BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I16

Length=520
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010318342.1|  PREDICTED: TITAN-like protein isoform X2           131   9e-33   
ref|XP_010318341.1|  PREDICTED: TITAN-like protein isoform X1           131   9e-33   
ref|XP_009601641.1|  PREDICTED: TITAN-like protein                      130   1e-32   Nicotiana tomentosiformis
ref|XP_009799986.1|  PREDICTED: TITAN-like protein isoform X1           130   1e-32   Nicotiana sylvestris
ref|XP_009799988.1|  PREDICTED: TITAN-like protein isoform X2           130   2e-32   Nicotiana sylvestris
gb|AAU90341.2|  hypothetical protein SDM1_56t00018                      128   1e-31   Solanum demissum
emb|CBI15671.3|  unnamed protein product                                125   9e-31   Vitis vinifera
ref|XP_002280098.3|  PREDICTED: TITAN-like protein                      125   1e-30   
emb|CAN68392.1|  hypothetical protein VITISV_019528                     124   2e-30   Vitis vinifera
ref|XP_002511180.1|  conserved hypothetical protein                     119   1e-28   
ref|XP_011086966.1|  PREDICTED: TITAN-like protein                      117   1e-27   Sesamum indicum [beniseed]
ref|XP_009368545.1|  PREDICTED: TITAN-like protein                      116   2e-27   
ref|XP_006828112.1|  hypothetical protein AMTR_s00151p00095510          109   1e-26   
emb|CDO98600.1|  unnamed protein product                                114   2e-26   Coffea canephora [robusta coffee]
ref|XP_002318132.2|  hypothetical protein POPTR_0012s10000g             110   4e-26   
ref|XP_010926848.1|  PREDICTED: TITAN-like protein                      112   7e-26   Elaeis guineensis
ref|XP_010037417.1|  PREDICTED: TITAN-like protein isoform X3           111   1e-25   Eucalyptus grandis [rose gum]
ref|XP_011044142.1|  PREDICTED: TITAN-like protein isoform X2           111   1e-25   Populus euphratica
ref|XP_011044139.1|  PREDICTED: TITAN-like protein isoform X1           111   1e-25   Populus euphratica
ref|XP_010037418.1|  PREDICTED: TITAN-like protein isoform X4           110   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010250709.1|  PREDICTED: TITAN-like protein isoform X1           110   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_007037987.1|  Coiled-coil domain-containing protein 84, pu...    110   2e-25   
ref|XP_010037416.1|  PREDICTED: TITAN-like protein isoform X2           110   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010250710.1|  PREDICTED: TITAN-like protein isoform X2           110   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010037415.1|  PREDICTED: TITAN-like protein isoform X1           110   2e-25   Eucalyptus grandis [rose gum]
ref|XP_008239479.1|  PREDICTED: TITAN-like protein isoform X2           110   3e-25   Prunus mume [ume]
ref|XP_008239478.1|  PREDICTED: TITAN-like protein isoform X1           109   4e-25   Prunus mume [ume]
ref|XP_007037986.1|  Coiled-coil domain-containing protein 84, pu...    110   5e-25   
ref|XP_008374235.1|  PREDICTED: LOW QUALITY PROTEIN: TITAN-like p...    108   1e-24   
ref|XP_007209221.1|  hypothetical protein PRUPE_ppa006869mg             106   4e-24   
gb|KJB07266.1|  hypothetical protein B456_001G058800                    106   5e-24   Gossypium raimondii
gb|KDP22616.1|  hypothetical protein JCGZ_26447                         103   4e-23   Jatropha curcas
ref|XP_003595419.1|  hypothetical protein MTR_2g045190                  107   4e-23   
gb|EYU22282.1|  hypothetical protein MIMGU_mgv1a007038mg                103   5e-23   Erythranthe guttata [common monkey flower]
ref|XP_003595428.1|  hypothetical protein MTR_2g045310                  102   5e-23   
gb|KHG30681.1|  Coiled-coil domain-containing 84                        103   6e-23   Gossypium arboreum [tree cotton]
ref|XP_010104046.1|  hypothetical protein L484_005519                   104   6e-23   
ref|XP_002869700.1|  hypothetical protein ARALYDRAFT_492348             103   8e-23   
ref|XP_003595422.1|  hypothetical protein MTR_2g045240                  102   8e-23   
ref|NP_194220.2|  TITAN-like protein                                    103   9e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36732.1|  hypothetical protein                                   103   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AES65673.2|  hypothetical protein MTR_2g045240                       103   1e-22   Medicago truncatula
ref|XP_003602808.1|  hypothetical protein MTR_3g099220                  103   1e-22   Medicago truncatula
ref|XP_008439800.1|  PREDICTED: TITAN-like protein isoform X2           102   2e-22   Cucumis melo [Oriental melon]
ref|XP_007137911.1|  hypothetical protein PHAVU_009G166300g             102   2e-22   Phaseolus vulgaris [French bean]
gb|ACU20416.1|  unknown                                               99.4    3e-22   Glycine max [soybeans]
ref|XP_003595418.1|  hypothetical protein MTR_2g045180                  102   5e-22   
ref|XP_008439729.1|  PREDICTED: TITAN-like protein isoform X1           101   5e-22   Cucumis melo [Oriental melon]
ref|XP_006582519.1|  PREDICTED: uncharacterized LOC100799252            101   5e-22   
ref|XP_006285365.1|  hypothetical protein CARUB_v10006756mg             100   7e-22   
ref|XP_010433713.1|  PREDICTED: TITAN-like protein                    97.4    8e-22   Camelina sativa [gold-of-pleasure]
gb|KGN64412.1|  hypothetical protein Csa_1G050510                       100   1e-21   Cucumis sativus [cucumbers]
ref|XP_004501701.1|  PREDICTED: LOW QUALITY PROTEIN: coiled-coil ...  99.4    3e-21   
gb|KFK29025.1|  hypothetical protein AALP_AA7G078700                  98.6    3e-21   Arabis alpina [alpine rockcress]
ref|XP_008813479.1|  PREDICTED: TITAN-like protein                    99.0    4e-21   Phoenix dactylifera
emb|CDY03408.1|  BnaC01g16740D                                        98.2    4e-21   
ref|XP_004145224.1|  PREDICTED: uncharacterized protein LOC101221394    100   4e-21   
ref|XP_004162138.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   4e-21   
gb|KHN32540.1|  hypothetical protein glysoja_040736                   98.6    5e-21   Glycine soja [wild soybean]
ref|XP_004297558.1|  PREDICTED: TITAN-like protein                    98.2    5e-21   Fragaria vesca subsp. vesca
ref|XP_010555549.1|  PREDICTED: TITAN-like protein isoform X2         97.8    8e-21   Tarenaya hassleriana [spider flower]
ref|XP_009138618.1|  PREDICTED: TITAN-like protein                    97.4    9e-21   Brassica rapa
ref|XP_010555548.1|  PREDICTED: TITAN-like protein isoform X1         97.8    9e-21   Tarenaya hassleriana [spider flower]
ref|XP_010433714.1|  PREDICTED: TITAN-like protein                    96.3    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010448504.1|  PREDICTED: TITAN-like protein                    96.3    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010438957.1|  PREDICTED: TITAN-like protein                    96.3    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009413601.1|  PREDICTED: TITAN-like protein                    96.7    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY34322.1|  BnaA01g14250D                                        94.4    9e-20   Brassica napus [oilseed rape]
gb|EPS64526.1|  hypothetical protein M569_10255                       90.9    3e-19   Genlisea aurea
ref|XP_002321706.2|  hypothetical protein POPTR_0015s10880g           92.0    6e-19   
ref|XP_010695364.1|  PREDICTED: TITAN-like protein isoform X2         91.7    1e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010695362.1|  PREDICTED: TITAN-like protein isoform X1         91.7    1e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006436839.1|  hypothetical protein CICLE_v10031832mg           90.5    2e-18   
ref|XP_006485353.1|  PREDICTED: TITAN-like protein-like               90.1    7e-18   Citrus sinensis [apfelsine]
ref|XP_006661414.1|  PREDICTED: TITAN-like protein-like               86.7    3e-17   
dbj|BAG90078.1|  unnamed protein product                              84.3    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ45300.1|  hypothetical protein OsJ_29944                        84.7    5e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09681.1|  hypothetical protein OsI_31964                        82.0    3e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_006413373.1|  hypothetical protein EUTSA_v10025155mg           82.8    3e-15   
dbj|BAJ89643.1|  predicted protein                                    79.7    3e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004957285.1|  PREDICTED: coiled-coil domain-containing pro...  73.2    5e-12   
ref|XP_002993791.1|  hypothetical protein SELMODRAFT_431817           72.4    5e-12   Selaginella moellendorffii
ref|XP_002993273.1|  hypothetical protein SELMODRAFT_449066           70.9    2e-11   
ref|XP_001754595.1|  predicted protein                                63.9    8e-09   
gb|EMT02464.1|  HORMA domain-containing protein 1                     63.5    2e-08   
ref|XP_006811383.1|  PREDICTED: coiled-coil domain-containing pro...  60.1    1e-07   Saccoglossus kowalevskii
ref|XP_001631428.1|  predicted protein                                58.9    3e-07   Nematostella vectensis
ref|XP_002460489.1|  hypothetical protein SORBIDRAFT_02g029290        58.9    3e-07   
ref|XP_003578389.2|  PREDICTED: uncharacterized protein LOC100842600  58.9    4e-07   
ref|XP_002165975.1|  PREDICTED: coiled-coil domain-containing pro...  57.8    6e-07   Hydra vulgaris
ref|NP_001168885.1|  hypothetical protein                             56.6    7e-07   
tpg|DAA40485.1|  TPA: hypothetical protein ZEAMMB73_492711            56.6    7e-07   
ref|XP_011449772.1|  PREDICTED: coiled-coil domain-containing pro...  52.8    1e-05   Crassostrea gigas
ref|XP_002107652.1|  hypothetical protein TRIADDRAFT_51376            51.6    6e-05   Trichoplax adhaerens
ref|XP_002594717.1|  hypothetical protein BRAFLDRAFT_114632           50.8    1e-04   Branchiostoma floridae
ref|XP_009049271.1|  hypothetical protein LOTGIDRAFT_231005           48.1    9e-04   Lottia gigantea



