BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I15

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP15036.1|  unnamed protein product                                228   1e-69   Coffea canephora [robusta coffee]
ref|XP_009614578.1|  PREDICTED: 26S proteasome non-ATPase regulat...    220   1e-66   Nicotiana tomentosiformis
ref|XP_011083991.1|  PREDICTED: 26S proteasome non-ATPase regulat...    219   2e-66   Sesamum indicum [beniseed]
gb|ABK42076.1|  26S proteasome subunit RPN7                             217   2e-65   Capsicum annuum
gb|EYU23158.1|  hypothetical protein MIMGU_mgv1a008065mg                216   3e-65   Erythranthe guttata [common monkey flower]
ref|XP_009781733.1|  PREDICTED: 26S proteasome non-ATPase regulat...    216   4e-65   Nicotiana sylvestris
ref|XP_007209234.1|  hypothetical protein PRUPE_ppa006999mg             214   2e-64   Prunus persica
ref|XP_008392851.1|  PREDICTED: 26S proteasome non-ATPase regulat...    211   4e-63   
ref|XP_008239417.1|  PREDICTED: 26S proteasome non-ATPase regulat...    211   4e-63   Prunus mume [ume]
gb|KDP30971.1|  hypothetical protein JCGZ_11347                         211   6e-63   Jatropha curcas
ref|XP_009359483.1|  PREDICTED: 26S proteasome non-ATPase regulat...    210   6e-63   Pyrus x bretschneideri [bai li]
ref|XP_009336533.1|  PREDICTED: 26S proteasome non-ATPase regulat...    209   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_006366835.1|  PREDICTED: 26S proteasome non-ATPase regulat...    208   4e-62   Solanum tuberosum [potatoes]
ref|XP_007155515.1|  hypothetical protein PHAVU_003G208200g             208   4e-62   Phaseolus vulgaris [French bean]
ref|XP_004291699.1|  PREDICTED: 26S proteasome non-ATPase regulat...    208   4e-62   Fragaria vesca subsp. vesca
ref|XP_004242844.1|  PREDICTED: 26S proteasome non-ATPase regulat...    208   4e-62   Solanum lycopersicum
ref|XP_002511249.1|  26S proteasome non-atpase regulatory subunit...    207   9e-62   Ricinus communis
ref|XP_010250869.1|  PREDICTED: 26S proteasome non-ATPase regulat...    207   1e-61   
ref|XP_010248825.1|  PREDICTED: 26S proteasome non-ATPase regulat...    206   3e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010696184.1|  PREDICTED: 26S proteasome non-ATPase regulat...    206   3e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008777464.1|  PREDICTED: 26S proteasome non-ATPase regulat...    206   4e-61   Phoenix dactylifera
gb|KHN14079.1|  Putative 26S proteasome non-ATPase regulatory sub...    204   2e-60   Glycine soja [wild soybean]
ref|XP_004152512.1|  PREDICTED: probable 26S proteasome non-ATPas...    204   2e-60   Cucumis sativus [cucumbers]
ref|NP_001242671.1|  uncharacterized protein LOC100810692               204   2e-60   Glycine max [soybeans]
ref|XP_010555532.1|  PREDICTED: 26S proteasome non-ATPase regulat...    203   3e-60   Tarenaya hassleriana [spider flower]
ref|XP_008439357.1|  PREDICTED: 26S proteasome non-ATPase regulat...    203   3e-60   Cucumis melo [Oriental melon]
ref|XP_002262921.1|  PREDICTED: 26S proteasome non-ATPase regulat...    202   1e-59   Vitis vinifera
ref|XP_010105183.1|  26S proteasome non-ATPase regulatory subunit 6     202   2e-59   
ref|XP_003525624.1|  PREDICTED: 26S proteasome non-ATPase regulat...    201   2e-59   Glycine max [soybeans]
ref|XP_004157764.1|  PREDICTED: LOW QUALITY PROTEIN: probable 26S...    201   4e-59   
gb|KDO69335.1|  hypothetical protein CISIN_1g016653mg                   197   5e-59   Citrus sinensis [apfelsine]
ref|XP_010536648.1|  PREDICTED: 26S proteasome non-ATPase regulat...    200   7e-59   Tarenaya hassleriana [spider flower]
ref|XP_009379942.1|  PREDICTED: 26S proteasome non-ATPase regulat...    199   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG19496.1|  hypothetical protein F383_05500                         199   2e-58   Gossypium arboreum [tree cotton]
ref|XP_011040415.1|  PREDICTED: 26S proteasome non-ATPase regulat...    199   2e-58   Populus euphratica
ref|XP_006440041.1|  hypothetical protein CICLE_v10020559mg             197   6e-58   Citrus clementina [clementine]
gb|EPS62992.1|  hypothetical protein M569_11794                         197   6e-58   Genlisea aurea
ref|XP_006476974.1|  PREDICTED: 26S proteasome non-ATPase regulat...    197   7e-58   Citrus sinensis [apfelsine]
ref|XP_002318111.2|  putative proteasome regulatory subunit famil...    197   8e-58   
ref|XP_004515835.1|  PREDICTED: probable 26S proteasome non-ATPas...    197   8e-58   Cicer arietinum [garbanzo]
ref|XP_004515834.1|  PREDICTED: probable 26S proteasome non-ATPas...    197   1e-57   
gb|KCW54339.1|  hypothetical protein EUGRSUZ_I00301                     197   1e-57   Eucalyptus grandis [rose gum]
ref|XP_010912891.1|  PREDICTED: 26S proteasome non-ATPase regulat...    196   1e-57   Elaeis guineensis
gb|KCW54340.1|  hypothetical protein EUGRSUZ_I00301                     197   1e-57   Eucalyptus grandis [rose gum]
ref|XP_011024080.1|  PREDICTED: 26S proteasome non-ATPase regulat...    196   1e-57   Populus euphratica
ref|XP_010027752.1|  PREDICTED: 26S proteasome non-ATPase regulat...    196   2e-57   Eucalyptus grandis [rose gum]
ref|XP_009404232.1|  PREDICTED: 26S proteasome non-ATPase regulat...    197   2e-57   
ref|XP_010037462.1|  PREDICTED: 26S proteasome non-ATPase regulat...    195   5e-57   Eucalyptus grandis [rose gum]
gb|KJB19577.1|  hypothetical protein B456_003G109300                    194   5e-57   Gossypium raimondii
gb|KCW54338.1|  hypothetical protein EUGRSUZ_I00301                     196   5e-57   Eucalyptus grandis [rose gum]
ref|XP_007037890.1|  26S proteasome, regulatory subunit Rpn7,Prot...    193   6e-57   
gb|KFK29021.1|  hypothetical protein AALP_AA7G078400                    195   7e-57   Arabis alpina [alpine rockcress]
gb|KJB38749.1|  hypothetical protein B456_006G270400                    195   7e-57   Gossypium raimondii
ref|XP_010037459.1|  PREDICTED: 26S proteasome non-ATPase regulat...    196   8e-57   
ref|XP_006374553.1|  hypothetical protein POPTR_0015s10280g             193   8e-57   
gb|KJB38750.1|  hypothetical protein B456_006G270400                    195   1e-56   Gossypium raimondii
gb|KCW49173.1|  hypothetical protein EUGRSUZ_K02756                     195   1e-56   Eucalyptus grandis [rose gum]
gb|KJB51169.1|  hypothetical protein B456_008G204800                    192   2e-56   Gossypium raimondii
ref|NP_567709.1|  26S proteasome regulatory subunit Rpn7                194   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007037889.1|  26S proteasome, regulatory subunit Rpn7,Prot...    193   2e-56   Theobroma cacao [chocolate]
gb|KJB19576.1|  hypothetical protein B456_003G109300                    193   3e-56   Gossypium raimondii
emb|CAB41122.1|  putative proteasome regulatory subunit                 193   4e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92654.1|  BnaC07g39120D                                          193   4e-56   
ref|XP_010448512.1|  PREDICTED: 26S proteasome non-ATPase regulat...    192   4e-56   Camelina sativa [gold-of-pleasure]
emb|CDY24849.1|  BnaA08g14610D                                          192   5e-56   Brassica napus [oilseed rape]
emb|CDY08950.1|  BnaC08g11800D                                          192   5e-56   Brassica napus [oilseed rape]
gb|KJB51168.1|  hypothetical protein B456_008G204800                    192   7e-56   Gossypium raimondii
ref|XP_010438962.1|  PREDICTED: 26S proteasome non-ATPase regulat...    192   8e-56   Camelina sativa [gold-of-pleasure]
emb|CDY03414.1|  BnaC01g16680D                                          192   8e-56   
ref|XP_009137476.1|  PREDICTED: 26S proteasome non-ATPase regulat...    192   8e-56   Brassica rapa
gb|KJB51167.1|  hypothetical protein B456_008G204800                    192   1e-55   Gossypium raimondii
ref|XP_002321676.2|  hypothetical protein POPTR_0015s10280g             193   1e-55   
ref|XP_002867642.1|  hypothetical protein ARALYDRAFT_492356             191   2e-55   
ref|XP_010433719.1|  PREDICTED: 26S proteasome non-ATPase regulat...    191   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009138580.1|  PREDICTED: 26S proteasome non-ATPase regulat...    191   2e-55   Brassica rapa
ref|XP_009109236.1|  PREDICTED: 26S proteasome non-ATPase regulat...    191   3e-55   Brassica rapa
ref|XP_003608889.1|  26S proteasome non-ATPase regulatory subunit       190   3e-55   Medicago truncatula
gb|AFK38340.1|  unknown                                                 190   4e-55   Medicago truncatula
ref|XP_006413379.1|  hypothetical protein EUTSA_v10025431mg             189   9e-55   Eutrema salsugineum [saltwater cress]
emb|CDY08956.1|  BnaC08g11860D                                          187   2e-54   Brassica napus [oilseed rape]
gb|ACJ85273.1|  unknown                                                 188   2e-54   Medicago truncatula
gb|KJB51170.1|  hypothetical protein B456_008G204800                    187   9e-54   Gossypium raimondii
gb|KHG00753.1|  hypothetical protein F383_21552                         186   1e-53   Gossypium arboreum [tree cotton]
dbj|BAJ95389.1|  predicted protein                                      185   4e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003525646.1|  PREDICTED: 26S proteasome non-ATPase regulat...    184   7e-53   Glycine max [soybeans]
gb|ACU19140.1|  unknown                                                 184   8e-53   Glycine max [soybeans]
gb|EMT15242.1|  hypothetical protein F775_31879                         184   1e-52   
gb|ABK23809.1|  unknown                                                 183   2e-52   Picea sitchensis
ref|XP_009413439.1|  PREDICTED: 26S proteasome non-ATPase regulat...    183   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW72179.1|  hypothetical protein ZEAMMB73_868326                    179   5e-52   
emb|CAC09486.2|  H0811E11.2                                             181   1e-51   Oryza sativa [red rice]
tpg|DAA37271.1|  TPA: hypothetical protein ZEAMMB73_873701              179   1e-51   
ref|NP_001053129.1|  Os04g0485000                                       181   1e-51   
ref|XP_006283902.1|  hypothetical protein CARUB_v10005019mg             180   3e-51   Capsella rubella
ref|XP_004952997.1|  PREDICTED: 26S proteasome non-ATPase regulat...    180   3e-51   Setaria italica
gb|AFW72178.1|  hypothetical protein ZEAMMB73_868326                    179   6e-51   
ref|NP_001148992.1|  LOC100282612                                       179   7e-51   Zea mays [maize]
ref|NP_001148687.1|  26S proteasome non-ATPase regulatory subunit 6     179   8e-51   Zea mays [maize]
ref|XP_004976007.1|  PREDICTED: 26S proteasome non-ATPase regulat...    178   1e-50   Setaria italica
ref|XP_002454130.1|  hypothetical protein SORBIDRAFT_04g025090          178   2e-50   Sorghum bicolor [broomcorn]
ref|XP_006852152.1|  hypothetical protein AMTR_s00049p00076930          177   5e-50   Amborella trichopoda
ref|XP_006647462.1|  PREDICTED: 26S proteasome non-ATPase regulat...    176   1e-49   Oryza brachyantha
ref|NP_001047343.1|  Os02g0600100                                       176   1e-49   
ref|XP_003575295.1|  PREDICTED: 26S proteasome non-ATPase regulat...    175   3e-49   Brachypodium distachyon [annual false brome]
ref|XP_006652430.1|  PREDICTED: 26S proteasome non-ATPase regulat...    174   6e-49   Oryza brachyantha
gb|EMT22923.1|  hypothetical protein F775_07981                         174   1e-48   
ref|XP_003580002.1|  PREDICTED: 26S proteasome non-ATPase regulat...    172   3e-48   Brachypodium distachyon [annual false brome]
gb|KJB19579.1|  hypothetical protein B456_003G109300                    171   5e-48   Gossypium raimondii
gb|EAY86554.1|  hypothetical protein OsI_07934                          166   7e-46   Oryza sativa Indica Group [Indian rice]
gb|KFK31196.1|  hypothetical protein AALP_AA6G080700                    162   6e-45   Arabis alpina [alpine rockcress]
dbj|BAJ85457.1|  predicted protein                                      157   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001764711.1|  predicted protein                                  154   2e-41   
ref|XP_001763001.1|  predicted protein                                  153   7e-41   
gb|KJB38751.1|  hypothetical protein B456_006G270400                    148   1e-39   Gossypium raimondii
emb|CDY34374.1|  BnaA09g11160D                                          129   2e-34   Brassica napus [oilseed rape]
ref|XP_002968847.1|  hypothetical protein SELMODRAFT_146093             134   9e-34   Selaginella moellendorffii
ref|XP_002974125.1|  hypothetical protein SELMODRAFT_267709             134   9e-34   Selaginella moellendorffii
gb|KDO69334.1|  hypothetical protein CISIN_1g016653mg                   119   1e-28   Citrus sinensis [apfelsine]
ref|XP_010037463.1|  PREDICTED: 26S proteasome non-ATPase regulat...    119   1e-28   
ref|XP_008365109.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    115   2e-27   
gb|KJB19580.1|  hypothetical protein B456_003G109300                    115   3e-27   Gossypium raimondii
ref|XP_006843781.1|  hypothetical protein AMTR_s00007p00246340          112   3e-26   
gb|KEH19349.1|  26S proteasome non-ATPase regulatory subunit 6          114   3e-26   Medicago truncatula
ref|XP_010507951.1|  PREDICTED: 26S proteasome non-ATPase regulat...    110   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_003636705.1|  26S proteasome non-ATPase regulatory subunit       104   1e-23   
ref|XP_004368095.1|  proteasome (prosome, macropain) 26S subunit,...    105   2e-23   Acanthamoeba castellanii str. Neff
ref|XP_008378194.1|  PREDICTED: 26S proteasome non-ATPase regulat...  98.6    6e-22   
ref|NP_989264.1|  proteasome (prosome, macropain) 26S subunit, no...  99.0    3e-21   Xenopus tropicalis [western clawed frog]
ref|NP_956585.1|  26S proteasome non-ATPase regulatory subunit 6      99.0    3e-21   Danio rerio [leopard danio]
ref|XP_008289658.1|  PREDICTED: 26S proteasome non-ATPase regulat...  99.0    3e-21   Stegastes partitus
emb|CAG02059.1|  unnamed protein product                              98.2    5e-21   Tetraodon nigroviridis
ref|XP_004545341.1|  PREDICTED: 26S proteasome non-ATPase regulat...  98.2    5e-21   Maylandia zebra
ref|NP_001088312.1|  proteasome (prosome, macropain) 26S subunit,...  98.2    5e-21   Xenopus laevis [clawed frog]
ref|XP_005731272.1|  PREDICTED: 26S proteasome non-ATPase regulat...  98.2    6e-21   Pundamilia nyererei
ref|XP_005632411.1|  PREDICTED: 26S proteasome non-ATPase regulat...  97.8    6e-21   Canis lupus familiaris [dogs]
tpg|DAA34367.1|  TPA: 26S proteasome subunit RPN7                     96.7    6e-21   Amblyomma variegatum
ref|XP_541816.2|  PREDICTED: 26S proteasome non-ATPase regulatory...  97.8    7e-21   Canis lupus familiaris [dogs]
ref|XP_010735678.1|  PREDICTED: 26S proteasome non-ATPase regulat...  97.8    8e-21   
emb|CBN81090.1|  26S proteasome non-ATPase regulatory subunit 6       97.4    9e-21   Dicentrarchus labrax [European sea bass]
ref|XP_007520678.1|  PREDICTED: 26S proteasome non-ATPase regulat...  97.4    1e-20   Erinaceus europaeus [common hedgehog]
ref|NP_001080462.1|  uncharacterized protein LOC380154                97.4    1e-20   Xenopus laevis [clawed frog]
ref|XP_008318583.1|  PREDICTED: 26S proteasome non-ATPase regulat...  97.4    1e-20   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005952308.1|  PREDICTED: 26S proteasome non-ATPase regulat...  97.1    2e-20   Haplochromis burtoni
ref|XP_003973510.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...  96.7    2e-20   
ref|XP_003442732.1|  PREDICTED: 26S proteasome non-ATPase regulat...  96.7    2e-20   Oreochromis niloticus
ref|XP_001363402.1|  PREDICTED: 26S proteasome non-ATPase regulat...  96.3    2e-20   Monodelphis domestica
ref|XP_003273709.1|  PREDICTED: 26S proteasome non-ATPase regulat...  96.3    3e-20   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_003410080.1|  PREDICTED: 26S proteasome non-ATPase regulat...  96.3    3e-20   Loxodonta africana [African bush elephant]
ref|XP_002713336.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.9    3e-20   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006494527.1|  PREDICTED: 26S proteasome non-ATPase regulat...  90.9    3e-20   Citrus sinensis [apfelsine]
ref|XP_006158091.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.9    4e-20   Tupaia chinensis
ref|XP_006917553.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.9    4e-20   Pteropus alecto
ref|XP_006751020.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.9    4e-20   Leptonychotes weddellii
ref|XP_002915483.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.9    4e-20   Ailuropoda melanoleuca
ref|XP_003785566.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.5    4e-20   Otolemur garnettii
ref|XP_004419950.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.5    4e-20   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|ADO28314.1|  26S proteasome non-ATPase regulatory subunit 6        95.5    4e-20   Ictalurus furcatus
ref|XP_007228770.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.5    5e-20   
ref|XP_006069792.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.5    5e-20   Bubalus bubalis [domestic water buffalo]
ref|NP_001188194.1|  26S proteasome non-ATPase regulatory subunit 6   95.5    5e-20   Ictalurus punctatus
ref|XP_007946269.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.5    5e-20   Orycteropus afer afer
gb|KEH19607.1|  glyceraldehyde-3-phosphate dehydrogenase              95.1    5e-20   Medicago truncatula
ref|XP_010773228.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.5    5e-20   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008050460.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.5    5e-20   Carlito syrichta
ref|XP_005892963.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.1    6e-20   Bos mutus
ref|XP_004018394.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.1    6e-20   Ovis aries [domestic sheep]
ref|XP_007983059.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.1    6e-20   Chlorocebus sabaeus
ref|XP_011356758.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.1    6e-20   Pteropus vampyrus
ref|XP_003982446.3|  PREDICTED: 26S proteasome non-ATPase regulat...  95.1    6e-20   Felis catus [cat]
ref|XP_004676060.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.1    6e-20   Condylura cristata
ref|NP_001029821.1|  26S proteasome non-ATPase regulatory subunit 6   95.1    6e-20   Bos taurus [bovine]
ref|XP_008562210.1|  PREDICTED: 26S proteasome non-ATPase regulat...  95.1    7e-20   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005648630.1|  PCI-domain-containing protein                    95.1    7e-20   Coccomyxa subellipsoidea C-169
ref|NP_055629.1|  26S proteasome non-ATPase regulatory subunit 6 ...  94.7    9e-20   Homo sapiens [man]
ref|XP_011473387.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.7    9e-20   Oryzias latipes [Japanese rice fish]
ref|XP_010950239.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.7    9e-20   Camelus bactrianus [camel]
ref|XP_004644843.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.7    1e-19   
ref|XP_004482519.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.0    1e-19   
ref|XP_007101357.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.7    1e-19   Physeter catodon
ref|XP_004268039.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.7    1e-19   Orcinus orca [Orca]
ref|XP_002399642.1|  26S proteasome regulatory complex, subunit R...  94.7    1e-19   Ixodes scapularis [blacklegged tick]
ref|NP_001253686.1|  26S proteasome non-ATPase regulatory subunit 6   94.7    1e-19   Macaca mulatta [rhesus macaque]
ref|XP_006862168.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.4    1e-19   Chrysochloris asiatica
gb|ACH70831.1|  proteasome (prosome, macropain) 26S subunit, non-...  94.4    1e-19   Salmo salar
ref|XP_007445734.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.4    1e-19   Lipotes vexillifer [baiji]
ref|XP_002108183.1|  hypothetical protein TRIADDRAFT_18564            94.4    1e-19   Trichoplax adhaerens
ref|XP_004482517.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.4    1e-19   Dasypus novemcinctus
ref|XP_004581647.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.4    1e-19   Ochotona princeps [southern American pika]
dbj|BAB26823.1|  unnamed protein product                              94.0    2e-19   Mus musculus [mouse]
ref|XP_006893898.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.0    2e-19   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005335380.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.0    2e-19   Ictidomys tridecemlineatus
ref|XP_007571649.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.0    2e-19   Poecilia formosa
gb|KFB36906.1|  AGAP002061-PA-like protein                            94.0    2e-19   Anopheles sinensis
ref|XP_002758568.1|  PREDICTED: 26S proteasome non-ATPase regulat...  93.6    2e-19   Callithrix jacchus [common marmoset]
ref|XP_007192455.1|  PREDICTED: 26S proteasome non-ATPase regulat...  94.4    2e-19   
ref|XP_010880034.1|  PREDICTED: 26S proteasome non-ATPase regulat...  93.6    3e-19   Esox lucius
ref|XP_006630691.1|  PREDICTED: 26S proteasome non-ATPase regulat...  93.6    3e-19   Lepisosteus oculatus
dbj|BAC24988.1|  unnamed protein product                              92.0    3e-19   Mus musculus [mouse]
emb|CDQ61185.1|  unnamed protein product                              93.2    4e-19   Oncorhynchus mykiss
ref|XP_008144493.1|  PREDICTED: 26S proteasome non-ATPase regulat...  92.8    4e-19   Eptesicus fuscus
ref|XP_007435827.1|  PREDICTED: 26S proteasome non-ATPase regulat...  92.8    5e-19   Python bivittatus
ref|XP_005409078.1|  PREDICTED: 26S proteasome non-ATPase regulat...  92.4    6e-19   Chinchilla lanigera
ref|XP_003480192.1|  PREDICTED: 26S proteasome non-ATPase regulat...  92.4    6e-19   Cavia porcellus [guinea pig]
ref|XP_010735679.1|  PREDICTED: 26S proteasome non-ATPase regulat...  92.0    6e-19   
ref|XP_005669762.1|  PREDICTED: 26S proteasome non-ATPase regulat...  92.4    6e-19   
ref|XP_006089098.1|  PREDICTED: 26S proteasome non-ATPase regulat...  92.4    7e-19   Myotis lucifugus
ref|XP_005808509.1|  PREDICTED: 26S proteasome non-ATPase regulat...  92.0    9e-19   Xiphophorus maculatus
gb|ETN58689.1|  26S proteasome non-ATPase regulatory subunit 6        92.0    9e-19   Anopheles darlingi [American malaria mosquito]
gb|ETE71439.1|  26S proteasome non-ATPase regulatory subunit 6        92.8    1e-18   Ophiophagus hannah
ref|XP_002673249.1|  26S proteasome regulatory subunit RPN7           91.7    1e-18   Naegleria gruberi strain NEG-M
ref|XP_007893373.1|  PREDICTED: 26S proteasome non-ATPase regulat...  91.7    1e-18   Callorhinchus milii [Australian ghost shark]
ref|XP_004661331.1|  PREDICTED: 26S proteasome non-ATPase regulat...  91.7    1e-18   Jaculus jaculus
ref|XP_005008346.1|  PREDICTED: 26S proteasome non-ATPase regulat...  91.7    1e-18   
ref|XP_005348592.1|  PREDICTED: 26S proteasome non-ATPase regulat...  91.7    1e-18   Microtus ochrogaster [prairie voles]
gb|ACQ58022.1|  26S proteasome non-ATPase regulatory subunit 6        91.7    1e-18   Anoplopoma fimbria
gb|ACO09854.1|  26S proteasome non-ATPase regulatory subunit 6        91.3    1e-18   Osmerus mordax
ref|NP_001158526.1|  26S proteasome non-ATPase regulatory subunit 6   90.9    1e-18   Oncorhynchus mykiss
ref|NP_942025.1|  26S proteasome non-ATPase regulatory subunit 6      91.3    1e-18   Rattus norvegicus [brown rat]
ref|XP_006975153.1|  PREDICTED: 26S proteasome non-ATPase regulat...  90.9    2e-18   Peromyscus maniculatus bairdii
ref|XP_001845077.1|  26S proteasome non-ATPase regulatory subunit 6   90.9    2e-18   Culex quinquefasciatus
ref|XP_004702469.1|  PREDICTED: 26S proteasome non-ATPase regulat...  90.9    2e-18   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004461818.1|  PREDICTED: 26S proteasome non-ATPase regulat...  90.9    2e-18   
gb|KDR21785.1|  26S proteasome non-ATPase regulatory subunit 6        90.9    2e-18   Zootermopsis nevadensis
ref|NP_079826.2|  26S proteasome non-ATPase regulatory subunit 6      90.9    2e-18   Mus musculus [mouse]
emb|CDQ60524.1|  unnamed protein product                              90.5    3e-18   Oncorhynchus mykiss
gb|ACI68252.1|  26S proteasome non-ATPase regulatory subunit 6        90.5    3e-18   Salmo salar
ref|XP_003223640.1|  PREDICTED: 26S proteasome non-ATPase regulat...  90.5    3e-18   Anolis carolinensis [Carolina anole]
