hypothetical protein B456_013G023400, partial [Gossypium raimondii]
Length=262

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V      K L L G G   +EI    IK+TAIGVYL+   V+ L  KWK
Sbjct  45   LQVENFTFPPTVKPPGSTKTLFLGGAGERGLEIQGKFIKFTAIGVYLEDSAVNCLGVKWK  104

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GK+ V+L +  +FF  ++    +K +RV +I  + G QY  ++ EN V
Sbjct  105  GKSAVELTESVEFFRDVVTGDFEKFVRVTMILPLTGQQYSEKVSENCV  152



>ref|XP_008776249.1| PREDICTED: LOW QUALITY PROTEIN: chalcone--flavonone isomerase-like 
[Phoenix dactylifera]
Length=234

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 58/106 (55%), Gaps = 4/106 (4%)
 Frame = +3

Query  87   VDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGK  257
            V+   FPP V     +K L L G G+  +EI    I +TAIGVYL+ E +  L  KW+GK
Sbjct  13   VEGFVFPPVVRPPGSSKTLFLGGAGVRGLEIGGRFITFTAIGVYLEDEAIRSLSGKWRGK  72

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            T  +LA   DFF  I+    +K  RV ++  + G QY  ++ EN V
Sbjct  73   TADELAASVDFFRDIVAGXFEKFTRVTMVLPLTGQQYSEKVSENCV  118



>gb|ADZ54781.1| chalcone isomerase [Prunus avium]
Length=232

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNK--LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP V        L L G G+  +EI    +K+TAIGVYL+ + V  L  KWK
Sbjct  10   LQIEATSFPPSVKPPGSANTLFLGGAGVRGLEIQGNFVKFTAIGVYLEEKAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K  +V  I  + G QY  ++ EN V
Sbjct  70   GKTAQELTESVEFFREIVTGPFEKFTQVTTILPLTGQQYSEKVSENCV  117



>gb|AJO67964.1| chalcone isomerase [Prunus avium]
Length=238

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP V        L L G G+  +EI    +K+TAIGVYL+ + V  L  KWK
Sbjct  10   LQIEATSFPPSVKPPGSANTLFLGGAGVRGLEIQGNFVKFTAIGVYLEEKAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K  +V  I  + G QY  ++ EN V
Sbjct  70   GKTAQELTESVEFFREIVTGPFEKFTQVTTILPLTGQQYSEKVSENCV  117



>gb|ACB37366.1| chalcone isomerase 1 [Glycine max]
Length=215

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = +3

Query  96   IPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPV  266
            + FPP V          L G G+  ++IH   +K+TAI +YL  + +S L  KWK K+  
Sbjct  1    VTFPPTVKPPCSPNTFFLAGAGVRGLQIHHAFVKFTAICIYLQYDALSFLSVKWKTKSTH  60

Query  267  DLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
             L + D FF  I+  P +K ++V +IK + G QY  ++ EN V
Sbjct  61   QLTESDQFFSDIVTGPFEKFMQVTMIKPLTGQQYSEKVAENCV  103



>dbj|BAO32070.1| chalcone isomerase Type1 [Antirrhinum majus]
Length=221

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP+V     +K   L G G+  +EI    IK+TAI VY+  + VS L  KWK
Sbjct  7    IQVESHVFPPEVKPPGSDKTFFLGGAGVRGLEIQGKFIKFTAIAVYIADDAVSSLAVKWK  66

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L    DFF+ I+  P +K  +V +I  + G QY  ++ EN V
Sbjct  67   GKTADELTDSVDFFKDIVTGPFEKFTQVTMILPLTGQQYSEKMVENCV  114



>gb|ACR38773.1| unknown [Zea mays]
Length=231

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 53/101 (52%), Gaps = 4/101 (4%)
 Frame = +3

Query  102  FPPQVNLDNKLLS--LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHL-QKWKGKTPVDL  272
            FPP         S  L G G+  +EI    +K+TAIGVYL+   V  L +KW GKT  +L
Sbjct  13   FPPAARPPGSAGSHFLGGAGVRGLEIGGNFVKFTAIGVYLEDAAVPALARKWAGKTAGEL  72

Query  273  AQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY-GVQLENSV  392
            A D  FF  ++    +K  RV +I+ + G QY G   EN V
Sbjct  73   ASDAAFFRDVVTGGFEKFARVTMIRPLTGEQYAGKVAENCV  113



>gb|KHG18033.1| Chalcone--flavonone isomerase [Gossypium arboreum]
Length=227

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V      K L L G G   +EI    IK+TAIGVYL+   V+ L  KWK
Sbjct  10   LQVENFTFPPTVKPPGSTKTLFLGGAGERGLEIQGKFIKFTAIGVYLEDSAVNCLGVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GK+ V+L +   FF  ++    +K +RV +I  + G QY  ++ EN V
Sbjct  70   GKSAVELTESVAFFRDVVTGDFEKFIRVTMILPLTGQQYSEKVSENCV  117