>ref|XP_010318342.1| PREDICTED: TITAN-like protein isoform X2 [Solanum lycopersicum]
Length=417

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC VCKLNHNQGRRHNF PNHKKSL A LSRF+SKL+D+R  LKNP PLRPEHASLNR
Sbjct  7    FEFCVVCKLNHNQGRRHNFIPNHKKSLAAVLSRFQSKLSDIRFFLKNPIPLRPEHASLNR  66

Query  124  LWCRFCQFDIPELHSFF  74
            LWC FC  DI EL SF+
Sbjct  67   LWCIFCDRDILELDSFY  83



>ref|XP_010318341.1| PREDICTED: TITAN-like protein isoform X1 [Solanum lycopersicum]
Length=419

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC VCKLNHNQGRRHNF PNHKKSL A LSRF+SKL+D+R  LKNP PLRPEHASLNR
Sbjct  7    FEFCVVCKLNHNQGRRHNFIPNHKKSLAAVLSRFQSKLSDIRFFLKNPIPLRPEHASLNR  66

Query  124  LWCRFCQFDIPELHSFF  74
            LWC FC  DI EL SF+
Sbjct  67   LWCIFCDRDILELDSFY  83



>ref|XP_009601641.1| PREDICTED: TITAN-like protein [Nicotiana tomentosiformis]
Length=417

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FE C VCKLNHNQGRRHNF PNHKKSL AALSRF+SKL+D+R  +KNP PLRPEHASLNR
Sbjct  7    FELCVVCKLNHNQGRRHNFLPNHKKSLAAALSRFQSKLSDIRFFIKNPIPLRPEHASLNR  66

Query  124  LWCRFCQFDIPELHSFF  74
            LWC FC+ DI EL  FF
Sbjct  67   LWCVFCECDILELDGFF  83



>ref|XP_009799986.1| PREDICTED: TITAN-like protein isoform X1 [Nicotiana sylvestris]
 ref|XP_009799987.1| PREDICTED: TITAN-like protein isoform X1 [Nicotiana sylvestris]
Length=415

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FE C VCKLNHNQGRRHNF PNHKKSL A LSRF+SKL+D+R  +KNP PLRPEHASLNR
Sbjct  7    FELCVVCKLNHNQGRRHNFLPNHKKSLAATLSRFQSKLSDIRFFIKNPIPLRPEHASLNR  66

Query  124  LWCRFCQFDIPELHSFFNRSSVKQFIEQIG  35
            LWC FC+ DI EL SFF   +  + +   G
Sbjct  67   LWCLFCECDILELDSFFASDNAIRHLASAG  96



>ref|XP_009799988.1| PREDICTED: TITAN-like protein isoform X2 [Nicotiana sylvestris]
Length=406

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FE C VCKLNHNQGRRHNF PNHKKSL A LSRF+SKL+D+R  +KNP PLRPEHASLNR
Sbjct  7    FELCVVCKLNHNQGRRHNFLPNHKKSLAATLSRFQSKLSDIRFFIKNPIPLRPEHASLNR  66

Query  124  LWCRFCQFDIPELHSFFNRSSVKQFIEQIG  35
            LWC FC+ DI EL SFF   +  + +   G
Sbjct  67   LWCLFCECDILELDSFFASDNAIRHLASAG  96



>gb|AAU90341.2| hypothetical protein SDM1_56t00018 [Solanum demissum]
Length=418

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC VCKLNHNQ RRHNF PNHKKSL A LSRF+SKL+D+R  LKNP PLRPEHASLNR
Sbjct  7    FEFCVVCKLNHNQRRRHNFLPNHKKSLAAVLSRFQSKLSDIRFFLKNPIPLRPEHASLNR  66

Query  124  LWCRFCQFDIPELHSFF  74
            LWC FC+ DI EL SF+
Sbjct  67   LWCIFCECDILELDSFY  83



>emb|CBI15671.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = -1

Query  316  SNEG-FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEH  140
            SN G FEFC+VC LNHNQGRRHN+FPNH KSL + LSRF SKL+D+R SLK+P+PLRPEH
Sbjct  25   SNNGEFEFCKVCNLNHNQGRRHNYFPNHTKSLSSFLSRFLSKLSDVRFSLKDPSPLRPEH  84

Query  139  ASLNRLWCRFCQFDIPELHSFF  74
            AS NRLWC FC  DI EL S F
Sbjct  85   ASRNRLWCIFCDADIDELGSSF  106



>ref|XP_002280098.3| PREDICTED: TITAN-like protein [Vitis vinifera]
Length=452

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = -1

Query  316  SNEG-FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEH  140
            SN G FEFC+VC LNHNQGRRHN+FPNH KSL + LSRF SKL+D+R SLK+P+PLRPEH
Sbjct  25   SNNGEFEFCKVCNLNHNQGRRHNYFPNHTKSLSSFLSRFLSKLSDVRFSLKDPSPLRPEH  84

Query  139  ASLNRLWCRFCQFDIPELHSFF  74
            AS NRLWC FC  DI EL S F
Sbjct  85   ASRNRLWCIFCDADIDELGSSF  106



>emb|CAN68392.1| hypothetical protein VITISV_019528 [Vitis vinifera]
Length=360

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = -1

Query  316  SNEG-FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEH  140
            SN G FEFC+VC L HNQGRRHN+FPNH KSL + LSRF SKL+D+R SLK+P+PLRPEH
Sbjct  25   SNNGEFEFCKVCNLXHNQGRRHNYFPNHTKSLSSFLSRFLSKLSDVRFSLKDPSPLRPEH  84

Query  139  ASLNRLWCRFCQFDIPELHSFF  74
            AS NRLWC FC  DI EL S F
Sbjct  85   ASRNRLWCIFCDADIDELGSSF  106



>ref|XP_002511180.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51782.1| conserved hypothetical protein [Ricinus communis]
Length=416

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  325  KKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRP  146
            K+K N GFEFC+VC LNH+QG+RH +FPNHKKSL A LSRF++KLAD+R  LKNP+ LRP
Sbjct  2    KQKINNGFEFCKVCNLNHDQGQRHKYFPNHKKSLSAFLSRFQNKLADIRFFLKNPSLLRP  61

Query  145  EHASLNRLWCRFCQFDIPELHSFF  74
            EH+  NRLWC FC  DI E+ S F
Sbjct  62   EHSYRNRLWCVFCDTDIIEIGSSF  85



>ref|XP_011086966.1| PREDICTED: TITAN-like protein [Sesamum indicum]
Length=426

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 75/120 (63%), Gaps = 15/120 (13%)
 Frame = -1

Query  331  KKKKKSNEG--FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPT  158
            KKKK SNE   FE+CEVC+LN NQGRRHN+FPNHK SL   L+RF+SKL D++  LK P 
Sbjct  4    KKKKNSNEQQQFEYCEVCRLNQNQGRRHNYFPNHKTSLATLLTRFQSKLTDVKFFLKTPM  63

Query  157  PLRPEHASLNRLWCRFCQFDIPELHSFF-------------NRSSVKQFIEQIGTDADYL  17
             LRPEHA  NRLWC FC  DI EL S F             +  SVK F+ + G   D L
Sbjct  64   LLRPEHAHQNRLWCPFCSCDILELDSHFACGNAIEHLASVEHWKSVKGFMWKYGGGMDRL  123



>ref|XP_009368545.1| PREDICTED: TITAN-like protein [Pyrus x bretschneideri]
Length=435

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = -1

Query  340  KRMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNP  161
            KR +  KK    FE+C VCKLNH+QG  H + P H KSL A LSRF+SKLAD+R  LKNP
Sbjct  4    KRQEITKKKKYEFEYCVVCKLNHDQGPSHKYIPKHTKSLSAFLSRFQSKLADVRFFLKNP  63

Query  160  TPLRPEHASLNRLWCRFCQFDIPELHSFF  74
            +PLRPEHAS NRLWC FC  DI EL+S F
Sbjct  64   SPLRPEHASRNRLWCVFCDSDIDELYSSF  92



>ref|XP_006828112.1| hypothetical protein AMTR_s00151p00095510 [Amborella trichopoda]
 gb|ERM95528.1| hypothetical protein AMTR_s00151p00095510 [Amborella trichopoda]
Length=157

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = -1

Query  343  LKRMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKN  164
            +K  + K+ S + FEFC VC+LNH+QGRRHN+FP+HK S    LS+F+SK+ D+R  LKN
Sbjct  1    MKEKEGKESSTQRFEFCSVCRLNHDQGRRHNYFPSHKSSFSLLLSKFKSKIQDVRFFLKN  60

Query  163  PTPLRPEHASLNRLWCRFCQFDIPELHSFFNRSSVKQFIEQIG  35
            P+ L+PE  S NR WC  C+ DI EL+S F  S+    +   G
Sbjct  61   PSVLKPEDVSCNRFWCVCCEHDINELNSTFACSNAIAHLTSSG  103



>emb|CDO98600.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLA-DLRSSLKNPTPLRPEHASLN  128
            FEFC+VC+LNHNQGRRH +FPNHKK+L + LSRF+SKL  D+   LK P PLRPEHA+LN
Sbjct  66   FEFCKVCRLNHNQGRRHIYFPNHKKALSSFLSRFQSKLKNDVAFYLKKPMPLRPEHAALN  125