ref|XP_003503712.1|  PREDICTED: 26S proteasome non-ATPase regulat...  90.5    3e-18   Cricetulus griseus [Chinese hamsters]
ref|XP_004871661.1|  PREDICTED: 26S proteasome non-ATPase regulat...  90.5    3e-18   Heterocephalus glaber [naked mole rat]
ref|XP_008819795.1|  PREDICTED: 26S proteasome non-ATPase regulat...  90.1    4e-18   Nannospalax galili
gb|ACI67508.1|  26S proteasome non-ATPase regulatory subunit 6        89.4    4e-18   Salmo salar
ref|XP_002736795.1|  PREDICTED: 26S proteasome non-ATPase regulat...  89.7    6e-18   Saccoglossus kowalevskii
ref|XP_414416.1|  PREDICTED: 26S proteasome non-ATPase regulatory...  89.7    7e-18   Gallus gallus [bantam]
ref|XP_003393696.1|  PREDICTED: 26S proteasome non-ATPase regulat...  89.7    7e-18   
ref|XP_003490080.1|  PREDICTED: 26S proteasome non-ATPase regulat...  89.4    7e-18   Bombus impatiens
ref|XP_005023314.1|  PREDICTED: 26S proteasome non-ATPase regulat...  88.6    8e-18   
ref|XP_005632412.1|  PREDICTED: 26S proteasome non-ATPase regulat...  89.0    8e-18   
ref|XP_005149456.1|  PREDICTED: 26S proteasome non-ATPase regulat...  89.4    9e-18   Melopsittacus undulatus
gb|EFB25903.1|  hypothetical protein PANDA_003474                     89.0    9e-18   Ailuropoda melanoleuca
ref|XP_005522070.1|  PREDICTED: 26S proteasome non-ATPase regulat...  89.0    1e-17   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_009468144.1|  PREDICTED: 26S proteasome non-ATPase regulat...  89.0    1e-17   Nipponia nippon
gb|KFR02323.1|  26S proteasome non-ATPase regulatory subunit 6        89.0    1e-17   Nipponia nippon
ref|XP_010295301.1|  PREDICTED: 26S proteasome non-ATPase regulat...  89.0    1e-17   Phaethon lepturus
gb|EFA83237.1|  26S proteasome non-ATPase regulatory subunit 6        88.6    1e-17   Heterostelium album PN500
emb|CDQ00191.1|  Protein BM-RPN-7                                     89.0    1e-17   Brugia malayi [agent of lymphatic filariasis]
ref|XP_006010999.1|  PREDICTED: 26S proteasome non-ATPase regulat...  88.6    1e-17   Latimeria chalumnae
ref|XP_005053297.1|  PREDICTED: 26S proteasome non-ATPase regulat...  88.6    1e-17   Ficedula albicollis
gb|ERL91028.1|  hypothetical protein D910_08370                       89.4    1e-17   Dendroctonus ponderosae
ref|XP_320986.2|  AGAP002061-PA                                       88.6    1e-17   Anopheles gambiae str. PEST
ref|XP_005731273.1|  PREDICTED: 26S proteasome non-ATPase regulat...  88.2    1e-17   
ref|XP_005632410.1|  PREDICTED: 26S proteasome non-ATPase regulat...  89.4    1e-17   
ref|XP_010295294.1|  PREDICTED: 26S proteasome non-ATPase regulat...  88.6    1e-17   Phaethon lepturus
gb|KFQ69124.1|  26S proteasome non-ATPase regulatory subunit 6        88.6    2e-17   Phaethon lepturus
ref|XP_011344883.1|  PREDICTED: 26S proteasome non-ATPase regulat...  88.6    2e-17   Ooceraea biroi
ref|XP_005053299.1|  PREDICTED: 26S proteasome non-ATPase regulat...  88.6    2e-17   
gb|ENN76580.1|  hypothetical protein YQE_07029                        88.6    2e-17   Dendroctonus ponderosae
gb|KFW82453.1|  26S proteasome non-ATPase regulatory subunit 6        88.2    2e-17   Manacus vitellinus
gb|KFD50017.1|  hypothetical protein M513_09110                       88.2    2e-17   Trichuris suis
ref|XP_010569217.1|  PREDICTED: 26S proteasome non-ATPase regulat...  88.2    2e-17   Haliaeetus leucocephalus
ref|XP_005053298.1|  PREDICTED: 26S proteasome non-ATPase regulat...  87.8    3e-17   Ficedula albicollis
ref|XP_008555127.1|  PREDICTED: 26S proteasome non-ATPase regulat...  87.4    4e-17   Microplitis demolitor
ref|XP_004352009.1|  26S proteasome non-ATPase regulatory subunit 6   87.4    4e-17   Cavenderia fasciculata
ref|XP_007520679.1|  PREDICTED: 26S proteasome non-ATPase regulat...  86.7    5e-17   Erinaceus europaeus [common hedgehog]
ref|XP_005952309.1|  PREDICTED: 26S proteasome non-ATPase regulat...  86.7    5e-17   
ref|XP_001622916.1|  predicted protein                                87.4    5e-17   Nematostella vectensis
ref|XP_005969180.1|  PREDICTED: 26S proteasome non-ATPase regulat...  87.0    5e-17   Pantholops hodgsonii [Tibetan antelope]
ref|XP_011136150.1|  PREDICTED: 26S proteasome non-ATPase regulat...  87.0    5e-17   Harpegnathos saltator
ref|XP_005450356.1|  PREDICTED: 26S proteasome non-ATPase regulat...  86.7    5e-17   
ref|XP_002069766.1|  GK11396                                          87.0    6e-17   Drosophila willistoni
ref|XP_006618260.1|  PREDICTED: 26S proteasome non-ATPase regulat...  87.0    6e-17   Apis dorsata [rock honeybee]
ref|XP_973643.1|  PREDICTED: 26S proteasome non-ATPase regulatory...  87.0    6e-17   Tribolium castaneum [rust-red flour beetle]
ref|XP_001899710.1|  Probable 26S proteasome non-ATPase regulator...  87.4    7e-17   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003696943.1|  PREDICTED: 26S proteasome non-ATPase regulat...  86.7    7e-17   Apis florea [dwarf honeybee]
ref|XP_006630692.1|  PREDICTED: 26S proteasome non-ATPase regulat...  86.3    7e-17   
ref|XP_004091826.1|  PREDICTED: 26S proteasome non-ATPase regulat...  86.3    8e-17   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_002141884.1|  PCI domain-containing protein                    86.7    8e-17   Cryptosporidium muris RN66
ref|XP_003701620.1|  PREDICTED: 26S proteasome non-ATPase regulat...  86.7    8e-17   Megachile rotundata
gb|EFO25800.2|  proteasome Regulatory Particle                        86.7    8e-17   Loa loa
ref|XP_008695472.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...  85.5    8e-17   Ursus maritimus [white bear]
ref|XP_001654173.1|  AAEL010048-PA                                    86.3    9e-17   
ref|XP_007520677.1|  PREDICTED: 26S proteasome non-ATPase regulat...  87.0    1e-16   
ref|XP_004676061.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.5    1e-16   
ref|XP_011502186.1|  PREDICTED: 26S proteasome non-ATPase regulat...  86.3    1e-16   
ref|XP_004530703.1|  PREDICTED: 26S proteasome non-ATPase regulat...  86.3    1e-16   
ref|XP_006751021.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.5    1e-16   
ref|XP_004738358.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.5    1e-16   
ref|XP_004419951.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.5    1e-16   
ref|XP_007946270.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.5    1e-16   
ref|XP_011269632.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.9    2e-16   
ref|XP_007983060.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.5    2e-16   
gb|EPS98950.1|  hypothetical protein FOMPIDRAFT_1125161               84.0    2e-16   
ref|XP_011434053.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.5    2e-16   
gb|EJW81452.1|  26S proteasome non-ATPase regulatory subunit 6        84.3    2e-16   
ref|XP_005969181.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.1    2e-16   
ref|XP_004018395.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.1    2e-16   
ref|XP_005892964.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.1    2e-16   
ref|XP_006069793.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.1    2e-16   
ref|XP_006196616.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.7    2e-16   
emb|CEF64301.1|  Proteasome component (PCI) domain and Winged hel...  85.9    2e-16   
ref|XP_011314534.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.5    2e-16   
ref|XP_004581648.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.7    2e-16   
ref|XP_005969179.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.5    2e-16   
ref|XP_005184260.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.5    2e-16   
ref|XP_001607901.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.1    2e-16   
ref|XP_006178363.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.7    3e-16   
ref|NP_001258710.1|  26S proteasome non-ATPase regulatory subunit...  84.7    3e-16   
ref|NP_001258709.1|  26S proteasome non-ATPase regulatory subunit...  84.7    3e-16   
ref|XP_010295286.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.1    3e-16   
gb|EAW65426.1|  proteasome (prosome, macropain) 26S subunit, non-...  84.7    3e-16   
ref|XP_002058394.1|  GJ14389                                          85.1    3e-16   
ref|XP_009198663.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.7    3e-16   
ref|XP_005265675.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.1    3e-16   
ref|XP_003762398.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.5    3e-16   
ref|XP_004268040.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.3    3e-16   
ref|XP_004461819.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.3    3e-16   
ref|XP_646606.1|  26S proteasome non-ATPase regulatory subunit 6      84.7    4e-16   
gb|ACO12307.1|  26S proteasome non-ATPase regulatory subunit 6        84.7    4e-16   
ref|XP_006862169.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.3    4e-16   
ref|XP_011198598.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.7    4e-16   
ref|XP_011192820.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.7    4e-16   
ref|XP_007445735.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.0    4e-16   
ref|XP_007084426.1|  PREDICTED: 26S proteasome non-ATPase regulat...  85.1    4e-16   
ref|XP_004482518.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.0    5e-16   
emb|CDW55431.1|  26s proteasome non atpase regulatory subunit         84.3    5e-16   
ref|XP_002191027.2|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...  84.3    5e-16   
ref|XP_006893899.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.0    5e-16   
ref|XP_004368718.1|  PREDICTED: 26S proteasome non-ATPase regulat...  83.6    7e-16   
ref|XP_004661332.1|  PREDICTED: 26S proteasome non-ATPase regulat...  83.6    7e-16   
ref|XP_008701336.1|  PREDICTED: 26S proteasome non-ATPase regulat...  83.2    8e-16   
ref|XP_006751022.1|  PREDICTED: 26S proteasome non-ATPase regulat...  83.2    8e-16   
ref|XP_005600552.1|  PREDICTED: 26S proteasome non-ATPase regulat...  83.2    8e-16   
ref|XP_004091825.1|  PREDICTED: 26S proteasome non-ATPase regulat...  84.3    9e-16   
gb|KFQ46598.1|  26S proteasome non-ATPase regulatory subunit 6        83.2    9e-16   
ref|XP_005808510.1|  PREDICTED: 26S proteasome non-ATPase regulat...  83.2    9e-16   
ref|XP_004616521.1|  PREDICTED: 26S proteasome non-ATPase regulat...  83.2    9e-16   
gb|KFO88383.1|  26S proteasome non-ATPase regulatory subunit 6        82.8    1e-15   
gb|ACO12125.1|  26S proteasome non-ATPase regulatory subunit 6        82.4    1e-15   
ref|XP_010716972.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.8    1e-15   
ref|XP_007983061.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.8    1e-15   
ref|XP_011067516.1|  PREDICTED: 26S proteasome non-ATPase regulat...  83.6    1e-15   
ref|XP_008144494.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.8    1e-15   
gb|KFP31606.1|  26S proteasome non-ATPase regulatory subunit 6        82.8    1e-15   
dbj|GAM18098.1|  hypothetical protein SAMD00019534_012730             83.2    1e-15   
ref|XP_004644844.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.8    1e-15   
ref|XP_005695819.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.4    1e-15   
ref|XP_006011000.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.8    1e-15   
ref|XP_004419949.1|  PREDICTED: 26S proteasome non-ATPase regulat...  83.6    1e-15   
ref|XP_005348593.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.4    1e-15   
gb|KFU89157.1|  26S proteasome non-ATPase regulatory subunit 6        82.8    1e-15   
ref|XP_004944718.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.4    1e-15   
ref|XP_005874340.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.4    2e-15   
gb|KFP56379.1|  26S proteasome non-ATPase regulatory subunit 6        82.4    2e-15   
gb|EMC81675.1|  26S proteasome non-ATPase regulatory subunit 6        82.4    2e-15   
ref|XP_004990356.1|  proteasome 26S subunit                           82.8    2e-15   
ref|XP_005409079.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.4    2e-15   
ref|XP_005265676.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.4    2e-15   
gb|KFV14700.1|  26S proteasome non-ATPase regulatory subunit 6        82.4    2e-15   
gb|KFZ64307.1|  26S proteasome non-ATPase regulatory subunit 6        81.6    2e-15   
ref|XP_005420291.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.4    2e-15   
ref|XP_004419948.1|  PREDICTED: 26S proteasome non-ATPase regulat...  83.6    2e-15   
ref|XP_005488473.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.4    2e-15   
ref|XP_001693816.1|  26S proteasome regulatory subunit                82.4    2e-15   
ref|XP_005053300.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.4    2e-15   
ref|XP_005008347.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.4    2e-15   
ref|XP_007101358.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.0    2e-15   
gb|KFO95390.1|  26S proteasome non-ATPase regulatory subunit 6        82.0    2e-15   
ref|XP_008923951.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.0    2e-15   
ref|XP_009198664.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.0    2e-15   
ref|XP_006089099.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.0    2e-15   
gb|KFR12376.1|  26S proteasome non-ATPase regulatory subunit 6        82.0    2e-15   
ref|XP_005053301.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.0    2e-15   
ref|XP_005522071.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.0    2e-15   
ref|XP_005149457.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.0    2e-15   
ref|XP_009468145.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.0    2e-15   
gb|KFQ81555.1|  26S proteasome non-ATPase regulatory subunit 6        82.0    2e-15   
gb|KFW07939.1|  26S proteasome non-ATPase regulatory subunit 6        82.0    2e-15   
gb|KFO77813.1|  26S proteasome non-ATPase regulatory subunit 6        82.0    2e-15   
ref|XP_003096244.1|  CRE-RPN-7 protein                                82.8    2e-15   
ref|XP_002001436.1|  GI10792                                          82.4    2e-15   
ref|XP_005409077.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.8    3e-15   
gb|KFP70030.1|  26S proteasome non-ATPase regulatory subunit 6        81.6    3e-15   
gb|KFP89659.1|  26S proteasome non-ATPase regulatory subunit 6        81.6    3e-15   
gb|KFP36907.1|  26S proteasome non-ATPase regulatory subunit 6        81.6    3e-15   
gb|KFM11011.1|  26S proteasome non-ATPase regulatory subunit 6        81.6    3e-15   
gb|EPY85693.1|  26S proteasome non-ATPase regulatory subunit 6-li...  82.4    3e-15   
ref|XP_009070480.1|  PREDICTED: 26S proteasome non-ATPase regulat...  81.6    3e-15   
ref|XP_008934382.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...  82.0    3e-15   
ref|NP_001258708.1|  26S proteasome non-ATPase regulatory subunit...  82.8    3e-15   
gb|ELR58417.1|  26S proteasome non-ATPase regulatory subunit 6        82.4    3e-15   
gb|KFQ25915.1|  26S proteasome non-ATPase regulatory subunit 6        81.6    3e-15   
ref|XP_003748544.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.0    3e-15   
ref|XP_006779216.1|  PREDICTED: 26S proteasome non-ATPase regulat...  82.4    4e-15   
gb|EPS98953.1|  hypothetical protein FOMPIDRAFT_1125247               82.0    4e-15   
gb|KFP95613.1|  26S proteasome non-ATPase regulatory subunit 6        81.3    4e-15   
ref|XP_005076456.1|  PREDICTED: 26S proteasome non-ATPase regulat...  81.6    4e-15   
ref|XP_008641848.1|  PREDICTED: 26S proteasome non-ATPase regulat...  81.6    4e-15   
gb|KFO54133.1|  26S proteasome non-ATPase regulatory subunit 6        81.3    4e-15   
gb|AAR10117.1|  similar to Drosophila melanogaster Rpn7               79.7    4e-15   
ref|XP_010295309.1|  PREDICTED: 26S proteasome non-ATPase regulat...  81.3    4e-15   
ref|NP_501632.1|  Protein RPN-7                                       82.0    4e-15   
ref|XP_009282660.1|  PREDICTED: 26S proteasome non-ATPase regulat...  81.3    4e-15   
ref|XP_004871662.1|  PREDICTED: 26S proteasome non-ATPase regulat...  81.3    4e-15   
ref|XP_005297915.2|  PREDICTED: 26S proteasome non-ATPase regulat...  81.6    5e-15   
ref|XP_002013573.1|  GL23337                                          81.6    5e-15   
ref|XP_004702470.1|  PREDICTED: 26S proteasome non-ATPase regulat...  80.9    6e-15   
ref|XP_001358718.1|  GA18834                                          81.3    6e-15   
ref|XP_005230095.1|  PREDICTED: 26S proteasome non-ATPase regulat...  81.3    7e-15   
ref|XP_010009012.1|  PREDICTED: 26S proteasome non-ATPase regulat...  80.5    8e-15   
ref|XP_007862980.1|  PCI-domain-containing protein                    80.9    8e-15   
ref|XP_010132218.1|  PREDICTED: 26S proteasome non-ATPase regulat...  80.5    8e-15   
ref|XP_002632951.1|  C. briggsae CBR-RPN-7 protein                    81.3    9e-15   
ref|NP_001089880.1|  uncharacterized protein LOC734947                80.9    9e-15   
gb|EEC73544.1|  hypothetical protein OsI_07953                        76.6    9e-15   
ref|XP_008502478.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.7    1e-14   
ref|XP_005510668.1|  PREDICTED: 26S proteasome non-ATPase regulat...  80.1    1e-14   
gb|EFX76942.1|  hypothetical protein DAPPUDRAFT_305955                80.5    1e-14   
ref|XP_004884565.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.0    1e-14   
ref|XP_009995317.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.7    1e-14   
gb|EPQ12698.1|  26S proteasome non-ATPase regulatory subunit 6        79.7    1e-14   
ref|XP_007361598.1|  PCI-domain-containing protein                    80.5    1e-14   
ref|XP_001993912.1|  GH18475                                          80.5    1e-14   
ref|XP_009579333.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.7    1e-14   
gb|KDQ61274.1|  hypothetical protein JAAARDRAFT_173883                80.1    1e-14   
ref|XP_010152812.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.7    1e-14   
ref|XP_009481930.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.7    2e-14   
ref|XP_010081092.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.7    2e-14   
ref|XP_010604871.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.3    2e-14   
gb|EMP30107.1|  26S proteasome non-ATPase regulatory subunit 6        79.3    2e-14   
ref|XP_007066012.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.3    2e-14   
gb|EGT52847.1|  hypothetical protein CAEBREN_12279                    80.1    2e-14   
ref|XP_009561395.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.3    2e-14   
gb|EGT39282.1|  hypothetical protein CAEBREN_22940                    80.1    2e-14   
gb|KFH64738.1|  26S proteasome regulatory subunit N7                  79.7    2e-14   
emb|CCL98764.1|  predicted protein                                    79.7    2e-14   
ref|XP_010388493.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.0    2e-14   
ref|XP_009327770.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.0    2e-14   
ref|XP_009869156.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.0    2e-14   
ref|XP_008045326.1|  PCI-domain-containing protein                    79.7    2e-14   
ref|XP_005432615.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.0    2e-14   
ref|XP_010123166.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.0    3e-14   
ref|XP_009503964.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...  79.0    3e-14   
gb|EYC30100.1|  hypothetical protein Y032_0005g2451                   80.1    3e-14   
gb|EYC30101.1|  hypothetical protein Y032_0005g2451                   79.7    3e-14   
ref|XP_795620.1|  PREDICTED: 26S proteasome non-ATPase regulatory...  79.3    3e-14   
gb|EYC30102.1|  hypothetical protein Y032_0005g2451                   79.7    3e-14   
ref|XP_011172944.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.3    3e-14   
ref|XP_002032204.1|  GM23647                                          79.3    4e-14   
ref|NP_651048.1|  regulatory particle non-ATPase 7                    79.3    4e-14   
ref|XP_003382982.1|  PREDICTED: 26S proteasome non-ATPase regulat...  79.0    5e-14   
ref|XP_006135142.1|  PREDICTED: 26S proteasome non-ATPase regulat...  78.2    5e-14   
gb|ABG01866.1|  putative accessory gland protein                      78.6    5e-14   
ref|XP_007326323.1|  hypothetical protein AGABI1DRAFT_82126           78.6    6e-14   
ref|XP_002948735.1|  26S proteasome regulatory complex                78.6    6e-14   
gb|KFM81225.1|  26S proteasome non-ATPase regulatory subunit 6        78.6    7e-14   
gb|ABG01862.1|  putative accessory gland protein                      78.2    7e-14   
gb|ABG01865.1|  putative accessory gland protein                      78.2    7e-14   
ref|XP_006457750.1|  hypothetical protein AGABI2DRAFT_63917           78.2    7e-14   
gb|ABG01864.1|  putative accessory gland protein                      77.8    8e-14   
gb|ESA16452.1|  hypothetical protein GLOINDRAFT_156531                78.2    8e-14   
gb|EMD38248.1|  hypothetical protein CERSUDRAFT_113407                78.2    9e-14   
ref|XP_002098292.1|  Rpn7                                             78.2    1e-13   
ref|XP_001982274.1|  GG12513                                          77.8    1e-13   
ref|XP_005106668.1|  PREDICTED: 26S proteasome non-ATPase regulat...  77.8    1e-13   
gb|KIH65300.1|  PCI domain protein                                    78.2    1e-13   
emb|CDJ94711.1|  26S proteasome and Proteasome component region P...  78.6    1e-13   
ref|XP_003096252.1|  hypothetical protein CRE_25761                   77.4    1e-13   
gb|ETN76915.1|  PCI domain protein                                    77.4    2e-13   
gb|KFV08068.1|  26S proteasome non-ATPase regulatory subunit 6        76.6    2e-13   
dbj|GAA48177.1|  26S proteasome regulatory subunit N7                 78.2    2e-13   
ref|XP_003284537.1|  26S proteasome non-ATPase regulatory subunit 6   77.0    2e-13   
gb|EPB83934.1|  26S proteasome regulatory subunit N7                  77.0    3e-13   
ref|XP_002594468.1|  hypothetical protein BRAFLDRAFT_87657            76.6    3e-13   
ref|XP_003138268.1|  proteasome Regulatory Particle                   76.6    4e-13   
ref|XP_002508810.1|  predicted protein                                75.5    5e-13   
gb|KII89170.1|  hypothetical protein PLICRDRAFT_698276                75.9    6e-13   
ref|XP_009049000.1|  hypothetical protein LOTGIDRAFT_200903           75.1    1e-12   
gb|AEB61323.1|  26S proteasome non-ATPase regulatory subunit 6-li...  73.9    1e-12   
gb|AAP06037.1|  similar to GenBank Accession Number AF145308 26S ...  75.1    1e-12   
gb|KJA16829.1|  hypothetical protein HYPSUDRAFT_46964                 74.7    1e-12   
ref|XP_009975446.1|  PREDICTED: 26S proteasome non-ATPase regulat...  74.3    1e-12   
ref|XP_003379796.1|  26S proteasome non-ATPase regulatory subunit 6   75.5    1e-12   
emb|CDO75233.1|  hypothetical protein BN946_scf184895.g13             74.3    2e-12   
gb|ELU15978.1|  hypothetical protein CAPTEDRAFT_152596                74.3    2e-12   
ref|XP_004410907.1|  PREDICTED: 26S proteasome non-ATPase regulat...  73.9    2e-12   
emb|CEP12755.1|  hypothetical protein                                 74.3    2e-12   
gb|EEE67977.1|  hypothetical protein OsJ_25897                        72.8    2e-12   
ref|XP_007385268.1|  proteasome 26S subunit                           73.2    4e-12   
emb|CEI87072.1|  Putative 26S proteasome regulatory subunit N7        72.4    5e-12   
emb|CCD78069.1|  putative 26s proteasome non-ATPase regulatory su...  72.4    1e-11   
emb|CEG73911.1|  Putative 26S proteasome regulatory subunit N7        72.0    1e-11   
dbj|GAN04275.1|  26S proteasome non-ATPase regulatory subunit 6       72.4    1e-11   
ref|XP_626426.1|  proteasome regulatory subunit Rpn7/26S proteaso...  72.0    1e-11   
ref|XP_007855571.1|  26s proteasome non-atpase regulatory subunit 6   72.0    1e-11   
gb|ERG81969.1|  26s proteasome non-atpase regulatory subunit 6        72.0    1e-11   
gb|KFV50511.1|  26S proteasome non-ATPase regulatory subunit 6        70.5    2e-11   
ref|XP_009964911.1|  PREDICTED: 26S proteasome non-ATPase regulat...  70.5    2e-11   
ref|XP_007339507.1|  PCI-domain-containing protein                    71.2    2e-11   
ref|XP_006019661.1|  PREDICTED: 26S proteasome non-ATPase regulat...  70.5    2e-11   
gb|KFW91564.1|  26S proteasome non-ATPase regulatory subunit 6        70.5    3e-11   
gb|KIO04292.1|  hypothetical protein M404DRAFT_143998                 70.9    3e-11   



