BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I17

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009784851.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    128   4e-31   Nicotiana sylvestris
ref|XP_010093134.1|  Cytochrome P450                                    126   2e-30   Morus notabilis
ref|XP_009612398.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    126   2e-30   Nicotiana tomentosiformis
ref|XP_009784850.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    125   6e-30   Nicotiana sylvestris
ref|XP_004239253.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    124   1e-29   Solanum lycopersicum
ref|XP_010044825.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     123   2e-29   Eucalyptus grandis [rose gum]
ref|XP_010260623.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    123   3e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010321037.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    122   9e-29   Solanum lycopersicum
ref|XP_010321038.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    120   1e-28   
ref|XP_008342307.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     121   1e-28   
ref|XP_006354415.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    121   1e-28   Solanum tuberosum [potatoes]
ref|XP_006429775.1|  hypothetical protein CICLE_v10011353mg             121   2e-28   
ref|XP_006481375.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    121   3e-28   Citrus sinensis [apfelsine]
ref|XP_010260624.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    119   4e-28   
ref|XP_007049044.1|  Cytochrome P450 97B2, chloroplastic isoform 2      118   1e-27   
ref|XP_007049043.1|  Cytochrome P450 97B2 isoform 1                     118   2e-27   
ref|XP_009612399.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    117   2e-27   Nicotiana tomentosiformis
gb|KDP42786.1|  hypothetical protein JCGZ_00485                         117   3e-27   Jatropha curcas
ref|XP_002266883.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     117   3e-27   Vitis vinifera
gb|KJB10648.1|  hypothetical protein B456_001G213800                    117   4e-27   Gossypium raimondii
ref|XP_010914244.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     117   4e-27   Elaeis guineensis
ref|XP_009347871.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     117   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_009784852.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    116   5e-27   Nicotiana sylvestris
gb|KJB10651.1|  hypothetical protein B456_001G213800                    114   6e-27   Gossypium raimondii
ref|XP_006841947.1|  hypothetical protein AMTR_s00042p00221280          117   7e-27   
gb|KJB10649.1|  hypothetical protein B456_001G213800                    114   2e-26   Gossypium raimondii
ref|XP_004147731.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    115   2e-26   Cucumis sativus [cucumbers]
ref|XP_008451892.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    115   3e-26   
ref|XP_004303949.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     114   4e-26   Fragaria vesca subsp. vesca
ref|XP_008229650.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     114   5e-26   Prunus mume [ume]
ref|XP_011100398.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     114   8e-26   Sesamum indicum [beniseed]
ref|XP_007215027.1|  hypothetical protein PRUPE_ppa003405mg             113   1e-25   
ref|XP_009412059.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    113   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN35086.1|  Cytochrome P450 97B2, chloroplastic                     113   1e-25   Glycine soja [wild soybean]
ref|XP_004164429.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    113   2e-25   
ref|XP_010532498.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     112   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_010313051.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    112   3e-25   
ref|XP_006414564.1|  hypothetical protein EUTSA_v10024764mg             112   3e-25   Eutrema salsugineum [saltwater cress]
ref|XP_007158591.1|  hypothetical protein PHAVU_002G165400g             112   3e-25   Phaseolus vulgaris [French bean]
ref|XP_010435019.1|  PREDICTED: cytochrome P450 97B3, chloroplast...    112   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_008809593.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     111   7e-25   Phoenix dactylifera
ref|XP_010495892.1|  PREDICTED: cytochrome P450 97B3, chloroplast...    111   7e-25   Camelina sativa [gold-of-pleasure]
ref|NP_001235534.1|  cytochrome P450 97B2, chloroplastic                110   2e-24   
dbj|BAD26183.1|  putative cytochrome P450                               110   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84668.1|  hypothetical protein OsI_06039                          110   2e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_011002376.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     109   4e-24   Populus euphratica
gb|AJD25227.1|  cytochrome P450 CYP97B34                                108   6e-24   Salvia miltiorrhiza [Chinese salvia]
emb|CDP16026.1|  unnamed protein product                                108   9e-24   Coffea canephora [robusta coffee]
ref|XP_002308766.1|  hypothetical protein POPTR_0006s00800g             107   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010440341.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     107   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010680161.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     106   3e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001046036.1|  Os02g0173100                                       103   3e-23   
gb|AAT28222.1|  putative 97B2-like cytochrome P450                      105   6e-23   Ginkgo biloba [ginkgo]
gb|AFW66345.1|  putative cytochrome P450 superfamily protein            100   6e-23   
ref|XP_006285060.1|  hypothetical protein CARUB_v10006369mg             104   2e-22   Capsella rubella
ref|XP_002520583.1|  cytochrome P450, putative                          103   3e-22   Ricinus communis
emb|CDY09057.1|  BnaC08g10110D                                          103   4e-22   Brassica napus [oilseed rape]
emb|CDY22733.1|  BnaA08g05630D                                          103   5e-22   Brassica napus [oilseed rape]
gb|EYU42831.1|  hypothetical protein MIMGU_mgv1a003489mg                103   5e-22   Erythranthe guttata [common monkey flower]
ref|XP_008679919.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     103   6e-22   Zea mays [maize]
ref|NP_193247.2|  cytochrome P450 97B3                                  102   1e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CAB10290.1|  cytochrome P450 like protein                           102   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ21913.1|  hypothetical protein OsJ_05566                          102   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648355.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    102   1e-21   
ref|XP_009107829.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     101   2e-21   Brassica rapa
gb|KFK33561.1|  hypothetical protein AALP_AA5G029500                    101   2e-21   Arabis alpina [alpine rockcress]
ref|XP_002451628.1|  hypothetical protein SORBIDRAFT_04g004850        99.8    9e-21   Sorghum bicolor [broomcorn]
ref|XP_004951757.1|  PREDICTED: cytochrome P450 97B2, chloroplast...  99.4    1e-20   Setaria italica
dbj|BAJ97821.1|  predicted protein                                    99.0    1e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87287.1|  predicted protein                                    99.0    2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003610974.1|  Cytochrome P450                                  98.6    2e-20   Medicago truncatula
gb|EMS51606.1|  Cytochrome P450 97B2, chloroplastic                   98.6    2e-20   Triticum urartu
gb|KEH27407.1|  cytochrome P450 family 97 protein                     96.3    7e-20   Medicago truncatula
ref|XP_002868224.1|  hypothetical protein ARALYDRAFT_493377           96.7    1e-19   
sp|Q43078.1|C97B1_PEA  RecName: Full=Cytochrome P450 97B1, chloro...  95.9    2e-19   Pisum sativum [garden pea]
gb|EPS66221.1|  hypothetical protein M569_08554                       94.0    2e-19   Genlisea aurea
ref|XP_003570274.1|  PREDICTED: cytochrome P450 97B2, chloroplast...  95.5    3e-19   Brachypodium distachyon [annual false brome]
ref|XP_001769554.1|  predicted protein                                95.1    4e-19   
ref|XP_006478583.1|  PREDICTED: transmembrane 9 superfamily membe...  90.1    1e-18   Citrus sinensis [apfelsine]
ref|XP_006478580.1|  PREDICTED: transmembrane 9 superfamily membe...  90.1    2e-18   Citrus sinensis [apfelsine]
ref|XP_006478581.1|  PREDICTED: transmembrane 9 superfamily membe...  89.4    4e-18   Citrus sinensis [apfelsine]
gb|EMT03024.1|  Cytochrome P450 97B2                                  90.9    1e-17   
gb|KHG14945.1|  Cytochrome P450, chloroplastic                        89.0    4e-17   Gossypium arboreum [tree cotton]
ref|XP_002968239.1|  hypothetical protein SELMODRAFT_145597           80.5    3e-14   
ref|XP_002976141.1|  hypothetical protein SELMODRAFT_175360           80.5    3e-14   
gb|AFK42094.1|  unknown                                               67.0    2e-11   Medicago truncatula
ref|XP_006833026.1|  hypothetical protein AMTR_s00094p00103220        63.5    3e-10   
gb|KJB10650.1|  hypothetical protein B456_001G213800                  59.3    3e-07   Gossypium raimondii
emb|CDY08069.1|  BnaA06g16570D                                        56.2    3e-06   Brassica napus [oilseed rape]