Query  127  RLWCRFCQFDIPELHSFF  74
            RLWC FC FDI E  S F
Sbjct  126  RLWCVFCDFDILESDSSF  143



>ref|XP_002318132.2| hypothetical protein POPTR_0012s10000g [Populus trichocarpa]
 gb|EEE96352.2| hypothetical protein POPTR_0012s10000g [Populus trichocarpa]
Length=253

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -1

Query  337  RMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPT  158
            ++  +KK N  FEFC+ C LNH+QG+ H +FPNHKKSL   LS F++KLAD+R  LKNPT
Sbjct  6    KINNEKKKNMEFEFCKACNLNHDQGQNHKYFPNHKKSLSNFLSCFQTKLADIRFFLKNPT  65

Query  157  PLRPEHASLNRLWCRFCQFDIPELHSFF  74
             LRPE AS NR+WC FC FDI E  S F
Sbjct  66   ILRPELASRNRIWCIFCDFDIHETGSSF  93



>ref|XP_010926848.1| PREDICTED: TITAN-like protein [Elaeis guineensis]
Length=455

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFCEVCKLNH+QG RH +F +H+++L A+L+RF  KLADLR  L NP+PLRPEH++LNR
Sbjct  28   FEFCEVCKLNHDQGHRHKYFSSHRRALAASLARFHKKLADLRFFLCNPSPLRPEHSTLNR  87

Query  124  LWCRFCQFDIPELHSFF  74
            LWC FC  D+ E+ S F
Sbjct  88   LWCLFCAVDLHEVSSPF  104



>ref|XP_010037417.1| PREDICTED: TITAN-like protein isoform X3 [Eucalyptus grandis]
Length=420

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = -1

Query  325  KKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRP  146
            K+KS   FEFC+VCKLNH+QG+RH + PNHK+SL   L RFRSKL D+R  L NP+ LRP
Sbjct  39   KRKSE--FEFCKVCKLNHDQGQRHKYLPNHKRSLSGYLDRFRSKLGDVRFFLDNPSLLRP  96

Query  145  EHASLNRLWCRFCQFDIPELHSFF  74
            EH S NR WC FC  D+ EL S F
Sbjct  97   EHVSRNRFWCVFCDVDVEELDSSF  120



>ref|XP_011044142.1| PREDICTED: TITAN-like protein isoform X2 [Populus euphratica]
Length=446

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -1

Query  337  RMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPT  158
            +   +KK N  FEFC+ C LNH+QG+ H +FPNHKKSL   LSRF++KLAD+R  LKNPT
Sbjct  6    KTNNEKKKNMEFEFCKACNLNHDQGQNHKYFPNHKKSLSNFLSRFQTKLADIRFFLKNPT  65

Query  157  PLRPEHASLNRLWCRFCQFDIPELHSFF  74
             LRP+ AS NR+WC FC FDI E  + F
Sbjct  66   ILRPDLASRNRIWCVFCDFDIHETGNSF  93



>ref|XP_011044139.1| PREDICTED: TITAN-like protein isoform X1 [Populus euphratica]
 ref|XP_011044141.1| PREDICTED: TITAN-like protein isoform X1 [Populus euphratica]
Length=449

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -1

Query  337  RMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPT  158
            +   +KK N  FEFC+ C LNH+QG+ H +FPNHKKSL   LSRF++KLAD+R  LKNPT
Sbjct  6    KTNNEKKKNMEFEFCKACNLNHDQGQNHKYFPNHKKSLSNFLSRFQTKLADIRFFLKNPT  65

Query  157  PLRPEHASLNRLWCRFCQFDIPELHSFF  74
             LRP+ AS NR+WC FC FDI E  + F
Sbjct  66   ILRPDLASRNRIWCVFCDFDIHETGNSF  93



>ref|XP_010037418.1| PREDICTED: TITAN-like protein isoform X4 [Eucalyptus grandis]
Length=394

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = -1

Query  325  KKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRP  146
            K+KS   FEFC+VCKLNH+QG+RH + PNHK+SL   L RFRSKL D+R  L NP+ LRP
Sbjct  39   KRKSE--FEFCKVCKLNHDQGQRHKYLPNHKRSLSGYLDRFRSKLGDVRFFLDNPSLLRP  96

Query  145  EHASLNRLWCRFCQFDIPELHSFF  74
            EH S NR WC FC  D+ EL S F
Sbjct  97   EHVSRNRFWCVFCDVDVEELDSSF  120



>ref|XP_010250709.1| PREDICTED: TITAN-like protein isoform X1 [Nelumbo nucifera]
Length=474

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+VC LNH+QGRRH +FPNH KSL + LSRF  KL+D+R  LKNP+ LRPEHA  NR
Sbjct  35   FEFCKVCNLNHDQGRRHIYFPNHIKSLSSYLSRFHKKLSDVRFFLKNPSLLRPEHAPRNR  94

Query  124  LWCRFCQFDIPELHSFFN-RSSVKQFIE-QIGTDADYLLFKY  5
            LWC FC  DI EL S F   +++  F   +   + +Y L+KY
Sbjct  95   LWCVFCDSDIEELDSLFACGNAITHFASAEHLKNLNYFLWKY  136



>ref|XP_007037987.1| Coiled-coil domain-containing protein 84, putative isoform 2, 
partial [Theobroma cacao]
 gb|EOY22488.1| Coiled-coil domain-containing protein 84, putative isoform 2, 
partial [Theobroma cacao]
Length=443

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+VCKLNHNQG RH +FPNHK SL A LSR ++K+ D+R  LKNPT +RPEHA  NR
Sbjct  33   FEFCKVCKLNHNQGPRHKYFPNHKNSLSAFLSRIQNKINDIRFFLKNPTIIRPEHAERNR  92

Query  124  LWCRFCQFDIPELHSFF  74
             WC FC  D+ EL S F
Sbjct  93   FWCVFCDADVDELDSSF  109



>ref|XP_010037416.1| PREDICTED: TITAN-like protein isoform X2 [Eucalyptus grandis]
Length=455

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+VCKLNH+QG+RH + PNHK+SL   L RFRSKL D+R  L NP+ LRPEH S NR
Sbjct  44   FEFCKVCKLNHDQGQRHKYLPNHKRSLSGYLDRFRSKLGDVRFFLDNPSLLRPEHVSRNR  103

Query  124  LWCRFCQFDIPELHSFF  74
             WC FC  D+ EL S F
Sbjct  104  FWCVFCDVDVEELDSSF  120



>ref|XP_010250710.1| PREDICTED: TITAN-like protein isoform X2 [Nelumbo nucifera]
Length=460

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+VC LNH+QGRRH +FPNH KSL + LSRF  KL+D+R  LKNP+ LRPEHA  NR
Sbjct  35   FEFCKVCNLNHDQGRRHIYFPNHIKSLSSYLSRFHKKLSDVRFFLKNPSLLRPEHAPRNR  94

Query  124  LWCRFCQFDIPELHSFFN-RSSVKQFIE-QIGTDADYLLFKY  5
            LWC FC  DI EL S F   +++  F   +   + +Y L+KY
Sbjct  95   LWCVFCDSDIEELDSLFACGNAITHFASAEHLKNLNYFLWKY  136



>ref|XP_010037415.1| PREDICTED: TITAN-like protein isoform X1 [Eucalyptus grandis]
Length=457

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+VCKLNH+QG+RH + PNHK+SL   L RFRSKL D+R  L NP+ LRPEH S NR
Sbjct  44   FEFCKVCKLNHDQGQRHKYLPNHKRSLSGYLDRFRSKLGDVRFFLDNPSLLRPEHVSRNR  103

Query  124  LWCRFCQFDIPELHSFF  74
             WC FC  D+ EL S F
Sbjct  104  FWCVFCDVDVEELDSSF  120



>ref|XP_008239479.1| PREDICTED: TITAN-like protein isoform X2 [Prunus mume]
Length=431

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -1

Query  331  KKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPL  152
            +KKKK    FE+C VCKLNH+QG  H + P+H KSL   LSRF+ KL+D+R  LKNPTPL
Sbjct  3    EKKKKKRYEFEYCVVCKLNHDQGPSHKYIPSHTKSLSTFLSRFQDKLSDVRFFLKNPTPL  62

Query  151  RPEHASLNRLWCRFCQFDIPELHSFF  74
            RPE AS NRLWC FC  DI EL S F
Sbjct  63   RPELASRNRLWCVFCDTDIDELDSSF  88



>ref|XP_008239478.1| PREDICTED: TITAN-like protein isoform X1 [Prunus mume]
Length=438

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -1

Query  331  KKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPL  152
            +KKKK    FE+C VCKLNH+QG  H + P+H KSL   LSRF+ KL+D+R  LKNPTPL
Sbjct  3    EKKKKKRYEFEYCVVCKLNHDQGPSHKYIPSHTKSLSTFLSRFQDKLSDVRFFLKNPTPL  62

Query  151  RPEHASLNRLWCRFCQFDIPELHSFF  74
            RPE AS NRLWC FC  DI EL S F
Sbjct  63   RPELASRNRLWCVFCDTDIDELDSSF  88



>ref|XP_007037986.1| Coiled-coil domain-containing protein 84, putative isoform 1 
[Theobroma cacao]
 gb|EOY22487.1| Coiled-coil domain-containing protein 84, putative isoform 1 
[Theobroma cacao]
Length=508

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+VCKLNHNQG RH +FPNHK SL A LSR ++K+ D+R  LKNPT +RPEHA  NR
Sbjct  36   FEFCKVCKLNHNQGPRHKYFPNHKNSLSAFLSRIQNKINDIRFFLKNPTIIRPEHAERNR  95

Query  124  LWCRFCQFDIPELHSFF  74
             WC FC  D+ EL S F
Sbjct  96   FWCVFCDADVDELDSSF  112



>ref|XP_008374235.1| PREDICTED: LOW QUALITY PROTEIN: TITAN-like protein [Malus domestica]
Length=475