>emb|CDP15036.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EG Q   LILANK+FLLTHPDVDD++KVRLRDEV+NAVV++DMAPLY+TLIAN VL
Sbjct  1    MENQEGKQQPHLILANKLFLLTHPDVDDIEKVRLRDEVYNAVVSDDMAPLYETLIANGVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            NLDQKVLDSMRAKIDEELK+LDEKIADAEENLGESEVREAHLAKSLF+IRI DK+KALEQ
Sbjct  61   NLDQKVLDSMRAKIDEELKQLDEKIADAEENLGESEVREAHLAKSLFYIRISDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVF+TLQ+GFF M
Sbjct  121  LKVTESKTVAVGQKMDLVFHTLQIGFFYM  149



>ref|XP_009614578.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Nicotiana tomentosiformis]
Length=386

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            M+ EEGTQ  QL+LA+K+FLLTHPDV+DL KVRLR+EV  +VV+NDM PLY+TL+AN VL
Sbjct  1    MDAEEGTQQPQLVLAHKLFLLTHPDVNDLDKVRLREEVLESVVSNDMVPLYETLVANGVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +DQ VLD+MRAKI +ELKKLDEKIADAEENLGESEVREAHLAKSLF+IRIGDK+KALEQ
Sbjct  61   TVDQNVLDAMRAKIADELKKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE KTVAVGQKMDLVFYTLQMGFFD+
Sbjct  121  LKVTEGKTVAVGQKMDLVFYTLQMGFFDL  149



>ref|XP_011083991.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Sesamum indicum]
Length=386

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG Q  QL+LA+ +FLLT  DVDD++KVRLRDEVFN ++ANDMAPLY+TL+AN VL
Sbjct  1    MEGEEGKQQPQLVLAHNLFLLTQNDVDDIEKVRLRDEVFNFILANDMAPLYETLVANKVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            NLDQK LDSMRAKID+ELKKLDEKIADAEENLGESEVREAHLAKSLF+IRIGDK+KALEQ
Sbjct  61   NLDQKALDSMRAKIDDELKKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LK+TESKTVAVGQKMDLVFY LQ+GFF M
Sbjct  121  LKLTESKTVAVGQKMDLVFYMLQIGFFRM  149



>gb|ABK42076.1| 26S proteasome subunit RPN7 [Capsicum annuum]
Length=386

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            M+ EEGTQ  QL+LA+K+F LTHPDV+DL KVRLR+EV  AV++NDM PLY+TL+ N VL
Sbjct  1    MDSEEGTQQPQLVLAHKLFRLTHPDVNDLDKVRLREEVLEAVLSNDMVPLYETLVTNGVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            +LDQKVLDSMRAK  +ELKKLD+KIADAEENLGESEVREAHLAKSLF+IRIGDK+KALEQ
Sbjct  61   SLDQKVLDSMRAKNCDELKKLDDKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDL FYTLQMG FD+
Sbjct  121  LKVTESKTVAVGQKMDLAFYTLQMGLFDL  149



>gb|EYU23158.1| hypothetical protein MIMGU_mgv1a008065mg [Erythranthe guttata]
Length=386

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG Q  QL+LANK+FLLT  DVDD++KVRLRDEVFN ++ NDMAPLY+TL+A+ VL
Sbjct  1    MEGEEGVQQPQLVLANKLFLLTQNDVDDIEKVRLRDEVFNFIITNDMAPLYETLVASKVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            NLDQ  LD+MRAK D+ELKKL+EKIADAEENLGESEVREAHLAKSLF++RIGDK+KALEQ
Sbjct  61   NLDQTALDAMRAKNDDELKKLEEKIADAEENLGESEVREAHLAKSLFYVRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTL +GFF +
Sbjct  121  LKVTESKTVAVGQKMDLVFYTLLIGFFHL  149



>ref|XP_009781733.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Nicotiana sylvestris]
Length=386

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            M+ EEGTQ  QL+LA+K+FLLTH DV+DL KVRLR+EV  +VV+NDM PLY+TL+AN VL
Sbjct  1    MDAEEGTQQPQLVLAHKLFLLTHADVNDLDKVRLREEVLESVVSNDMVPLYETLVANGVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +DQ VLD+MRAKI +ELKKLDEKIADAEENLGESEVREAHLAKSLF+IRIGDK+KALEQ
Sbjct  61   TVDQNVLDAMRAKIADELKKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE KTVAVGQKMDLVFYTLQMGFFD+
Sbjct  121  LKVTEGKTVAVGQKMDLVFYTLQMGFFDL  149



>ref|XP_007209234.1| hypothetical protein PRUPE_ppa006999mg [Prunus persica]
 gb|EMJ10433.1| hypothetical protein PRUPE_ppa006999mg [Prunus persica]
Length=386

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEG+EG Q   L+LA+K+FLL+HPDV D++KV+LR+EVF +V A+DMAPLY+TL++ SVL
Sbjct  1    MEGQEGPQQPHLVLAHKLFLLSHPDVQDIEKVQLREEVFASVKADDMAPLYETLVSESVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             LDQ VLDSMRAKI +ELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  61   PLDQSVLDSMRAKIQDELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  LKVTESKTVAVGQKMDLVFYTLQLGFFYM  149



>ref|XP_008392851.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Malus domestica]
Length=386

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EGTQ   L+LANK+FLL+H DV D++KV+LRDEVF +V A+DMAPLY+TL++ SVL
Sbjct  1    MEAQEGTQQPHLVLANKLFLLSHSDVPDIEKVQLRDEVFTSVKADDMAPLYETLVSESVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             LDQ V+DSMRAK  EELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  61   ELDQGVMDSMRAKNQEELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVF+TLQ+GFF M
Sbjct  121  LKVTESKTVAVGQKMDLVFHTLQLGFFYM  149



>ref|XP_008239417.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Prunus mume]
Length=386

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEG+EG Q   L+LA+K+FLL+HPDV D++KV+LR+EVF +V A+DMAPLY+TL++ SVL
Sbjct  1    MEGQEGPQQPHLVLAHKLFLLSHPDVQDIEKVQLREEVFASVKADDMAPLYETLVSESVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             LDQ VLDSM AKI +ELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  61   PLDQSVLDSMLAKIQDELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  LKVTESKTVAVGQKMDLVFYTLQLGFFYM  149



>gb|KDP30971.1| hypothetical protein JCGZ_11347 [Jatropha curcas]
Length=386

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEG+EGTQ   L+LA+K FLLTHPDV D++KVRL++EVF AV  +DMAPLY+TL+A  +L
Sbjct  1    MEGQEGTQQPHLVLAHKRFLLTHPDVQDIEKVRLKEEVFAAVKDDDMAPLYETLMAEGIL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            + DQ VLDSMRAK +EELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  61   DKDQSVLDSMRAKNEEELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +KVTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  MKVTESKTVAVGQKMDLVFYTLQLGFFYM  149



>ref|XP_009359483.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Pyrus x bretschneideri]
Length=386

 Score =   210 bits (535),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EGTQ   L+LANK+FLL+H DV D++KV+LRDEVF +V A+DMAPLY+TL++ SVL
Sbjct  1    MEAQEGTQQPHLVLANKLFLLSHSDVPDIEKVQLRDEVFASVKADDMAPLYETLVSESVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             LDQ V+DSMRAK  EELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  61   ELDQGVMDSMRAKNQEELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVF+TLQ+GFF M
Sbjct  121  LKVTESKTVAVGQKMDLVFHTLQLGFFYM  149



>ref|XP_009336533.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Pyrus x bretschneideri]
 ref|XP_009345323.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Pyrus x bretschneideri]
Length=386

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EGTQ   L+LANK+FLL+H DV D++KV+LR+EVF +V  +DMAPLY+TL+A SVL
Sbjct  1    MEAQEGTQQPHLVLANKLFLLSHSDVPDIEKVQLREEVFASVKDDDMAPLYETLVAESVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             LDQ V+DSMRAK  EELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  61   KLDQGVMDSMRAKNQEELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  LKVTESKTVAVGQKMDLVFYTLQLGFFYM  149



>ref|XP_006366835.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Solanum tuberosum]
Length=386

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            M+ EEGTQ  QL+LA+K+FLLTHPDV+DL KVRLR+EV  AVV+NDMAPL++TL++  V 
Sbjct  1    MDSEEGTQQPQLVLAHKLFLLTHPDVNDLDKVRLREEVLEAVVSNDMAPLFETLVSKGVF  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            +L+ +VLD MR K  +ELKKLDEKIADAEENLGESEVREAHLAKSLF+IRIGDK KALEQ
Sbjct  61   SLNLEVLDPMRVKNADELKKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKGKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE KTVAVGQKMDLVFYTLQMG FD+
Sbjct  121  LKVTEKKTVAVGQKMDLVFYTLQMGLFDL  149



>ref|XP_007155515.1| hypothetical protein PHAVU_003G208200g [Phaseolus vulgaris]
 gb|ESW27509.1| hypothetical protein PHAVU_003G208200g [Phaseolus vulgaris]
Length=386

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG+Q  QL+LA+K+FLL  PDV D+ KVR +++VFN V  NDM PLY+TL+A+SVL
Sbjct  1    MEGEEGSQQPQLVLADKLFLLRQPDVQDIDKVRYKEDVFNHVKENDMVPLYETLVADSVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            ++D+ +LDSMRAK +EEL K+DEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALE 
Sbjct  61   DMDRALLDSMRAKTEEELNKIDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEH  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LK+TE+KTVAVGQKMDLVFYTLQ+GFFDM
Sbjct  121  LKITETKTVAVGQKMDLVFYTLQLGFFDM  149



>ref|XP_004291699.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Fragaria vesca subsp. vesca]
Length=386

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEG+E TQ   L LANK+FLL+HPDV D+ KVRLR+EVF AV A+DMAPLY+TL++ SVL
Sbjct  1    MEGQEETQQPHLQLANKLFLLSHPDVQDIDKVRLREEVFAAVKADDMAPLYETLVSESVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +DQ +LD M+ KI EELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  61   EMDQGLLDFMKTKIQEELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  LKVTESKTVAVGQKMDLVFYTLQLGFFYM  149



>ref|XP_004242844.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Solanum lycopersicum]
Length=386

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            M+ EEGTQ  QL+LA+K+FLLTHPDV+DL KVRLR+EV  AVV+NDMAPL++TL++  V 
Sbjct  1    MDSEEGTQQPQLVLAHKLFLLTHPDVNDLDKVRLREEVLEAVVSNDMAPLFETLVSKGVF  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            +L+ +VLD MR K  +ELKKLDEKIADAEENLGESEVREAHLAKSLF+IRIGDK KALEQ
Sbjct  61   SLNLEVLDPMRVKNADELKKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKGKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE KTVAVGQKMDLVFYTLQMG FD+
Sbjct  121  LKVTEKKTVAVGQKMDLVFYTLQMGLFDL  149



>ref|XP_002511249.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus 
communis]
 gb|EEF51851.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus 
communis]
Length=386

 Score =   207 bits (528),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEG+EGTQ   LILA+K FLLTHPDV D++KVRL++EVF AV ++DMAPLY+TLI   +L
Sbjct  1    MEGQEGTQQPHLILAHKRFLLTHPDVQDIEKVRLKEEVFAAVKSDDMAPLYETLITEGLL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
              DQ +LD MRAK ++ELKK+DEKIADAEENLGESEVREAHLAKSLF+IRIGDK+KALEQ
Sbjct  61   EKDQSILDLMRAKNEDELKKIDEKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  LKVTESKTVAVGQKMDLVFYTLQLGFFYM  149



>ref|XP_010250869.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Nelumbo nucifera]
 ref|XP_010250870.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Nelumbo nucifera]
Length=386

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EGTQ  QL+LA+K+FLLTHPDV+D++KVRLR+EV + V ANDMAPLY+TL A+S+L
Sbjct  1    MEAQEGTQQPQLVLAHKLFLLTHPDVEDIEKVRLREEVLSFVKANDMAPLYETLAASSIL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +DQ VL+SMR KIDEELKKLD+KIADAEENLGESEVREAHLAKSLF++RI DK+KALEQ
Sbjct  61   EMDQAVLESMRTKIDEELKKLDDKIADAEENLGESEVREAHLAKSLFYVRISDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LK+TESKTVA+G KMD+VFY+LQMGFF M
Sbjct  121  LKLTESKTVAIGHKMDIVFYSLQMGFFYM  149



>ref|XP_010248825.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Nelumbo nucifera]
Length=386

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EGTQ   L+LA+K+FLLTHPDV+D++KVRLR+EVF+AV A+ MAPLY+TL ANS+L
Sbjct  1    MEAQEGTQQPHLVLAHKLFLLTHPDVEDIEKVRLREEVFSAVKADYMAPLYETLAANSIL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +DQ VL+SMRAKIDEELKK DEKIADAEENLGESEVREAHLAKSLF+IRI DK+KALEQ
Sbjct  61   EMDQAVLESMRAKIDEELKKFDEKIADAEENLGESEVREAHLAKSLFYIRISDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LK+TESKTVA+G KMD+VFY+LQ+GFF M
Sbjct  121  LKLTESKTVAIGHKMDIVFYSLQIGFFYM  149



>ref|XP_010696184.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Beta vulgaris subsp. vulgaris]
Length=386

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EG+Q + LILANKIFLLTHPDV D++KVRL+DEV +++ ++ MA LY+TL AN VL
Sbjct  1    MEAQEGSQNEHLILANKIFLLTHPDVQDIEKVRLKDEVLSSIKSDFMASLYETLAANGVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             LDQ  LDSMR  I+EELKKLDEKIADAEENLGESEVREAHLAKSLF+IRIGDKDKALEQ
Sbjct  61   ELDQSALDSMRKSIEEELKKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKDKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LK+TE+KTVAVGQKMDLVFYTL +G FDM
Sbjct  121  LKLTETKTVAVGQKMDLVFYTLLIGLFDM  149



>ref|XP_008777464.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Phoenix 
dactylifera]
Length=386

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEG+EG+Q   L LA+K+FLL HPDVDD+ KVRLRDEVF+AV+ +DMAPLY++L A SVL
Sbjct  1    MEGQEGSQQPHLALAHKLFLLAHPDVDDIDKVRLRDEVFHAVMDHDMAPLYESLAARSVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D  VLDSMR +I++ELKKLDEKIADAEENLGESEVREAHLAKSL +IRIGDK+KALEQ
Sbjct  61   EMDTGVLDSMRRRIEDELKKLDEKIADAEENLGESEVREAHLAKSLLYIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LK+TE KTVAVGQKMDLVFYTLQ+G F M
Sbjct  121  LKITEGKTVAVGQKMDLVFYTLQLGLFYM  149



>gb|KHN14079.1| Putative 26S proteasome non-ATPase regulatory subunit 6 [Glycine 
soja]
Length=386

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG+Q  QL+LA+K+FLL  PDV D+ KVR +++VF  V  NDM PLY+TL+A+SVL
Sbjct  1    MEGEEGSQQPQLVLADKLFLLRQPDVQDIDKVRYKEDVFTHVKENDMVPLYETLVADSVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            +LD+ +LDSMRAKID+EL KLDEKIADAEENLGESEVREAHLAKSLFFIRI DK+KALE 
Sbjct  61   DLDRALLDSMRAKIDDELTKLDEKIADAEENLGESEVREAHLAKSLFFIRIMDKEKALEH  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE+KTVAVGQKMDLVFYTLQ+GFFDM
Sbjct  121  LKVTETKTVAVGQKMDLVFYTLQLGFFDM  149



>ref|XP_004152512.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
6-like [Cucumis sativus]
 gb|KGN64378.1| hypothetical protein Csa_1G050170 [Cucumis sativus]
Length=386

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEG+EGTQ   L+LA+K+FLLTHPDV D++KVRL +EV  +V A+DM+PLY+TL + S+L
Sbjct  1    MEGQEGTQQPHLVLAHKLFLLTHPDVQDIEKVRLTEEVLASVKADDMSPLYETLTSESLL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             LD+ VL+SMRAK +EELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ
Sbjct  61   ALDRSVLESMRAKNEEELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVG KMDLVF+TLQ+GFF M
Sbjct  121  LKVTESKTVAVGLKMDLVFHTLQLGFFYM  149



>ref|NP_001242671.1| uncharacterized protein LOC100810692 [Glycine max]
 gb|ACU22821.1| unknown [Glycine max]
Length=386

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG+Q  QL+LA+K+FLL  PDV D+ KVR +++VF  V  NDM PLY+TL+A+SVL
Sbjct  1    MEGEEGSQQPQLVLADKLFLLRQPDVQDIDKVRYKEDVFTHVKENDMVPLYETLVADSVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            +LD+ +LDSMRAKID+EL KLDEKIADAEENLGESEVREAHLAKSLFFIRI DK+KALE 
Sbjct  61   DLDRALLDSMRAKIDDELTKLDEKIADAEENLGESEVREAHLAKSLFFIRIMDKEKALEH  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE+KTVAVGQKMDLVFYTLQ+GFFDM
Sbjct  121  LKVTETKTVAVGQKMDLVFYTLQLGFFDM  149



>ref|XP_010555532.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Tarenaya hassleriana]
Length=387

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EGTQ   L+LA+ +FLLTHPDV D++KVRL+DEV +++ A+DMAPLYQTL A+SVL+L
Sbjct  4    GGEGTQQPHLVLAHTLFLLTHPDVQDIEKVRLKDEVLSSIKADDMAPLYQTLAASSVLDL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LDSMRAK +EELKK DEKIADAEENLGESEVREAHLAK+L++IRI DK+KALEQLK
Sbjct  64   DQSLLDSMRAKNEEELKKFDEKIADAEENLGESEVREAHLAKALYYIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVFYTLQ+GFF M
Sbjct  124  VTEGKTVAVGQKMDLVFYTLQIGFFYM  150



>ref|XP_008439357.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Cucumis melo]
 gb|ADN33965.1| 26S proteasome non-ATPase regulatory subunit [Cucumis melo subsp. 
melo]
Length=386

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEG+EGTQ   L+LA+K+FLL HPDV D++KVRL +EV  +V A+DM+PLY+TL  +S+L
Sbjct  1    MEGQEGTQQPHLVLAHKLFLLIHPDVQDIEKVRLTEEVLASVKADDMSPLYETLTGSSLL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            +LD+ VLDSMRAK +EELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKD+ALEQ
Sbjct  61   DLDRSVLDSMRAKNEEELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKDRALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVG KMDLVF+TLQ+GFF M
Sbjct  121  LKVTESKTVAVGLKMDLVFHTLQLGFFYM  149



>ref|XP_002262921.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Vitis 
vinifera]
 emb|CBI14864.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME ++GTQ   L+LA+K+FLLTHPD  D++KVRL++EVF AV  +DMA LY+TL A+SVL
Sbjct  1    MESQDGTQQPHLVLAHKLFLLTHPDAQDIEKVRLKEEVFAAVKVDDMASLYETLAADSVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +DQ VLD+MRAKID+ELKKLDEKIADAEENLGESEVREAHLAKSLF+IRIGDK+KALEQ
Sbjct  61   EMDQAVLDTMRAKIDDELKKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTL +GFF M
Sbjct  121  LKVTESKTVAVGQKMDLVFYTLLLGFFYM  149



>ref|XP_010105183.1| 26S proteasome non-ATPase regulatory subunit 6 [Morus notabilis]
 gb|EXC04029.1| 26S proteasome non-ATPase regulatory subunit 6 [Morus notabilis]
Length=404

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 131/167 (78%), Gaps = 18/167 (11%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EG Q  QL+LA+K+FLL+HPDV D++KVRLR+EVF +V A+DMAPLY+TL+A  +L
Sbjct  1    MEAQEGNQQPQLVLAHKLFLLSHPDVQDIEKVRLREEVFASVKADDMAPLYETLVAEVIL  60

Query  284  NLDQKVLDSMRakide------------------elkkldekiadAEENLGESEVREAHL  409
            +LDQ VLDSMRAKI+E                   +  +   IADAEENLGESEVREAHL
Sbjct  61   DLDQGVLDSMRAKIEEELKKLDEKSVQAKKQINGLVSVVIMGIADAEENLGESEVREAHL  120

Query  410  AKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            AKSLFFIRI DK+KALEQLKVTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  AKSLFFIRIADKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYM  167



>ref|XP_003525624.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Glycine max]
 gb|KHN34383.1| Putative 26S proteasome non-ATPase regulatory subunit 6 [Glycine 
soja]
Length=386

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG+Q  QL+L +K+FLL  PDV D+ KVR +++VF  +  NDM PLY+TL+A+SVL
Sbjct  1    MEGEEGSQQPQLVLGDKLFLLRQPDVQDIDKVRYKEDVFTHINQNDMVPLYETLVADSVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            +LD+ +LDSMRAKI +EL  LDEKIADAEENLGESEVREAHLAKSLFFIRI DK+KALE 
Sbjct  61   DLDRALLDSMRAKIHDELANLDEKIADAEENLGESEVREAHLAKSLFFIRIMDKEKALEH  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE+KTVAVGQKMDLVFYTLQ+GFFDM
Sbjct  121  LKVTETKTVAVGQKMDLVFYTLQLGFFDM  149



>ref|XP_004157764.1| PREDICTED: LOW QUALITY PROTEIN: probable 26S proteasome non-ATPase 
regulatory subunit 6-like [Cucumis sativus]
Length=386

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEG+EGTQ   L+LA+K+FLLTHPDV D++KVRL +EV  +V A+DM+PLY+TL + S+L
Sbjct  1    MEGQEGTQQPHLVLAHKLFLLTHPDVQDIEKVRLTEEVLASVKADDMSPLYETLTSESLL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             LD+ VL+SMRAK +EELKKLDEKIADAEENLGESEVREAHLAKSL FIRIGDKDKALEQ
Sbjct  61   ALDRSVLESMRAKNEEELKKLDEKIADAEENLGESEVREAHLAKSLXFIRIGDKDKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVG KMDLVF+TLQ+GFF M
Sbjct  121  LKVTESKTVAVGLKMDLVFHTLQLGFFYM  149