>ref|XP_002980623.1| hypothetical protein SELMODRAFT_444624 [Selaginella moellendorffii]
 gb|EFJ18274.1| hypothetical protein SELMODRAFT_444624 [Selaginella moellendorffii]
Length=216

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = +3

Query  63   EMGTEMVMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHF-LQIKYTAIGVYLDPEIVS  233
            E+  + ++++   FPP +   +  K L L G G+  ++I+  + I  T +G Y +  I+ 
Sbjct  4    ELLKQGLVIEGTQFPPGLTSPVSQKSLFLAGAGVRSIQINPQVTITVTVLGFYFEDGILK  63

Query  234  HLQ-KWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQ-LENS  389
            HL  KW GK+  +L ++DDFF  IINAP +K+  V ++K + G+++  + +EN+
Sbjct  64   HLSGKWSGKSGSELEKEDDFFTDIINAPSEKIFSVTMLKPLPGTEFSKKVMENT  117



>gb|AFA55178.1| chalcone isomerase [Acacia confusa]
Length=239

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ + FPP V     NK   L G G   + I    +K+TAIGVYL+ + +  L  KWK
Sbjct  9    VQVESVEFPPTVKAPGSNKSFFLGGAGERGLHIQDKFVKFTAIGVYLEDDAIPALAAKWK  68

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+    +K  RV +I  + G QY  ++ EN V
Sbjct  69   GKTAQELTESVEFFREIVTGGFEKFTRVTMILPLTGQQYAEKVSENCV  116



>ref|XP_004307451.1| PREDICTED: chalcone--flavonone isomerase 1 [Fragaria vesca subsp. 
vesca]
Length=237

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + +  + FPP V          L G G+  +EI    +K+TAIGVYL+ + V  L  KWK
Sbjct  8    IQIGGMSFPPSVKPPGSGNTFFLGGAGVRGMEIQGNFVKFTAIGVYLEDKAVPALAVKWK  67

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K  +V +I  + G QY  ++ EN V
Sbjct  68   GKTAEELTESVEFFREIVTGPFEKFTQVTMILPLTGQQYSEKVSENCV  115



>sp|Q4AE11.1|CFI1_FRAAN RecName: Full=Chalcone--flavonone isomerase 1; Short=Chalcone 
isomerase 1 [Fragaria x ananassa]
 dbj|BAE17121.1| chalcone isomerase [Fragaria x ananassa]
Length=237

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + +  + FPP V          L G G+  +EI    +K+TAIGVYL+ + V  L  KWK
Sbjct  8    IQIGGMSFPPSVKPPGSGNTFFLGGAGVRGMEIQGNFVKFTAIGVYLEDKAVPALAVKWK  67

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K  +V +I  + G QY  ++ EN V
Sbjct  68   GKTAEELTESVEFFREIVTGPFEKFTQVTMILPLTGQQYSEKVSENCV  115



>gb|AEO36980.1| chalcone isomerase [Dimocarpus longan]
Length=246

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+ + F P V      K L L G G   +EI    IK+TAIGVYL+   VS L  KWK
Sbjct  10   IQVENVTFTPFVKPPGSTKTLFLGGAGERGLEIQGKFIKFTAIGVYLEDVAVSWLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V +I  + G QY  ++ EN +
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFMKVTMILPLTGQQYSEKVTENCI  117



>ref|XP_010034339.1| PREDICTED: chalcone--flavonone isomerase-like [Eucalyptus grandis]
Length=249

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 54/99 (55%), Gaps = 3/99 (3%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V        L L G G+  +E+    +KYTAIGVYL+ + V  L  KWK
Sbjct  12   IQVECFVFPPTVKPPGSGNTLFLSGAGVRGLEVDGKYVKYTAIGVYLEAKAVPILAAKWK  71

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
            GKT  +L    DFF  ++  P +K+ +V  I ++ G QY
Sbjct  72   GKTADELRDSIDFFRDVVTGPFEKLTQVSFITQLTGQQY  110



>ref|XP_009344895.1| PREDICTED: chalcone--flavonone isomerase isoform X1 [Pyrus x 
bretschneideri]
Length=466

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQIETTAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPQLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTTILPLTGQQYAEKVSENCV  117


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP +     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  243  LQIETTTFPPSIKPPGSSNTLFLGGGGVRGLEIQGNFVKFTAIGVYLEDSAVPQLAVKWK  302

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  303  GKTAKELTESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSEKVSENCV  350