>ref|XP_009784851.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score =   128 bits (321),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 69/120 (58%), Positives = 75/120 (63%), Gaps = 20/120 (17%)
 Frame = +2

Query  230  MATG------CCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQ  391
            MATG      C V    +DC   R C    S  + +   R S              IRCQ
Sbjct  1    MATGFVSSNTCLVLNRRSDCCSSRFCHFPSSYPTLSTPKRAS--------------IRCQ  46

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            STSTDE KTKMNL DNASNLLTN+LSGG IGSMP AEGAVSDLF RP+FFSLYDWF+KYG
Sbjct  47   STSTDEPKTKMNLFDNASNLLTNMLSGGSIGSMPIAEGAVSDLFDRPLFFSLYDWFIKYG  106



>ref|XP_010093134.1| Cytochrome P450 [Morus notabilis]
 gb|EXB53586.1| Cytochrome P450 [Morus notabilis]
Length=581

 Score =   126 bits (317),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 7/87 (8%)
 Frame = +2

Query  323  GTRHSHGSS----FKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSM  490
            G+ HS  +S    FK K S   R+RCQSTSTDE KTK NLLDNASNLLTNLLSGG++GSM
Sbjct  28   GSFHSSSASNLLYFKPKRS---RVRCQSTSTDELKTKRNLLDNASNLLTNLLSGGRLGSM  84

Query  491  PTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            P AEGAVSDLF RP+FFSLYDWFL++G
Sbjct  85   PVAEGAVSDLFDRPLFFSLYDWFLEHG  111



>ref|XP_009612398.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=582

 Score =   126 bits (317),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 74/120 (62%), Positives = 81/120 (68%), Gaps = 12/120 (10%)
 Frame = +2

Query  230  MATG------CCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQ  391
            MATG      C V    +DC   R C   PS SS ++ +  S  S+ K        IRCQ
Sbjct  1    MATGSVSSNTCLVLNRRSDCCSSRFC-HFPSSSSSSSSSSKSTLSTPKRT-----SIRCQ  54

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            STSTDE KTKMNL DNASNLLTNLLSGG IGSMP AEGAVSDLF RP+FFSLYDWF+KYG
Sbjct  55   STSTDEPKTKMNLFDNASNLLTNLLSGGSIGSMPIAEGAVSDLFDRPLFFSLYDWFIKYG  114



>ref|XP_009784850.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=584

 Score =   125 bits (314),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQSTSTDE KTKMNL DNASNLLTN+LSGG IGSMP AEGAVSDLF RP+FFSLYDWF
Sbjct  53   IRCQSTSTDEPKTKMNLFDNASNLLTNMLSGGSIGSMPIAEGAVSDLFDRPLFFSLYDWF  112

Query  560  LKYG  571
            +KYG
Sbjct  113  IKYG  116



>ref|XP_004239253.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=578

 Score =   124 bits (311),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 69/120 (58%), Positives = 78/120 (65%), Gaps = 17/120 (14%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRH---SHGSSFKMKPSGGCRI---RCQ  391
            MATG C + T         C+ L   S      RH   S+ +S+  +     R    RCQ
Sbjct  1    MATGFCSSIT---------CLVLNRRSDSI--FRHFPSSYPTSWSTQKRSSIRTMKCRCQ  49

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            ST TDE KTKMNL DNASNLLTNLLSGG+IGSMP AEGAV+DLF RP+FFSLYDWFLKYG
Sbjct  50   STGTDEPKTKMNLFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLYDWFLKYG  109



>ref|XP_010044825.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Eucalyptus grandis]
 gb|KCW88536.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88537.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88538.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
Length=584

 Score =   123 bits (309),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query  362  PSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            P G C IRCQSTSTDE KTK NLLDNASNLLTNLLSGG +GSMP AEGAV+DLFG+P+FF
Sbjct  44   PRGPC-IRCQSTSTDEPKTKRNLLDNASNLLTNLLSGGSLGSMPIAEGAVTDLFGKPLFF  102

Query  542  SLYDWFLKYG  571
            SLYDWFL++G
Sbjct  103  SLYDWFLEHG  112



>ref|XP_010260623.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=587

 Score =   123 bits (308),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  371  GCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            G RIRCQSTST+E KT+ NLLDNASNLLTNLLSGG +G+MP AEGAVSDLFGRP+FFSLY
Sbjct  46   GSRIRCQSTSTEEPKTRRNLLDNASNLLTNLLSGGSMGTMPIAEGAVSDLFGRPLFFSLY  105

Query  551  DWFLKYG  571
            DWFL++G
Sbjct  106  DWFLEHG  112



>ref|XP_010321037.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=573

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 77/116 (66%), Gaps = 14/116 (12%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCR--IRCQSTST  403
            MATG C + T         C+ L   + R+        SS+    S   R  IRCQST T
Sbjct  1    MATGFCSSIT---------CLVL---NRRSDSIFRHFPSSYPTSWSTQKRSSIRCQSTGT  48

Query  404  DERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            DE KTKMNL DNASNLLTNLLSGG+IGSMP AEGAV+DLF RP+FFSLYDWFLKYG
Sbjct  49   DEPKTKMNLFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLYDWFLKYG  104



>ref|XP_010321038.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X3 [Solanum 
lycopersicum]
Length=436

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 79/120 (66%), Gaps = 17/120 (14%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRH---SHGSSFKMKPSGGCRI---RCQ  391
            MATG C + T         C+ L   S   +  RH   S+ +S+  +     R    RCQ
Sbjct  1    MATGFCSSIT---------CLVLNRRSD--SIFRHFPSSYPTSWSTQKRSSIRTMKCRCQ  49

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            ST TDE KTKMNL DNASNLLTNLLSGG+IGSMP AEGAV+DLF RP+FFSLYDWFLKYG
Sbjct  50   STGTDEPKTKMNLFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLYDWFLKYG  109



>ref|XP_008342307.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Malus domestica]
Length=577

 Score =   121 bits (304),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  CRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYD  553
            C +RCQSTST+E KTK NLLDNASNLLTN LSGGKIGSMPTAEGAV+DLF RP+FFSLYD
Sbjct  43   CPLRCQSTSTEEPKTKRNLLDNASNLLTNFLSGGKIGSMPTAEGAVTDLFDRPLFFSLYD  102