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -1

Query  298  FCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNRLW  119
            +C VCKLNH+QG  H + PNH KSL A LSRF+SKLAD+R  LKNP+PLRP+HAS NRLW
Sbjct  24   YCVVCKLNHDQGPSHRYIPNHTKSLSAFLSRFQSKLADVRFFLKNPSPLRPKHASCNRLW  83

Query  118  CRFCQFDIPELHSFF  74
            C FC  +I EL S F
Sbjct  84   CVFCDSBIGELDSSF  98



>ref|XP_007209221.1| hypothetical protein PRUPE_ppa006869mg [Prunus persica]
 gb|EMJ10420.1| hypothetical protein PRUPE_ppa006869mg [Prunus persica]
Length=392

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -1

Query  331  KKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPL  152
            +K KK    FE+C VCKLNHNQG  H + P H KSL   LSRF+ KL+D+R  L+NPTP 
Sbjct  3    EKNKKKRYEFEYCVVCKLNHNQGPSHKYIPGHTKSLSTFLSRFQDKLSDVRFFLQNPTPF  62

Query  151  RPEHASLNRLWCRFCQFDIPELHSFF  74
            RPE AS NRLWC FC  DI EL S F
Sbjct  63   RPELASRNRLWCVFCDTDIDELDSSF  88



>gb|KJB07266.1| hypothetical protein B456_001G058800 [Gossypium raimondii]
Length=451

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+VCKLNHNQG RH +FPNHK +L + L RF++K+ D+R  L+NP  LRPEHA  NR
Sbjct  38   FEFCKVCKLNHNQGPRHKYFPNHKTALSSFLCRFQNKINDVRFFLRNPNVLRPEHADRNR  97

Query  124  LWCRFCQFDIPELHSFF  74
             WC FC  D+ EL S F
Sbjct  98   FWCVFCDTDVDELDSSF  114



>gb|KDP22616.1| hypothetical protein JCGZ_26447 [Jatropha curcas]
Length=368

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC VCKLNH+QG+RH ++P+HKKSL   LSRF+ K++D++  LKNP+ L PEHAS NR
Sbjct  19   FEFCNVCKLNHDQGQRHKYYPSHKKSLSVFLSRFQRKISDIQFFLKNPSVLGPEHASHNR  78

Query  124  LWCRFCQFDIPELHSFF  74
             WC  C  D+ E+ S F
Sbjct  79   FWCVVCDVDVGEIGSSF  95



>ref|XP_003595419.1| hypothetical protein MTR_2g045190 [Medicago truncatula]
Length=1776

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -1

Query  343   LKRMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKN  164
             L+R+KK++     FEFC+VCK+NH+QG RH +FP HK+SL   LSRF++KL+D+R  LK 
Sbjct  1166  LRRIKKERGGKSEFEFCKVCKINHDQGLRHKYFPKHKQSLSTFLSRFKNKLSDVRFFLKT  1225

Query  163   PTPLRPEHASLNRLWCRFCQFDIPELHSFF  74
             P+PL P+ AS NR WC FC  DI E  S F
Sbjct  1226  PSPLTPQLASGNRFWCVFCDQDIDEHSSSF  1255


 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 2/87 (2%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
             K+KKKS   FEFC+VCK+NH+QG RH +FP HK+SL   LSRF++KL+D+R  LK P+P
Sbjct  18   TKEKKKSE--FEFCKVCKINHDQGLRHKYFPKHKQSLSTFLSRFKNKLSDVRFFLKTPSP  75

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFF  74
            L P+ AS NR WC FC  DI E  S F
Sbjct  76   LTPQLASGNRFWCVFCDQDIDEHSSSF  102


 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 2/87 (2%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
             K+KKKS   FEFC+VCK+NH+QG RH +FP HK+SL   LSRF++KL+D+R  LK P+P
Sbjct  602  TKEKKKSE--FEFCKVCKINHDQGLRHKYFPKHKQSLSTFLSRFKNKLSDVRFFLKTPSP  659

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFF  74
            L P+ AS NR WC FC  DI E  S F
Sbjct  660  LTPQLASGNRFWCVFCDQDINEHSSSF  686



>gb|EYU22282.1| hypothetical protein MIMGU_mgv1a007038mg [Erythranthe guttata]
Length=422

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 63/95 (66%), Gaps = 3/95 (3%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFCEVCKLNHNQGRRH +FP HK SL A L+R +SKL+D++  LK P  L  EHA  NR
Sbjct  21   FEFCEVCKLNHNQGRRHIYFPAHKSSLSALLTRLQSKLSDVKPFLKTPMLLPAEHAQQNR  80

Query  124  LWCRFCQFDIPELHSFFNRSSVKQFIEQIGTDADY  20
            LWC FC  D+ EL + F   +  + IE + +   Y
Sbjct  81   LWCVFCNRDVIELDTPF---ACGKAIEHLASGEHY  112



>ref|XP_003595428.1| hypothetical protein MTR_2g045310 [Medicago truncatula]
Length=292

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 2/87 (2%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
             K+KKKS   FEFC+VCK+NH+QG RH +FP HK+SL   LSRF++KL+D+R  LK P+P
Sbjct  18   TKEKKKSE--FEFCKVCKINHDQGLRHKYFPKHKQSLSTFLSRFKNKLSDVRFFLKTPSP  75

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFF  74
            L P+ AS NR WC FC  DI E  S F
Sbjct  76   LTPQLASGNRFWCVFCDQDIXEHSSSF  102



>gb|KHG30681.1| Coiled-coil domain-containing 84 [Gossypium arboreum]
Length=472

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -1

Query  298  FCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNRLW  119
            FC+VCKLNHNQG RH +FPNHK +L + LSRF++K+ D+R  L+NP  LRPEHA  NR W
Sbjct  61   FCKVCKLNHNQGPRHKYFPNHKTALSSFLSRFQNKINDVRFFLRNPKVLRPEHADRNRFW  120

Query  118  CRFCQFDIPELHSFF  74
            C FC  D+ EL S F
Sbjct  121  CVFCDTDVDELDSSF  135



>ref|XP_010104046.1| hypothetical protein L484_005519 [Morus notabilis]
 gb|EXB98030.1| hypothetical protein L484_005519 [Morus notabilis]
Length=483

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FE+C+VCKLNH+QG+RH +FP+HKKSL    S+F++KL+D+   L+NP+ LR EHAS NR
Sbjct  31   FEYCKVCKLNHDQGQRHKYFPSHKKSLSIFFSKFQTKLSDVGFFLRNPSLLRSEHASRNR  90

Query  124  LWCRFCQFDIPELHSFF  74
            +WC FC  DI EL S F
Sbjct  91   VWCVFCDMDIDELGSEF  107



>ref|XP_002869700.1| hypothetical protein ARALYDRAFT_492348 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45959.1| hypothetical protein ARALYDRAFT_492348 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 73/117 (62%), Gaps = 14/117 (12%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MKK  K +E  EFC+VC+L+H+QG RH +FP HK SL + L RFRSK+AD+R  LKNP+ 
Sbjct  1    MKKPSKKSE-IEFCKVCRLHHDQGSRHKYFPRHKSSLSSLLDRFRSKIADVRFFLKNPSV  59

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFFNRS-------------SVKQFIEQIGTDAD  23
            LRP+  S NR+WC FC  +I EL S F  S             ++KQF+ + G   D
Sbjct  60   LRPQEQSQNRVWCVFCDEEIVELGSSFACSKAITHFASSDHLKNIKQFLSKNGPAMD  116



>ref|XP_003595422.1| hypothetical protein MTR_2g045240 [Medicago truncatula]
Length=387

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -1

Query  331  KKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPL  152
            K+KKKS   FEFC+VCK+NH+QG RH +FP HK+SL   LSRF++KL+D+R  LK P+PL
Sbjct  19   KEKKKSE--FEFCKVCKINHDQGLRHKYFPKHKQSLSTFLSRFKNKLSDVRFFLKTPSPL  76

Query  151  RPEHASLNRLWCRFCQFDIPELHSFF  74
             P+ AS NR WC FC  DI E  S F
Sbjct  77   TPQLASGNRFWCVFCDQDIDEHSSSF  102



>ref|NP_194220.2| TITAN-like protein [Arabidopsis thaliana]
 sp|F4JRR5.1|TTL_ARATH RecName: Full=TITAN-like protein [Arabidopsis thaliana]
 gb|AEE84974.1| uncharacterized protein AT4G24900 [Arabidopsis thaliana]
Length=421

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 72/119 (61%), Gaps = 14/119 (12%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MKK  K +E  EFC VC+ +H+QG RH +FP HK SL + L RFRSK+AD+R  LKNP+ 
Sbjct  1    MKKPSKKSE-IEFCTVCRFHHDQGSRHKYFPRHKSSLSSLLDRFRSKIADVRFFLKNPSV  59

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFFNRS-------------SVKQFIEQIGTDADYL  17
            LRP+  S NR+WC FC  DI EL S F  S             ++KQF+ + G   D +
Sbjct  60   LRPQEQSQNRVWCVFCDEDIVELGSSFACSKAINHFASSDHLKNIKQFLSKNGPAMDCI  118



>emb|CAB36732.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79399.1| hypothetical protein [Arabidopsis thaliana]
Length=423

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 72/119 (61%), Gaps = 14/119 (12%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MKK  K +E  EFC VC+ +H+QG RH +FP HK SL + L RFRSK+AD+R  LKNP+ 
Sbjct  1    MKKPSKKSE-IEFCTVCRFHHDQGSRHKYFPRHKSSLSSLLDRFRSKIADVRFFLKNPSV  59

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFFNRS-------------SVKQFIEQIGTDADYL  17
            LRP+  S NR+WC FC  DI EL S F  S             ++KQF+ + G   D +
Sbjct  60   LRPQEQSQNRVWCVFCDEDIVELGSSFACSKAINHFASSDHLKNIKQFLSKNGPAMDCI  118