>gb|ADE76284.1| unknown [Picea sitchensis]
Length=292

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
 Frame = +3

Query  66   MGTEMVMVD---EIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIV  230
            +GTE  +V+    + F   +N+   +  LSL G G  + +I  + +K  A G+Y+D  I 
Sbjct  84   VGTEDFIVEPATNVKFLTSLNVPGGSSSLSLAGTGFREKKIAIISVKVYAAGLYVDTTIK  143

Query  231  SHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSV  392
            S+L  W GK    + QD+ FF A+  APV+K L++V++++I G  +   L+ ++
Sbjct  144  SYLAAWSGKLGSQIEQDNLFFNAVFEAPVEKSLQIVLVRDIDGETFWGALDEAL  197



>gb|AHI86005.1| chalcone isomerase [Olea europaea]
 gb|AHI86006.1| chalcone isomerase [Olea europaea]
Length=249

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 56/106 (53%), Gaps = 4/106 (4%)
 Frame = +3

Query  87   VDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGK  257
            VD   FP        +K L L G G   +EI    IK+TAIGVYL+   VS L  KW GK
Sbjct  12   VDSYLFPAAAKPPGSSKTLFLGGAGARGLEIEGKFIKFTAIGVYLEDNAVSLLAVKWNGK  71

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            +  +L    +FF AI+  P +K  RV +I  + G QY  ++ EN V
Sbjct  72   SAEELTDSVEFFNAIVTGPFEKFTRVTMILPLTGPQYSEKVAENCV  117



>ref|XP_003592764.1| Chalcone-flavonone isomerase 1B-1 [Medicago truncatula]
 gb|AFK46547.1| unknown [Medicago truncatula]
Length=223

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (58%), Gaps = 3/99 (3%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKLLS--LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ I FP  V   +   S  L G G+  +++    +K+T +GVYL+ + V+ L  KWK
Sbjct  11   VKVEFIEFPAVVTPPSSTKSYFLGGAGVRGLDVDGEFVKFTGLGVYLEEKAVASLTLKWK  70

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
            GKTP  L +  DF+  II  P +K +R   ++ ++GS+Y
Sbjct  71   GKTPSQLFESLDFYRDIIKGPFEKFIRCTKVRTLEGSEY  109



>gb|ACP30360.1| chalcone isomerase protein [Malus hybrid cultivar]
Length=219

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V    FPP V     +  L L G G+  +EI    +K TAIGVYL+   V  L  KWK
Sbjct  10   LQVGATAFPPSVKPPGSSNTLFLGGAGMRGLEIQGNFVKVTAIGVYLEDSAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L++  +FF  I+  P +K ++V++I  + G QY  ++ EN V
Sbjct  70   GKTAEELSESVEFFRDIVTGPFEKFIQVIMILPLTGQQYSEKVSENCV  117



>ref|XP_008386466.1| PREDICTED: chalcone--flavonone isomerase [Malus domestica]
Length=228

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNK--LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V        L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQVETTAFPPSVKPPGSPNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEENAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTXILPLTGQQYSDKVSENCV  117



>ref|XP_009335926.1| PREDICTED: chalcone--flavonone isomerase-like [Pyrus x bretschneideri]
Length=454

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  245  LQVEATAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPLLAVKWK  304

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L++  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  305  GKTAKELSESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSEKVSENCV  352


 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = +3

Query  132  LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIIN  308
            +L L G G+  + I    +K+T IGVYL+   V  L  KWKGKT  +LA   +F + ++ 
Sbjct  29   ILFLGGAGVRGLPIEGKLVKFTVIGVYLEDNAVPVLAVKWKGKTAQELANSVEFIKDVVT  88

Query  309  APVDKVLRVVVIKEIKGSQYGVQL-ENSVRD  398
             P +K  +V  I+ + G QY  ++ EN +  
Sbjct  89   GPFEKFTQVTFIQHLTGRQYSEKVAENCIAS  119



>ref|XP_010910012.1| PREDICTED: chalcone--flavonone isomerase [Elaeis guineensis]
Length=234

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 58/106 (55%), Gaps = 4/106 (4%)
 Frame = +3

Query  87   VDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGK  257
            V+ I FPP V+    +K L L G G   +EI    I +TAIG+YL+ E +  L  KWKGK
Sbjct  13   VEGIVFPPVVSPPGSSKTLFLGGAGCRGLEIGGRFITFTAIGIYLEDEALRSLSGKWKGK  72

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            T  +LA   +FF  I     +K  RV ++  + G QY  ++ EN V
Sbjct  73   TTDELAASLEFFRDIFTGSFEKFTRVTMVLPLTGQQYSEKVAENCV  118



>sp|Q45QI7.2|CFI_CAMSI RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Camellia sinensis]
 gb|AAZ17563.2| chalcone isomerase [Camellia sinensis]
Length=230

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 64/127 (50%), Gaps = 12/127 (9%)
 Frame = +3