Query  554  WFLKYG  571
            WF+++G
Sbjct  103  WFIEHG  108



>ref|XP_006354415.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Solanum 
tuberosum]
Length=573

 Score =   121 bits (303),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 68/116 (59%), Positives = 76/116 (66%), Gaps = 14/116 (12%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCR--IRCQSTST  403
            MATG C + T         C+ L   + R+        SS+    S   R  IRCQST T
Sbjct  1    MATGFCSSNT---------CLVL---NRRSDSIFRHFPSSYPTSGSTRKRSSIRCQSTGT  48

Query  404  DERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            DE KTKM+L DNASNLLTNLLSGGKIGSMP AEGAV+DLF RP+FFSLYDW LKYG
Sbjct  49   DEPKTKMSLFDNASNLLTNLLSGGKIGSMPIAEGAVTDLFDRPLFFSLYDWSLKYG  104



>ref|XP_006429775.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
 gb|ESR43015.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
Length=582

 Score =   121 bits (303),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 75/114 (66%), Gaps = 7/114 (6%)
 Frame = +2

Query  236  TGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSS--FKMKPSGGCRIRCQSTSTDE  409
            T  C++  H       S +G  S  +R  G   S+  +     KP     IRCQST T+E
Sbjct  4    TTTCISHHHLS-----SAVGYGSFHAREFGFVGSNSRTHLVNSKPKESPSIRCQSTGTNE  58

Query  410  RKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
             KT+ NLLDNASNLLTNLLSGG +GS P AEGAVSDLFGRP+FFSLYDWF+++G
Sbjct  59   PKTRRNLLDNASNLLTNLLSGGNLGSTPVAEGAVSDLFGRPLFFSLYDWFIEHG  112



>ref|XP_006481375.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Citrus sinensis]
Length=619

 Score =   121 bits (303),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 75/114 (66%), Gaps = 7/114 (6%)
 Frame = +2

Query  236  TGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSS--FKMKPSGGCRIRCQSTSTDE  409
            T  C++  H       S +G  S  +R  G   S+  +     KP     IRCQST T+E
Sbjct  41   TTTCISHHHLS-----SAVGYGSFHAREFGFVGSNSRTHLVNSKPKESPSIRCQSTGTNE  95

Query  410  RKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
             KT+ NLLDNASNLLTNLLSGG +GS P AEGAVSDLFGRP+FFSLYDWF+++G
Sbjct  96   PKTRRNLLDNASNLLTNLLSGGNLGSTPVAEGAVSDLFGRPLFFSLYDWFIEHG  149



>ref|XP_010260624.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=481

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  371  GCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            G RIRCQSTST+E KT+ NLLDNASNLLTNLLSGG +G+MP AEGAVSDLFGRP+FFSLY
Sbjct  46   GSRIRCQSTSTEEPKTRRNLLDNASNLLTNLLSGGSMGTMPIAEGAVSDLFGRPLFFSLY  105

Query  551  DWFLKYG  571
            DWFL++G
Sbjct  106  DWFLEHG  112



>ref|XP_007049044.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
 gb|EOX93201.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
Length=582

 Score =   118 bits (296),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 2/73 (3%)
 Frame = +2

Query  353  KMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRP  532
            K+K S    IRCQSTSTDE K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFG+P
Sbjct  41   KLKTSAA--IRCQSTSTDEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGQP  98

Query  533  VFFSLYDWFLKYG  571
            +FFSLYDWFL++G
Sbjct  99   LFFSLYDWFLEHG  111



>ref|XP_007049043.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
 gb|EOX93200.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
Length=622

 Score =   118 bits (296),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 2/73 (3%)
 Frame = +2

Query  353  KMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRP  532
            K+K S    IRCQSTSTDE K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFG+P
Sbjct  41   KLKTSAA--IRCQSTSTDEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGQP  98

Query  533  VFFSLYDWFLKYG  571
            +FFSLYDWFL++G
Sbjct  99   LFFSLYDWFLEHG  111



>ref|XP_009612399.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQSTSTDE KTKMNL DNASNLLTNLLSGG IGSMP AEGAVSDLF RP+FFSLYDWF
Sbjct  51   IRCQSTSTDEPKTKMNLFDNASNLLTNLLSGGSIGSMPIAEGAVSDLFDRPLFFSLYDWF  110

Query  560  LK  565
            +K
Sbjct  111  IK  112



>gb|KDP42786.1| hypothetical protein JCGZ_00485 [Jatropha curcas]
Length=583

 Score =   117 bits (294),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = +2

Query  332  HSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAV  511
            H H  + K K  G   IRCQSTSTD+ KT+ NLLDNASNLLTNLLSGG +GSMPTAEGAV
Sbjct  40   HYHFLNSKAK-KGFPAIRCQSTSTDKPKTR-NLLDNASNLLTNLLSGGNLGSMPTAEGAV  97

Query  512  SDLFGRPVFFSLYDWFLKYG  571
            SDLFGRP+FFSLYDWFL++G
Sbjct  98   SDLFGRPLFFSLYDWFLEHG  117



>ref|XP_002266883.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Vitis vinifera]
 emb|CBI34117.3| unnamed protein product [Vitis vinifera]
Length=572

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 81/115 (70%), Gaps = 13/115 (11%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSF-KMKPSGGCRIRCQSTSTD  406
            MAT  CV   H    +  SC       SRT   + S  S   K++P GG  IRCQSTSTD
Sbjct  1    MAT--CVLLQH--FHVSDSCF------SRTPYLQSSRTSQLSKLRP-GGSSIRCQSTSTD  49

Query  407  ERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            ++K++ NLLDNASNLLTN LSGG IGSMP AEGAVSDLFGRP+FFSLYDWF+++G
Sbjct  50   KQKSR-NLLDNASNLLTNFLSGGSIGSMPVAEGAVSDLFGRPLFFSLYDWFIEHG  103



>gb|KJB10648.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=579

 Score =   117 bits (293),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQSTST E K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFGRP+FFSLYDWF
Sbjct  46   IRCQSTSTKEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLYDWF  105

Query  560  LKYG  571
            L++G
Sbjct  106  LEHG  109



>ref|XP_010914244.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Elaeis guineensis]
Length=574

 Score =   117 bits (293),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 60/93 (65%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = +2

Query  293  GLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSG  472
            GL S+ S   G      S F  K S   RIRCQSTS ++ K K NLLDNASNLLTNLLSG
Sbjct  16   GLHSLQSSQTGASTPR-SVFPKKRS---RIRCQSTSIEKPKMKRNLLDNASNLLTNLLSG  71

Query  473  GKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            G +G+MP AEGAVSDLFG+P+FFSLYDWFL++G
Sbjct  72   GSLGTMPVAEGAVSDLFGQPLFFSLYDWFLEHG  104



>ref|XP_009347871.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Pyrus x bretschneideri]
Length=577

 Score =   117 bits (293),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  CRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYD  553
            C +R QSTST+E KTK NLLDNASNLLTN LSGGKIGSMPTAEGAV+DLF RP+FFSLYD
Sbjct  43   CPLRSQSTSTEEPKTKRNLLDNASNLLTNFLSGGKIGSMPTAEGAVTDLFDRPLFFSLYD  102