>gb|KDO69335.1| hypothetical protein CISIN_1g016653mg [Citrus sinensis]
Length=282

 Score =   197 bits (501),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  116  EGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQ  295
            EGTQ   L+LA+K FLLTHPDV D++KV L+ EVF+ V A+DMA  Y+TL+A SVL +DQ
Sbjct  4    EGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQ  63

Query  296  KVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVT  475
             VLDSMR KI++ELKKLD++IADAEENLGESEVREAHLAKSLF+I+IGDK+KALEQLKVT
Sbjct  64   SVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVT  123

Query  476  ESKTVAVGQKMDLVFYTLQMGFFDM  550
            ESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  124  ESKTVAVGQKMDLVFYTLQLGFFYM  148



>ref|XP_010536648.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Tarenaya hassleriana]
Length=387

 Score =   200 bits (508),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EGTQ   L+LA+K+FL TH DV D++KVRL+DEV +++ A+DMAPLY+TL A+SVL+L
Sbjct  4    GGEGTQQPHLVLAHKLFLFTHSDVQDIEKVRLKDEVMSSIKADDMAPLYETLAASSVLDL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LDSMRAK +EELKK DEKIADAEENLGESEVREAHLAK+L++IRI DK+KALEQLK
Sbjct  64   DQGLLDSMRAKNEEELKKFDEKIADAEENLGESEVREAHLAKALYYIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  124  VTESKTVAVGQKMDLVFYTLQIGFFYM  150



>ref|XP_009379942.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Musa acuminata subsp. malaccensis]
Length=386

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME ++GTQ Q + LA+K+FLLTHPDVDD++KVRLRDEV +AV   DMA LY++L   SVL
Sbjct  1    MEAQDGTQQQHIALAHKLFLLTHPDVDDIEKVRLRDEVLDAVKTRDMASLYESLAVASVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D  VLD MR +I++ELK LD+KIADAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  61   EMDTAVLDRMRKRIEDELKTLDDKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LK TE KTVA GQKMDLVFYTLQ+GFF M
Sbjct  121  LKTTEEKTVAAGQKMDLVFYTLQLGFFYM  149



>gb|KHG19496.1| hypothetical protein F383_05500 [Gossypium arboreum]
Length=402

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 135/150 (90%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ ++G Q +QQLIL + +FLL HPDV D++KVRL+DEV N+V +N+MAP Y+TL+A+ V
Sbjct  1    MDAQDGNQQSQQLILGHNVFLLKHPDVPDIEKVRLKDEVLNSVKSNEMAPYYETLVADKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            + LDQ VLD+MRAK +EE+KKLDEKIADAEENLGESEVREAHLAKSL++IRIGDK+KALE
Sbjct  61   VELDQNVLDAMRAKNEEEIKKLDEKIADAEENLGESEVREAHLAKSLYYIRIGDKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLK+TE+KTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  QLKLTETKTVAVGQKMDLVFYTLQIGFFYM  150



>ref|XP_011040415.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Populus euphratica]
Length=386

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EGTQ   L+LA+K+FLLTH DV D++KVRL++EV  A+ ++DM PLY+TL+A S+L
Sbjct  1    MENQEGTQQPHLVLAHKLFLLTHHDVQDIEKVRLKEEVLTAIKSDDMVPLYETLVAESLL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
              DQ +LDSMR K +EEL KLDEKIADAEENLGESEVREAHLAKSLF+IRIGDKDKALEQ
Sbjct  61   ERDQSLLDSMRVKNEEELNKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKDKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE KTVAVGQ+MDLVFYTLQ+ FF M
Sbjct  121  LKVTEGKTVAVGQRMDLVFYTLQLAFFYM  149



>ref|XP_006440041.1| hypothetical protein CICLE_v10020559mg [Citrus clementina]
 gb|ESR53281.1| hypothetical protein CICLE_v10020559mg [Citrus clementina]
Length=385

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  116  EGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQ  295
            EGTQ   L+LA+K FLLTHPDV D++KV L+ EVF+ V A+DMA  Y+TL+A SVL +DQ
Sbjct  4    EGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQ  63

Query  296  KVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVT  475
             VLDSMR KI++ELKKLD+KIADAEENLGESEVREAHLAKSLF+I+IGDK+KALEQLKVT
Sbjct  64   SVLDSMRTKIEDELKKLDDKIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVT  123

Query  476  ESKTVAVGQKMDLVFYTLQMGFFDM  550
            ESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  124  ESKTVAVGQKMDLVFYTLQLGFFYM  148



>gb|EPS62992.1| hypothetical protein M569_11794, partial [Genlisea aurea]
Length=382

 Score =   197 bits (501),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +2

Query  116  EGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQ  295
            EG Q  QL+LA+ +FLL H DV+D+++VRLR+EVFN ++ANDMAPLY+TL+A+ VL LDQ
Sbjct  1    EGKQQPQLVLAHNLFLLKHNDVEDIEQVRLREEVFNFILANDMAPLYETLVASKVLTLDQ  60

Query  296  KVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVT  475
            K LDSMRAKIDE LKKLDEK+ADAEENLGESEVREA LAKSLF I+IGDK+KALEQL++T
Sbjct  61   KALDSMRAKIDEVLKKLDEKVADAEENLGESEVREAQLAKSLFLIKIGDKEKALEQLRLT  120

Query  476  ESKTVAVGQKMDLVFYTLQMGFFDM  550
            E+KTVAVGQKMDLVF+TLQ+GFFDM
Sbjct  121  ETKTVAVGQKMDLVFHTLQIGFFDM  145



>ref|XP_006476974.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Citrus sinensis]
 gb|KDO69333.1| hypothetical protein CISIN_1g016653mg [Citrus sinensis]
Length=385

 Score =   197 bits (501),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  116  EGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQ  295
            EGTQ   L+LA+K FLLTHPDV D++KV L+ EVF+ V A+DMA  Y+TL+A SVL +DQ
Sbjct  4    EGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQ  63

Query  296  KVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVT  475
             VLDSMR KI++ELKKLD++IADAEENLGESEVREAHLAKSLF+I+IGDK+KALEQLKVT
Sbjct  64   SVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVT  123

Query  476  ESKTVAVGQKMDLVFYTLQMGFFDM  550
            ESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  124  ESKTVAVGQKMDLVFYTLQLGFFYM  148



>ref|XP_002318111.2| putative proteasome regulatory subunit family protein [Populus 
trichocarpa]
 gb|EEE96331.2| putative proteasome regulatory subunit family protein [Populus 
trichocarpa]
Length=386

 Score =   197 bits (501),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EGTQ   L LA+K+FLLTH DV D++KVRL++EV  A+ ++DM PLY+TL+A S+L
Sbjct  1    MENQEGTQQPHLALAHKLFLLTHHDVQDIEKVRLKEEVLTAIKSDDMVPLYETLVAESLL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
              DQ +LDS+RAK ++EL KLDEKIADAEENLGESEVREAHLAKSLF+IRIGDKDKALEQ
Sbjct  61   EKDQSLLDSVRAKNEDELNKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKDKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE KTVAVGQ+MDLVFYTLQ+GFF M
Sbjct  121  LKVTEGKTVAVGQRMDLVFYTLQLGFFCM  149



>ref|XP_004515835.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
6-like isoform X2 [Cicer arietinum]
Length=385

 Score =   197 bits (501),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEE +Q  QLILA+K+FLL  PDV D+ KVR +++VF+ V  +DM PLY+TL+A+SVL
Sbjct  1    MEGEE-SQQPQLILADKLFLLKQPDVQDIDKVRFKEDVFSFVKEHDMVPLYETLVADSVL  59

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            + D+ +LDSMRAKID+ELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALE 
Sbjct  60   DTDRALLDSMRAKIDDELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEH  119

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE+KTVAVGQKMDLVFYTLQ+GFFDM
Sbjct  120  LKVTETKTVAVGQKMDLVFYTLQLGFFDM  148



>ref|XP_004515834.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
6-like isoform X1 [Cicer arietinum]
Length=405

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEE +Q  QLILA+K+FLL  PDV D+ KVR +++VF+ V  +DM PLY+TL+A+SVL
Sbjct  1    MEGEE-SQQPQLILADKLFLLKQPDVQDIDKVRFKEDVFSFVKEHDMVPLYETLVADSVL  59

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            + D+ +LDSMRAKID+ELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALE 
Sbjct  60   DTDRALLDSMRAKIDDELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEH  119

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE+KTVAVGQKMDLVFYTLQ+GFFDM
Sbjct  120  LKVTETKTVAVGQKMDLVFYTLQLGFFDM  148



>gb|KCW54339.1| hypothetical protein EUGRSUZ_I00301 [Eucalyptus grandis]
Length=392

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG+Q   L LA+++FLL HP V D++KVRL+DEV  ++ ++DMA LY+TL A S+L
Sbjct  60   MEGEEGSQQPHLALAHRLFLLKHPSVPDIEKVRLKDEVLASIKSDDMASLYETLAAESLL  119

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D+ +LDSMRA+I+EELKKLDEKI DAEENLGESEVREAHLAKSL+FIRIGD++KALEQ
Sbjct  120  EMDRGLLDSMRARIEEELKKLDEKITDAEENLGESEVREAHLAKSLYFIRIGDQEKALEQ  179

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  180  LKVTESKTVAVGQKMDLVFYTLQLGFFYM  208



>ref|XP_010912891.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Elaeis 
guineensis]
Length=386

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EG+Q   L LA+K+FLL H DVDD+ KVRLRDEVF AV  +DMA LY++L A SVL
Sbjct  1    MEEQEGSQQPHLALAHKLFLLAHHDVDDIDKVRLRDEVFVAVKDHDMASLYESLAARSVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D  VLDSMR KI++ELKKLDEKIADAEENLGESEVREAHLAKSLF+IRIGDK+KALEQ
Sbjct  61   EMDAGVLDSMRRKIEDELKKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE KTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  LKVTEGKTVAVGQKMDLVFYTLQLGFFYM  149



>gb|KCW54340.1| hypothetical protein EUGRSUZ_I00301 [Eucalyptus grandis]
Length=388

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG+Q   L LA+++FLL HP V D++KVRL+DEV  ++ ++DMA LY+TL A S+L
Sbjct  60   MEGEEGSQQPHLALAHRLFLLKHPSVPDIEKVRLKDEVLASIKSDDMASLYETLAAESLL  119

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D+ +LDSMRA+I+EELKKLDEKI DAEENLGESEVREAHLAKSL+FIRIGD++KALEQ
Sbjct  120  EMDRGLLDSMRARIEEELKKLDEKITDAEENLGESEVREAHLAKSLYFIRIGDQEKALEQ  179

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  180  LKVTESKTVAVGQKMDLVFYTLQLGFFYM  208



>ref|XP_011024080.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Populus euphratica]
Length=386

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME E GTQ   L+L++K+FLLTHPDV D++KVRL++EV   + ++DM PLY+TL+A S+L
Sbjct  1    MENEGGTQQPHLVLSHKLFLLTHPDVQDIEKVRLKEEVLTTIKSDDMVPLYETLVAESLL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
              DQ +LDSMRAK ++ELKKLDEKIADAEENLGESEVREAHLAKSLF+IRIGDK+KALEQ
Sbjct  61   EKDQSLLDSMRAKNEDELKKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE KTVAVGQ+MDLVFYTLQ+ FF M
Sbjct  121  LKVTEGKTVAVGQRMDLVFYTLQLAFFYM  149



>ref|XP_010027752.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Eucalyptus 
grandis]
Length=386

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG+Q   L LA+++FLL HP V D++KVRL+DEV  ++ ++DMA LY+TL A S+L
Sbjct  1    MEGEEGSQQPHLALAHRLFLLKHPSVPDIEKVRLKDEVLASIKSDDMASLYETLAAESLL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D+ +LDSMRA+I+EELKKLDEKI DAEENLGESEVREAHLAKSL+FIRIGD++KALEQ
Sbjct  61   EMDRGLLDSMRARIEEELKKLDEKITDAEENLGESEVREAHLAKSLYFIRIGDQEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  LKVTESKTVAVGQKMDLVFYTLQLGFFYM  149



>ref|XP_009404232.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Musa acuminata subsp. malaccensis]
Length=429

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME ++GTQ   L LA+K+FLL+HPD+DD++KVRLRDEV +AV  +DM+ LY+TL A SVL
Sbjct  44   MEAQQGTQELHLALAHKLFLLSHPDIDDIEKVRLRDEVLDAVKTDDMSSLYETLAAASVL  103

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D  VLDSMR +ID ELKKLD+KIADAEENLGESEVREAHLAKSLF+I+IGDKDKALEQ
Sbjct  104  EMDATVLDSMRRRIDNELKKLDDKIADAEENLGESEVREAHLAKSLFYIQIGDKDKALEQ  163

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LK TE KTVAVGQKMDLVFYTLQ+G F M
Sbjct  164  LKTTEGKTVAVGQKMDLVFYTLQLGLFYM  192



>ref|XP_010037462.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X2 [Eucalyptus grandis]
Length=386

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG+Q   L+LA+K+FLL HPDV D+ +VRL +EV  ++ ++DM  LY+ L+A SVL
Sbjct  1    MEGEEGSQQPHLVLAHKLFLLRHPDVQDIDRVRLEEEVLASIESDDMVALYEALVAESVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D+ +LDSMRA+I EELKKLDEKI DAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  61   EMDRGLLDSMRARIGEELKKLDEKITDAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+ FF M
Sbjct  121  LKVTESKTVAVGQKMDLVFYTLQLAFFYM  149



>gb|KJB19577.1| hypothetical protein B456_003G109300 [Gossypium raimondii]
 gb|KJB19578.1| hypothetical protein B456_003G109300 [Gossypium raimondii]
Length=330

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ ++GTQ +QQLILA+ +FLL HPDV D++KVRL DEV N+V +NDM   Y+TL+ + V
Sbjct  1    MDTQDGTQQSQQLILAHNVFLLKHPDVSDIEKVRLSDEVLNSVQSNDMTSYYETLVTDKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            L LDQ +L+SMRAK +EE+KKLDEKIADAEENLGESEVREAHLAKSL++IRIG+K+KALE
Sbjct  61   LELDQSLLESMRAKNEEEIKKLDEKIADAEENLGESEVREAHLAKSLYYIRIGEKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLKVTESKTVAVGQKMDLVFYTLQ+G F M
Sbjct  121  QLKVTESKTVAVGQKMDLVFYTLQIGLFYM  150



>gb|KCW54338.1| hypothetical protein EUGRSUZ_I00301 [Eucalyptus grandis]
Length=445

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG+Q   L LA+++FLL HP V D++KVRL+DEV  ++ ++DMA LY+TL A S+L
Sbjct  60   MEGEEGSQQPHLALAHRLFLLKHPSVPDIEKVRLKDEVLASIKSDDMASLYETLAAESLL  119

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D+ +LDSMRA+I+EELKKLDEKI DAEENLGESEVREAHLAKSL+FIRIGD++KALEQ
Sbjct  120  EMDRGLLDSMRARIEEELKKLDEKITDAEENLGESEVREAHLAKSLYFIRIGDQEKALEQ  179

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+GFF M
Sbjct  180  LKVTESKTVAVGQKMDLVFYTLQLGFFYM  208



>ref|XP_007037890.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component 
(PCI) domain isoform 2 [Theobroma cacao]
 ref|XP_007037891.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component 
(PCI) domain isoform 2 [Theobroma cacao]
 gb|EOY22391.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component 
(PCI) domain isoform 2 [Theobroma cacao]
 gb|EOY22392.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component 
(PCI) domain isoform 2 [Theobroma cacao]
Length=330

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ +EGTQ +QQLILA+ +FLL HPDV D++KV L+DEV N+V  NDM P Y+TL+A+ V
Sbjct  1    MDVQEGTQQSQQLILAHNVFLLKHPDVPDIEKVSLKDEVLNSVKPNDMTPYYETLVADKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            + LDQ VLD MR+K  +E+KK+DEKIADAEENLGESEVREAHLAKSL++I+IG+K+KALE
Sbjct  61   VELDQSVLDLMRSKNVDEIKKIDEKIADAEENLGESEVREAHLAKSLYYIQIGEKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLKVTESKTVAVGQKMDLVF TLQ+GFF M
Sbjct  121  QLKVTESKTVAVGQKMDLVFCTLQIGFFYM  150



>gb|KFK29021.1| hypothetical protein AALP_AA7G078400 [Arabis alpina]
Length=387

 Score =   195 bits (495),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   L+LANK+FLLTHPDV D++KVRL+ EV +++ ++ MAPLY+TL A+SVL+L
Sbjct  4    GAEGSQQPHLVLANKLFLLTHPDVQDIEKVRLKSEVLDSIKSDGMAPLYETLAASSVLDL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D+ +LDSMRA  DEELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK
Sbjct  64   DKSLLDSMRANNDEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>gb|KJB38749.1| hypothetical protein B456_006G270400 [Gossypium raimondii]
Length=387

 Score =   195 bits (495),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ ++G Q +QQLIL + +FLL HPDV D++KVRL+DEV  +V +N+MAP Y+TL A+ V
Sbjct  1    MDAQDGNQQSQQLILGHNVFLLKHPDVPDIEKVRLKDEVLISVKSNEMAPYYETLAADKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            + LDQ VLDSMRAK +EE+KKLDEKIADAEENLGESEVREAHLAKSL++IRIGDK+KALE
Sbjct  61   VELDQDVLDSMRAKNEEEIKKLDEKIADAEENLGESEVREAHLAKSLYYIRIGDKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLK+TE+KTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  QLKLTETKTVAVGQKMDLVFYTLQIGFFYM  150



>ref|XP_010037459.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010037460.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010037461.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X1 [Eucalyptus grandis]
Length=423

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG+Q   L+LA+K+FLL HPDV D+ +VRL +EV  ++ ++DM  LY+ L+A SVL
Sbjct  1    MEGEEGSQQPHLVLAHKLFLLRHPDVQDIDRVRLEEEVLASIESDDMVALYEALVAESVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D+ +LDSMRA+I EELKKLDEKI DAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  61   EMDRGLLDSMRARIGEELKKLDEKITDAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+ FF M
Sbjct  121  LKVTESKTVAVGQKMDLVFYTLQLAFFYM  149



>ref|XP_006374553.1| hypothetical protein POPTR_0015s10280g [Populus trichocarpa]
 gb|ERP52350.1| hypothetical protein POPTR_0015s10280g [Populus trichocarpa]
Length=339

 Score =   193 bits (491),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 9/175 (5%)
 Frame = +2

Query  53   LLQRNEEFR---------DQREAKSAMEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRL  205
            L Q N  FR         D +  +  ME +  TQ   L+L++K+FLLTHPDV D++KVRL
Sbjct  40   LSQTNPCFRVKSLETQLTDSQPIQLTMENQGETQQPHLVLSHKLFLLTHPDVQDIEKVRL  99

Query  206  RDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSMRakideelkkldekiadAEENLGE  385
            ++EV   + ++DM PLY+TL+A S+L  DQ +LDSMRAK ++ELKKLDEKIADAEENLGE
Sbjct  100  KEEVLTTIKSDDMVPLYETLVAESLLEKDQSLLDSMRAKNEDELKKLDEKIADAEENLGE  159

Query  386  SEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            SEVREAHLAKSLF+IRIGDK+KALEQLKVTE KTVAVGQ+MDLVFYTLQ+ FF M
Sbjct  160  SEVREAHLAKSLFYIRIGDKEKALEQLKVTEGKTVAVGQRMDLVFYTLQLAFFYM  214



>gb|KJB38750.1| hypothetical protein B456_006G270400 [Gossypium raimondii]
Length=415

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ ++G Q +QQLIL + +FLL HPDV D++KVRL+DEV  +V +N+MAP Y+TL A+ V
Sbjct  1    MDAQDGNQQSQQLILGHNVFLLKHPDVPDIEKVRLKDEVLISVKSNEMAPYYETLAADKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            + LDQ VLDSMRAK +EE+KKLDEKIADAEENLGESEVREAHLAKSL++IRIGDK+KALE
Sbjct  61   VELDQDVLDSMRAKNEEEIKKLDEKIADAEENLGESEVREAHLAKSLYYIRIGDKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLK+TE+KTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  QLKLTETKTVAVGQKMDLVFYTLQIGFFYM  150



>gb|KCW49173.1| hypothetical protein EUGRSUZ_K02756, partial [Eucalyptus grandis]
Length=426

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG+Q   L+LA+K+FLL HPDV D+ +VRL +EV  ++ ++DM  LY+ L+A SVL
Sbjct  41   MEGEEGSQQPHLVLAHKLFLLRHPDVQDIDRVRLEEEVLASIESDDMVALYEALVAESVL  100

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D+ +LDSMRA+I EELKKLDEKI DAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  101  EMDRGLLDSMRARIGEELKKLDEKITDAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  160

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTESKTVAVGQKMDLVFYTLQ+ FF M
Sbjct  161  LKVTESKTVAVGQKMDLVFYTLQLAFFYM  189



>gb|KJB51169.1| hypothetical protein B456_008G204800 [Gossypium raimondii]
 gb|KJB51171.1| hypothetical protein B456_008G204800 [Gossypium raimondii]
Length=330

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ +EGTQ +QQLILA+K+FLL H DV D++KVRL+DEV N V +N M P Y+ L+A+ V
Sbjct  1    MDAQEGTQQSQQLILAHKVFLLKHRDVPDIEKVRLKDEVLNTVKSNYMTPYYENLVADKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            L+LD  VLDSMRAK +EE+KK+DEKIADAEENLGESEVREAHLAK L+FI+IG+K+KALE
Sbjct  61   LDLDHSVLDSMRAKNEEEIKKIDEKIADAEENLGESEVREAHLAKFLYFIQIGEKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLKVTE+KTVAVGQKMDLVFY+LQ+GFF M
Sbjct  121  QLKVTENKTVAVGQKMDLVFYSLQIGFFYM  150



>ref|NP_567709.1| 26S proteasome regulatory subunit Rpn7 [Arabidopsis thaliana]
 ref|NP_974611.1| 26S proteasome regulatory subunit Rpn7 [Arabidopsis thaliana]
 sp|Q93Y35.1|PSMD6_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 6 
homolog; AltName: Full=26S proteasome regulatory subunit RPN7; 
Short=AtRPN7; AltName: Full=26S proteasome regulatory subunit 
S10 homolog [Arabidopsis thaliana]
 gb|AAK96691.1| putative proteasome regulatory subunit [Arabidopsis thaliana]
 gb|AAM13268.1| putative proteasome regulatory subunit [Arabidopsis thaliana]
 gb|AAM65400.1| putative proteasome regulatory subunit [Arabidopsis thaliana]
 gb|AAN31800.1| putative proteasome regulatory subunit [Arabidopsis thaliana]
 gb|AAP86665.1| 26S proteasome subunit RPN7 [Arabidopsis thaliana]
 gb|AEE84966.1| 26S proteasome regulatory subunit Rpn7 [Arabidopsis thaliana]
 gb|AEE84967.1| 26S proteasome regulatory subunit Rpn7 [Arabidopsis thaliana]
Length=387

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   LILANK+FLLTHPDV D++KV+L+ EV + + ++ MAPLY+TLIA+SVL+L
Sbjct  4    GAEGSQQPHLILANKLFLLTHPDVPDIEKVQLKSEVLDFIRSHGMAPLYETLIASSVLDL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +L+SMRA  +EELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK
Sbjct  64   DQSLLESMRAANEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMD+VFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDVVFYTLQLAFFYM  150



>ref|XP_007037889.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component 
(PCI) domain isoform 1 [Theobroma cacao]
 gb|EOY22390.1| 26S proteasome, regulatory subunit Rpn7,Proteasome component 
(PCI) domain isoform 1 [Theobroma cacao]
Length=387

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ +EGTQ +QQLILA+ +FLL HPDV D++KV L+DEV N+V  NDM P Y+TL+A+ V
Sbjct  1    MDVQEGTQQSQQLILAHNVFLLKHPDVPDIEKVSLKDEVLNSVKPNDMTPYYETLVADKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            + LDQ VLD MR+K  +E+KK+DEKIADAEENLGESEVREAHLAKSL++I+IG+K+KALE
Sbjct  61   VELDQSVLDLMRSKNVDEIKKIDEKIADAEENLGESEVREAHLAKSLYYIQIGEKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLKVTESKTVAVGQKMDLVF TLQ+GFF M
Sbjct  121  QLKVTESKTVAVGQKMDLVFCTLQIGFFYM  150