Query  24   IYPSLSPSAF*D*EMGTEMVMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYT  197
            + PS SPS           V ++   FPP V     +K   L G G   +EI    IK+T
Sbjct  1    MSPSQSPS--------VAQVQIESHVFPPTVKPPGTSKPFFLGGAGERGLEIQGKFIKFT  52

Query  198  AIGVYL-DPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGV  374
            AIGVYL D  I S   KWKGKT  +L    DFF  I++ P +K  +V +I  + G QY  
Sbjct  53   AIGVYLEDSAIPSLAVKWKGKTAEELTDSVDFFRDIVSGPFEKFTQVTMILPLTGQQYSE  112

Query  375  QL-ENSV  392
            ++ EN V
Sbjct  113  KVTENCV  119



>gb|ACQ41836.1| chalcone-flavanone isomerase [Elaeis oleifera]
Length=234

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 58/106 (55%), Gaps = 4/106 (4%)
 Frame = +3

Query  87   VDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGK  257
            V+ I FPP V+    +K L L G G   +EI    I +TAIG+YL+ E +  L  KWKGK
Sbjct  13   VEGIVFPPVVSPPGSSKSLFLGGAGCRGLEIGGRFITFTAIGIYLEDEALRSLSGKWKGK  72

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            T  +LA   +FF  I     +K  RV ++  + G QY  ++ EN V
Sbjct  73   TTDELAASLEFFRDIFTGSFEKFTRVTMVLPLTGQQYSEKVAENCV  118



>ref|XP_008370163.1| PREDICTED: chalcone--flavonone isomerase-like isoform X5 [Malus 
domestica]
Length=466

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  243  LQVETTAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPQLAVKWK  302

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  303  GKTAEELMESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSDKVSENCV  350


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP       +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQVETTAFPPSAKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEENAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTXILPLTGQQYSDKVSENCV  117



>sp|Q565D8.1|CFI_GENTR RecName: Full=Chalcone--flavonone isomerase; Short=Chalcone isomerase 
[Gentiana triflora]
 dbj|BAD95484.1| chalcone flavonone isomerase [Gentiana triflora]
Length=221

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 3/92 (3%)
 Frame = +3

Query  102  FPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDL  272
            FPP V      K   L G G+  +EI+   +K+TAIGVYL+   V+ L  KWKGKT  +L
Sbjct  19   FPPSVKPPSSTKSFLLGGAGVRGLEINGNFVKFTAIGVYLEESGVAVLSGKWKGKTAEEL  78

Query  273  AQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
            +   +FF  II  P +K  +V +I  + G QY
Sbjct  79   SDSVEFFTDIITGPFEKFTQVTLILPVTGQQY  110



>gb|AHJ80977.1| chalcone isomerase [Erythranthe lewisii]
Length=233

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 56/108 (52%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDN--KLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+   FPP V      K   L G G+  +EI    +K+TAIGVYL+ + V  L  KW 
Sbjct  10   VQVESCVFPPAVKPPGSAKTFFLGGAGVRGMEIGGRFVKFTAIGVYLEDDAVPSLAVKWN  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L    DFF  I+  P +K  +V  I  + G QY  ++ EN V
Sbjct  70   GKTADELTDSVDFFGDIVTGPFEKFTKVTTILPLTGKQYSEKVAENCV  117



>gb|EPS73111.1| chalcone--flavonone isomerase, partial [Genlisea aurea]
Length=218

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +3

Query  141  LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIINAPV  317
            L G G   +EI    IK+TAIGVYL  + +S L  KWKGKT  +LA+  +FF  ++  P 
Sbjct  33   LGGAGFRGLEIEGKFIKFTAIGVYLGHDAISSLAAKWKGKTSAELAESVEFFADVVTGPF  92

Query  318  DKVLRVVVIKEIKGSQY  368
             K+ RV +I  + G QY
Sbjct  93   QKLTRVTMILPLTGQQY  109



>gb|AFM29131.1| chalcone isomerase [Morus alba]
 gb|AID16081.1| chalcone isomerase [Morus alba]
Length=219

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 57/108 (53%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+   FPP       +K L L G G   +EI    +K+T IGVYL+   V  L  KWK
Sbjct  9    VQVEIATFPPAATPPGSDKTLFLGGAGARGLEIQGKFVKFTTIGVYLEDNAVKWLAGKWK  68

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GK+  +L +  +FF  I+  P +K  RV +I  + G QY  ++ EN V
Sbjct  69   GKSAEELTESVEFFRDIVTGPFEKFTRVTMILPLTGPQYSEKVSENCV  116