Query  554  WFLKYG  571
            WF+++G
Sbjct  103  WFIEHG  108



>ref|XP_009784852.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X3 [Nicotiana 
sylvestris]
Length=548

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQSTSTDE KTKMNL DNASNLLTN+LSGG IGSMP AEGAVSDLF RP+FFSLYDWF
Sbjct  53   IRCQSTSTDEPKTKMNLFDNASNLLTNMLSGGSIGSMPIAEGAVSDLFDRPLFFSLYDWF  112

Query  560  LK  565
            +K
Sbjct  113  IK  114



>gb|KJB10651.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=287

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQSTST E K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFGRP+FFSLYDWF
Sbjct  46   IRCQSTSTKEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLYDWF  105

Query  560  LKYG  571
            L++G
Sbjct  106  LEHG  109



>ref|XP_006841947.1| hypothetical protein AMTR_s00042p00221280 [Amborella trichopoda]
 gb|ERN03622.1| hypothetical protein AMTR_s00042p00221280 [Amborella trichopoda]
Length=589

 Score =   117 bits (292),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  341  GSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDL  520
            G   K + + G  +RCQSTS +E K + NLLDNASNLLTNLLSGG+IG MP AEGAVSDL
Sbjct  37   GKYQKKRRNNGFMLRCQSTSKNETKFEKNLLDNASNLLTNLLSGGRIGRMPVAEGAVSDL  96

Query  521  FGRPVFFSLYDWFLKYG  571
            FGRP+FFSLYDWFL++G
Sbjct  97   FGRPLFFSLYDWFLEHG  113



>gb|KJB10649.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=408

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQSTST E K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFGRP+FFSLYDWF
Sbjct  46   IRCQSTSTKEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLYDWF  105

Query  560  LKYG  571
            L++G
Sbjct  106  LEHG  109



>ref|XP_004147731.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN53488.1| hypothetical protein Csa_4G056760 [Cucumis sativus]
Length=580

 Score =   115 bits (288),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            +RCQST   E KTK NLLDNASNLLTNLLSGG +GSMP AEGAVSDLFGRP+FF+LYDWF
Sbjct  47   VRCQSTDVGEPKTKRNLLDNASNLLTNLLSGGNLGSMPIAEGAVSDLFGRPLFFALYDWF  106

Query  560  LKYG  571
            L++G
Sbjct  107  LEHG  110



>ref|XP_008451892.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic 
[Cucumis melo]
Length=580

 Score =   115 bits (287),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            +RCQST   E KTK NLLDNASNLLTNLLSGG +GSMP AEGAVSDLFGRP+FF+LYDWF
Sbjct  47   VRCQSTDVGEPKTKRNLLDNASNLLTNLLSGGNLGSMPIAEGAVSDLFGRPLFFALYDWF  106

Query  560  LKYG  571
            L++G
Sbjct  107  LEHG  110



>ref|XP_004303949.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011467680.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=572

 Score =   114 bits (286),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = +2

Query  323  GTRHSHGSSFKMKPS-GGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTA  499
            G  HS  ++  + P      IRCQSTST++ KTK NLLDNASNLLTNLLSGG +GSMP A
Sbjct  20   GYLHSSTTTNLLNPKLKRSSIRCQSTSTEDPKTKRNLLDNASNLLTNLLSGGNLGSMPIA  79

Query  500  EGAVSDLFGRPVFFSLYDWFLKYG  571
            EGAV+DLF RP+FFSLYDWF+++G
Sbjct  80   EGAVTDLFDRPLFFSLYDWFIEHG  103



>ref|XP_008229650.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Prunus mume]
Length=577

 Score =   114 bits (285),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQSTSTDE KT+  LLDNASNLLTN LSGG +GSMP AEGAVSDLF RP+FF+LYDWF
Sbjct  47   IRCQSTSTDEPKTRRKLLDNASNLLTNFLSGGSLGSMPIAEGAVSDLFARPLFFALYDWF  106

Query  560  LKYG  571
            L++G
Sbjct  107  LEHG  110



>ref|XP_011100398.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Sesamum indicum]
Length=577

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 4/74 (5%)
 Frame = +2

Query  359  KPSGGCRIRCQS-TSTDERKT--KMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGR  529
            KP G   +RCQS TSTDE KT   MNLLDNASNLLTN LSGGKIGSMPTAEGAVSDLFG+
Sbjct  36   KPKGSS-VRCQSSTSTDENKTTKSMNLLDNASNLLTNFLSGGKIGSMPTAEGAVSDLFGK  94

Query  530  PVFFSLYDWFLKYG  571
            P+FFSLYDWF+++G
Sbjct  95   PLFFSLYDWFIEHG  108



>ref|XP_007215027.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
 gb|EMJ16226.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
Length=577

 Score =   113 bits (282),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQSTSTDE KT+  LLDNASNLLTN LSGG +GSMP AEGAVSDLF RP+FF+LYDWF
Sbjct  45   IRCQSTSTDEPKTRRKLLDNASNLLTNFLSGGSLGSMPIAEGAVSDLFVRPLFFALYDWF  104

Query  560  LKYG  571
            L++G
Sbjct  105  LEHG  108



>ref|XP_009412059.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=574

 Score =   113 bits (282),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 4/72 (6%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKT-KMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPV  535
            KPS    IRCQSTS ++ KT K NLLDNASNLLTN LSGG++G MPTAEGAVSDLFGRP+
Sbjct  40   KPS---LIRCQSTSMEKPKTSKRNLLDNASNLLTNFLSGGRLGDMPTAEGAVSDLFGRPL  96

Query  536  FFSLYDWFLKYG  571
            FFSLYDWFL++G
Sbjct  97   FFSLYDWFLEHG  108



>gb|KHN35086.1| Cytochrome P450 97B2, chloroplastic [Glycine soja]
Length=576

 Score =   113 bits (282),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVF  538
            +P     IRCQS +TD++K+  NLLDNASNLLT+LLSGG IGSMP AEGAVSDL GRP+F
Sbjct  36   QPKRISSIRCQSINTDKKKSSRNLLDNASNLLTDLLSGGSIGSMPIAEGAVSDLLGRPLF  95

Query  539  FSLYDWFLKYG  571
            FSLYDWFL++G
Sbjct  96   FSLYDWFLEHG  106



>ref|XP_004164429.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis 
sativus]
Length=580

 Score =   113 bits (282),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            +RCQST   E KTK NLLDNASNLLTNLLSGG +GSMP AEGAVSDLFG P+FF+LYDWF
Sbjct  47   VRCQSTDVGEPKTKRNLLDNASNLLTNLLSGGNLGSMPIAEGAVSDLFGHPLFFALYDWF  106

Query  560  LKYG  571
            L++G
Sbjct  107  LEHG  110



>ref|XP_010532498.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Tarenaya hassleriana]
Length=585

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 69/93 (74%), Gaps = 9/93 (10%)
 Frame = +2

Query  293  GLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSG  472
            GL   SSR+    +S         SG  RIRCQSTST E KT+ N+ DNASNLLTNLLSG
Sbjct  31   GLLGFSSRSISVGYSR--------SGSARIRCQSTSTKEPKTR-NIFDNASNLLTNLLSG  81

Query  473  GKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            G +GSMP A+GAVSDLFG+P+FFSLYDWFL++G
Sbjct  82   GSLGSMPIAQGAVSDLFGKPLFFSLYDWFLEHG  114