>gb|AES65673.2| hypothetical protein MTR_2g045240 [Medicago truncatula]
 gb|KEH37698.1| hypothetical protein MTR_2g045245 [Medicago truncatula]
Length=458

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 2/87 (2%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
             K+KKKS   FEFC+VCK+NH+QG RH +FP HK+SL   LSRF++KL+D+R  LK P+P
Sbjct  18   TKEKKKSE--FEFCKVCKINHDQGLRHKYFPKHKQSLSTFLSRFKNKLSDVRFFLKTPSP  75

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFF  74
            L P+ AS NR WC FC  DI E  S F
Sbjct  76   LTPQLASGNRFWCVFCDQDIDEHSSSF  102



>ref|XP_003602808.1| hypothetical protein MTR_3g099220 [Medicago truncatula]
 gb|AES73059.1| hypothetical protein MTR_3g099220 [Medicago truncatula]
Length=440

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 2/87 (2%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
             K+KKKS   FEFC+VCK+NH+QG RH +FP HK+SL   LSRF++KL+D+R  LK P+P
Sbjct  18   TKEKKKSE--FEFCKVCKINHDQGLRHKYFPKHKQSLSTFLSRFKNKLSDVRFFLKTPSP  75

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFF  74
            L P+ AS NR WC FC  DI E  S F
Sbjct  76   LTPQLASGNRFWCVFCDQDIDEHSSSF  102



>ref|XP_008439800.1| PREDICTED: TITAN-like protein isoform X2 [Cucumis melo]
Length=437

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 67/106 (63%), Gaps = 5/106 (5%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MKKK+     +E+C VCKLNH+QG+RH +FPNHKKSL + LSRF  KL+D+R  LK P  
Sbjct  1    MKKKELKKSAYEYCLVCKLNHDQGQRHKYFPNHKKSLSSFLSRFEIKLSDVRFFLKTPFR  60

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFFNRSSVKQFIEQIGTDADYL  17
            L PE AS NR WC FC   + E  S F  +++K         AD+L
Sbjct  61   LSPEFASHNRFWCIFCDVQVDETDSSFACNAIKHL-----ASADHL  101



>ref|XP_007137911.1| hypothetical protein PHAVU_009G166300g [Phaseolus vulgaris]
 gb|ESW09905.1| hypothetical protein PHAVU_009G166300g [Phaseolus vulgaris]
Length=409

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MKK++     FEFC+ C +NH+QG RH +FPNHKKSL   LSRFR KL+D+R  L  P P
Sbjct  1    MKKQQTQKSEFEFCKACGINHDQGLRHKYFPNHKKSLSTFLSRFRKKLSDVRFFLNAPIP  60

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFF  74
            L P+ AS NR WC FC  DI E  S F
Sbjct  61   LNPQLASRNRFWCVFCDQDIHEHSSSF  87



>gb|ACU20416.1| unknown [Glycine max]
Length=210

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 65/109 (60%), Gaps = 13/109 (12%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+ C +NH+QG RH +FPNHKKSL   LSRFR KL+D+R  L  P PL P+ AS NR
Sbjct  29   FEFCKACNINHDQGLRHKYFPNHKKSLSTFLSRFRKKLSDVRFFLNAPIPLNPQLASRNR  88

Query  124  LWCRFCQFDIPELHSFF-------------NRSSVKQFIEQIGTDADYL  17
             WC FC   I EL+S F             +  ++KQF  + G  AD L
Sbjct  89   FWCVFCDQHIDELNSSFACANAIRHLASAEHVKNLKQFFWKYGGAADQL  137



>ref|XP_003595418.1| hypothetical protein MTR_2g045180 [Medicago truncatula]
Length=614

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 65/92 (71%), Gaps = 2/92 (2%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
             K+KKKS   FEFC+VCK+NH+QG RH +FP HK+SL   LSRF++KL+D+R  LK P+P
Sbjct  462  TKEKKKSE--FEFCKVCKINHDQGLRHKYFPKHKQSLSTFLSRFKNKLSDVRFFLKTPSP  519

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFFNRSSV  59
            L P+ AS NR WC FC  DI E  S F  S V
Sbjct  520  LTPQLASGNRFWCVFCDQDIDEHSSSFAWSCV  551


 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            +K+KKKS   FEFC+VCK+NH+QG RH +FP HK+SL   LSRF++KL+D+R  LK P+P
Sbjct  57   IKEKKKSE--FEFCKVCKINHDQGLRHKYFPKHKQSLSTFLSRFKNKLSDVRFFLKTPSP  114

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFF  74
            L P+ AS NR WC FC  DI E  S F
Sbjct  115  LTPQLASGNRFWCVFCDQDIDEHSSSF  141



>ref|XP_008439729.1| PREDICTED: TITAN-like protein isoform X1 [Cucumis melo]
 ref|XP_008439739.1| PREDICTED: TITAN-like protein isoform X1 [Cucumis melo]
 ref|XP_008439747.1| PREDICTED: TITAN-like protein isoform X1 [Cucumis melo]
 ref|XP_008439753.1| PREDICTED: TITAN-like protein isoform X1 [Cucumis melo]
 ref|XP_008439759.1| PREDICTED: TITAN-like protein isoform X1 [Cucumis melo]
 ref|XP_008439767.1| PREDICTED: TITAN-like protein isoform X1 [Cucumis melo]
 ref|XP_008439776.1| PREDICTED: TITAN-like protein isoform X1 [Cucumis melo]
 ref|XP_008439784.1| PREDICTED: TITAN-like protein isoform X1 [Cucumis melo]
 ref|XP_008439792.1| PREDICTED: TITAN-like protein isoform X1 [Cucumis melo]
Length=438

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MKKK+     +E+C VCKLNH+QG+RH +FPNHKKSL + LSRF  KL+D+R  LK P  
Sbjct  1    MKKKELKKSAYEYCLVCKLNHDQGQRHKYFPNHKKSLSSFLSRFEIKLSDVRFFLKTPFR  60

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFF  74
            L PE AS NR WC FC   + E  S F
Sbjct  61   LSPEFASHNRFWCIFCDVQVDETDSSF  87



>ref|XP_006582519.1| PREDICTED: uncharacterized LOC100799252 [Glycine max]
Length=460

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 65/109 (60%), Gaps = 13/109 (12%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+ C +NH+QG RH +FPNHKKSL   LSRFR KL+D+R  L  P PL P+ AS NR
Sbjct  29   FEFCKACNINHDQGLRHKYFPNHKKSLSTFLSRFRKKLSDVRFFLNAPIPLNPQLASRNR  88

Query  124  LWCRFCQFDIPELHSFF-------------NRSSVKQFIEQIGTDADYL  17
             WC FC   I EL+S F             +  ++KQF  + G  AD L
Sbjct  89   FWCVFCDQHIDELNSSFACANAIRHLASAEHVKNLKQFFWKYGGAADQL  137



>ref|XP_006285365.1| hypothetical protein CARUB_v10006756mg [Capsella rubella]
 gb|EOA18263.1| hypothetical protein CARUB_v10006756mg [Capsella rubella]
Length=420

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MKK  K +E  EFC+VC+L+H+QG RH +FP HK  L   L RFRSK+AD+R  LKNP+ 
Sbjct  1    MKKPSKKSE-TEFCKVCRLHHDQGSRHKYFPRHKDFLSTFLDRFRSKIADVRFFLKNPSV  59

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFF  74
            LRPE  S NR+WC FC  DI EL S F
Sbjct  60   LRPEEQSQNRVWCVFCDEDIVELGSSF  86



>ref|XP_010433713.1| PREDICTED: TITAN-like protein [Camelina sativa]
Length=178

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 71/119 (60%), Gaps = 14/119 (12%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MK+  K +E  E+C+VC+L+H+ G RH +FP HK  L   L RFR+K+AD+R  LKNP+ 
Sbjct  1    MKEPSKKSE-IEYCKVCRLHHDHGSRHKYFPRHKDLLSTFLDRFRTKIADVRFFLKNPSV  59

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFFNRS-------------SVKQFIEQIGTDADYL  17
            LRP+  S NR+WC FC  DI EL S F  S             +VKQF+ + G   D +
Sbjct  60   LRPQEQSQNRVWCVFCDEDIVELGSSFACSKAINHFASSDHLKNVKQFLSKNGPAMDCI  118



>gb|KGN64412.1| hypothetical protein Csa_1G050510 [Cucumis sativus]
Length=441

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -1

Query  343  LKRMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKN  164
            +  MKKK+     +E+C VCKLNH+QG+RH +FPNHKKSL + LSRF  KL+D+R  LK 
Sbjct  1    MHNMKKKELKKSAYEYCLVCKLNHDQGQRHKYFPNHKKSLSSFLSRFEIKLSDVRFFLKT  60

Query  163  PTPLRPEHASLNRLWCRFCQFDIPELHSFF  74
            P  L PE AS NR WC FC   + E  S F
Sbjct  61   PFLLSPEFASHNRFWCIFCDVQVDENDSSF  90



>ref|XP_004501701.1| PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing 
protein 84-like [Cicer arietinum]
Length=447

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+VC +NH+QG RH +FP HKKSL   LSRF++K +D+R  L  PTPL  + +S NR
Sbjct  26   FEFCKVCNINHDQGLRHKYFPKHKKSLSTFLSRFQNKCSDVRFFLNTPTPLSSQLSSHNR  85

Query  124  LWCRFCQFDIPELHSFFNRSSVKQFIEQI  38
             WC FC  DI EL S F+R++  + +  I
Sbjct  86   FWCVFCDQDIDELSSSFSRANAIRHLASI  114



>gb|KFK29025.1| hypothetical protein AALP_AA7G078700 [Arabis alpina]
Length=416

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 58/87 (67%), Gaps = 2/87 (2%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            +K  KKS    EFC VC+L+H+QG RH +FP HK SL   L RFRSKL D+R  L+NP  
Sbjct  2    VKSSKKSE--IEFCNVCRLHHDQGSRHKYFPRHKDSLSTFLDRFRSKLTDVRFFLRNPIL  59