>gb|KJB19576.1| hypothetical protein B456_003G109300 [Gossypium raimondii]
Length=387

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ ++GTQ +QQLILA+ +FLL HPDV D++KVRL DEV N+V +NDM   Y+TL+ + V
Sbjct  1    MDTQDGTQQSQQLILAHNVFLLKHPDVSDIEKVRLSDEVLNSVQSNDMTSYYETLVTDKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            L LDQ +L+SMRAK +EE+KKLDEKIADAEENLGESEVREAHLAKSL++IRIG+K+KALE
Sbjct  61   LELDQSLLESMRAKNEEEIKKLDEKIADAEENLGESEVREAHLAKSLYYIRIGEKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLKVTESKTVAVGQKMDLVFYTLQ+G F M
Sbjct  121  QLKVTESKTVAVGQKMDLVFYTLQIGLFYM  150



>emb|CAB41122.1| putative proteasome regulatory subunit [Arabidopsis thaliana]
 emb|CAB79392.1| putative proteasome regulatory subunit [Arabidopsis thaliana]
Length=406

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   LILANK+FLLTHPDV D++KV+L+ EV + + ++ MAPLY+TLIA+SVL+L
Sbjct  4    GAEGSQQPHLILANKLFLLTHPDVPDIEKVQLKSEVLDFIRSHGMAPLYETLIASSVLDL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +L+SMRA  +EELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK
Sbjct  64   DQSLLESMRAANEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMD+VFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDVVFYTLQLAFFYM  150



>emb|CDX92654.1| BnaC07g39120D [Brassica napus]
Length=387

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EGTQ   L+LA+K+FLLTHPDV D++KV+L+ EV +++ ++ MAPLY+TL A+SVL L
Sbjct  4    GAEGTQQPHLVLAHKLFLLTHPDVQDIEKVQLKSEVLDSIKSDGMAPLYETLAASSVLEL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LDSMRA  +EELKKLD+KIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK
Sbjct  64   DQSLLDSMRANNEEELKKLDDKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>ref|XP_010448512.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Camelina sativa]
Length=387

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   LILANK+FLLTHPDV D++KV L+ EV + + ++ MAPLY+TL A SVL+L
Sbjct  4    GAEGSQQPHLILANKLFLLTHPDVPDIEKVELKSEVVDFIKSDGMAPLYETLAATSVLDL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ  LDSMR   +EELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK
Sbjct  64   DQSFLDSMRTANEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>emb|CDY24849.1| BnaA08g14610D [Brassica napus]
Length=387

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EGTQ   LILA+K+FLLTHPDV D++KV+L+ +V +++ ++ MAPLY+TL A+SVL L
Sbjct  4    GAEGTQQPHLILAHKLFLLTHPDVQDIEKVQLKSDVLDSIKSDGMAPLYETLAASSVLEL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LDSMRA  +EELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK
Sbjct  64   DQSLLDSMRASNEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>emb|CDY08950.1| BnaC08g11800D [Brassica napus]
Length=387

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EGTQ   LILA+K+FLLTHPDV D++KV+L+ +V +++ ++ MAPLY+TL A+SVL L
Sbjct  4    GAEGTQQPHLILAHKLFLLTHPDVQDIEKVQLKSDVLSSIKSDGMAPLYETLAASSVLEL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LDSMRA  +EELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK
Sbjct  64   DQSLLDSMRASNEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>gb|KJB51168.1| hypothetical protein B456_008G204800 [Gossypium raimondii]
Length=377

 Score =   192 bits (487),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ +EGTQ +QQLILA+K+FLL H DV D++KVRL+DEV N V +N M P Y+ L+A+ V
Sbjct  1    MDAQEGTQQSQQLILAHKVFLLKHRDVPDIEKVRLKDEVLNTVKSNYMTPYYENLVADKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            L+LD  VLDSMRAK +EE+KK+DEKIADAEENLGESEVREAHLAK L+FI+IG+K+KALE
Sbjct  61   LDLDHSVLDSMRAKNEEEIKKIDEKIADAEENLGESEVREAHLAKFLYFIQIGEKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLKVTE+KTVAVGQKMDLVFY+LQ+GFF M
Sbjct  121  QLKVTENKTVAVGQKMDLVFYSLQIGFFYM  150



>ref|XP_010438962.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Camelina sativa]
Length=387

 Score =   192 bits (488),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   LILANK+FLLTHPDV D++KV+L+ EV + + ++ MAPLY+TL A SVL+L
Sbjct  4    GAEGSQQPHLILANKLFLLTHPDVPDIEKVQLKSEVLDYIKSDGMAPLYETLAATSVLDL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LD MR   +EELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK
Sbjct  64   DQSLLDIMRTANEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>emb|CDY03414.1| BnaC01g16680D [Brassica napus]
Length=387

 Score =   192 bits (487),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   LILA+K+FLLTHPDV D++KV+L+ EV +++ ++ MAPLY+TL A+SVL L
Sbjct  4    GAEGSQQPHLILAHKLFLLTHPDVQDIEKVQLKSEVLDSIKSDGMAPLYETLTASSVLEL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LDSMRA  +EELKKLDEKIADAEENLGESEVREAHLAK+L+F+RI DK+KALEQLK
Sbjct  64   DQSLLDSMRANNEEELKKLDEKIADAEENLGESEVREAHLAKALYFVRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>ref|XP_009137476.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Brassica rapa]
 emb|CDY11036.1| BnaA03g46950D [Brassica napus]
Length=387

 Score =   192 bits (487),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EGTQ   LILA+K+FLLTHPDV D++KV+L+ +V +++ ++ MAPLY+TL A+SVL L
Sbjct  4    GAEGTQQPHLILAHKLFLLTHPDVQDIEKVQLKSDVLDSIKSDGMAPLYETLAASSVLEL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LDSMRA  +EELKKLD+KIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK
Sbjct  64   DQSLLDSMRANNEEELKKLDDKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>gb|KJB51167.1| hypothetical protein B456_008G204800 [Gossypium raimondii]
Length=387

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ +EGTQ +QQLILA+K+FLL H DV D++KVRL+DEV N V +N M P Y+ L+A+ V
Sbjct  1    MDAQEGTQQSQQLILAHKVFLLKHRDVPDIEKVRLKDEVLNTVKSNYMTPYYENLVADKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            L+LD  VLDSMRAK +EE+KK+DEKIADAEENLGESEVREAHLAK L+FI+IG+K+KALE
Sbjct  61   LDLDHSVLDSMRAKNEEEIKKIDEKIADAEENLGESEVREAHLAKFLYFIQIGEKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLKVTE+KTVAVGQKMDLVFY+LQ+GFF M
Sbjct  121  QLKVTENKTVAVGQKMDLVFYSLQIGFFYM  150



>ref|XP_002321676.2| hypothetical protein POPTR_0015s10280g [Populus trichocarpa]
 gb|EEF05803.2| hypothetical protein POPTR_0015s10280g [Populus trichocarpa]
Length=451

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 9/175 (5%)
 Frame = +2

Query  53   LLQRNEEFR---------DQREAKSAMEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRL  205
            L Q N  FR         D +  +  ME +  TQ   L+L++K+FLLTHPDV D++KVRL
Sbjct  40   LSQTNPCFRVKSLETQLTDSQPIQLTMENQGETQQPHLVLSHKLFLLTHPDVQDIEKVRL  99

Query  206  RDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSMRakideelkkldekiadAEENLGE  385
            ++EV   + ++DM PLY+TL+A S+L  DQ +LDSMRAK ++ELKKLDEKIADAEENLGE
Sbjct  100  KEEVLTTIKSDDMVPLYETLVAESLLEKDQSLLDSMRAKNEDELKKLDEKIADAEENLGE  159

Query  386  SEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            SEVREAHLAKSLF+IRIGDK+KALEQLKVTE KTVAVGQ+MDLVFYTLQ+ FF M
Sbjct  160  SEVREAHLAKSLFYIRIGDKEKALEQLKVTEGKTVAVGQRMDLVFYTLQLAFFYM  214



>ref|XP_002867642.1| hypothetical protein ARALYDRAFT_492356 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43901.1| hypothetical protein ARALYDRAFT_492356 [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   LILA+K+FLLTHPDV D++KV+L+ EV + + ++ MAPLY+TL A+SVL+L
Sbjct  4    GAEGSQQPHLILAHKLFLLTHPDVPDIEKVQLKSEVLDFIKSDGMAPLYETLTASSVLDL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LDSMRA  +EELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+KAL+QLK
Sbjct  64   DQSLLDSMRAANEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALQQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>ref|XP_010433719.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Camelina sativa]
Length=387

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   LILANK+FLLTHPDV D++KV+L+ +V + + ++ MAPLY+TL A SVL+L
Sbjct  4    GAEGSQQPHLILANKLFLLTHPDVPDIEKVQLKSDVVDFIKSDAMAPLYETLAATSVLDL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ  LDSMR   +EELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK
Sbjct  64   DQSFLDSMRTANEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>ref|XP_009138580.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Brassica rapa]
 emb|CDY34315.1| BnaA01g14180D [Brassica napus]
Length=387

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   LILA+K+FLLTHPDV D++KV+L+ +V +++ ++ MAPLY+TL A+SVL L
Sbjct  4    GAEGSQQPHLILAHKLFLLTHPDVQDIEKVQLKSDVLDSIKSDGMAPLYETLTASSVLEL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LDSMRA  +EELKKLDEKIADAEENLGESEVREAHLAK+L+F+RI DK+KALEQLK
Sbjct  64   DQSLLDSMRATNEEELKKLDEKIADAEENLGESEVREAHLAKALYFVRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>ref|XP_009109236.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Brassica rapa]
Length=387

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EGTQ   LILA+K+FLLTHPDV D++KV+L+ +V +++ ++ MAPLY+TL A+SVL L
Sbjct  4    GAEGTQQPHLILAHKLFLLTHPDVQDIEKVQLKSDVLDSIKSDGMAPLYETLAASSVLEL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LDSMRA  +EELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+ ALEQLK
Sbjct  64   DQSLLDSMRASNEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKENALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>ref|XP_003608889.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula]
 gb|AES91086.1| 26S proteasome non-ATPase regulatory subunit 6 [Medicago truncatula]
Length=387

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  AMEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            A EGEE  Q  QL+LA+K+FLL   DV D+ KVR +++VFN V  +DM PLY+TL+A+SV
Sbjct  2    ANEGEE-VQQPQLVLADKLFLLKQKDVQDIDKVRFKEDVFNFVKEHDMVPLYETLVADSV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            L++D+ +LDSMRAKID+ELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALE
Sbjct  61   LDMDRALLDSMRAKIDDELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
             LK+TE+KTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  HLKITETKTVAVGQKMDLVFYTLQLGFFGM  150



>gb|AFK38340.1| unknown [Medicago truncatula]
 gb|AFK43043.1| unknown [Medicago truncatula]
Length=387

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  AMEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            A EGEE  Q  QL+LA+K+FLL   DV D+ KVR +++VFN V  +DM PLY+TL+A+SV
Sbjct  2    ANEGEE-VQQPQLVLADKLFLLKQKDVQDIDKVRFKEDVFNFVKEHDMIPLYETLVADSV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            L++D+ +LDSMRAKID+ELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALE
Sbjct  61   LDMDRALLDSMRAKIDDELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
             LK+TE+KTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  HLKITETKTVAVGQKMDLVFYTLQLGFFGM  150



>ref|XP_006413379.1| hypothetical protein EUTSA_v10025431mg [Eutrema salsugineum]
 gb|ESQ54832.1| hypothetical protein EUTSA_v10025431mg [Eutrema salsugineum]
Length=387

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   LILA+K+FLLT PDV D++KV+L+ EV +++ ++ MAPLY+TL A+SVL L
Sbjct  4    GAEGSQQPHLILAHKLFLLTQPDVQDIEKVQLKSEVLDSIKSDGMAPLYETLAASSVLEL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LDSMRA  +EELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK
Sbjct  64   DQSLLDSMRANNEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>emb|CDY08956.1| BnaC08g11860D [Brassica napus]
Length=334

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EGTQ   LILA+K+FLLTHPDV D++KV+L+ +V +++ ++ MAPL++TL A+SVL L
Sbjct  49   GAEGTQQPHLILAHKLFLLTHPDVQDIEKVQLKSDVLDSIESDGMAPLFETLAASSVLEL  108

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQ +LD MRA  +EELKKLDEKI DAEENLGESEVREAHLAK+L+FIRI DK KALEQLK
Sbjct  109  DQSLLDPMRASNEEELKKLDEKIVDAEENLGESEVREAHLAKALYFIRISDKLKALEQLK  168

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  169  LTEGKTVAVGQKMDLVFYTLQLAFFYM  195



>gb|ACJ85273.1| unknown [Medicago truncatula]
Length=387

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  AMEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            A EGEE  Q  QL+LA+K+FLL   DV D+ KVR +++VFN V  +DM PLY+TL+A+SV
Sbjct  2    ANEGEE-VQQPQLVLADKLFLLKQKDVQDIDKVRFKEDVFNFVKEHDMVPLYETLVADSV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            L++++ +LDSMRAKID+ELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDK+KALE
Sbjct  61   LDMNRALLDSMRAKIDDELKKLDEKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
             LK+TE+KTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  HLKITETKTVAVGQKMDLVFYTLQLGFFGM  150



>gb|KJB51170.1| hypothetical protein B456_008G204800 [Gossypium raimondii]
Length=386

 Score =   187 bits (474),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ +EGTQ +QQLILA+K+FLL H DV D++KVRL+DEV N V +N M P Y+ L+A+ V
Sbjct  1    MDAQEGTQQSQQLILAHKVFLLKHRDVPDIEKVRLKDEVLNTVKSNYMTPYYENLVADKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            L+LD  VLDSMRAK +EE+KK+DEKIADAEENLGESEVREAHLAK L+FI+IG+K KALE
Sbjct  61   LDLDHSVLDSMRAKNEEEIKKIDEKIADAEENLGESEVREAHLAKFLYFIQIGEK-KALE  119

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLKVTE+KTVAVGQKMDLVFY+LQ+GFF M
Sbjct  120  QLKVTENKTVAVGQKMDLVFYSLQIGFFYM  149



>gb|KHG00753.1| hypothetical protein F383_21552 [Gossypium arboreum]
Length=387

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 130/150 (87%), Gaps = 1/150 (1%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ +EGTQ +QQL LA+K+FLL H DV D++KV L+DEV N V +NDM P Y+ L+A+ V
Sbjct  1    MDAQEGTQQSQQLSLAHKVFLLKHRDVPDIEKVHLKDEVLNTVKSNDMTPYYENLVADKV  60

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            L+LD   LDSMRAK +EE+KKLDEKIADAEENLGESEVREAHLAK L+FI+IG+K+KALE
Sbjct  61   LDLDHSALDSMRAKNEEEIKKLDEKIADAEENLGESEVREAHLAKFLYFIQIGEKEKALE  120

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLKV+E+KTVAVGQKMDLVFY+LQ+GFF M
Sbjct  121  QLKVSENKTVAVGQKMDLVFYSLQIGFFYM  150



>dbj|BAJ95389.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   185 bits (470),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GEEG Q  QL+LA+K+FLL+ PDVDDL KV LRD+V  AV ++DMA LY++L A+ VL +
Sbjct  5    GEEGKQQPQLVLAHKLFLLSQPDVDDLAKVGLRDDVLAAVKSDDMAALYESLAADGVLEM  64

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MR +I+EE +K DEKIADAEENLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  65   DAALLAEMRGRIEEETRKFDEKIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLK  124

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVFYTLQ+G F M
Sbjct  125  VTEGKTVAVGQKMDLVFYTLQIGLFHM  151



>ref|XP_003525646.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Glycine max]
 gb|KHN34387.1| Putative 26S proteasome non-ATPase regulatory subunit 6 [Glycine 
soja]
Length=384

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 127/146 (87%), Gaps = 1/146 (1%)
 Frame = +2

Query  113  EEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLD  292
            EEG+Q  QL+LA K+FLL  P V D+ KVR +++VF  +  N+M PLY+TL+A+SVL+LD
Sbjct  3    EEGSQQPQLVLAEKLFLLRQP-VQDIDKVRYKEDVFTHIKENEMVPLYETLVADSVLDLD  61

Query  293  QKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKV  472
            + +LD MRAKI++EL KLDEKIADAEENLGESEVREAHLAKSLFFIRI DK+KALE LK+
Sbjct  62   RALLDFMRAKIEDELTKLDEKIADAEENLGESEVREAHLAKSLFFIRIMDKEKALEHLKI  121

Query  473  TESKTVAVGQKMDLVFYTLQMGFFDM  550
            TE+KTVAVGQKMDLVFYTLQ+GFFDM
Sbjct  122  TETKTVAVGQKMDLVFYTLQLGFFDM  147



>gb|ACU19140.1| unknown [Glycine max]
Length=384

 Score =   184 bits (467),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 127/146 (87%), Gaps = 1/146 (1%)
 Frame = +2

Query  113  EEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLD  292
            EEG+Q  QL+LA K+FLL  P V D+ KVR +++VF  +  N+M PLY+TL+A+SVL+LD
Sbjct  3    EEGSQQPQLVLAEKLFLLRQP-VQDIDKVRYKEDVFTHIKENEMVPLYETLVADSVLDLD  61

Query  293  QKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKV  472
            + +LD MRAKI++EL KLDEKIADAEENLGESEVREAHLAKSLFFIRI DK+KALE LK+
Sbjct  62   RALLDFMRAKIEDELTKLDEKIADAEENLGESEVREAHLAKSLFFIRIMDKEKALEHLKI  121

Query  473  TESKTVAVGQKMDLVFYTLQMGFFDM  550
            TE+KTVAVGQKMDLVFYTLQ+GFFDM
Sbjct  122  TETKTVAVGQKMDLVFYTLQLGFFDM  147



>gb|EMT15242.1| hypothetical protein F775_31879 [Aegilops tauschii]
Length=388

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GEEG Q  QL+LA+K+FLL+ PDVDDL KV LRD+V  AV ++DMA LY++L  + VL +
Sbjct  5    GEEGNQQPQLVLAHKLFLLSQPDVDDLAKVGLRDDVLAAVKSDDMAALYESLATDGVLEM  64

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MR +I+EE KKLDEKI DAEENLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  65   DAALLAEMRGRIEEETKKLDEKITDAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLK  124

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVFYTLQ+G F M
Sbjct  125  VTEGKTVAVGQKMDLVFYTLQIGLFHM  151



>gb|ABK23809.1| unknown [Picea sitchensis]
Length=386

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            M+ +EGTQ  +LILA+KIFLL HPDV D++K+ L++EVFN + A DMA LY++L      
Sbjct  1    MDPQEGTQEPKLILAHKIFLLRHPDVPDIEKIELKNEVFNLIKAEDMANLYESLCGELGW  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
            ++DQ +L +MRAKI+EELKKLDEK++DAEENLGESEVREAHLAKSL++IRIGDK+KALEQ
Sbjct  61   DIDQDLLQTMRAKIEEELKKLDEKVSDAEENLGESEVREAHLAKSLYYIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +K+TE KTVAVGQKMDLVF+TLQ+GFF M
Sbjct  121  IKITEGKTVAVGQKMDLVFHTLQLGFFFM  149



>ref|XP_009413439.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Musa 
acuminata subsp. malaccensis]
Length=386

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EG Q   L+LA+K+FLL+HPDVDD++KVRLRDEV +AV  +DMA L+++L ++SVL
Sbjct  1    MEVQEGAQQPHLVLAHKLFLLSHPDVDDIEKVRLRDEVVDAVKIHDMASLFESLSSSSVL  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D  VLDSMR +I++E+KKLD+KIADAEENLGESEVREAHLAKSLFFIRIGDK+KALEQ
Sbjct  61   GIDAAVLDSMRTRIEDEIKKLDDKIADAEENLGESEVREAHLAKSLFFIRIGDKEKALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LK+TE KTVAVGQKMDLVF+TLQ+GFF M
Sbjct  121  LKITEGKTVAVGQKMDLVFHTLQLGFFYM  149



>gb|AFW72179.1| hypothetical protein ZEAMMB73_868326 [Zea mays]
Length=280

 Score =   179 bits (454),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GEEG Q + L+LA+K+FLL+HP VDDL KV LR EV + V ++DMA L+++L+A  VL  
Sbjct  6    GEEGKQERHLVLAHKLFLLSHPSVDDLSKVALRAEVLDTVKSDDMATLFESLVAAGVLEG  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MR +IDEE++KLDEKIADAEENLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  66   DAALLAEMRGRIDEEIRKLDEKIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLK  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVF+TLQ+GFF M
Sbjct  126  VTEGKTVAVGQKMDLVFHTLQIGFFYM  152



>emb|CAC09486.2| H0811E11.2 [Oryza sativa Indica Group]
 emb|CAH67483.1| H0805A05.13 [Oryza sativa Indica Group]
Length=389

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GEEG Q   L+LA+K+FLL+HPDVDDL KV LR +V  AV ++DMA LY++L A  VL  
Sbjct  6    GEEGKQQPHLVLAHKLFLLSHPDVDDLAKVDLRADVLAAVKSDDMASLYESLGAGGVLET  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MR +I+EE++KLDEKIADAEENLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  66   DAALLAEMRGRIEEEIRKLDEKIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLK  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVF+TLQ+GFF M
Sbjct  126  VTEGKTVAVGQKMDLVFHTLQIGFFYM  152



>tpg|DAA37271.1| TPA: hypothetical protein ZEAMMB73_873701 [Zea mays]
Length=331

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GE+G Q   L+LA+K+FLL+H DVDDL KV LR +VF AV ++DMA LY++L A+ VL  
Sbjct  5    GEDGKQQPHLVLAHKLFLLSHSDVDDLAKVDLRADVFAAVKSDDMAALYESLAADGVLET  64

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MRA+IDEE++KLDEKIADAEENLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  65   DAALLAEMRARIDEEIRKLDEKIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLK  124

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVFYTLQ+G F M
Sbjct  125  VTEGKTVAVGQKMDLVFYTLQIGLFYM  151



>ref|NP_001053129.1| Os04g0485000 [Oryza sativa Japonica Group]
 sp|Q8W425.1|PSMD6_ORYSJ RecName: Full=26S proteasome non-ATPase regulatory subunit 6; 
AltName: Full=26S proteasome regulatory particle non-ATPase 
subunit 7; Short=OsRPN7; AltName: Full=26S proteasome regulatory 
subunit RPN7 [Oryza sativa Japonica Group]
 dbj|BAB78486.1| 26S proteasome regulatory particle non-ATPase subunit7 [Oryza 
sativa Japonica Group]
 emb|CAE03153.2| OSJNBa0081L15.15 [Oryza sativa Japonica Group]
 emb|CAD41392.2| OJ000223_09.5 [Oryza sativa Japonica Group]
 dbj|BAF15043.1| Os04g0485000 [Oryza sativa Japonica Group]
 gb|EAY94597.1| hypothetical protein OsI_16374 [Oryza sativa Indica Group]
 gb|EAZ31143.1| hypothetical protein OsJ_15241 [Oryza sativa Japonica Group]
 dbj|BAG91142.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96601.1| unnamed protein product [Oryza sativa Japonica Group]
Length=389

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GEEG Q   L+LA+K+FLL+HPDVDDL KV LR +V  AV ++DMA LY++L A  VL  
Sbjct  6    GEEGKQQPHLVLAHKLFLLSHPDVDDLAKVDLRADVLAAVKSDDMASLYESLGAGGVLET  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MR +I+EE++KLDEKIADAEENLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  66   DAALLAEMRGRIEEEIRKLDEKIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLK  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVF+TLQ+GFF M
Sbjct  126  VTEGKTVAVGQKMDLVFHTLQIGFFYM  152



>ref|XP_006283902.1| hypothetical protein CARUB_v10005019mg [Capsella rubella]
 gb|EOA16800.1| hypothetical protein CARUB_v10005019mg [Capsella rubella]
Length=387

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   LILA+K+FLLT  DV D++KV+L+ EV + + ++ MAPLY+TL A SVL L
Sbjct  4    GAEGSQQPHLILAHKLFLLTQSDVPDIEKVQLKSEVLDFIKSDSMAPLYETLAATSVLEL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            +Q +LDSMRA  +EELKKLDEKIADAEENLGESEVREAHLAK+L+FIRI DK+ ALEQLK
Sbjct  64   NQSLLDSMRANNEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKENALEQLK  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            +TE KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  124  LTEGKTVAVGQKMDLVFYTLQLAFFYM  150