>ref|XP_010313051.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic-like 
[Solanum lycopersicum]
Length=585

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  383  RCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFL  562
            RCQST TDE KTK++  DNASNLLTNLLSGG+IGSMP AEGAV+DLF RP+FFSLYDWFL
Sbjct  54   RCQSTGTDEPKTKVHSFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLYDWFL  113

Query  563  KYG  571
            KYG
Sbjct  114  KYG  116



>ref|XP_006414564.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
 gb|ESQ56017.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
Length=581

 Score =   112 bits (280),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 58/104 (56%), Positives = 70/104 (67%), Gaps = 11/104 (11%)
 Frame = +2

Query  260  HTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDN  439
            H    +GRS   L  +  +T  +R +  S           IRCQST+T E KT  N+LDN
Sbjct  20   HGGLHVGRSDYCLFGLYPQTENSRRASVS-----------IRCQSTNTKEPKTNGNILDN  68

Query  440  ASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            ASNL TNLLSGG +GSMPTAEGAVSDLFG+P+F SLYDWFL++G
Sbjct  69   ASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWFLEHG  112



>ref|XP_007158591.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
 gb|ESW30585.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
Length=576

 Score =   112 bits (279),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +2

Query  362  PSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            P     IRCQS +TD++K+  N+LDNASNLLT+LLSGG IGSMP AEGAVSDLF RP+FF
Sbjct  37   PQQISSIRCQSINTDKKKSSRNILDNASNLLTDLLSGGSIGSMPIAEGAVSDLFNRPLFF  96

Query  542  SLYDWFLKYG  571
            SLYDWFL++G
Sbjct  97   SLYDWFLEHG  106



>ref|XP_010435019.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   112 bits (279),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQST T E KT  NLLDNASNLLTN LSGG +GSMPTAEGAVSDLFG+P+F SLYDWF
Sbjct  47   IRCQSTDTKEPKTNGNLLDNASNLLTNFLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  106

Query  560  LKYG  571
            +++G
Sbjct  107  MEHG  110



>ref|XP_008809593.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Phoenix dactylifera]
Length=572

 Score =   111 bits (277),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +2

Query  362  PSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            P    + RCQSTS ++ KTK NLLDNASNLLTNLLSGG + +MP A+GAVSDLFGRP+FF
Sbjct  33   PKKRSQTRCQSTSIEKPKTKRNLLDNASNLLTNLLSGGILETMPVADGAVSDLFGRPLFF  92

Query  542  SLYDWFLKYG  571
            SLYDWFL++G
Sbjct  93   SLYDWFLEHG  102



>ref|XP_010495892.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   111 bits (277),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQST T E KT  N LDNASNLLTN LSGG +GSMPTAEGAVSDLFG+P+F SLYDWF
Sbjct  47   IRCQSTDTKEPKTNGNFLDNASNLLTNFLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  106

Query  560  LKYG  571
            L++G
Sbjct  107  LEHG  110



>ref|NP_001235534.1| cytochrome P450 97B2, chloroplastic [Glycine max]
 sp|O48921.1|C97B2_SOYBN RecName: Full=Cytochrome P450 97B2, chloroplastic; Flags: Precursor 
[Glycine max]
 gb|AAB94586.1| CYP97B2p [Glycine max]
Length=576

 Score =   110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVF  538
            +P     IRCQS +TD++K+  NLL NASNLLT+LLSGG IGSMP AEGAVSDL GRP+F
Sbjct  36   QPKRISSIRCQSINTDKKKSSRNLLGNASNLLTDLLSGGSIGSMPIAEGAVSDLLGRPLF  95

Query  539  FSLYDWFLKYG  571
            FSLYDWFL++G
Sbjct  96   FSLYDWFLEHG  106



>dbj|BAD26183.1| putative cytochrome P450 [Oryza sativa Japonica Group]
Length=571

 Score =   110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  380  IRCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDW  556
            +RCQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRP+FFSLYDW
Sbjct  41   VRCQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYDW  100

Query  557  FLKYG  571
            FL++G
Sbjct  101  FLEHG  105



>gb|EAY84668.1| hypothetical protein OsI_06039 [Oryza sativa Indica Group]
Length=571

 Score =   110 bits (274),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  380  IRCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDW  556
            +RCQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRP+FFSLYDW
Sbjct  41   VRCQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYDW  100

Query  557  FLKYG  571
            FL++G
Sbjct  101  FLEHG  105



>ref|XP_011002376.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Populus euphratica]
Length=585

 Score =   109 bits (272),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +2

Query  326  TRHSHGSSF-KMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAE  502
            +R  H   F   K  G   IRCQSTST+E KT+ N LD ASNLLTNLLSGG +GSMP AE
Sbjct  34   SRFPHKYHFLSSKTKGSPLIRCQSTSTEEPKTR-NPLDKASNLLTNLLSGGNLGSMPIAE  92

Query  503  GAVSDLFGRPVFFSLYDWFLKYG  571
            GAVSDLF RP+FFSLYDWF+++G
Sbjct  93   GAVSDLFSRPLFFSLYDWFIEHG  115



>gb|AJD25227.1| cytochrome P450 CYP97B34 [Salvia miltiorrhiza]
Length=582

 Score =   108 bits (270),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 3/67 (4%)
 Frame = +2

Query  380  IRCQS-TSTDERKT--KMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQS TSTDE K   KMNLLDNASNLLTN LSGGKI SMPTAEGAVSDLFG+P+F SL+
Sbjct  46   IRCQSSTSTDETKATKKMNLLDNASNLLTNFLSGGKILSMPTAEGAVSDLFGKPLFLSLF  105

Query  551  DWFLKYG  571
            DWF+++G
Sbjct  106  DWFIEHG  112



>emb|CDP16026.1| unnamed protein product [Coffea canephora]
Length=599

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRC S  T+  K KMNLLDNASNLLTN LSGG++GSMP AEGAVSDLFGRP+FF+LYDWF
Sbjct  64   IRCHSAKTNAPKPKMNLLDNASNLLTNFLSGGRMGSMPMAEGAVSDLFGRPLFFALYDWF  123

Query  560  LKYG  571
            L++G
Sbjct  124  LEHG  127



>ref|XP_002308766.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
 gb|EEE92289.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
Length=579

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVF  538
            K  G   IRCQSTST+E KT+ N LD ASNLLTNLLSGG +GSMP AEGAVSDLF RP+F
Sbjct  40   KTKGSPLIRCQSTSTEEPKTR-NPLDKASNLLTNLLSGGNLGSMPIAEGAVSDLFSRPLF  98

Query  539  FSLYDWFLKYG  571
            FSL+DWF+++G
Sbjct  99   FSLFDWFIEHG  109



>ref|XP_010440341.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Camelina sativa]
Length=578

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQS+ T E KT  N+LDNASNLLTN LSGG +GSMPTAEGAVSDLFG+P+F SLYDWF
Sbjct  46   IRCQSSDTKEPKTNGNILDNASNLLTNFLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  105