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFF  74
            LRP+  S NR+WC FC  DI EL S F
Sbjct  60   LRPQEQSQNRVWCVFCDHDIVELGSSF  86



>ref|XP_008813479.1| PREDICTED: TITAN-like protein [Phoenix dactylifera]
Length=459

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+VCKLNH+QG  H +F  H+++L AAL+RF  KLADLR  L+NP+PLRPEH++LNR
Sbjct  29   FEFCDVCKLNHDQGHHHKYFTGHRRALAAALARFHEKLADLRFFLRNPSPLRPEHSALNR  88

Query  124  LWCRFCQFDIPELHSFF  74
            LWC FC  D+ EL S F
Sbjct  89   LWCLFCAVDLRELGSPF  105



>emb|CDY03408.1| BnaC01g16740D [Brassica napus]
Length=386

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FE C+VC+ +H+QG RH +FP HK+ L A L+RFRSK+AD+R  LKNP+ LRP+  S NR
Sbjct  18   FELCKVCRFHHDQGPRHKYFPRHKELLSAFLNRFRSKIADVRFFLKNPSFLRPQEESQNR  77

Query  124  LWCRFCQFDIPELHSFF-------------NRSSVKQFIEQIGTDAD  23
            LWC FC  DI EL S F             +  +VKQF+ + G   D
Sbjct  78   LWCVFCDEDIVELGSSFACSKAINHFASSEHHKNVKQFLWKHGPSMD  124



>ref|XP_004145224.1| PREDICTED: uncharacterized protein LOC101221394 [Cucumis sativus]
 ref|XP_004154126.1| PREDICTED: uncharacterized protein LOC101221031 [Cucumis sativus]
Length=583

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -1

Query  343  LKRMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKN  164
            +  MKKK+     +E+C VCKLNH+QG+RH +FPNHKKSL + LSRF  KL+D+R  LK 
Sbjct  1    MHNMKKKELKKSAYEYCLVCKLNHDQGQRHKYFPNHKKSLSSFLSRFEIKLSDVRFFLKT  60

Query  163  PTPLRPEHASLNRLWCRFCQFDIPELHSFF  74
            P  L PE AS NR WC FC   + E  S F
Sbjct  61   PFLLSPEFASHNRFWCIFCDVQVDENDSSF  90



>ref|XP_004162138.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228491 
[Cucumis sativus]
Length=583

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -1

Query  343  LKRMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKN  164
            +  MKKK+     +E+C VCKLNH+QG+RH +FPNHKKSL + LSRF  KL+D+R  LK 
Sbjct  1    MHNMKKKELKKSAYEYCLVCKLNHDQGQRHKYFPNHKKSLSSFLSRFEIKLSDVRFFLKT  60

Query  163  PTPLRPEHASLNRLWCRFCQFDIPELHSFF  74
            P  L PE AS NR WC FC   + E  S F
Sbjct  61   PFLLSPEFASHNRFWCIFCDVQVDENDSSF  90



>gb|KHN32540.1| hypothetical protein glysoja_040736 [Glycine soja]
Length=447

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 64/109 (59%), Gaps = 13/109 (12%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+ C +NH+QG RH +FPNHKKSL   LSRFR KL+D+R  L  P PL P+  S NR
Sbjct  29   FEFCKACNINHDQGLRHKYFPNHKKSLSTFLSRFRKKLSDVRFFLNAPIPLNPQLTSRNR  88

Query  124  LWCRFCQFDIPELHSFF-------------NRSSVKQFIEQIGTDADYL  17
             WC FC   I EL+S F             +  ++KQF  + G  AD L
Sbjct  89   FWCVFCDQHIDELNSSFACANAIRHLASAEHVKNLKQFFWKYGGAADQL  137



>ref|XP_004297558.1| PREDICTED: TITAN-like protein [Fragaria vesca subsp. vesca]
Length=415

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FE+C VCKLNH+QG  H + P+H KSL   LSRF++KL+D+   L NPT LR EHA+ NR
Sbjct  13   FEYCTVCKLNHDQGPSHKYIPSHTKSLSTFLSRFQAKLSDVVFFLNNPTFLRLEHAARNR  72

Query  124  LWCRFCQFDIPELHSFF  74
            LWC FC FDI E  S F
Sbjct  73   LWCVFCDFDIDERDSSF  89



>ref|XP_010555549.1| PREDICTED: TITAN-like protein isoform X2 [Tarenaya hassleriana]
Length=426

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = -1

Query  340  KRMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNP  161
            K +  KKKS    EFC+VC+L+H+QG RH +FP HK  L A L RFR+K+AD+R  ++NP
Sbjct  8    KNLSTKKKSE--IEFCKVCRLHHDQGPRHKYFPRHKDFLSAFLDRFRAKIADVRFFVRNP  65

Query  160  TPLRPEHASLNRLWCRFCQFDIPELHSFF  74
            + LRP+  S NR WC FC  DI EL S F
Sbjct  66   SVLRPQEESQNRTWCVFCDEDIVELGSSF  94



>ref|XP_009138618.1| PREDICTED: TITAN-like protein [Brassica rapa]
Length=388

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FEFC+VC+ +H+ G RH +FP HK+ L A L+RFRSK+AD+R  LKNP+ LRP+  S NR
Sbjct  18   FEFCKVCRFHHDHGPRHKYFPRHKELLSAFLNRFRSKIADVRFFLKNPSFLRPQEESQNR  77

Query  124  LWCRFCQFDIPELHSFF  74
            +WC FC  DI EL S F
Sbjct  78   VWCVFCDEDIVELGSSF  94



>ref|XP_010555548.1| PREDICTED: TITAN-like protein isoform X1 [Tarenaya hassleriana]
Length=431

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = -1

Query  340  KRMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNP  161
            K +  KKKS    EFC+VC+L+H+QG RH +FP HK  L A L RFR+K+AD+R  ++NP
Sbjct  8    KNLSTKKKSE--IEFCKVCRLHHDQGPRHKYFPRHKDFLSAFLDRFRAKIADVRFFVRNP  65

Query  160  TPLRPEHASLNRLWCRFCQFDIPELHSFF  74
            + LRP+  S NR WC FC  DI EL S F
Sbjct  66   SVLRPQEESQNRTWCVFCDEDIVELGSSF  94



>ref|XP_010433714.1| PREDICTED: TITAN-like protein [Camelina sativa]
Length=422

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 71/119 (60%), Gaps = 14/119 (12%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MK+  K +E  E+C+VC+L+H+ G RH +FP HK  L   L RFR+K+AD+R  LKNP+ 
Sbjct  1    MKEPSKKSE-IEYCKVCRLHHDHGSRHKYFPRHKDLLSTFLDRFRTKIADVRFFLKNPSV  59

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFFNRS-------------SVKQFIEQIGTDADYL  17
            LRP+  S NR+WC FC  DI EL S F  S             +VKQF+ + G   D +
Sbjct  60   LRPQEQSQNRVWCVFCDEDIVELGSSFACSKAINHFASSDHLKNVKQFLSKNGPAMDCI  118



>ref|XP_010448504.1| PREDICTED: TITAN-like protein [Camelina sativa]
Length=412

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 70/117 (60%), Gaps = 14/117 (12%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MKK  K +E  E+C+VC+L+H+ G RH +FP HK  L   L RFR+K+AD+R  LKNP+ 
Sbjct  1    MKKPSKKSE-IEYCKVCRLHHDHGSRHKYFPRHKYLLSTFLDRFRTKIADVRFFLKNPSV  59

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFFNRS-------------SVKQFIEQIGTDAD  23
            LRP+  S NR+WC FC  DI EL S F  S             ++KQF+ + G   D
Sbjct  60   LRPQEQSQNRVWCVFCDEDIVELGSSFACSKAINHFASSDHLGNIKQFLSKNGPAMD  116



>ref|XP_010438957.1| PREDICTED: TITAN-like protein [Camelina sativa]
Length=422

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 70/119 (59%), Gaps = 14/119 (12%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MKK  K  E  E+C+VC+L+H+ G RH +FP HK  L   L RFR+K+AD+R  LKNP+ 
Sbjct  1    MKKPSKKRE-IEYCKVCRLHHDHGSRHKYFPRHKDLLSTFLDRFRTKIADVRFFLKNPSV  59

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFFNRS-------------SVKQFIEQIGTDADYL  17
            LRP+  S NR+WC FC  DI EL S F  S             ++KQF+ + G   D +
Sbjct  60   LRPQEQSQNRVWCVFCDEDIVELGSSFACSKAINHFASSDHLKNIKQFLSKNGPAMDCI  118



>ref|XP_009413601.1| PREDICTED: TITAN-like protein [Musa acuminata subsp. malaccensis]
Length=462

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -1

Query  319  KSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEH  140
            ++ + FEFCEVC+LNH+QGRRH +FP+H ++L A L+RF  KL+D+R  L+NP+ L PEH
Sbjct  24   ENGQDFEFCEVCRLNHDQGRRHKYFPSHARALAAVLARFHGKLSDIRFFLRNPSSLSPEH  83

Query  139  ASLNRLWCRFCQFDIPELHSFF  74
            A LN LWC FC+ D+ EL S F
Sbjct  84   AVLNHLWCLFCRCDLRELGSSF  105



>emb|CDY34322.1| BnaA01g14250D [Brassica napus]
Length=387

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            F+FC+VC+ +H+ G RH +FP HK+ L A L+RFRSK+AD+R  LKNP+ LRP+  S NR
Sbjct  18   FDFCKVCRFHHDHGPRHKYFPRHKELLSAFLNRFRSKIADVRFFLKNPSFLRPQEESQNR  77