>ref|XP_004952997.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Setaria italica]
Length=389

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GE+G Q + L+LA+K+FLL+HP VDDL KV LR EV +AV ++DMAPL ++L++  VL  
Sbjct  6    GEDGKQERHLVLAHKLFLLSHPAVDDLSKVALRAEVLDAVKSDDMAPLLESLVSAGVLEP  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MR +IDEE++KLDEKIADAEENLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  66   DAALLAEMRGRIDEEIRKLDEKIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLK  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVF+TLQ+GFF M
Sbjct  126  VTEGKTVAVGQKMDLVFHTLQIGFFYM  152



>gb|AFW72178.1| hypothetical protein ZEAMMB73_868326 [Zea mays]
Length=378

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GEEG Q + L+LA+K+FLL+HP VDDL KV LR EV + V ++DMA L+++L+A  VL  
Sbjct  6    GEEGKQERHLVLAHKLFLLSHPSVDDLSKVALRAEVLDTVKSDDMATLFESLVAAGVLEG  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MR +IDEE++KLDEKIADAEENLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  66   DAALLAEMRGRIDEEIRKLDEKIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLK  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVF+TLQ+GFF M
Sbjct  126  VTEGKTVAVGQKMDLVFHTLQIGFFYM  152



>ref|NP_001148992.1| LOC100282612 [Zea mays]
 gb|ACG33744.1| 26S proteasome non-ATPase regulatory subunit 6 [Zea mays]
 gb|ACG35818.1| 26S proteasome non-ATPase regulatory subunit 6 [Zea mays]
 gb|ACR36173.1| unknown [Zea mays]
 tpg|DAA37272.1| TPA: 26S proteasome non-ATPase regulatory subunit 6 [Zea mays]
Length=388

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GE+G Q   L+LA+K+FLL+H DVDDL KV LR +VF AV ++DMA LY++L A+ VL  
Sbjct  5    GEDGKQQPHLVLAHKLFLLSHSDVDDLAKVDLRADVFAAVKSDDMAALYESLAADGVLET  64

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MRA+IDEE++KLDEKIADAEENLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  65   DAALLAEMRARIDEEIRKLDEKIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLK  124

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVFYTLQ+G F M
Sbjct  125  VTEGKTVAVGQKMDLVFYTLQIGLFYM  151



>ref|NP_001148687.1| 26S proteasome non-ATPase regulatory subunit 6 [Zea mays]
 gb|ACF86154.1| unknown [Zea mays]
 gb|ACG31591.1| 26S proteasome non-ATPase regulatory subunit 6 [Zea mays]
 gb|ACG32537.1| 26S proteasome non-ATPase regulatory subunit 6 [Zea mays]
 gb|AFW72177.1| 26S proteasome non-ATPase regulatory subunit 6 [Zea mays]
Length=389

 Score =   179 bits (454),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GEEG Q + L+LA+K+FLL+HP VDDL KV LR EV + V ++DMA L+++L+A  VL  
Sbjct  6    GEEGKQERHLVLAHKLFLLSHPSVDDLSKVALRAEVLDTVKSDDMATLFESLVAAGVLEG  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MR +IDEE++KLDEKIADAEENLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  66   DAALLAEMRGRIDEEIRKLDEKIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLK  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVF+TLQ+GFF M
Sbjct  126  VTEGKTVAVGQKMDLVFHTLQIGFFYM  152



>ref|XP_004976007.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Setaria italica]
Length=388

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            + GE+G Q   L+LA+K+FLL+H DVDDL KV LR +V  AV ++DMA LY++L  + VL
Sbjct  3    IAGEDGKQQPHLVLAHKLFLLSHHDVDDLAKVDLRADVLAAVKSDDMAALYESLATDGVL  62

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D  +L  MRA+IDEE++K DEKIADAEENLGESEVREAHLAKSL+FIR+G+K+KALEQ
Sbjct  63   EMDAALLAEMRARIDEEIRKFDEKIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQ  122

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE KTVAVGQKMDLVFYTLQ+GFF M
Sbjct  123  LKVTEGKTVAVGQKMDLVFYTLQIGFFYM  151



>ref|XP_002454130.1| hypothetical protein SORBIDRAFT_04g025090 [Sorghum bicolor]
 gb|EES07106.1| hypothetical protein SORBIDRAFT_04g025090 [Sorghum bicolor]
Length=389

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GEEG Q + L+LA+K+FLL+HP VDDL KV LR EV + V ++DMA L+++L+   VL  
Sbjct  6    GEEGKQERHLVLAHKLFLLSHPAVDDLSKVALRAEVLDTVKSDDMATLFESLVTAGVLEA  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MR +IDEE++KLDEKIADAEENLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  66   DAALLAEMRGRIDEEIRKLDEKIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLK  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVF+TLQ+GFF M
Sbjct  126  VTEGKTVAVGQKMDLVFHTLQIGFFYM  152



>ref|XP_006852152.1| hypothetical protein AMTR_s00049p00076930 [Amborella trichopoda]
 gb|ERN13619.1| hypothetical protein AMTR_s00049p00076930 [Amborella trichopoda]
Length=386

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            MEGEEG Q   L+LA+K+FLL H DV D++KVRL++EV  ++VA+DMA LY++L      
Sbjct  1    MEGEEGKQHPHLVLAHKLFLLRHQDVPDIEKVRLKEEVLASLVADDMALLYESLSVELGW  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D  +L +MR+KIDEELKKLDE+IADAEENLGESEVREAHLAKSL +IRI DK++ALEQ
Sbjct  61   EMDHGILATMRSKIDEELKKLDERIADAEENLGESEVREAHLAKSLCYIRISDKERALEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE KTVAVGQKMDLVFYTLQ+GFF M
Sbjct  121  LKVTEGKTVAVGQKMDLVFYTLQLGFFYM  149



>ref|XP_006647462.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Oryza brachyantha]
Length=388

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GE+  Q + L+LA+K+FLL+HPDVDDL KV LR +V +AV ++ MAPL+++L A  VL  
Sbjct  5    GEDAKQERHLVLAHKLFLLSHPDVDDLAKVALRSDVLDAVKSDGMAPLFESLAAAGVLEP  64

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MRA+ID+E++KLDEKIAD EENLGESEVREAHLAKSL+F+R+G+K+KALEQLK
Sbjct  65   DDTLLTEMRARIDDEVRKLDEKIADGEENLGESEVREAHLAKSLYFMRVGEKEKALEQLK  124

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVFYTLQ+G F M
Sbjct  125  VTEGKTVAVGQKMDLVFYTLQIGLFHM  151



>ref|NP_001047343.1| Os02g0600100 [Oryza sativa Japonica Group]
 dbj|BAD22146.1| putative 26S proteasome non-ATPase regulatory subunit 6 (26S 
proteasome regulatory particle non-ATPase subunit 7) (OsRPN7) 
[Oryza sativa Japonica Group]
 dbj|BAF09257.1| Os02g0600100 [Oryza sativa Japonica Group]
Length=388

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GEE  Q + L+LA+K+FLL+HPD+DDL KV LR +  +AV ++ MAPL+++L A  VL  
Sbjct  5    GEEAKQERHLVLAHKLFLLSHPDLDDLAKVALRSDALDAVKSDGMAPLFESLAAAGVLEP  64

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MRA+IDEE++KLDEKIADAEENLGESEVREAHLAKSL+F+R+G+K+KALEQLK
Sbjct  65   DDALLAEMRARIDEEVRKLDEKIADAEENLGESEVREAHLAKSLYFMRVGEKEKALEQLK  124

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVFYTLQ+G F M
Sbjct  125  VTEGKTVAVGQKMDLVFYTLQIGLFHM  151



>ref|XP_003575295.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Brachypodium 
distachyon]
Length=393

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  125  QTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVL  304
            Q + L+LA+K+FLL+HPDVDDL KV LR EV +AV ++DMAPL+++L A  VL  D  ++
Sbjct  15   QEKHLVLAHKLFLLSHPDVDDLSKVALRSEVLSAVKSDDMAPLFESLSAAGVLEPDASLV  74

Query  305  DSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESK  484
              MRA+IDEE++KLDEKIADAEENLGESEVREAHLAKSL+F+R+G+K+KALEQLK+TE K
Sbjct  75   AEMRARIDEEIRKLDEKIADAEENLGESEVREAHLAKSLYFVRVGEKEKALEQLKITEGK  134

Query  485  TVAVGQKMDLVFYTLQMGFFDM  550
            TVA+GQKMDLVFYTLQ+G F M
Sbjct  135  TVAIGQKMDLVFYTLQIGLFYM  156



>ref|XP_006652430.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Oryza brachyantha]
Length=389

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GEEG Q   L+LA+K+FLL+H DVDDL KV LR +V  AV ++DMA LY++L  + VL  
Sbjct  6    GEEGKQQPHLVLAHKLFLLSHQDVDDLAKVDLRADVLAAVKSDDMAALYESLGGSGVLET  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MRA+I+EE++KLDEKIADAE+NLGESEVREAHLAKSL+FIR+G+K+KALEQLK
Sbjct  66   DPALLAEMRARIEEEIRKLDEKIADAEDNLGESEVREAHLAKSLYFIRVGEKEKALEQLK  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVF+TLQ+GFF M
Sbjct  126  VTEGKTVAVGQKMDLVFHTLQIGFFYM  152



>gb|EMT22923.1| hypothetical protein F775_07981 [Aegilops tauschii]
Length=395

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  125  QTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVL  304
            Q + L+LA+K+FLL+HPDVDDL KV LR +V +AV ++DMAPL+++L A  VL  D  +L
Sbjct  17   QEKHLVLAHKLFLLSHPDVDDLSKVDLRSDVLSAVKSDDMAPLFESLAAAGVLEPDAVLL  76

Query  305  DSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESK  484
              MRA+IDEE++KLDEKIADAEENLGESEVREAHLAKSL+F+++G+K+KALEQLKVTE K
Sbjct  77   SEMRARIDEEIRKLDEKIADAEENLGESEVREAHLAKSLYFVKVGEKEKALEQLKVTEGK  136

Query  485  TVAVGQKMDLVFYTLQMGFFDM  550
            TVA+GQKMDLVFYTLQ+G F M
Sbjct  137  TVAIGQKMDLVFYTLQIGLFYM  158



>ref|XP_003580002.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Brachypodium distachyon]
Length=388

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  134  QLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSM  313
             L+LA+K+FLL+HPDVDDL KV LR EV  AV ++DMA LY++L A+ VL +D  +L  M
Sbjct  13   HLVLAHKLFLLSHPDVDDLAKVGLRGEVLAAVKSDDMAALYESLAADGVLEMDAPLLAEM  72

Query  314  RakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVA  493
            R +I+EE +KLDEKIADAEENLGESEVREAHLAKSL+F+R+G+K+KAL QLK+TE KTVA
Sbjct  73   RTRIEEETRKLDEKIADAEENLGESEVREAHLAKSLYFVRVGEKEKALVQLKITEGKTVA  132

Query  494  VGQKMDLVFYTLQMGFFDM  550
            VGQKMDLVFYTLQ+G F M
Sbjct  133  VGQKMDLVFYTLQIGLFHM  151



>gb|KJB19579.1| hypothetical protein B456_003G109300 [Gossypium raimondii]
Length=374

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 124/150 (83%), Gaps = 14/150 (9%)
 Frame = +2

Query  104  MEGEEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSV  280
            M+ ++GTQ +QQLILA+ +FLL HPDV D++KVRL DEV N+V +N             V
Sbjct  1    MDTQDGTQQSQQLILAHNVFLLKHPDVSDIEKVRLSDEVLNSVQSN-------------V  47

Query  281  LNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALE  460
            L LDQ +L+SMRAK +EE+KKLDEKIADAEENLGESEVREAHLAKSL++IRIG+K+KALE
Sbjct  48   LELDQSLLESMRAKNEEEIKKLDEKIADAEENLGESEVREAHLAKSLYYIRIGEKEKALE  107

Query  461  QLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            QLKVTESKTVAVGQKMDLVFYTLQ+G F M
Sbjct  108  QLKVTESKTVAVGQKMDLVFYTLQIGLFYM  137



>gb|EAY86554.1| hypothetical protein OsI_07934 [Oryza sativa Indica Group]
Length=375

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            GEE  Q + L+LA+K+FLL+HPD+DDL KV LR +  +AV ++ MAPL+++L A  VL  
Sbjct  5    GEEAKQERHLVLAHKLFLLSHPDLDDLAKVALRSDALDAVKSDGMAPLFESLAAAGVLEP  64

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  MRA+IDEE++KLDEKI DAEENL E EVRE HL KSL+F+R+G+K+KALEQLK
Sbjct  65   DDALLAEMRARIDEEVRKLDEKIPDAEENLVEIEVREPHLPKSLYFMRLGEKEKALEQLK  124

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
            VTE KTVAVGQKMDLVFYTLQ+G F M
Sbjct  125  VTEGKTVAVGQKMDLVFYTLQIGLFHM  151



>gb|KFK31196.1| hypothetical protein AALP_AA6G080700 [Arabis alpina]
Length=323

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +2

Query  140  ILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSMRa  319
            + AN IFLLT+P V+D+ K+ L+  VF+++  + M PLY+TL A+SVL+LDQ +LDSMR+
Sbjct  4    VFANNIFLLTNPVVEDIDKLGLKSHVFDSIKTHYMTPLYETLTASSVLDLDQNLLDSMRS  63

Query  320  kideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVG  499
              DEELKKLDEKI DAEEN+GESEVR+A+LAK+L+F+RI DK KALEQLK+TE KTVA+G
Sbjct  64   CNDEELKKLDEKIIDAEENVGESEVRQAYLAKALYFVRICDKTKALEQLKLTEGKTVAIG  123

Query  500  QKMDLVFYTLQMGFFDM  550
            QKMDL+FYTLQ+ FF M
Sbjct  124  QKMDLIFYTLQLAFFYM  140



>dbj|BAJ85457.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +2

Query  167  THPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSMRakideelkkl  346
            +HPDVDDL KV +R +V +AV ++DMAPL+++L A  VL  D  +L  MRA+IDEE++KL
Sbjct  31   SHPDVDDLSKVDIRSDVLSAVKSDDMAPLFESLAATGVLEPDAALLAEMRARIDEEIRKL  90

Query  347  dekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYT  526
            DEKIADAEENLGESEVREAHLAKSL+F+++G+K+KALEQLKVTE KTVA+GQKMDLVFYT
Sbjct  91   DEKIADAEENLGESEVREAHLAKSLYFVKVGEKEKALEQLKVTEGKTVAIGQKMDLVFYT  150

Query  527  LQMGFFDM  550
            LQ+G F M
Sbjct  151  LQIGLFYM  158



>ref|XP_001764711.1| predicted protein [Physcomitrella patens]
 gb|EDQ70410.1| predicted protein [Physcomitrella patens]
Length=386

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +E TQ  +L LA K+FLL  PDV+D++K  L++EV   + ++DMA LYQ        
Sbjct  1    MEEKEATQDSKLSLAQKLFLLRSPDVEDIEKASLKEEVLALIKSDDMAGLYQFYCHELGW  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             LDQ  +D+M AK  EELK+LD+KIADAEENLGESEVREA LAK+LF+IRIGDK+ +LEQ
Sbjct  61   ELDQGCVDAMNAKNAEELKRLDDKIADAEENLGESEVREALLAKALFYIRIGDKENSLEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LK+TE+KTVAVGQKMDLVF+TL++GFF +
Sbjct  121  LKITEAKTVAVGQKMDLVFHTLRLGFFHL  149



>ref|XP_001763001.1| predicted protein [Physcomitrella patens]
 gb|EDQ72206.1| predicted protein [Physcomitrella patens]
Length=386

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME    TQ  +L+LA+K+FLL   DV+D++K  L+DEV   + +++MA LYQ+       
Sbjct  1    MEERVATQDPKLVLAHKLFLLRSSDVEDIEKASLKDEVMTIIKSDNMAGLYQSCSQELGW  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             LDQ +LDS+ +    ELK LD+KIADAEENLGESEVREA LAK+LF+IRIGDK+ +LEQ
Sbjct  61   ELDQTLLDSINSSNANELKTLDDKIADAEENLGESEVREALLAKALFYIRIGDKENSLEQ  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LKVTE+KTVAVGQKMDLVF+TL++GFF +
Sbjct  121  LKVTEAKTVAVGQKMDLVFHTLRLGFFHL  149



>gb|KJB38751.1| hypothetical protein B456_006G270400 [Gossypium raimondii]
Length=347

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  224  AVVANDMAPLYQTLIANSVLNLDQKVLDSMRakideelkkldekiadAEENLGESEVREA  403
            AVV  +MAP Y+TL A+ V+ LDQ VLDSMRAK +EE+KKLDEKIADAEENLGESEVREA
Sbjct  2    AVVVVEMAPYYETLAADKVVELDQDVLDSMRAKNEEEIKKLDEKIADAEENLGESEVREA  61

Query  404  HLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            HLAKSL++IRIGDK+KALEQLK+TE+KTVAVGQKMDLVFYTLQ+GFF M
Sbjct  62   HLAKSLYYIRIGDKEKALEQLKLTETKTVAVGQKMDLVFYTLQIGFFYM  110



>emb|CDY34374.1| BnaA09g11160D [Brassica napus]
Length=124

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +2

Query  110  GEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            G EG+Q   LILANK+FLLTHPDV D++KV+L+ +V +++ ++ MAPLY+TL A+SVL L
Sbjct  4    GAEGSQQPHLILANKLFLLTHPDVQDIEKVQLKSDVLDSIKSDGMAPLYETLAASSVLEL  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDK  445
            DQ +LDSMRA  +EELKKLDEKIADAEENLG SEVREA LAK+L+FIRI DK
Sbjct  64   DQSLLDSMRASNEEELKKLDEKIADAEENLGGSEVREALLAKALYFIRISDK  115



>ref|XP_002968847.1| hypothetical protein SELMODRAFT_146093 [Selaginella moellendorffii]
 gb|EFJ29963.1| hypothetical protein SELMODRAFT_146093 [Selaginella moellendorffii]
Length=387

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = +2

Query  113  EEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLD  292
            +E  Q  +L LA K+FLL+ P++ D++KV+L+++V  A   +DMA  Y+         +D
Sbjct  5    KEACQDPRLELARKLFLLSAPEIPDIEKVQLKEDVIAAAREDDMAGPYEGWCHKFGWEID  64

Query  293  QKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKV  472
              +L  MRAKIDEE++KLDEKIADAEENLGESEVR+A LAK+LFFIRIG+K+  LEQLK+
Sbjct  65   HALLAKMRAKIDEEVRKLDEKIADAEENLGESEVRDALLAKALFFIRIGEKELTLEQLKI  124

Query  473  TESKTVAVGQKMDLVFYTLQMGFF  544
            TE+KTVAVG KMDLVF+TL++ FF
Sbjct  125  TEAKTVAVGHKMDLVFHTLRLAFF  148



>ref|XP_002974125.1| hypothetical protein SELMODRAFT_267709 [Selaginella moellendorffii]
 gb|EFJ25080.1| hypothetical protein SELMODRAFT_267709 [Selaginella moellendorffii]
Length=387

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = +2

Query  113  EEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLD  292
            +E  Q  +L LA K+FLL+ P++ D++KV+L+++V  A   +DMA  Y+         +D
Sbjct  5    KEACQDPRLELARKLFLLSAPEIPDIEKVQLKEDVIAAAREDDMAGPYEGWCHKFGWEID  64

Query  293  QKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKV  472
              +L  MRAKIDEE++KLDEKIADAEENLGESEVR+A LAK+LFFIRIG+K+  LEQLK+
Sbjct  65   HALLAKMRAKIDEEVRKLDEKIADAEENLGESEVRDALLAKALFFIRIGEKELTLEQLKI  124

Query  473  TESKTVAVGQKMDLVFYTLQMGFF  544
            TE+KTVAVG KMDLVF+TL++ FF
Sbjct  125  TEAKTVAVGHKMDLVFHTLRLAFF  148



>gb|KDO69334.1| hypothetical protein CISIN_1g016653mg [Citrus sinensis]
Length=340

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +2

Query  365  AEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFF  544
            AEENLGESEVREAHLAKSLF+I+IGDK+KALEQLKVTESKTVAVGQKMDLVFYTLQ+GFF
Sbjct  42   AEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFF  101

Query  545  DM  550
             M
Sbjct  102  YM  103



>ref|XP_010037463.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X3 [Eucalyptus grandis]
Length=358

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  365  AEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFF  544
            AEENLGESEVREAHLAKSLFFIRIGDK+KALEQLKVTESKTVAVGQKMDLVFYTLQ+ FF
Sbjct  23   AEENLGESEVREAHLAKSLFFIRIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLAFF  82

Query  545  DM  550
             M
Sbjct  83   YM  84



>ref|XP_008365109.1| PREDICTED: LOW QUALITY PROTEIN: 26S proteasome non-ATPase regulatory 
subunit 6-like, partial [Malus domestica]
Length=318

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  365  AEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFF  544
            AEENLGESEV EAHLAKSLFFIRIGDK+KALEQLKV ES+TVAVGQKMDLVFYTLQ+GFF
Sbjct  19   AEENLGESEVXEAHLAKSLFFIRIGDKEKALEQLKVMESRTVAVGQKMDLVFYTLQLGFF  78

Query  545  DM  550
             M
Sbjct  79   YM  80



>gb|KJB19580.1| hypothetical protein B456_003G109300 [Gossypium raimondii]
Length=310

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  365  AEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFF  544
            AEENLGESEVREAHLAKSL++IRIG+K+KALEQLKVTESKTVAVGQKMDLVFYTLQ+G F
Sbjct  12   AEENLGESEVREAHLAKSLYYIRIGEKEKALEQLKVTESKTVAVGQKMDLVFYTLQIGLF  71

Query  545  DM  550
             M
Sbjct  72   YM  73



>ref|XP_006843781.1| hypothetical protein AMTR_s00007p00246340 [Amborella trichopoda]
 gb|ERN05456.1| hypothetical protein AMTR_s00007p00246340 [Amborella trichopoda]
Length=307

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  365  AEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFF  544
            AEENLGESEVREAHLAKSL +IRI DK++ALEQLKVTE KTVAVGQKMDLVFYTLQ+GFF
Sbjct  9    AEENLGESEVREAHLAKSLCYIRISDKERALEQLKVTEGKTVAVGQKMDLVFYTLQLGFF  68

Query  545  DM  550
             M
Sbjct  69   YM  70



>gb|KEH19349.1| 26S proteasome non-ATPase regulatory subunit 6 [Medicago truncatula]
Length=523

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  365  AEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFF  544
            AEENLGESEV EAHLAKSLFFI IGDK+KALE LK+TE+KTVAVGQKMDLVFYTLQ+GFF
Sbjct  263  AEENLGESEVCEAHLAKSLFFIWIGDKEKALEHLKITETKTVAVGQKMDLVFYTLQLGFF  322

Query  545  DM  550
             M
Sbjct  323  GM  324



>ref|XP_010507951.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Camelina sativa]
Length=331

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  302  LDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTES  481
            +DS+R   +EELKKL+EKIADAEENLGESEVREAHLAK+L+FIRI DK+KALEQLK+TE 
Sbjct  1    MDSIRNANEEELKKLEEKIADAEENLGESEVREAHLAKALYFIRIRDKEKALEQLKLTEG  60

Query  482  KTVAVGQKMDLVFYTLQMGFFDM  550
            KTVAVGQKMDLVFYTLQ+ FF M
Sbjct  61   KTVAVGQKMDLVFYTLQLAFFFM  83



>ref|XP_003636705.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula]
Length=286

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 13/75 (17%)
 Frame = +2

Query  365  AEENLGESEVREAHLAKSLFFIRIGDK-------------DKALEQLKVTESKTVAVGQK  505
            AEENLGESEV EAHLAKSLFFI IGDK             +KALE LK+TE+KTVAVGQK
Sbjct  13   AEENLGESEVCEAHLAKSLFFIWIGDKVCISIIIYFTLLQEKALEHLKITETKTVAVGQK  72

Query  506  MDLVFYTLQMGFFDM  550
            MDLVFYTLQ+GFF M
Sbjct  73   MDLVFYTLQLGFFGM  87



>ref|XP_004368095.1| proteasome (prosome, macropain) 26S subunit, nonATPase, 6, putative 
[Acanthamoeba castellanii str. Neff]
 gb|ELR25340.1| proteasome (prosome, macropain) 26S subunit, nonATPase, 6, putative 
[Acanthamoeba castellanii str. Neff]
Length=397