Query  560  LKYG  571
            L++G
Sbjct  106  LEHG  109



>ref|XP_010680161.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score =   106 bits (265),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  377  RIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDW  556
            R  CQST+T++ K++ NLLDNASNLLTN LSGG +GSMPTAEGAVSDLFGRP+F SLYDW
Sbjct  43   RFICQSTNTEKPKSR-NLLDNASNLLTNFLSGGNLGSMPTAEGAVSDLFGRPLFLSLYDW  101

Query  557  FLKYG  571
            FL++G
Sbjct  102  FLEHG  106



>ref|NP_001046036.1| Os02g0173100 [Oryza sativa Japonica Group]
 dbj|BAF07950.1| Os02g0173100, partial [Oryza sativa Japonica Group]
Length=286

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 1/64 (2%)
 Frame = +2

Query  383  RCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            RCQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRP+FFSLYDWF
Sbjct  1    RCQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYDWF  60

Query  560  LKYG  571
            L++G
Sbjct  61   LEHG  64



>gb|AAT28222.1| putative 97B2-like cytochrome P450 [Ginkgo biloba]
Length=586

 Score =   105 bits (263),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 4/78 (5%)
 Frame = +2

Query  344  SSFKMKPSGGCRIRCQSTSTDERKTKMN--LLDNASNLLTNLLSGGKIGSMPTAEGAVSD  517
            SSF++ P      RC+S+ST ER TK N  LLDNASN LTNLLSGG++G+MP AEGAVSD
Sbjct  37   SSFRL-PGSKFFPRCESSST-ERATKSNRTLLDNASNFLTNLLSGGQLGTMPIAEGAVSD  94

Query  518  LFGRPVFFSLYDWFLKYG  571
            LFG+P+FFSLYDWF+++G
Sbjct  95   LFGKPLFFSLYDWFIEHG  112



>gb|AFW66345.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=169

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 6/70 (9%)
 Frame = +2

Query  380  IRCQSTSTDERKTK------MNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
             RCQSTS D+++ +       NLLDNASNLLTN LSGG +G+MP AEGAV+DLFG+P+FF
Sbjct  37   FRCQSTSVDKQQERPPKPKQRNLLDNASNLLTNFLSGGNLGAMPVAEGAVTDLFGKPLFF  96

Query  542  SLYDWFLKYG  571
            SLYDWFL++G
Sbjct  97   SLYDWFLEHG  106



>ref|XP_006285060.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
 gb|EOA17958.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
Length=576

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +2

Query  332  HSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAV  511
            +SH  S          IRCQST+T E K   N+LD+ASNLLTN LSGG +GSMPTAEGAV
Sbjct  29   YSHTLSSVNPRRASVSIRCQSTNTKEPKNG-NILDDASNLLTNFLSGGNLGSMPTAEGAV  87

Query  512  SDLFGRPVFFSLYDWFLKYG  571
            SDLFG+P+F SLYDWFL++G
Sbjct  88   SDLFGKPLFLSLYDWFLEHG  107



>ref|XP_002520583.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF41816.1| cytochrome P450, putative [Ricinus communis]
Length=555

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +2

Query  335  SHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVS  514
            SH      K  G   IRCQ   TDE KT+  LLDNASNLLT+ LSGG +GSMP AEGAVS
Sbjct  8    SHYPLLNSKAKGSPVIRCQPKITDEPKTR-TLLDNASNLLTSFLSGGSLGSMPIAEGAVS  66

Query  515  DLFGRPVFFSLYDWFLKYG  571
            DLF RP+FFSLYDWFL++G
Sbjct  67   DLFNRPLFFSLYDWFLEHG  85



>emb|CDY09057.1| BnaC08g10110D [Brassica napus]
Length=565

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%), Gaps = 1/64 (2%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQST+T E K+  N+LDNASNL TNLLSGG +GSMPTAEGAVSDLFG+P+F SLYDWF
Sbjct  45   IRCQSTNTKEPKSS-NILDNASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  103

Query  560  LKYG  571
            +++G
Sbjct  104  MEHG  107



>emb|CDY22733.1| BnaA08g05630D [Brassica napus]
Length=566

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%), Gaps = 1/64 (2%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQST+T E K+  N+LDNASNL TNLLSGG +GSMPTAEGAVSDLFG+P+F SLYDWF
Sbjct  45   IRCQSTNTKEPKSS-NILDNASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  103

Query  560  LKYG  571
            +++G
Sbjct  104  MEHG  107



>gb|EYU42831.1| hypothetical protein MIMGU_mgv1a003489mg [Erythranthe guttata]
Length=582

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 56/67 (84%), Gaps = 3/67 (4%)
 Frame = +2

Query  380  IRCQS-TSTDERKT--KMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLY  550
            IRCQS TSTDE K   KM LLDNASN LTN LSGG IG MP AEGAVSDLFG+P+FFSLY
Sbjct  46   IRCQSSTSTDETKAAKKMTLLDNASNFLTNFLSGGNIGPMPIAEGAVSDLFGKPLFFSLY  105

Query  551  DWFLKYG  571
            DWF+++G
Sbjct  106  DWFIEHG  112



>ref|XP_008679919.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Zea mays]
 gb|ADL28271.1| carotene beta-ring hydroxylase [Zea mays]
 gb|AFP28222.1| beta-carotene hydroxylase [synthetic construct]
 gb|AFW66346.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=572

 Score =   103 bits (256),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 46/69 (67%), Positives = 57/69 (83%), Gaps = 6/69 (9%)
 Frame = +2

Query  383  RCQSTSTDERKTK------MNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFS  544
            RCQSTS D+++ +       NLLDNASNLLTN LSGG +G+MP AEGAV+DLFG+P+FFS
Sbjct  38   RCQSTSVDKQQERPPKPKQRNLLDNASNLLTNFLSGGNLGAMPVAEGAVTDLFGKPLFFS  97

Query  545  LYDWFLKYG  571
            LYDWFL++G
Sbjct  98   LYDWFLEHG  106



>ref|NP_193247.2| cytochrome P450 97B3 [Arabidopsis thaliana]
 sp|O23365.2|C97B3_ARATH RecName: Full=Cytochrome P450 97B3, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL32753.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAO00942.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AEE83557.1| cytochrome P450 97B3 [Arabidopsis thaliana]
Length=580

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 3/64 (5%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            I+CQST   E KT  N+LDNASNLLTN LSGG +GSMPTAEG+VSDLFG+P+F SLYDWF
Sbjct  51   IKCQST---EPKTNGNILDNASNLLTNFLSGGSLGSMPTAEGSVSDLFGKPLFLSLYDWF  107

Query  560  LKYG  571
            L++G
Sbjct  108  LEHG  111



>emb|CAB10290.1| cytochrome P450 like protein [Arabidopsis thaliana]
 emb|CAB78553.1| cytochrome P450 like protein [Arabidopsis thaliana]
Length=576

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 3/64 (5%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            I+CQST   E KT  N+LDNASNLLTN LSGG +GSMPTAEG+VSDLFG+P+F SLYDWF
Sbjct  47   IKCQST---EPKTNGNILDNASNLLTNFLSGGSLGSMPTAEGSVSDLFGKPLFLSLYDWF  103

Query  560  LKYG  571
            L++G
Sbjct  104  LEHG  107



>gb|EAZ21913.1| hypothetical protein OsJ_05566 [Oryza sativa Japonica Group]
Length=557