Query  124  LWCRFCQFDIPELHSFF  74
            +WC FC  DI +L S F
Sbjct  78   VWCVFCDEDIVDLGSSF  94



>gb|EPS64526.1| hypothetical protein M569_10255, partial [Genlisea aurea]
Length=188

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            ++FCE+C+LNHNQG RH +FP HK ++   L+RFRSKL D+R  LK P   RPE+A  N 
Sbjct  5    YQFCEICRLNHNQGNRHKYFPAHKSAVSGLLTRFRSKLDDVRFFLKYPKAFRPENAQENG  64

Query  124  LWCRFCQFDIPEL  86
             WC FC  ++ EL
Sbjct  65   FWCLFCNRNVLEL  77



>ref|XP_002321706.2| hypothetical protein POPTR_0015s10880g [Populus trichocarpa]
 gb|EEF05833.2| hypothetical protein POPTR_0015s10880g [Populus trichocarpa]
Length=381

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -1

Query  298  FCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNRLW  119
            FCEVC LN+++G+ H ++PNHK SL   LSRF++K+ D+R  LK PT LRP  +S NR+W
Sbjct  19   FCEVCNLNNDEGQNHKYYPNHKNSLSNFLSRFQTKIVDVRFFLKIPTILRPGISSRNRIW  78

Query  118  CRFCQFDIPELHSFF  74
            C FC FDI E  S F
Sbjct  79   CVFCDFDIHETGSSF  93



>ref|XP_010695364.1| PREDICTED: TITAN-like protein isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=427

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MKKK K+ + +EFC+ CK+NHNQGRRHNFFP H  SL +  SRF+ KL++++ SLKNP+ 
Sbjct  1    MKKKVKTGD-YEFCKFCKINHNQGRRHNFFPRHTNSLSSLFSRFQHKLSNIKFSLKNPSF  59

Query  154  LRPEHASLN-RLWCRFCQFDIPELHSFF  74
            +     S + RLWC FC  DI E  S F
Sbjct  60   VFSSPDSRDYRLWCIFCDCDIVEFDSTF  87



>ref|XP_010695362.1| PREDICTED: TITAN-like protein isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010695363.1| PREDICTED: TITAN-like protein isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=428

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            MKKK K+ + +EFC+ CK+NHNQGRRHNFFP H  SL +  SRF+ KL++++ SLKNP+ 
Sbjct  1    MKKKVKTGD-YEFCKFCKINHNQGRRHNFFPRHTNSLSSLFSRFQHKLSNIKFSLKNPSF  59

Query  154  LRPEHASLN-RLWCRFCQFDIPELHSFF  74
            +     S + RLWC FC  DI E  S F
Sbjct  60   VFSSPDSRDYRLWCIFCDCDIVEFDSTF  87



>ref|XP_006436839.1| hypothetical protein CICLE_v10031832mg [Citrus clementina]
 gb|ESR50079.1| hypothetical protein CICLE_v10031832mg [Citrus clementina]
Length=380

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            F+FC+VC  NH++G+RH +FP+H  SL    SRF++KL ++R  LKNP+ LR E AS NR
Sbjct  12   FDFCKVCNRNHDEGQRHKYFPSHTNSLSKFFSRFQNKLTEVRFFLKNPSFLRLELASRNR  71

Query  124  LWCRFCQFDIPELHSFF  74
            LWC FC  DI EL S F
Sbjct  72   LWCVFCDCDIDELGSSF  88



>ref|XP_006485353.1| PREDICTED: TITAN-like protein-like [Citrus sinensis]
Length=461

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            F+FC+VC  NH++G+RH +FP+H  SL    SRF++KL ++R  LKNP+ LR E AS NR
Sbjct  44   FDFCKVCNRNHDEGQRHKYFPSHTNSLSKFFSRFQNKLTEVRFFLKNPSFLRLELASRNR  103

Query  124  LWCRFCQFDIPELHSFF  74
            LWC FC  DI EL S F
Sbjct  104  LWCVFCDCDIDELGSSF  120



>ref|XP_006661414.1| PREDICTED: TITAN-like protein-like [Oryza brachyantha]
Length=322

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 4/92 (4%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            +K+       FE+CE+C+ NH+QGRRH +FP H+ +L AALSRFRSKL+DLR +L+ P  
Sbjct  3    LKRGTPPAAAFEYCELCRRNHDQGRRHRYFPAHRAALAAALSRFRSKLSDLRRALRRP--  60

Query  154  LRPEHASLNRLWCRFCQFDIPELHSFFNRSSV  59
              P   + +RLWC FC  D+ +L S F  S+V
Sbjct  61   --PSSVARSRLWCPFCSADLVDLDSRFACSNV  90



>dbj|BAG90078.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 18/116 (16%)
 Frame = -1

Query  331  KKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPL  152
            K+       FE+CE+C+ NH+QGRRH +FP H+ +L AALSRFRSKL DLR +L++P+  
Sbjct  4    KRGAAPAAAFEYCELCRRNHDQGRRHRYFPAHRAALAAALSRFRSKLLDLRRALRHPS--  61

Query  151  RPEHASLNRLWCRFCQFDIPELHSFFNRS-------------SVKQFIEQIGTDAD  23
                A+ +RLWC FC  D+ +L S F  S              VK F+++ G   D
Sbjct  62   ---SAARSRLWCPFCSADLVDLDSRFACSNAIYHLASQDHLNGVKAFLQKHGGGMD  114



>gb|EAZ45300.1| hypothetical protein OsJ_29944 [Oryza sativa Japonica Group]
Length=425

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 18/109 (17%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FE+CE+C+ NH+QGRRH +FP H+ +L AALSRFRSKL DLR +L++P+      A+ +R
Sbjct  13   FEYCELCRRNHDQGRRHRYFPAHRAALAAALSRFRSKLLDLRRALRHPS-----SAARSR  67

Query  124  LWCRFCQFDIPELHSFFNRS-------------SVKQFIEQIGTDADYL  17
            LWC FC  D+ +L S F  S              VK F+++ G   D +
Sbjct  68   LWCPFCSADLVDLDSRFACSNAIYHLASQDHLNGVKAFLQKHGGGMDQV  116



>gb|EAZ09681.1| hypothetical protein OsI_31964 [Oryza sativa Indica Group]
Length=398

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 18/109 (17%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FE+CE+C+ NH+QGRRH +FP H+ +L AALSRFRSK  DLR +L++P+      A+ +R
Sbjct  13   FEYCELCRRNHDQGRRHRYFPAHRAALAAALSRFRSKRLDLRRALRHPS-----SAARSR  67

Query  124  LWCRFCQFDIPELHSFFNRS-------------SVKQFIEQIGTDADYL  17
            LWC FC  D+ +L S F  S              VK F+++ G   D +
Sbjct  68   LWCPFCSADLVDLDSRFACSNAIYHLASQDHLNGVKAFLQKHGGGMDQV  116



>ref|XP_006413373.1| hypothetical protein EUTSA_v10025155mg [Eutrema salsugineum]
 gb|ESQ54826.1| hypothetical protein EUTSA_v10025155mg [Eutrema salsugineum]
Length=459

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -1

Query  268  QGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNRLWCRFCQFDIPE  89
            QG RH +FP HK SL A L RFRSK+AD+R  LKNP+ LRP+  S NR+WC FC  DI E
Sbjct  54   QGPRHKYFPRHKDSLSAFLDRFRSKVADVRFFLKNPSVLRPQEESQNRVWCVFCDEDIVE  113

Query  88   LHSFF  74
            L S F
Sbjct  114  LGSSF  118



>dbj|BAJ89643.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 64/109 (59%), Gaps = 17/109 (16%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FE+CE+C+ NH+QGRRH +FP H+ +L AALS F +KLADLR +L +P+   P     +R
Sbjct  13   FEYCELCRRNHDQGRRHRYFPAHRAALAAALSGFHAKLADLRRALLHPSTPGPR----SR  68

Query  124  LWCRFCQFDIPELHSFFNRS-------------SVKQFIEQIGTDADYL  17
            LWC FC  D+ +L S F  S              VK F+ + G   D++
Sbjct  69   LWCPFCSADLVDLDSRFACSNAIYHLASEEHLKGVKDFLRKHGGGMDHV  117



>ref|XP_004957285.1| PREDICTED: coiled-coil domain-containing protein 84-like [Setaria 
italica]
Length=491

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 55/88 (63%), Gaps = 9/88 (10%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSL--KNPTPLRPEHASL  131
             E+CE+C+ +H+ GRRH +   H+  LEAAL+ FRSKL+DLR +L   +P+P  P    L
Sbjct  77   LEYCELCRHHHDLGRRHRYGRKHRAKLEAALTTFRSKLSDLRRALLHGSPSPQPP----L  132

Query  130  NRLWCRFCQFDIPELHSFFNRSSVKQFI  47
             RLWC FC  ++ +L    NRS+    I
Sbjct  133  PRLWCPFCSTELVDLD---NRSACSNAI  157



>ref|XP_002993791.1| hypothetical protein SELMODRAFT_431817 [Selaginella moellendorffii]
 gb|EFJ05157.1| hypothetical protein SELMODRAFT_431817 [Selaginella moellendorffii]
Length=341

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 19/111 (17%)
 Frame = -1

Query  310  EGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASL  131
            +GF FC VC+ NH QGR H +   H+ +L++ L + R K+  LR  L NP    P H   
Sbjct  4    KGFSFCAVCRRNHEQGRGHRYTAGHRNALQSVLGKIRMKIEGLRGFLGNPRDQAPSH---  60

Query  130  NRLWCRFCQFDIPE---------------LHSFFNRSSVKQFIEQIGTDAD  23
             R WC FC+ D+ +               L S  + S+VK+F  + G DA+
Sbjct  61   -RFWCLFCEEDVADNQGSSSIACSNAIHHLASAAHVSNVKRFWCENGADAN  110