>gb|AFH02720.1| chalcone isomerase, partial [Lonicera japonica]
Length=206

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +3

Query  141  LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIINAPV  317
            L G G+  +EI    IK+TAIGVYL+ + V+ L  KWKGKT  +LA   +FF  I+  P 
Sbjct  32   LGGAGVRGLEIQGKFIKFTAIGVYLEEKAVASLADKWKGKTAEELADSVEFFADIVTGPF  91

Query  318  DKVLRVVVIKEIKGSQYGVQL-ENSV  392
            +K  +V +I  + G QY  ++ EN V
Sbjct  92   EKFTQVTMILPLTGQQYSEKVAENCV  117



>gb|ADZ28513.1| chalcone isomerase [Camellia nitidissima]
Length=230

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 64/127 (50%), Gaps = 12/127 (9%)
 Frame = +3

Query  24   IYPSLSPSAF*D*EMGTEMVMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYT  197
            + PS SPS           V ++   FPP V     +K   L G G   +EI    IK+T
Sbjct  1    MSPSQSPSV--------TQVQIESHVFPPTVKPPGTSKPFFLGGAGERGLEIQGKFIKFT  52

Query  198  AIGVYL-DPEIVSHLQKWKGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGV  374
            AIGVYL D  I S   KWKGKT  +L    DFF  I++ P +K  +V +I  + G QY  
Sbjct  53   AIGVYLEDSAIPSLAVKWKGKTAEELTDSVDFFRDIVSGPFEKFTQVTMILPLTGQQYSE  112

Query  375  QL-ENSV  392
            ++ EN V
Sbjct  113  KVTENCV  119



>ref|XP_008370159.1| PREDICTED: chalcone--flavonone isomerase-like isoform X4 [Malus 
domestica]
Length=466

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  243  LQVETTAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPQLAVKWK  302

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  303  GKTAEELMESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSDKVSENCV  350


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP       +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQVETTAFPPSAKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEENAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTXILPLTGQQYSDKVSENCV  117



>gb|AGE10599.1| chalcone isomerase [Lonicera japonica]
Length=240

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +3

Query  141  LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIINAPV  317
            L G G+  +EI    IK+TAIGVYL+ + V+ L  KWKGKT  +LA   +FF  I+  P 
Sbjct  32   LGGAGVRGLEIQGKFIKFTAIGVYLEEKAVASLADKWKGKTAEELADSVEFFADIVTGPF  91

Query  318  DKVLRVVVIKEIKGSQYGVQL-ENSV  392
            +K  +V +I  + G QY  ++ EN V
Sbjct  92   EKFTQVTMILPLTGQQYSEKVAENCV  117



>ref|XP_008370152.1| PREDICTED: chalcone--flavonone isomerase-like isoform X3 [Malus 
domestica]
Length=466

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNK--LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V        L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  243  LQVETTAFPPSVKPPGSPNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPQLAVKWK  302

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN +
Sbjct  303  GKTAKELTESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSEKVSENCI  350


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP       +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQVETTAFPPSAKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEENAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTXILPLTGQQYSDKVSENCV  117



>ref|XP_004497326.1| PREDICTED: chalcone--flavonone isomerase 1-like [Cicer arietinum]
Length=224

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 58/106 (55%), Gaps = 4/106 (4%)
 Frame = +3

Query  87   VDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYL-DPEIVSHLQKWKGK  257
            V+ + FPP V      K   L G G   + I    IK+TAIGVYL D  + S   KWKGK
Sbjct  12   VEFLEFPPVVTSPATAKSYFLGGAGERGLTIEGNFIKFTAIGVYLEDIAVASLATKWKGK  71

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQ-LENSV  392
            T   L Q  DF+  II+ P +K++R   I+E+ G +Y  + +EN V
Sbjct  72   TSQQLLQTLDFYRDIISGPFEKLIRGSKIRELSGPEYSRKVMENCV  117



>ref|XP_003592763.1| Chalcone-flavonone isomerase 2-B [Medicago truncatula]
 gb|AES63014.1| chalcone-flavanone isomerase family protein [Medicago truncatula]
 gb|AFK35537.1| unknown [Medicago truncatula]
Length=225

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ I FP  V      K   L G G+  ++I    +K+T IG+YL+ + V+ L  KWK
Sbjct  11   VKVENIEFPAVVTPPASPKSYFLGGAGVRGLDIDGEFVKFTGIGIYLEEKAVASLTPKWK  70

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
            GKTP  L +  +F+  II  P +K +R   ++ ++GS+Y
Sbjct  71   GKTPSQLFESLEFYRDIIKGPFEKFIRSTKVRTLEGSEY  109



>gb|AES63015.2| chalcone-flavanone isomerase family protein [Medicago truncatula]
Length=223

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (58%), Gaps = 3/99 (3%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNKLLS--LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+ I FP  V   +   S  L G G+  +++    +K+T +GVYL+ + V+ L  KWK
Sbjct  11   VKVEFIEFPVVVTPPSSTKSYFLGGAGVRGLDVDGEFVKFTGLGVYLEEKAVASLTLKWK  70