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 1/63 (2%)
 Frame = +2

Query  386  CQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFL  562
            CQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRP+FFSLYDWFL
Sbjct  29   CQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYDWFL  88

Query  563  KYG  571
            ++G
Sbjct  89   EHG  91



>ref|XP_006648355.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Oryza brachyantha]
Length=543

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +2

Query  383  RCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
             CQSTS D++ K K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRP+FFSLYDWF
Sbjct  14   ECQSTSVDDKPKPKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYDWF  73

Query  560  LKYG  571
            +++G
Sbjct  74   IEHG  77



>ref|XP_009107829.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Brassica rapa]
Length=578

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 1/64 (2%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQST+T + K+  N+LDNASNL TNLLSGG +GSMPTAEGAVSDLFG+P+F SLYDWF
Sbjct  45   IRCQSTNTKDPKSS-NILDNASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  103

Query  560  LKYG  571
            +++G
Sbjct  104  MEHG  107



>gb|KFK33561.1| hypothetical protein AALP_AA5G029500 [Arabis alpina]
Length=577

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQST+T E KT  N+LDNASNLLTN LSGG + SMP A+GAVSDLFG+P+F SLYDWF
Sbjct  45   IRCQSTNTKEPKTDGNILDNASNLLTNFLSGGSLSSMPIAKGAVSDLFGKPLFLSLYDWF  104

Query  560  LKYG  571
            +++G
Sbjct  105  IEHG  108



>ref|XP_002451628.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
 gb|EES04604.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
Length=573

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 7/70 (10%)
 Frame = +2

Query  383  RCQSTSTDERKTKM-------NLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            RCQSTS D+++          NLLDNASNLLTN LSGG +G+MP AEGAV+DLFG+P+FF
Sbjct  38   RCQSTSVDKQQQPPPPKQKQRNLLDNASNLLTNFLSGGNLGAMPVAEGAVTDLFGKPLFF  97

Query  542  SLYDWFLKYG  571
            SLYDWFL++G
Sbjct  98   SLYDWFLEHG  107



>ref|XP_004951757.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Setaria 
italica]
Length=568

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 56/69 (81%), Gaps = 6/69 (9%)
 Frame = +2

Query  383  RCQSTSTDERKTK------MNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFS  544
            RCQSTS D+ + +       N+LDNASNLLTN LSGG +G+MP AEGAV+DLFG+P+FFS
Sbjct  37   RCQSTSVDKEQEQPPKPKQRNMLDNASNLLTNFLSGGSLGAMPVAEGAVTDLFGKPLFFS  96

Query  545  LYDWFLKYG  571
            LYDWFL++G
Sbjct  97   LYDWFLEHG  105



>dbj|BAJ97821.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 7/100 (7%)
 Frame = +2

Query  275  LGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDER-KTKMNLLDNASNL  451
            L RS  G   ++S    +  +HG S ++ P     +RCQS   D+  K K NL DNASNL
Sbjct  13   LPRSSTGTHRVASSYPSSSAAHGRS-RLLP-----VRCQSPGVDKTTKPKRNLFDNASNL  66

Query  452  LTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            LTNLL+GG + +MP AEGAV+DLF RP+F+SLYDWFL++G
Sbjct  67   LTNLLAGGNLKNMPVAEGAVTDLFDRPLFYSLYDWFLEHG  106



>dbj|BAJ87287.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 7/100 (7%)
 Frame = +2

Query  275  LGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDER-KTKMNLLDNASNL  451
            L RS  G   ++S    +  +HG S ++ P     +RCQS   D+  K K NL DNASNL
Sbjct  13   LPRSSTGTHRVASSYPSSSAAHGRS-RLLP-----VRCQSPGVDKTTKPKRNLFDNASNL  66

Query  452  LTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            LTNLL+GG + +MP AEGAV+DLF RP+F+SLYDWFL++G
Sbjct  67   LTNLLAGGNLKNMPVAEGAVTDLFDRPLFYSLYDWFLEHG  106



>ref|XP_003610974.1| Cytochrome P450 [Medicago truncatula]
 gb|AES93932.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=574

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 5/69 (7%)
 Frame = +2

Query  380  IRCQSTSTDERKTKM-----NLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFS  544
            IRCQ+ + D++K        N+ DNASNLLTNLLSGG +G+MP AEGAV+DLF RP+FFS
Sbjct  36   IRCQAVNGDKKKQSSSSSSRNVFDNASNLLTNLLSGGSLGNMPIAEGAVTDLFDRPLFFS  95

Query  545  LYDWFLKYG  571
            LYDWFL++G
Sbjct  96   LYDWFLEHG  104



>gb|EMS51606.1| Cytochrome P450 97B2, chloroplastic [Triticum urartu]
Length=571

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 7/100 (7%)
 Frame = +2

Query  275  LGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDER-KTKMNLLDNASNL  451
            L RS  G   ++S    +  +HG S ++ P     +RCQS   D+  K K NL DNASNL
Sbjct  12   LPRSSTGTHRLASSYPSSSAAHGRS-RLLP-----VRCQSPGVDKTTKPKRNLFDNASNL  65

Query  452  LTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            LTNLL+GG + +MP AEGAV+DLF RP+F+SLYDWFL++G
Sbjct  66   LTNLLAGGNLKNMPVAEGAVTDLFDRPLFYSLYDWFLEHG  105



>gb|KEH27407.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=463

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 5/69 (7%)
 Frame = +2

Query  380  IRCQSTSTDERKTKM-----NLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFS  544
            IRCQ+ + D++K        N+ DNASNLLTNLLSGG +G+MP AEGAV+DLF RP+FFS
Sbjct  36   IRCQAVNGDKKKQSSSSSSRNVFDNASNLLTNLLSGGSLGNMPIAEGAVTDLFDRPLFFS  95

Query  545  LYDWFLKYG  571
            LYDWFL++G
Sbjct  96   LYDWFLEHG  104



>ref|XP_002868224.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44483.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 3/64 (5%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            I+CQS    E KT  N+LDNASNLLTN LSGG +GSMPTA+GAVSDLFG+P+F SLYDWF
Sbjct  42   IKCQSM---EPKTNGNILDNASNLLTNFLSGGSLGSMPTAQGAVSDLFGKPLFLSLYDWF  98

Query  560  LKYG  571
            L++G
Sbjct  99   LEHG  102



>sp|Q43078.1|C97B1_PEA RecName: Full=Cytochrome P450 97B1, chloroplastic; AltName: Full=Cytochrome 
P450 97A2; Flags: Precursor [Pisum sativum]
 emb|CAA89260.1| cytochrome P450 [Pisum sativum]
Length=552

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = +2

Query  332  HSHGSSFKMKPSGGCRIRCQSTSTDERK-TKMNLLDNASNLLTNLLSGGKIGSMPTAEGA  508
            H H SS   + S    IRCQS + ++RK +  N+ DNASNLLT+LLSG  +GSMP AEGA
Sbjct  38   HFHFSSHSKRFSS---IRCQSVNGEKRKQSSRNVFDNASNLLTSLLSGANLGSMPIAEGA  94

Query  509  VSDLFGRPVFFSLYDWFLKYG  571
            V+DLF RP+FFSLYDWFL++G
Sbjct  95   VTDLFDRPLFFSLYDWFLEHG  115



>gb|EPS66221.1| hypothetical protein M569_08554, partial [Genlisea aurea]
Length=394