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 98/138 (71%), Gaps = 2/138 (1%)
 Frame = +2

Query  137  LILANKIFLLTHPD--VDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDS  310
            L LA K FLLT  D  V   +K  ++DE+F AV  ++M P YQ L       +D  ++++
Sbjct  19   LELAQKRFLLTLNDEIVPPEEKQTIKDELFEAVKKDNMLPFYQALCEQFKWKVDTALVET  78

Query  311  MRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTV  490
            M+A+I++++K+L++ IADAEENLGESEVRE  LA++ F+ RIGDK+KA++  + T  KTV
Sbjct  79   MKAEIEKKVKELNDTIADAEENLGESEVREGFLARADFYCRIGDKEKAIQAFRETTEKTV  138

Query  491  AVGQKMDLVFYTLQMGFF  544
             +GQK+D++F  ++MGFF
Sbjct  139  GLGQKLDILFTLIRMGFF  156



>ref|XP_008378194.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Malus domestica]
Length=195

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME +EGTQ   L+LANK+FLL+H DV D++KV+LR+EVF +  A+DMAPLY+TL+A S+L
Sbjct  1    MEAQEGTQQPHLVLANKLFLLSHSDVPDIEKVQLREEVFASXKADDMAPLYETLVAESML  60

Query  284  NLDQKVLDSMR  316
             LDQ V+DSMR
Sbjct  61   ELDQGVMDSMR  71



>ref|NP_989264.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Xenopus 
(Silurana) tropicalis]
 gb|AAH64247.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Xenopus 
(Silurana) tropicalis]
 gb|AAH80335.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Xenopus 
(Silurana) tropicalis]
 emb|CAJ83374.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Xenopus 
(Silurana) tropicalis]
Length=389

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 98/147 (67%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+    ++V LR E+  AV +N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLKFLLSLPE--HRREVPLRSELMEAVTSNNMAPYYEGLCKHLDWTV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LD+++ DAE+NLGESE+R+A +A++ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDDELEDAEKNLGESEIRDAMMARAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|NP_956585.1| 26S proteasome non-ATPase regulatory subunit 6 [Danio rerio]
 gb|AAH49452.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Danio 
rerio]
 gb|AAI53638.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Danio 
rerio]
Length=386

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 6/147 (4%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLTH      Q  +++ E+ +A+  N+MAP Y+TL        
Sbjct  8    EEGLPKNPNLRIAQLKFLLTHR-----QDAQVKSELMDAIKLNNMAPYYETLCKELKWQA  62

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   ++ELK+LD+ + DAE+NLGESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  63   DTDLLSKMKKANEDELKRLDDVLEDAEKNLGESEIRDAMMAKAEYLIRIGDKEGALTAFR  122

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  123  KTYDKTVALGHRLDIVFYLLRIGLFYM  149



>ref|XP_008289658.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Stegastes 
partitus]
Length=389

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q V+++ E+ +A+ AN+MAP Y+ L       L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDVKVKTELMDAIKANNMAPYYEGLCKELKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LD+ + DAE+NLGESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DSDLLSKMKKANEEELKRLDDVLEDAEKNLGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>emb|CAG02059.1| unnamed protein product [Tetraodon nigroviridis]
Length=389

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 97/147 (66%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +A+ AN+MAP Y+ L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKTELMDAIKANNMAPYYECLCKDLNWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D ++L+ M+   +EELK+LD+ + DAE+NLGESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DVELLNRMKKANEEELKRLDDVLEDAEKNLGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_004545341.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Maylandia zebra]
 ref|XP_006784666.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Neolamprologus brichardi]
Length=389

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +A+ AN+MAP Y++L       L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKTELMDAIKANNMAPYYESLCKELKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LD+ + DAE+NLGESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DSDLLSKMKKANEEELKRLDDVLEDAEKNLGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|NP_001088312.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Xenopus 
laevis]
 gb|AAH84351.1| LOC495148 protein [Xenopus laevis]
Length=389

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 97/147 (66%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+    + V LR E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLKFLLSLPE--HRRDVPLRTELMEAVTVNNMAPYYEGLCKHLDWTV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D ++L+ M+   +EELK+LD+++ DAE+NLGESE+R+A +A++ +  RIG+KD AL   +
Sbjct  66   DTELLNKMKKANEEELKRLDDQLEDAEKNLGESEIRDAMMARAEYLCRIGNKDGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_005731272.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X1 [Pundamilia nyererei]
Length=389

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +A+ AN+MAP Y++L       L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKTELMDAIKANNMAPYYESLCKELKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LD+ + DAE+NLGESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DSDLLSKMKEANEEELKRLDDVLEDAEKNLGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_005632411.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X3 [Canis lupus familiaris]
Length=362

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+      VR  DE+  A   N+MAP Y+ L  +    L
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPEPRGDAPVR--DELMAAFRDNNMAPYYEALCKSLDWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ MR   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  R+GDKD AL   +
Sbjct  66   DTDLLNKMRKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRVGDKDGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>tpg|DAA34367.1| TPA_inf: 26S proteasome subunit RPN7 [Amblyomma variegatum]
Length=222

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 90/142 (63%), Gaps = 7/142 (5%)
 Frame = +2

Query  125  QTQQLILANKIFLLTH--PDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQK  298
            +   L LA   F+L H  P  D     +L+ ++ +A+  ++MAP Y+   A     LDQ+
Sbjct  13   KNPNLELAQIKFVLAHHEPKND-----KLKQDLMSAITEHNMAPFYEETCAELGWTLDQR  67

Query  299  VLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTE  478
            +L++M+     E+ +LD  I DAE+NL E EVREAHLAK+ +  RIGDK+ AL QL+ T 
Sbjct  68   LLNNMKTANTAEIARLDSAIEDAEKNLSEMEVREAHLAKAEYLSRIGDKEAALTQLRKTY  127

Query  479  SKTVAVGQKMDLVFYTLQMGFF  544
             KTV++G ++DL+F+ +++G F
Sbjct  128  DKTVSLGHRLDLLFHLIRLGLF  149



>ref|XP_541816.2| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoformX1 
[Canis lupus familiaris]
Length=389

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+      VR  DE+  A   N+MAP Y+ L  +    L
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPEPRGDAPVR--DELMAAFRDNNMAPYYEALCKSLDWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ MR   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  R+GDKD AL   +
Sbjct  66   DTDLLNKMRKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRVGDKDGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_010735678.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Larimichthys crocea]
Length=389

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +A+ AN+MAP Y+ L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKSELMDAIRANNMAPYYEGLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LD+ + DAE+NLGESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DGDLLSKMKKANEEELKRLDDVLEDAEKNLGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>emb|CBN81090.1| 26S proteasome non-ATPase regulatory subunit 6 [Dicentrarchus 
labrax]
Length=389

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +A+ AN+MAP Y+ L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKTELMDAIKANNMAPYYEGLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LD+ + DAE+NLGESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DGDLLSKMKKANEEELKRLDDVLEDAEKNLGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_007520678.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X2 [Erinaceus europaeus]
Length=389

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRENNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDKD AL   +
Sbjct  66   DSDLLHKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKDGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|NP_001080462.1| uncharacterized protein LOC380154 [Xenopus laevis]
 gb|AAH43825.1| P44s10-prov protein [Xenopus laevis]
Length=389

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+    + V LR E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPRNPDLRVAQLRFLLSLPE--HRRDVPLRTELMEAVTVNNMAPYYEGLCKHLDWTV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LD ++ DAE+NLGESE+R+A +A++ +  RIGDK+ AL   +
Sbjct  66   DTDLLNKMKKANEEELKRLDNELEDAEQNLGESEIRDAMMARAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_008318583.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Cynoglossus 
semilaevis]
Length=389

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +A+ AN+MAP Y+ L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDTKVKTELMDAIKANNMAPYYEGLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LD+ + DAE+NLGESE+R+A +A++ + IRIGDK+ AL   +
Sbjct  66   DNDLLSKMKKTNEEELKRLDDVLEDAEKNLGESEIRDAMMARAEYLIRIGDKESALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_005952308.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X1 [Haplochromis burtoni]
Length=389

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +A+ AN+MAP Y++L       L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKTELMDAIKANNMAPYYESLCKELKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D   L  M+   +EELK+LD+ + DAE+NLGESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DSDQLSKMKKANEEELKRLDDVLEDAEKNLGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_003973510.1| PREDICTED: LOW QUALITY PROTEIN: 26S proteasome non-ATPase regulatory 
subunit 6-like [Takifugu rubripes]
Length=389

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 97/147 (66%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +A+ AN+MAP Y+ L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKTELMDAIKANNMAPYYEVLCKDLNWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D ++L+ M+   +EELK+LD+ + DAE++LGESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DGELLNKMKKANEEELKRLDDVLEDAEKSLGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_003442732.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X1 [Oreochromis niloticus]
Length=389

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +A+ AN+MAP Y++L       L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKTELMDAIKANNMAPYYESLCKELKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LD+ + DAE+NLGESE+R+  +AK+ + IRIGDK+ AL   +
Sbjct  66   DSDLLSKMKKANEEELKRLDDVLEDAEKNLGESEIRDVMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_001363402.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Monodelphis 
domestica]
Length=389

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRENNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D ++L+ M+   +EELK+LD+++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DTELLNKMKKANEEELKRLDDELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_003273709.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
1 [Nomascus leucogenys]
Length=389

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQI  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ MR   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLNKMRKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_003410080.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Loxodonta 
africana]
Length=389

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    L
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DTDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_002713336.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Oryctolagus 
cuniculus]
Length=389

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+    +   +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRRDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EEL++LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLSKMKKANEEELRRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_006494527.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 homolog 
[Citrus sinensis]
Length=83

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  116  EGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQ  295
            EGTQ   L+LA+K FLLTHPDV D++KV L+ EVF+ V A+DMA  Y+TL+A SVL +DQ
Sbjct  4    EGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQ  63

Query  296  KVLDSMR  316
             VLDSMR
Sbjct  64   SVLDSMR  70



>ref|XP_006158091.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Tupaia 
chinensis]
 ref|XP_008530691.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Equus 
przewalskii]
Length=389

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_006917553.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Pteropus 
alecto]
 gb|ELK07772.1| 26S proteasome non-ATPase regulatory subunit 6 [Pteropus alecto]
Length=389

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDTAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_006751020.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Leptonychotes weddellii]
Length=389

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DTDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_002915483.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Ailuropoda 
melanoleuca]
 ref|XP_004738359.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X2 [Mustela putorius furo]
 ref|XP_004791799.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Mustela putorius furo]
Length=389

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DTDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_003785566.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Otolemur 
garnettii]
Length=389

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+      VR  DE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPEYRGDTAVR--DELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DMDLLHKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_004419950.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
3 [Ceratotherium simum simum]
Length=389

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCRSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|ADO28314.1| 26S proteasome non-ATPase regulatory subunit 6 [Ictalurus furcatus]
Length=389

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 92/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT  D    Q   ++ E+  A+ AN+MAP Y+TL       +
Sbjct  8    EEGLPKNPDLRIAQLKFLLTLDD--HRQDAEVKTELMEAIRANNMAPYYETLCKELKWPV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   ++ELK+LD  + DAE+N GESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DSDLLSKMKKANEDELKRLDVVLEDAEKNQGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_007228770.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Astyanax 
mexicanus]
Length=389

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 92/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q   LR E+  A+ AN+MAP Y+ L       +
Sbjct  8    EEGLPKNPDLRIAQLKFLLTLDG--HRQDAALRTELMEAIRANNMAPYYEALCKELKWPV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   ++ELK+LD+ + DAE+NLGESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DSDLLGKMKKANEDELKRLDDVLEDAEKNLGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_006069792.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Bubalus bubalis]
Length=389

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAIRDELMAAVRDNNMAPYYEALCKSLEWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|NP_001188194.1| 26S proteasome non-ATPase regulatory subunit 6 [Ictalurus punctatus]
 gb|ADO29129.1| 26S proteasome non-ATPase regulatory subunit 6 [Ictalurus punctatus]
Length=389

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 92/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT  D    Q   ++ E+  A+ AN+MAP Y+TL       +
Sbjct  8    EEGLPKNPDLRIAQLKFLLTLDD--HRQDAEVKTELMEAIRANNMAPYYETLCKELKWPV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   ++ELK+LD  + DAE+N GESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DSDLLSKMKKANEDELKRLDVVLEDAEKNQGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_007946269.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Orycteropus afer afer]
Length=389

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|KEH19607.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=366

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  386  SEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            SEV EA LAKSLFFIRIGD +KALE LK+TE+KTVAVGQKMDLVFYTLQ GFF M
Sbjct  160  SEVCEARLAKSLFFIRIGDNEKALEHLKITETKTVAVGQKMDLVFYTLQHGFFGM  214



>ref|XP_010773228.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Notothenia 
coriiceps]
Length=389

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q V+++ E+ +A+ AN+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDGHK--QDVKVKTELMDAITANNMAPYYEGLCKDLKWPV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LD+ + DAE++LGESE+R+A +A++ + IRIGDK+ AL   +
Sbjct  66   DGDLLSKMKKANEEELKRLDDVLEDAEKSLGESEIRDAMMARAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_008050460.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Tarsius 
syrichta]
Length=389

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEGLCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_005892963.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Bos mutus]
 ref|XP_010849830.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Bison 
bison bison]
 tpg|DAA17069.1| TPA: 26S proteasome non-ATPase regulatory subunit 6 [Bos taurus]
Length=389

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLEWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  RTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_004018394.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
1 [Ovis aries]
Length=389

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLEWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_007983059.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Chlorocebus sabaeus]
Length=389

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCRSLDWQI  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_011356758.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Pteropus 
vampyrus]
Length=389

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDTAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_003982446.3| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Felis 
catus]
Length=389

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DTDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_004676060.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Condylura cristata]
Length=389

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMVAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|NP_001029821.1| 26S proteasome non-ATPase regulatory subunit 6 [Bos taurus]
 sp|Q3T0B2.1|PSMD6_BOVIN RecName: Full=26S proteasome non-ATPase regulatory subunit 6; 
AltName: Full=26S proteasome regulatory subunit RPN7 [Bos taurus]
 gb|AAI02469.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Bos 
taurus]
Length=389

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLEWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  RTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_008562210.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Galeopterus 
variegatus]
Length=389

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAVVRDELMAAVRDNNMAPYYEALCRSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_005648630.1| PCI-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24086.1| PCI-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=393

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 85/139 (61%), Gaps = 0/139 (0%)
 Frame = +2

Query  119  GTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQK  298
            G Q  ++ LANK FL   P     +K + + E+   +  +D APLY+T+  +    +D  
Sbjct  11   GIQDPRITLANKCFLYKLPGRTQKEKAKTQQEILETIFKDDAAPLYETVCKDLGWEVDSG  70

Query  299  VLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTE  478
             L +M++  + EL +L+  I DAEENLG+ EVR+A+LAK+ +  +IGD++ A    + TE
Sbjct  71   RLAAMKSANEAELVRLEASIKDAEENLGDIEVRDAYLAKADYLYKIGDREAAKAAYQQTE  130

Query  479  SKTVAVGQKMDLVFYTLQM  535
            SKT  VGQKMDL F  L++
Sbjct  131  SKTAGVGQKMDLAFSMLRL  149



>ref|NP_055629.1| 26S proteasome non-ATPase regulatory subunit 6 isoform 2 [Homo 
sapiens]
 ref|XP_002813608.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Pongo 
abelii]
 ref|XP_520898.3| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Pan 
troglodytes]
 ref|XP_003811648.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Pan paniscus]
 ref|XP_004035897.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Gorilla 
gorilla gorilla]
 sp|Q15008.1|PSMD6_HUMAN RecName: Full=26S proteasome non-ATPase regulatory subunit 6; 
AltName: Full=26S proteasome regulatory subunit RPN7; AltName: 
Full=26S proteasome regulatory subunit S10; AltName: Full=Breast 
cancer-associated protein SGA-113M; AltName: Full=Phosphonoformate 
immuno-associated protein 4; AltName: Full=Proteasome 
regulatory particle subunit p44S10; AltName: Full=p42A 
[Homo sapiens]
 gb|AAF65540.1|AF215935_1 proteasome regulatory particle subunit p44S10 [Homo sapiens]
 dbj|BAA03497.1| KIAA0107 [Homo sapiens]
 gb|AAH00630.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Homo 
sapiens]
 gb|AAH00904.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Homo 
sapiens]
 gb|AAH12369.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Homo 
sapiens]
 gb|AAQ09946.1| phosphonoformate immuno-associated protein 4 [Homo sapiens]
 gb|AAS68366.1| breast cancer associated protein SGA-113M [Homo sapiens]
 gb|EAW65424.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6, isoform 
CRA_a [Homo sapiens]
 dbj|BAF82894.1| unnamed protein product [Homo sapiens]
 dbj|BAG72709.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [synthetic 
construct]
 gb|AIC50453.1| PSMD6, partial [synthetic construct]
Length=389

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQI  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_011473387.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Oryzias 
latipes]
Length=389

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q   ++ E+ +A+ AN+MAP Y+ L       L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMEA--HRQDANVKTELMDAIKANNMAPYYEALCKELKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D ++L  M+   DEELK+LD+ + DAE+NLGESE+R+  +AK+ + IRIGDK+ AL   +
Sbjct  66   DTELLSKMKKANDEELKRLDDVLEDAEKNLGESEIRDVMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_010950239.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Camelus 
bactrianus]
 ref|XP_010984679.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Camelus 
dromedarius]
Length=389

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_004644843.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Octodon degus]
Length=389

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  NDMAP Y+ L       +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNDMAPYYEALCKALDWPV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  ++  M+   +EEL++LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DADLVGKMKKANEEELRRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALAAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_004482519.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
3 [Dasypus novemcinctus]
Length=290

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDTAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A + K+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMTKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_007101357.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Physeter catodon]
Length=389

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DGDLLSKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_004268039.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
1 [Orcinus orca]
 ref|XP_004314096.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
1 [Tursiops truncatus]
Length=389

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLEWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLSKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_002399642.1| 26S proteasome regulatory complex, subunit RPN7/PSMD6, putative 
[Ixodes scapularis]
 gb|EEC11208.1| 26S proteasome regulatory complex, subunit RPN7/PSMD6, putative 
[Ixodes scapularis]
Length=389

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 90/149 (60%), Gaps = 7/149 (5%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTH--PDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANS  277
            +E E   +   L LA   FLL H  P  D     +L+ ++  A+  N+MAP Y+      
Sbjct  6    LEDESLEKNPNLHLAQIKFLLAHHEPGND-----KLKQDLMTAITENNMAPFYEETCNEL  60

Query  278  VLNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKAL  457
               +D K+L SM+A    +++KLD  I DAE+NL E+EVREAHL K+ +  RIGDK+ AL
Sbjct  61   GWQMDNKLLTSMKAANATQIEKLDSAIEDAEKNLSETEVREAHLVKAEYLSRIGDKEAAL  120

Query  458  EQLKVTESKTVAVGQKMDLVFYTLQMGFF  544
             Q + T  KTV++G ++DL+F+ +++G F
Sbjct  121  TQFRKTYDKTVSLGHRLDLLFHMIRIGIF  149



>ref|NP_001253686.1| 26S proteasome non-ATPase regulatory subunit 6 [Macaca mulatta]
 ref|XP_003894271.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Papio anubis]
 ref|XP_010351198.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Rhinopithecus roxellana]
 dbj|BAE87141.1| unnamed protein product [Macaca fascicularis]
 gb|EHH16253.1| hypothetical protein EGK_11513 [Macaca mulatta]
 gb|EHH51207.1| hypothetical protein EGM_10544 [Macaca fascicularis]
Length=389

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCRSLDWQI  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_006862168.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Chrysochloris asiatica]
Length=389

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A + K+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMTKAEYLCRIGDKEGALSAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|ACH70831.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Salmo 
salar]
 gb|ACI69175.1| 26S proteasome non-ATPase regulatory subunit 6 [Salmo salar]
Length=389

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +++  NDMAP Y++L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKTELMDSIKENDMAPYYESLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   ++ELK+LD+ + DAE+NLGESE+R+A +A++ + IRIG+K++AL   +
Sbjct  66   DTSLLSKMKKANEDELKRLDDVLEDAEKNLGESEIRDAMMARAEYLIRIGNKEEALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTFDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_007445734.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Lipotes vexillifer]
Length=389

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLLSKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_002108183.1| hypothetical protein TRIADDRAFT_18564 [Trichoplax adhaerens]
 gb|EDV28981.1| hypothetical protein TRIADDRAFT_18564 [Trichoplax adhaerens]
Length=386

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 91/147 (62%), Gaps = 0/147 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            ME E  +    L +A   FL T P+ D  QK + ++++   + A +MAP YQ +      
Sbjct  1    MEEEGLSNIPNLQIARLKFLCTMPEYDMNQKGQAKEQLMKNIEAANMAPFYQEICREMKW  60

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D K+L+ M+     ELK+L + + DAE+N GESEVR+  L K+ +  +IGDKD +L  
Sbjct  61   EVDDKLLNKMKLTNQAELKRLSDALEDAEKNRGESEVRDIMLEKAEYLSKIGDKDGSLIA  120

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFF  544
            L+ T  KT+A+GQKMD++F+ +++GFF
Sbjct  121  LRQTYDKTMALGQKMDIIFHLIRIGFF  147



>ref|XP_004482517.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
1 [Dasypus novemcinctus]
Length=389

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDTAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A + K+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMTKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_004581647.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Ochotona princeps]
Length=389

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+    +   +R+E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRRDAAVREELMAAVRDNNMAPYYEALCKSLDWQV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D ++L  M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DAELLSKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>dbj|BAB26823.1| unnamed protein product [Mus musculus]
Length=389

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A+ +FLL+ P+        +R+E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIADCVFLLSLPE--HRGDAAVREELMAAVRENNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  +IGDK+ AL   +
Sbjct  66   DVDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCQIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_006893898.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Elephantulus edwardii]
Length=389

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D ++L  M+   +EELK+LDE++ DAE+NLGESE+R+A + K+ +  RIGDK+ AL   +
Sbjct  66   DTELLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMTKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_005335380.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Ictidomys tridecemlineatus]
Length=389

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +R+E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVREELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_007571649.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Poecilia 
formosa]
 ref|XP_008407760.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Poecilia 
reticulata]
Length=389

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       +KV+   E+ +A+ AN+MAP Y+ L       L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDGHRRDEKVK--TELMDAIKANNMAPYYEGLCKELKWPL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D ++L  M+   +EELK+LD+ + DAE+N+GESE+R+  +AK+ + IRIGDK+ AL   +
Sbjct  66   DSELLSKMKKANEEELKRLDDVLEDAEKNMGESEIRDVMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|KFB36906.1| AGAP002061-PA-like protein [Anopheles sinensis]
Length=389

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 86/129 (67%), Gaps = 2/129 (2%)
 Frame = +2

Query  158  FLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSMRakideel  337
            FLL+ P+    Q  +L +++  A+ A +MAP Y+ + A+    +DQK+L  M+    + L
Sbjct  24   FLLSLPEF--AQDKKLSEKLLAAIKAENMAPWYEEVCADLGWTVDQKLLAEMKESNRKRL  81

Query  338  kkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLV  517
            ++LD  I DAE+NLGE EVREA+L KS +  RIGDK+KA+   + T  KTV++G ++D+V
Sbjct  82   EQLDAAIDDAEKNLGEMEVREANLRKSEYLCRIGDKEKAISAFRKTYEKTVSLGHRLDIV  141

Query  518  FYTLQMGFF  544
            F+ +++G F
Sbjct  142  FHNIRIGLF  150



>ref|XP_002758568.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Callithrix 
jacchus]
 ref|XP_003940262.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Saimiri 
boliviensis boliviensis]
Length=389

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +R+E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDTAVREELMAAVRDNNMAPYYEALCKSLDWQI  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_007192455.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Balaenoptera 
acutorostrata scammoni]
Length=442

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  61   EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQM  118

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  119  DVDLLSKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  178

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  179  KTYDKTVALGHRLDIVFYLLRIGLFYM  205



>ref|XP_010880034.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Esox 
lucius]
Length=389

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 97/147 (66%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +++  N+MAP Y++L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKTELMDSIKENNMAPYYESLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LD+ + DAE+NLGESE+R+A +A++ + IRIG+K++AL   +
Sbjct  66   DTDLLNKMKKANEDELKRLDDVLEDAEKNLGESEIRDAMMARAEYLIRIGNKEEALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_006630691.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X1 [Lepisosteus oculatus]
Length=389