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQY  368
            GKTP  L +  DF+  II  P +K +R   ++ ++GS+Y
Sbjct  71   GKTPSQLFESLDFYRDIIKGPFEKFIRCTKVRTLEGSEY  109



>gb|AFP33452.1| type I chalcone isomerase [Arachis hypogaea]
Length=255

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 57/108 (53%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V VD + FP        +K   L G G+  ++I    +K+TAI VYL    V  L  KW 
Sbjct  10   VQVDNVTFPATAKPPGSDKTFFLGGAGVRGLQIDDKFVKFTAIAVYLQDNAVPSLAVKWN  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKTP +L +  DFF  I+  P +K ++V +I  + G QY  ++ EN V
Sbjct  70   GKTPSELTESVDFFRDIVTGPFEKFMQVTMILPLTGQQYSQKVSENCV  117



>ref|XP_008392235.1| PREDICTED: chalcone--flavonone isomerase-like [Malus domestica]
Length=219

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V    FPP V     +  L L G G+  +EI    +K TAIGVYL+   V  L  KWK
Sbjct  10   LQVGATAFPPSVKPPGSSNTLFLGGAGMRGLEIQGNFVKVTAIGVYLEDNAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L++  +FF  I+  P +K ++V +I  + G QY  ++ EN V
Sbjct  70   GKTAEELSESVEFFRDIVTGPFEKFIQVTMILPLTGQQYSEKVSENCV  117



>ref|XP_008385653.1| PREDICTED: chalcone--flavonone isomerase-like [Malus domestica]
Length=333

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNK--LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V        L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQVETTAFPPSVKPPGSPNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEENAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSDKVSENCV  117


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 3/83 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  243  LQVETTAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPQLAVKWK  302

Query  252  GKTPVDLAQDDDFFEAIINAPVD  320
            GKT  +L +  +FF  I+    D
Sbjct  303  GKTAEELMESVEFFRDIVTGTGD  325



>gb|AIE16819.1| chalcone isomerase, partial [Glycine soja]
Length=137

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  141  LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIINAPV  317
            L G G+  ++IH   +K+TAI +YL  + +S L  KWK K+   L + D FF  I+  P 
Sbjct  10   LAGAGVRGLQIHHAFVKFTAICIYLQYDALSFLSVKWKTKSAHQLTESDQFFSDIVTGPF  69

Query  318  DKVLRVVVIKEIKGSQYGVQL-ENSV  392
            +K ++V +IK + G QY  ++ EN V
Sbjct  70   EKFMQVTMIKPLTGQQYSEKVAENCV  95



>gb|AFI25035.1| chalcone isomerase, partial [Populus deltoides x Populus tremuloides]
Length=134

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +3

Query  123  DNKLLSLMGHGITDVEIHFLQIKYTAIGVYL-DPEIVSHLQKWKGKTPVDLAQDDDFFEA  299
             N  L L G G+  +EI    IK+TAIGVYL D  + S   KWKGK   +L    +FF  
Sbjct  2    SNNTLFLGGAGVRGLEIEGKFIKFTAIGVYLEDNSLQSLAPKWKGKIAKELTDSVEFFRD  61

Query  300  IINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            I+  P +K +RV +I  + G QY  ++ EN V
Sbjct  62   IVRGPFEKFMRVTMILPLTGLQYSEKVAENCV  93



>gb|AIY22761.1| chalcone flavanone isomerase [Iochroma cyaneum]
Length=234

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 56/108 (52%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQV---NLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KW  248
            + V+   FPP V      N LL L G G   +EI    +K+T IGVYL+   +  L  KW
Sbjct  7    LQVENYVFPPTVVKPPGSNNLLFLGGAGSRGLEIEGKFVKFTVIGVYLEESAIPFLAAKW  66

Query  249  KGKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQLENSV  392
            KGK+  +L    +FF  I+  P +K  RV +I  + G Q+  ++E + 
Sbjct  67   KGKSSEELTHSVEFFRDIVTGPFEKFTRVTMILPLTGKQFSEKVEENC  114



>gb|AIE16811.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16813.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16815.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16816.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16820.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16821.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16822.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16823.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16824.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16825.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16826.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16827.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16828.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16829.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16830.1| chalcone isomerase, partial [Glycine soja]
 gb|AIE16835.1| chalcone isomerase, partial [Glycine max]
Length=137

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  141  LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIINAPV  317
            L G G+  ++IH   +K+TAI +YL  + +S L  KWK K+   L + D FF  I+  P 
Sbjct  10   LAGAGVRGLQIHHAFVKFTAICIYLQYDALSFLSVKWKTKSAHQLTESDQFFSDIVTGPF  69