>ref|XP_002993273.1| hypothetical protein SELMODRAFT_449066 [Selaginella moellendorffii]
 gb|EFJ05694.1| hypothetical protein SELMODRAFT_449066 [Selaginella moellendorffii]
Length=343

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 56/111 (50%), Gaps = 19/111 (17%)
 Frame = -1

Query  310  EGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASL  131
            +GF FC VC+ NH QGR H +   H+ +L++ L + R K+  +R  L NP    P H   
Sbjct  4    KGFSFCAVCRRNHEQGRGHRYSAGHRNALQSVLGKTRMKIEGVRGFLGNPLAQAPSH---  60

Query  130  NRLWCRFCQFDIPE---------------LHSFFNRSSVKQFIEQIGTDAD  23
             R WC FC+ D+ +               L S  + S+VK+F  + G DA+
Sbjct  61   -RFWCLFCEEDVADDQGSSSIACSNAIHHLASAAHVSNVKRFWCENGADAN  110



>ref|XP_001754595.1| predicted protein [Physcomitrella patens]
 gb|EDQ80565.1| predicted protein [Physcomitrella patens]
Length=509

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -1

Query  298  FCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNRLW  119
            FC VC+++H++ + H +   HKK L   LS+ R KL D+R S+K  T L+ E    ++ W
Sbjct  6    FCPVCRIHHDKVKGHKYGVKHKKYLTEFLSKARKKLQDVRLSMKEVTTLQDEDRDRSKFW  65

Query  118  CRFCQFDIPELHSFFNRSSVKQFI  47
            C FC+ +I E  S F   S  Q +
Sbjct  66   CAFCEQEIDEKKSVFVSESTIQHL  89



>gb|EMT02464.1| HORMA domain-containing protein 1 [Aegilops tauschii]
Length=1075

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 4/65 (6%)
 Frame = -1

Query  268  QGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNRLWCRFCQFDIPE  89
            QGRRH +FP H+ +L AALS FR+KLADLR +L  P+   P     +RLWC FC  D+ +
Sbjct  683  QGRRHRYFPAHRAALAAALSGFRAKLADLRRALLRPSTPGPR----SRLWCPFCSADLVD  738

Query  88   LHSFF  74
            L S F
Sbjct  739  LDSRF  743



>ref|XP_006811383.1| PREDICTED: coiled-coil domain-containing protein 84-like [Saccoglossus 
kowalevskii]
Length=390

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -1

Query  316  SNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHA  137
            +N+ ++FCE C++NH+ GR+H +   HK  +++AL RF  K+ + +S +K PT       
Sbjct  6    ANDSYDFCEFCRINHDHGRKHVYSKRHKDRIQSALRRFCKKIKEAKSEIKKPTVSNNTSL  65

Query  136  SLNRLWCRFCQFDI  95
                 WC  C  +I
Sbjct  66   LEVNFWCYMCAQEI  79



>ref|XP_001631428.1| predicted protein [Nematostella vectensis]
 gb|EDO39365.1| predicted protein [Nematostella vectensis]
Length=367

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            M  +++S   F FC +C+ NHNQGR+H +   HK +L+  L++F  K+ ++R  L  P  
Sbjct  1    MADEEESLRDFAFCILCRKNHNQGRKHVYSRKHKTNLDRILNKFAKKIDEVREYLSKPAV  60

Query  154  LRPEHASLNRLWCRFCQFDI  95
               E       WC FC  D+
Sbjct  61   ENGELEPGAHFWCHFCARDV  80



>ref|XP_002460489.1| hypothetical protein SORBIDRAFT_02g029290 [Sorghum bicolor]
 gb|EER97010.1| hypothetical protein SORBIDRAFT_02g029290 [Sorghum bicolor]
Length=435

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (60%), Gaps = 7/102 (7%)
 Frame = -1

Query  334  MKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTP  155
            M  K      FE+CE+C+ +H+ GRRH +   H+++L+AALS FRSKL+DLR +  + +P
Sbjct  1    MPAKPPPAAEFEYCELCRHHHDHGRRHRYVTKHRRNLDAALSSFRSKLSDLRRAFLHGSP  60

Query  154  -LRPEHASLNRLWCRFCQFDIPELHSFFNRSSVKQFIEQIGT  32
              +P      RLWC FC  D+ +L S   RS+ K  I  + +
Sbjct  61   SSQPPRV---RLWCPFCSTDLVDLDS---RSAGKNGIYHLAS  96



>ref|XP_003578389.2| PREDICTED: uncharacterized protein LOC100842600 [Brachypodium 
distachyon]
Length=994

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 4/64 (6%)
 Frame = -1

Query  265  GRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNRLWCRFCQFDIPEL  86
            GRRH +F  H+ +L + LS FR KL+DLR +L  PT + P+ +   RLWC FC  D+ ++
Sbjct  595  GRRHRYFHAHRAALASVLSGFRCKLSDLRRALLRPT-VPPQRS---RLWCPFCSADLIDV  650

Query  85   HSFF  74
             S F
Sbjct  651  DSRF  654



>ref|XP_002165975.1| PREDICTED: coiled-coil domain-containing protein 84-like [Hydra 
vulgaris]
Length=323

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPT--PLRPEHASL  131
            + +C+VC++NH  G+RHNF   HK +L+  + +F  ++ +  +  +NP     + E  S 
Sbjct  4    YSYCDVCRINHTLGKRHNFTKKHKLALKILIEKFGKRITECYTYFQNPVIFEAKSEDESS  63

Query  130  NRLWCRFCQ  104
              +WC FC+
Sbjct  64   MTVWCHFCK  72



>ref|NP_001168885.1| hypothetical protein [Zea mays]
 gb|ACN30930.1| unknown [Zea mays]
 tpg|DAA40484.1| TPA: hypothetical protein ZEAMMB73_492711 [Zea mays]
Length=229

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FE+CE+C+ +H+ GRRH +   H+++L+AAL+ FRSKL+DLR +    +P         R
Sbjct  14   FEYCELCRHHHDHGRRHRYIVKHRRNLDAALTCFRSKLSDLRRAFLPGSP--SSQPPRTR  71

Query  124  LWCRFCQFDIPELHS  80
            LWC FC  D+ +L S
Sbjct  72   LWCPFCSIDLVDLDS  86



>tpg|DAA40485.1| TPA: hypothetical protein ZEAMMB73_492711, partial [Zea mays]
Length=226

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            FE+CE+C+ +H+ GRRH +   H+++L+AAL+ FRSKL+DLR +    +P         R
Sbjct  14   FEYCELCRHHHDHGRRHRYIVKHRRNLDAALTCFRSKLSDLRRAFLPGSP--SSQPPRTR  71

Query  124  LWCRFCQFDIPELHS  80
            LWC FC  D+ +L S
Sbjct  72   LWCPFCSIDLVDLDS  86



>ref|XP_011449772.1| PREDICTED: coiled-coil domain-containing protein 84-like [Crassostrea 
gigas]
Length=182

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = -1

Query  304  FEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNR  125
            F+FC++C+LNH + R+H +   H+  +   L ++  K+ + RS+LK+P     +     +
Sbjct  5    FQFCQLCRLNHKKKRKHIYSIRHQNVVNNILEKYLRKVTEARSTLKSPQIHNAQFERGAK  64

Query  124  LWCRFC  107
             WC FC
Sbjct  65   FWCHFC  70



>ref|XP_002107652.1| hypothetical protein TRIADDRAFT_51376 [Trichoplax adhaerens]
 gb|EDV28450.1| hypothetical protein TRIADDRAFT_51376 [Trichoplax adhaerens]
Length=353

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = -1

Query  301  EFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLNRL  122
            ++CE+C++NH  G++H +   HKK L+  L +F+  +A +R  L  P     ++ +    
Sbjct  9    DYCEICRINHCCGKKHKYSNKHKKKLDILLEKFQQHIASIREFLVKPVVEDGDYQTNLTF  68

Query  121  WCRFCQFDI  95
            WC  C+  +
Sbjct  69   WCHICRSSV  77



>ref|XP_002594717.1| hypothetical protein BRAFLDRAFT_114632 [Branchiostoma floridae]
 gb|EEN50728.1| hypothetical protein BRAFLDRAFT_114632 [Branchiostoma floridae]
Length=319

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/97 (26%), Positives = 53/97 (55%), Gaps = 3/97 (3%)
 Frame = -1

Query  346  VLKRMKKKKKSNEGFEFCEVCKLNHNQGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLK  167
            ++   KK  K+ + F +C+VC+ +H+QGR+H +   H+ ++ A ++++  K+   +  LK
Sbjct  1    MMAATKKTDKNIQDFNYCDVCRRHHSQGRKHVYSRTHRDNINAIINKYGKKVKIAKPVLK  60

Query  166  NPTPLRPEHASLNRLWCRFCQFDIPELHSFFNRSSVK  56
            +  P+     +    WC FC  ++ + H     S++K
Sbjct  61   H--PVVESGVNDENFWCYFCGCEVKK-HDTTTTSTMK  94



>ref|XP_009049271.1| hypothetical protein LOTGIDRAFT_231005 [Lottia gigantea]
 gb|ESP00080.1| hypothetical protein LOTGIDRAFT_231005 [Lottia gigantea]
Length=316

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 47/83 (57%), Gaps = 2/83 (2%)
 Frame = -1

Query  304  FEFCEVCKLNHN-QGRRHNFFPNHKKSLEAALSRFRSKLADLRSSLKNPTPLRPEHASLN  128
            F +C++CK++H  + ++H +   H++ L   LS+FR K+ D +  LKNP  ++    S  
Sbjct  13   FRYCKLCKISHKYKNKKHIYSLRHQQILINILSKFRKKIEDSQLILKNPVIMKLGWESDV  72

Query  127  RLWCRFCQFDIPELHSFFNRSSV  59
             +WC FC+  I + HS     +V
Sbjct  73   TIWCYFCEESI-QKHSTLEDCTV  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000