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  383  RCQSTSTDERKTKMNLLDNASNLLTNLLSGGK-IGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            RC+ ++  E    M+L DNASNLLTNLLSGG+  G MPTAEGAVSDLFGRP+FF+LYDWF
Sbjct  2    RCKLSTNAEDNKSMSLFDNASNLLTNLLSGGRRFGFMPTAEGAVSDLFGRPLFFALYDWF  61

Query  560  LKYG  571
            L++G
Sbjct  62   LQHG  65



>ref|XP_003570274.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=569

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            +RCQS   D+ K K +L DNASN+LTNLL+GG + +MP AEGAV+DLF RP+F+SLYDWF
Sbjct  40   VRCQSPGVDKTKPKRSLFDNASNVLTNLLAGGSLRNMPVAEGAVTDLFDRPLFYSLYDWF  99

Query  560  LKYG  571
            L++G
Sbjct  100  LEHG  103



>ref|XP_001769554.1| predicted protein [Physcomitrella patens]
 gb|EDQ65715.1| predicted protein [Physcomitrella patens]
Length=586

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 51/103 (50%), Positives = 68/103 (66%), Gaps = 10/103 (10%)
 Frame = +2

Query  293  GLPSISSRTAGTRHSH-------GSSFKMK--PSGGCRIRCQSTSTDER-KTKMNLLDNA  442
            G  S+ ++ +G+R          G SF ++  PS       Q   TD + + +  LLDNA
Sbjct  11   GPASLMNQNSGSRRLSSSKSTILGHSFLLRHLPSKTRSRGIQCLKTDRKPENERTLLDNA  70

Query  443  SNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            SNLLTNLLSGG +G+MP AEGAVSDLFGRP+FF+LYDWF+++G
Sbjct  71   SNLLTNLLSGGNMGTMPIAEGAVSDLFGRPLFFALYDWFMQHG  113



>ref|XP_006478583.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X4 [Citrus sinensis]
 ref|XP_006478584.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X5 [Citrus sinensis]
Length=204

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 62/110 (56%), Gaps = 13/110 (12%)
 Frame = +2

Query  248  VAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKM------------KPSGGCRIRCQ  391
            +A+ H    +  S +   S +S   G    HG  F              KP     IRCQ
Sbjct  92   LASNHAQLNISISNLN-NSTNSEAVGYGSFHGREFGFVGGNSRTHLVNSKPKESPSIRCQ  150

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            ST T+E KT+ NLLDNASNLLTNLLSGG +GSMP AEGAV DLF  P+FF
Sbjct  151  STGTNEPKTRRNLLDNASNLLTNLLSGGSLGSMPVAEGAVFDLFSSPLFF  200



>ref|XP_006478580.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Citrus sinensis]
Length=267

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 62/110 (56%), Gaps = 13/110 (12%)
 Frame = +2

Query  248  VAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKM------------KPSGGCRIRCQ  391
            +A+ H    +  S +   S +S   G    HG  F              KP     IRCQ
Sbjct  155  LASNHAQLNISISNLN-NSTNSEAVGYGSFHGREFGFVGGNSRTHLVNSKPKESPSIRCQ  213

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFF  541
            ST T+E KT+ NLLDNASNLLTNLLSGG +GSMP AEGAV DLF  P+FF
Sbjct  214  STGTNEPKTRRNLLDNASNLLTNLLSGGSLGSMPVAEGAVFDLFSSPLFF  263



>ref|XP_006478581.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Citrus sinensis]
Length=266

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVF  538
            KP     IRCQST T+E KT+ NLLDNASNLLTNLLSGG +GSMP AEGAV DLF  P+F
Sbjct  202  KPKESPSIRCQSTGTNEPKTRRNLLDNASNLLTNLLSGGSLGSMPVAEGAVFDLFSSPLF  261

Query  539  F  541
            F
Sbjct  262  F  262



>gb|EMT03024.1| Cytochrome P450 97B2 [Aegilops tauschii]
Length=605

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +2

Query  383  RCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            RCQ    D+  K K NL DNASNLLTNLL+G  + +MP AEGAV+DLF RP+F+SLYDWF
Sbjct  23   RCQLPGVDKTTKPKRNLFDNASNLLTNLLAGSNLKNMPVAEGAVTDLFDRPLFYSLYDWF  82

Query  560  LKYG  571
            L++G
Sbjct  83   LEHG  86



>gb|KHG14945.1| Cytochrome P450, chloroplastic [Gossypium arboreum]
Length=576

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            IRCQSTST E K K NLLDN SNLLTN LSGG +GSMP AEGAVSDLFGRP+FFSLYDWF
Sbjct  46   IRCQSTSTKEPKAKRNLLDNLSNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLYDWF  105

Query  560  LKYG  571
            L++G
Sbjct  106  LEHG  109



>ref|XP_002968239.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
 gb|EFJ30493.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
Length=563

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            K +   LDNASN LTN LSGG I +MP A+GA+SDLF RP+FF+LYDWFL++G
Sbjct  46   KPQRTFLDNASNALTNFLSGGGIQNMPVADGAISDLFSRPLFFALYDWFLEHG  98



>ref|XP_002976141.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
 gb|EFJ23046.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
Length=541

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            K +   LDNASN LTN LSGG I +MP A+GA+SDLF RP+FF+LYDWFL++G
Sbjct  21   KPQRTFLDNASNALTNFLSGGGIQNMPVADGAISDLFSRPLFFALYDWFLEHG  73



>gb|AFK42094.1| unknown [Medicago truncatula]
Length=84

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  573  EPYFKNQSYSEKKTGRPKRSETAPSAVGMDPIFPPLNRLVRRLLALSN  430
            EP  KNQSYSEKK GR  +S TAPSA+G+ P  PPLN+ V+RLLALSN
Sbjct  19   EPCSKNQSYSEKKRGRSNKSVTAPSAIGIFPKLPPLNKFVKRLLALSN  66



>ref|XP_006833026.1| hypothetical protein AMTR_s00094p00103220, partial [Amborella 
trichopoda]
 gb|ERM98304.1| hypothetical protein AMTR_s00094p00103220, partial [Amborella 
trichopoda]
Length=70

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +2

Query  386  CQSTSTDERKTKMNLLDNASNLLTNLLS--GGKIGSMPTAEGAVSDLFGRPVFFSLYDWF  559
            C S+S      +  LLD AS++LTN+    G   G+MP A GA+SDL GRP+F SLYD+F
Sbjct  1    CDSSSVKPLLLRTVLLDKASDILTNIYRDRGESYGTMPVARGALSDLVGRPLFLSLYDFF  60

Query  560  LK  565
            LK
Sbjct  61   LK  62



>gb|KJB10650.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=498

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            MP AEGAVSDLFGRP+FFSLYDWFL++G
Sbjct  1    MPVAEGAVSDLFGRPLFFSLYDWFLEHG  28



>emb|CDY08069.1| BnaA06g16570D [Brassica napus]
Length=474

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPVFFSLYDWFLKYG  571
            MPTAEGAVSDLFG+P+F SLYDWF+++G
Sbjct  1    MPTAEGAVSDLFGKPLFLSLYDWFMEHG  28



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750