Query  318  DKVLRVVVIKEIKGSQYGVQL-ENSV  392
            +K ++V +IK + G QY  ++ EN V
Sbjct  70   EKFMQVTMIKPLTGQQYSEKVAENCV  95



>gb|AIE16809.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16810.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16812.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16831.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16832.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16833.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16834.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16836.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16837.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16838.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16839.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16840.1| chalcone isomerase, partial [Glycine max]
 gb|AIE16841.1| chalcone isomerase, partial [Glycine max]
Length=137

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  141  LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIINAPV  317
            L G G+  ++IH   +K+TAI +YL  + +S L  KWK K+   L + D FF  I+  P 
Sbjct  10   LAGAGVRGLQIHHAFVKFTAICIYLQYDALSFLSVKWKTKSTHQLTESDQFFSDIVTGPF  69

Query  318  DKVLRVVVIKEIKGSQYGVQL-ENSV  392
            +K ++V +IK + G QY  ++ EN V
Sbjct  70   EKFMQVTMIKPLTGQQYSEKVAENCV  95



>gb|AEO79980.1| chalcone isomerase [Prunus avium]
Length=232

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNK--LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP V        L L G G+  +EI    +K+TAIGVYL+ + V  L  KWK
Sbjct  10   LQIEATSFPPSVKPPGSADTLFLGGAGVRGLEIQGNFVKFTAIGVYLEEKAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            G+T  +L +  +FF  ++  P +K  +V  I  + G QY  ++ EN V
Sbjct  70   GETAQELTESVEFFREVVTGPFEKFTQVTTILPLTGQQYSEKVSENCV  117



>ref|XP_006403490.1| hypothetical protein EUTSA_v10010658mg [Eutrema salsugineum]
 gb|ESQ44943.1| hypothetical protein EUTSA_v10010658mg [Eutrema salsugineum]
Length=253

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + VD + FPP VN    +  L L G G+  ++IH   + +T IGVYLD   +  L  KWK
Sbjct  16   LQVDSVTFPPSVNSPASSNPLFLGGAGVRGLDIHGKFVIFTVIGVYLDAASLPSLSVKWK  75

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +   FF  I+    +K ++V +   + G QY  ++ EN V
Sbjct  76   GKTTEELTESVPFFREIVTGAFEKFIKVTMKLPLTGQQYSEKVTENCV  123



>gb|AHY35310.1| chalcone isomerase [Morus notabilis]
Length=219

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 57/108 (53%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+   FPP       +K L L G G   +EI    +K+T IGVYL+   V  L  KWK
Sbjct  9    VQVEIATFPPAATPPGSDKTLFLGGAGARGLEIQGKFVKFTTIGVYLEDNAVKWLAGKWK  68

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GK+  +L +  +FF  I+  P +K  RV +I  + G QY  ++ EN V
Sbjct  69   GKSVEELTESVEFFRDIVTGPFEKFTRVTMILPLTGPQYSEKVSENCV  116



>gb|ADK97764.1| chalcone isomerase [Eclipta prostrata]
Length=221

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 6/105 (6%)
 Frame = +3

Query  96   IPFPPQV----NLDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKT  260
            I FPP V            L G G+  +EI    +K+T IGVYL+ + VS L  KWKGKT
Sbjct  7    IVFPPSVKPPGTTTTATFFLGGAGVRGLEIQGNFVKFTGIGVYLEDKAVSALAVKWKGKT  66

Query  261  PVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
              +L    DF+  I+  P +K  +V +I  + G+QY  ++ EN V
Sbjct  67   ADELTDSVDFYRDIVTGPFEKFAQVTMILPLTGNQYAEKVSENCV  111



>ref|XP_010101512.1| Chalcone--flavonone isomerase [Morus notabilis]
 gb|EXB88509.1| Chalcone--flavonone isomerase [Morus notabilis]
Length=223

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 57/108 (53%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            V V+   FPP       +K L L G G   +EI    +K+T IGVYL+   V  L  KWK
Sbjct  9    VQVEIATFPPAATPPGSDKTLFLGGAGARGLEIQGKFVKFTTIGVYLEDNAVKWLAGKWK  68

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GK+  +L +  +FF  I+  P +K  RV +I  + G QY  ++ EN V
Sbjct  69   GKSVEELTESVEFFRDIVTGPFEKFTRVTMILPLTGPQYSEKVSENCV  116



>gb|AGH13331.1| chalcone isomerase [Rhus chinensis]
Length=245

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  141  LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIINAPV  317
            L G G+  +EI    +K+TAIGVY++   VS L  KWKGK+  +L +   FF  I+  P 
Sbjct  32   LGGAGVRGLEIQGKFVKFTAIGVYVEDSAVSSLAGKWKGKSAEELCESVPFFRDIVTGPF  91

Query  318  DKVLRVVVIKEIKGSQYGVQL-ENSV  392
            +K +RV +I  + G QY  ++ EN V
Sbjct  92   EKFIRVTMILPLTGQQYSQKVAENCV  117



>gb|ADT63063.1| chalcone isomerase [Fagopyrum esculentum]
Length=256

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + +++  FPP V      K   L G G+  + I    I +TAIG+Y +   V+ L  KWK
Sbjct  10   IAIEDFVFPPSVRPPATEKSFFLGGAGVRGLTIQGTFISFTAIGIYFEETAVASLADKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GK+  +LA+  +FF  ++    +K +++ ++K + G+QY  ++ EN V
Sbjct  70   GKSATELAESVEFFRDVVTGQFEKFIQISMLKPLTGAQYSEKVSENCV  117



>gb|ADO95199.1| chalcone isomerase [Litchi chinensis]
Length=100

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  141  LMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGKTPVDLAQDDDFFEAIINAPV  317
            L G G   +EI    +K+TAIGVYL+   VS L  KWKGKT  +L +  +FF  I+  P 
Sbjct  2    LGGAGERGLEIQGKFVKFTAIGVYLEDVAVSSLAVKWKGKTAEELTESVEFFRDIVTGPF  61

Query  318  DKVLRVVVIKEIKGSQYGVQL-ENSV  392
            +K ++V +I  + G QY  ++ EN +
Sbjct  62   EKFMKVTMILPLTGQQYSEKVTENCI  87



>ref|XP_008370145.1| PREDICTED: uncharacterized protein LOC103433655 isoform X1 [Malus 
domestica]
Length=699

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  243  LQVETTAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPQLAVKWK  302

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  303  GKTAEELMESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSDKVSENCV  350


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDN--KLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V        L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  476  LQVETTAFPPSVKPPGSPNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPQLAVKWK  535

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN +
Sbjct  536  GKTAKELTESVEFFRDIVTGPFEKFIQVTTILPLTGQQYSEKVSENCI  583


 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP       +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQVETTAFPPSAKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEENAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTXILPLTGQQYSDKVSENCV  117



>ref|XP_007218371.1| hypothetical protein PRUPE_ppa011276mg [Prunus persica]
 gb|EMJ19570.1| hypothetical protein PRUPE_ppa011276mg [Prunus persica]
Length=216

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 57/108 (53%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNLDNK--LLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + ++   FPP V        L L G G+  +EI    +K+TAIGVYL+ + V  L  KWK
Sbjct  10   LQIEATSFPPSVKPPGSANTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDKAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +F   I+  P +K  +V  I  + G QY  ++ EN V
Sbjct  70   GKTAQELTESVEFLREIVTGPFEKFTQVTTILPLTGQQYSEKVSENCV  117



>dbj|BAO50257.1| chalcone isomerase [Tricyrtis sp. Shinonome]
Length=234

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +3

Query  87   VDEIPFPPQVN--LDNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWKGK  257
            V+ I FPP V     +K L L G G   +EI    I +TAIGVYL+   V  L  KWKGK
Sbjct  13   VEGIVFPPVVCPPGSSKTLFLGGAGRRGMEIGGKFITFTAIGVYLEDAAVDVLAGKWKGK  72

Query  258  TPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            T  +LA + DF+  I+  P +K  +V ++  + G QY  ++ EN V
Sbjct  73   TADELAGNVDFYREIVAGPFEKFTKVTMVLPLTGEQYSEKVTENCV  118



>ref|XP_008370172.1| PREDICTED: chalcone--flavonone isomerase-like isoform X6 [Malus 
domestica]
Length=334

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP       +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  10   LQVETTAFPPSAKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEENAVPLLAVKWK  69

Query  252  GKTPVDLAQDDDFFEAIINAPVDKVLRVVVIKEIKGSQYGVQL-ENSV  392
            GKT  +L +  +FF  I+  P +K ++V  I  + G QY  ++ EN V
Sbjct  70   GKTAEELTESVEFFRDIVTGPFEKFIQVTXILPLTGQQYSDKVSENCV  117


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 3/79 (4%)
 Frame = +3

Query  81   VMVDEIPFPPQVNL--DNKLLSLMGHGITDVEIHFLQIKYTAIGVYLDPEIVSHLQ-KWK  251
            + V+   FPP V     +  L L G G+  +EI    +K+TAIGVYL+   V  L  KWK
Sbjct  243  LQVETTAFPPSVKPPGSSNTLFLGGAGVRGLEIQGNFVKFTAIGVYLEDNAVPQLAVKWK  302

Query  252  GKTPVDLAQDDDFFEAIIN  308
            GKT  +L +  +FF  I+ 
Sbjct  303  GKTAEELMESVEFFRDIVT  321



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140