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = +2

Query  197  VRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSMRakideelkkldekiadAEEN  376
            V++++E+  A+  N+MAP Y+ L       +D + L  M+   +E LK+LD+ + DAE+N
Sbjct  35   VKVKEELMEAIKENNMAPYYEALCKELKWQVDTEFLSKMKKANEEVLKRLDDVLEDAEKN  94

Query  377  LGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            LGESE+R+A +AK+ + IRIGDK+ AL   + T  KTVA+G ++D+VFY L++G F M
Sbjct  95   LGESEIRDAMMAKAEYLIRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYM  152



>dbj|BAC24988.1| unnamed protein product [Mus musculus]
Length=241

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A+  FLL+ P+        +R+E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIADCRFLLSLPE--HRGDAAVREELMAAVRENNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  +IGDK+ AL   +
Sbjct  66   DVDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCQIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>emb|CDQ61185.1| unnamed protein product [Oncorhynchus mykiss]
Length=389

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +++  NDMAP Y++L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKTELMDSIKENDMAPYYESLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  ++  M+   ++ELK+LD+ + DAE+NLGESE+R+A +A++ + IRIG+K++AL   +
Sbjct  66   DTDLMSKMKKANEDELKRLDDVLEDAEKNLGESEIRDAMMARAEYLIRIGNKEEALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTFDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_008144493.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Eptesicus fuscus]
Length=389

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A + K+ +  RIGDK+ AL   +
Sbjct  66   DVDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMTKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_007435827.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Python 
bivittatus]
Length=389

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLT-HPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLN  286
            EEG  +   L +A   FLL+  P   D     +R E+  A+  +DMAP Y++L  +    
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLQPQCPDPA---VRQELMAAIRQHDMAPYYESLCKSLDWQ  64

Query  287  LDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQL  466
            +D  +L+ M+   +EELK+LD+++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   
Sbjct  65   VDTDLLNKMKKANEEELKRLDDELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEAALTAF  124

Query  467  KVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            + T  KTVA+G ++D+VFY L++G F M
Sbjct  125  RKTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_005409078.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X2 [Chinchilla lanigera]
Length=389

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L       +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKALDWQV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +++ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DVDLVNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_003480192.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Cavia porcellus]
Length=389

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L       +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKALDWQV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  ++  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DADLVSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_010735679.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X2 [Larimichthys crocea]
Length=348

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +2

Query  221  NAVVANDMAPLYQTLIANSVLNLDQKVLDSMRakideelkkldekiadAEENLGESEVRE  400
            +A+ AN+MAP Y+ L  +    LD  +L  M+   +EELK+LD+ + DAE+NLGESE+R+
Sbjct  2    DAIRANNMAPYYEGLCKDLKWQLDGDLLSKMKKANEEELKRLDDVLEDAEKNLGESEIRD  61

Query  401  AHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            A +AK+ + IRIGDK+ AL   + T  KTVA+G ++D+VFY L++G F M
Sbjct  62   AMMAKAEYLIRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYM  111



>ref|XP_005669762.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Sus 
scrofa]
Length=381

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+      VR  +E+  AV  N  AP Y+ L  +    +
Sbjct  70   EEGLPKNPDLRIAQLRFLLSLPEHRGDAAVR--EELMAAVRDNSEAPYYEALCKSLTGQM  127

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LDE++ DAE+NLGESE+R+A +AK+ +F RIGDK+ AL   +
Sbjct  128  DVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYFCRIGDKEGALTAFR  187

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  188  KTYDKTVALGHRLDIVFYLLRIGLFYM  214



>ref|XP_006089098.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Myotis lucifugus]
Length=389

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LDE++ DAE+NLGESE+R+A + K+ +  RIGDK+ AL   +
Sbjct  66   DVDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMTKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_005808509.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X1 [Xiphophorus maculatus]
Length=389

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       +KV+   E+ +A+ AN+MAP Y+ L       L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDGHRRDEKVK--TELMDAIKANNMAPYYEGLCKELKWPL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D ++L  M+   +EELK+LD+ + DAE+N+GESE+R+  +AK+ + IRIG+K+ AL   +
Sbjct  66   DSELLSKMKKANEEELKRLDDVLEDAEKNMGESEIRDVMMAKAEYLIRIGNKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|ETN58689.1| 26S proteasome non-ATPase regulatory subunit 6 [Anopheles darlingi]
Length=389

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +2

Query  158  FLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSMRakideel  337
            FLL+ P+    Q   L +++  A+ A++MAP Y+ +  +    +D K+L  MR    ++L
Sbjct  24   FLLSLPEFR--QDKNLAEKLLGAIKADNMAPWYEEVCNDLGWTMDSKLLAEMRETNRKKL  81

Query  338  kkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLV  517
            ++LD  I DA++NLGE EVREA+L KS +  RIGDKD+A+   + T  KTV++G ++D+V
Sbjct  82   EQLDAAIEDADKNLGEMEVREANLRKSEYLCRIGDKDRAISAFRTTYEKTVSLGHRLDIV  141

Query  518  FYTLQMGFF  544
            F+ +++G F
Sbjct  142  FHNIRIGLF  150



>gb|ETE71439.1| 26S proteasome non-ATPase regulatory subunit 6, partial [Ophiophagus 
hannah]
Length=449

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLT-HPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLN  286
            EEG  +   L +A   FLL+  P   D     +R E+  A+  +DMAP Y++L  +    
Sbjct  49   EEGLPKNPDLRIAQLRFLLSLQPQCPDPA---VRQELMAAIRQHDMAPYYESLCKSLDWP  105

Query  287  LDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQL  466
            +D  +L+ M+   ++ELK+L++++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   
Sbjct  106  VDTDLLNKMKKANEDELKRLEDELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEAALTAF  165

Query  467  KVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            + T  KTVA+G ++D+VFY L++G F M
Sbjct  166  RKTYDKTVALGHRLDIVFYLLRIGLFYM  193



>ref|XP_002673249.1| 26S proteasome regulatory subunit RPN7 [Naegleria gruberi]
 gb|EFC40505.1| 26S proteasome regulatory subunit RPN7 [Naegleria gruberi]
Length=388

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 93/141 (66%), Gaps = 5/141 (4%)
 Frame = +2

Query  137  LILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIAN---SVLNLDQKVLD  307
            L+LA K FL+++ D     K  L  E+ + V   +M P Y+ ++     +   LDQ +L 
Sbjct  11   LVLAEKKFLVSN-DFPKTNKTALAQEILDLVKQKEMGPYYENVLTQQLPTYFKLDQTLLQ  69

Query  308  SMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKT  487
            S++     +LK+L++KI+DA +NLGE+EVREA LAK+ ++  IGDK+ AL   + TE+KT
Sbjct  70   SLKEANQNKLKELEDKISDANQNLGENEVREALLAKAQYYYSIGDKENALSAFRETETKT  129

Query  488  VAVGQKMDLVFYTLQMGF-FD  547
            VA+GQK+D++F  L++GF FD
Sbjct  130  VALGQKLDILFALLRIGFAFD  150



>ref|XP_007893373.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Callorhinchus 
milii]
Length=389

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 96/148 (65%), Gaps = 5/148 (3%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVR-LRDEVFNAVVANDMAPLYQTLIANSVLN  286
            EEG  +   L +A   FLLT   +D  ++   LR E+ +AV  N+MAP Y+ L  +   +
Sbjct  8    EEGLPKNPSLSIAQSRFLLT---LDGHRRDEVLRGELMDAVRDNNMAPYYEELCKDLGWS  64

Query  287  LDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQL  466
            +D  +L  M+   +EELK+LD+ + DAE+NLGESE+R++ +AK+ +  RIGDK+ AL   
Sbjct  65   VDTDLLTKMKKANEEELKRLDDILKDAEKNLGESEIRDSMMAKAEYLCRIGDKEGALTAF  124

Query  467  KVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            + T  KTVA+G ++D+VFY L++G F M
Sbjct  125  RKTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_004661331.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Jaculus jaculus]
Length=389

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +R+E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVREELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   ++ELK+LDE++ DAE+NLGESE+R+A + K+ +  RIGDK+ AL   +
Sbjct  66   DMDLLSKMKKANEQELKRLDEELEDAEKNLGESEIRDAMMTKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_005008346.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X2 [Cavia porcellus]
Length=386

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L       +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKALDWQV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  ++  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  66   DADLVSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_005348592.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Microtus ochrogaster]
Length=389

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +R+E+  AV  N+MAP Y+ L  +    L
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGNAAVREELMAAVRENNMAPYYEALCKSLDWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LD+++ DAE+NLGESE+R+A +AK+ +  +IGDK+ AL   +
Sbjct  66   DVDLLSKMKKANEEELKRLDDELEDAEKNLGESEIRDAMMAKAEYLCQIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|ACQ58022.1| 26S proteasome non-ATPase regulatory subunit 6 [Anoplopoma fimbria]
Length=389

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  ++  E+ +A+ AN+MAP Y+ L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVETELMDAIKANNMAPYYEGLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LD+ + DAE++LGESE+R+A +A++   IRIGDK+ AL   +
Sbjct  66   DGDLLSKMKKANEEELKRLDDVLEDAEKSLGESEIRDAMMARAEHLIRIGDKESALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|ACO09854.1| 26S proteasome non-ATPase regulatory subunit 6 [Osmerus mordax]
Length=389

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +++  N+MAP Y+ L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDAKVKTELMDSIKENNMAPYYEGLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +   M+   +EELK+LD+ + DAE+NLGESE+R+A +AK+ + IRIGDK+ AL   +
Sbjct  66   DTDLQSKMKKANEEELKRLDDVLEDAEKNLGESEIRDAMMAKAEYLIRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYEKTVALGHRLDIVFYLLRIGLFYM  152



>ref|NP_001158526.1| 26S proteasome non-ATPase regulatory subunit 6 [Oncorhynchus 
mykiss]
 gb|ACO08067.1| 26S proteasome non-ATPase regulatory subunit 6 [Oncorhynchus 
mykiss]
Length=330

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +++  N+MAP Y++L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDDKVKTELMDSIKENNMAPYYESLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LD+ + DAE+NLGESE+R+A +A++ + IRIG+K+ AL   +
Sbjct  66   DTDLLNKMKKANEDELKRLDDVLEDAEKNLGESEIRDAMMARAEYLIRIGNKEDALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTFDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|NP_942025.1| 26S proteasome non-ATPase regulatory subunit 6 [Rattus norvegicus]
 gb|AAH59159.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Rattus 
norvegicus]
 gb|EDL94116.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6, isoform 
CRA_a [Rattus norvegicus]
Length=389

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +R+E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDTAVREELMAAVRENNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  +IGDK+ AL   +
Sbjct  66   DMDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCQIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_006975153.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Peromyscus 
maniculatus bairdii]
Length=389

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +R+E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGNAAVREELMAAVRENNMAPYYEALCKSLDWQV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  +IGDK+ AL   +
Sbjct  66   DGDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCQIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_001845077.1| 26S proteasome non-ATPase regulatory subunit 6 [Culex quinquefasciatus]
 gb|EDS39093.1| 26S proteasome non-ATPase regulatory subunit 6 [Culex quinquefasciatus]
Length=389

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +2

Query  158  FLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSMRakideel  337
            FLLT P+ +  Q   L D++  A+ A++M P Y+ +  +    +DQK+L  M+    +++
Sbjct  24   FLLTLPEHN--QDKALVDKLLTAIKADNMGPWYEEVCKDLGWTVDQKLLGEMKELNRKKV  81

Query  338  kkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLV  517
            ++LD  I DAE+NLGE EVREA+L KS +  RIGDK+ A+   + T  KTV++G ++D+V
Sbjct  82   EELDAVIEDAEKNLGEMEVREANLKKSEYLCRIGDKEGAISAFRKTYDKTVSLGHRLDIV  141

Query  518  FYTLQMGFF  544
            F+ +++G F
Sbjct  142  FHNIRIGLF  150



>ref|XP_004702469.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Echinops telfairi]
Length=389

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (62%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV  N+MAP Y+ L  +     
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQT  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LD+ + DAE+NLGESE+R+A + K+ +  RIGDK+ AL   +
Sbjct  66   DVDLLTKMKKANEEELKRLDDMLEDAEKNLGESEIRDAMMTKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_004461818.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform 1 [Dasypus novemcinctus]
Length=389

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        + DE+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDTAVCDELMAAVRDNNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A + K+ +  RIGDK+ AL   +
Sbjct  66   DMDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMTKAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|KDR21785.1| 26S proteasome non-ATPase regulatory subunit 6 [Zootermopsis 
nevadensis]
Length=389

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 94/147 (64%), Gaps = 2/147 (1%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            +E E   +   L LA   FLL+ PD    +K  L+ ++  A+V  +MAP Y+ +  +S  
Sbjct  6    LEDEGLEKNPNLKLALWKFLLSLPDHSGDKK--LQSKLLEAIVGENMAPFYEEVCRDSDW  63

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +DQ +L  M++  +E+LK+L+E I DAE+NL E EVREA+L KS +  RIGDK+ AL  
Sbjct  64   KVDQTLLAKMKSANEEKLKELEETIEDAEKNLSEMEVREANLKKSEYLCRIGDKEGALSA  123

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFF  544
             + T  KTV++G ++D+VF+ +++G F
Sbjct  124  FRKTYDKTVSLGHRLDIVFHLIRIGLF  150



>ref|NP_079826.2| 26S proteasome non-ATPase regulatory subunit 6 [Mus musculus]
 sp|Q99JI4.1|PSMD6_MOUSE RecName: Full=26S proteasome non-ATPase regulatory subunit 6; 
AltName: Full=26S proteasome regulatory subunit RPN7; AltName: 
Full=26S proteasome regulatory subunit S10; AltName: Full=p42A 
[Mus musculus]
 emb|CAC34579.1| putative KIAA0107 homologue [Mus musculus]
 gb|AAH06869.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Mus 
musculus]
 gb|EDL20627.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 [Mus 
musculus]
Length=389

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +R+E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVREELMAAVRENNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  +IGDK+ AL   +
Sbjct  66   DVDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCQIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>emb|CDQ60524.1| unnamed protein product [Oncorhynchus mykiss]
Length=389

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +++  N+MAP Y++L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDDKVKTELMDSIKENNMAPYYESLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LD+ + DAE+NLGESE+R+A +A++ + IRIG+K+ AL   +
Sbjct  66   DTDLLNKMKKANEDELKRLDDVLEDAEKNLGESEIRDAMMARAEYLIRIGNKEDALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTFDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|ACI68252.1| 26S proteasome non-ATPase regulatory subunit 6 [Salmo salar]
Length=389

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +++  N+MAP Y++L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDDKVKTELMDSIKENNMAPYYESLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LD+ + DAE+NLGESE+R+A +A++ + IRIG+K+ AL   +
Sbjct  66   DTDLLNKMKKANEDELKRLDDVLEDAEKNLGESEIRDAMMARAEYLIRIGNKEDALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTFDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_003223640.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Anolis 
carolinensis]
Length=389

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  206  RDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSMRakideelkkldekiadAEENLGE  385
            R E+  A+  +DMAP Y++L  +    +D  +L+ M+   ++ELK+LD+++ DAE+NLGE
Sbjct  38   RQELMAAIKEHDMAPYYESLCKSLDWQVDSDLLNKMKKANEDELKRLDDELEDAEKNLGE  97

Query  386  SEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            SE+R+A +AK+ +  RIGDK+ AL   + T  KTVA+G ++D+VFY L++G F M
Sbjct  98   SEIRDAMMAKAEYLCRIGDKEAALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_003503712.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Cricetulus 
griseus]
 ref|XP_005076455.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Mesocricetus auratus]
 ref|XP_007636438.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Cricetulus 
griseus]
 gb|EGV94626.1| 26S proteasome non-ATPase regulatory subunit 6 [Cricetulus griseus]
 gb|ERE90032.1| 26S proteasome non-ATPase regulatory subunit 6 [Cricetulus griseus]
Length=389

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +R+E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGNAAVREELMAAVRENNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +   IGDK+ AL   +
Sbjct  66   DMDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCLIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_004871661.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Heterocephalus glaber]
Length=389

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +R E+  AV  NDMAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRAELMAAVRDNDMAPYYEALCKSLDWQV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  ++  M+   +EELK+LDE++ DAE+NLGESE+R+A +A++ +  RIGDK+ AL   +
Sbjct  66   DVDLVGKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMARAEYLCRIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_008819795.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Nannospalax 
galili]
Length=389

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 93/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +R+E+  AV  N+MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRADAAVREELMAAVRENNMAPYYEALCKSLDWQM  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L  M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +   IGDK+ AL   +
Sbjct  66   DMDLLSKMKKANEEELKRLDEELDDAEKNLGESEIRDAMMAKAEYLCLIGDKEGALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|ACI67508.1| 26S proteasome non-ATPase regulatory subunit 6 [Salmo salar]
Length=293

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 95/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLLT       Q  +++ E+ +++  N+MAP Y++L  +    L
Sbjct  8    EEGLPKNPDLRIAQLKFLLTMDG--HRQDDKVKTELMDSIKENNMAPYYESLCKDLKWQL  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   ++ELK+LD+ + DAE+NLGESE+R A +A++ + IRIG+K+ AL   +
Sbjct  66   DTDLLNKMKKANEDELKRLDDVLEDAEKNLGESEIRGAMMARAEYLIRIGNKEDALTAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  126  KTFDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_002736795.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Saccoglossus kowalevskii]
Length=389

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 90/147 (61%), Gaps = 3/147 (2%)
 Frame = +2

Query  113  EEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG +    L L+   FLL+ PD  +   V+   ++ + + AN+MAP Y+ +  +    +
Sbjct  8    EEGLEKNPDLRLSQLKFLLSLPDYKNDASVK--KKLIDGIQANNMAPFYEEVCNDLGWKV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            DQK+L  M+     +LK+L   + DAE+NLGE+EVR+A LA++ F  RIGDK+  L   +
Sbjct  66   DQKLLKQMKDSNATKLKELQTTLEDAEQNLGETEVRDAFLAQAEFHCRIGDKEACLSTFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
                KTVA+G ++D++F+ +++G F M
Sbjct  126  KAFEKTVALGHRLDIIFHLIRVGLFYM  152



>ref|XP_414416.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X2 [Gallus gallus]
Length=389

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 93/148 (63%), Gaps = 5/148 (3%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLT-HPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLN  286
            EEG  +   L +A   FLL+  P   D      RDE+  AV  ++MAP Y+ L  +    
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLRPRAPDPAA---RDELMAAVRLHNMAPYYEALCKSLEWQ  64

Query  287  LDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQL  466
            +D ++L+ M+   +EELK+LD ++ DAE+ LGESE+R+A +AK+ +  RIGDK+ AL   
Sbjct  65   IDTELLNKMKKANEEELKRLDNELEDAEKILGESEIRDAMMAKAEYLCRIGDKEGALTAF  124

Query  467  KVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            + T  KTVA+G ++D+VFY L++G F M
Sbjct  125  RKTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_003393696.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Bombus terrestris]
Length=389

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 96/145 (66%), Gaps = 3/145 (2%)
 Frame = +2

Query  113  EEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG +   +L LA   FLL+ P+  D     L++++ +A+ A+DMAP Y+ +  +    +
Sbjct  8    EEGLEKNPKLELAQTKFLLSLPEHKD--DPFLKNKLLDAIKADDMAPFYEEVCKDLNWPV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L +M+AK  E+LK+LD+ I DAE+NLGE EVREA+L KS    RIGDK+ A+   +
Sbjct  66   DDTLLTTMKAKNMEQLKELDDAIEDAEKNLGEMEVREANLKKSEHLCRIGDKEGAISAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFF  544
             T  KTV++G ++D+VF+ +++G F
Sbjct  126  KTYDKTVSLGHRLDIVFHNIRIGLF  150



>ref|XP_003490080.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
[Bombus impatiens]
Length=389

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 96/145 (66%), Gaps = 3/145 (2%)
 Frame = +2

Query  113  EEGTQ-TQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG +   +L LA   FLL+ P+  D     L++++ +A+ A+DMAP Y+ +  +    +
Sbjct  8    EEGLEKNPKLELAQTKFLLSLPEHKD--DPFLKNKLLDAIKADDMAPFYEEVCKDLNWPV  65

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L +M+AK  E+LK+LD+ I DAE+NLGE EVREA+L KS    RIGDK+ A+   +
Sbjct  66   DDNLLATMKAKNMEQLKELDDAIEDAEKNLGEMEVREANLKKSEHLCRIGDKEGAISAFR  125

Query  470  VTESKTVAVGQKMDLVFYTLQMGFF  544
             T  KTV++G ++D+VF+ +++G F
Sbjct  126  KTYDKTVSLGHRLDIVFHNIRIGLF  150



>ref|XP_005023314.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Anas 
platyrhynchos]
Length=298

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 93/154 (60%), Gaps = 11/154 (7%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLT-HPDVDDLQKVRLRDEVFNAVVAN------DMAPLYQTLI  268
            EEG  +   L +A   FLL+  P   D      RDE+  A V N      DMAP Y+ L 
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLRPRAPDPAA---RDELMAAAVTNLLAFLSDMAPYYEALC  64

Query  269  ANSVLNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKD  448
             +    +D ++L+ M+   +EELK+LD ++ DAE+ LGESE+R+A +AK+ +  RIGDK+
Sbjct  65   KSLEWQVDTELLNKMKKANEEELKRLDNELEDAEKILGESEIRDAMMAKAEYLCRIGDKE  124

Query  449  KALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
             AL   + T  KTVA+G ++D+VFY L++G F M
Sbjct  125  GALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYM  158



>ref|XP_005632412.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X4 [Canis lupus familiaris]
Length=350

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  239  DMAPLYQTLIANSVLNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKS  418
            DMAP Y+ L  +    LD  +L+ MR   ++ELK+LDE++ DAE+NLGESE+R+A +AK+
Sbjct  10   DMAPYYEALCKSLDWQLDTDLLNKMRKANEDELKRLDEELEDAEKNLGESEIRDAMMAKA  69

Query  419  LFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
             +  R+GDKD AL   + T  KTVA+G ++D+VFY L++G F M
Sbjct  70   EYLCRVGDKDGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYM  113



>ref|XP_005149456.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X1 [Melopsittacus undulatus]
Length=394

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 92/148 (62%), Gaps = 5/148 (3%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLT-HPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLN  286
            EEG  +   L +A   FLL+  P   D      RDE+  AV  ++MAP Y+ L  +    
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLRPRAPDPAA---RDELMAAVRLHNMAPYYEALCKSLEWQ  64

Query  287  LDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQL  466
            +D ++L  M+   +EELK+LD ++ DAE+ LGESE+R+A +AK+ +  RIGDK+ AL   
Sbjct  65   MDTELLSKMKKANEEELKRLDNELEDAEKILGESEIRDAMMAKAEYLCRIGDKEGALTAF  124

Query  467  KVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            + T  KTVA+G ++D+VFY L++G F M
Sbjct  125  RKTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|EFB25903.1| hypothetical protein PANDA_003474 [Ailuropoda melanoleuca]
Length=387

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 93/147 (63%), Gaps = 5/147 (3%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNL  289
            EEG  +   L +A   FLL+ P+        +RDE+  AV    MAP Y+ L  +    +
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLPE--HRGDAAVRDELMAAV--RXMAPYYEALCKSLDWQM  63

Query  290  DQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLK  469
            D  +L+ M+   +EELK+LDE++ DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   +
Sbjct  64   DTDLLNKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFR  123

Query  470  VTESKTVAVGQKMDLVFYTLQMGFFDM  550
             T  KTVA+G ++D+VFY L++G F M
Sbjct  124  KTYDKTVALGHRLDIVFYLLRIGLFYM  150



>ref|XP_005522070.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Pseudopodoces humilis]
Length=389

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 92/148 (62%), Gaps = 5/148 (3%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLT-HPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLN  286
            EEG  +   L +A   FLL+  P   D      RDE+  AV  ++MAP Y+ L  +    
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLRPRAPDPAA---RDELMAAVRLHNMAPYYEALCKSLEWQ  64

Query  287  LDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQL  466
            +D  +L+ M+   +EELK+LD ++ DAE+ LGESE+R+A +AK+ +  RIGDK+ AL   
Sbjct  65   MDTDLLNKMKKANEEELKRLDNELEDAEKILGESEIRDAMMAKAEYLCRIGDKEGALTAF  124

Query  467  KVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            + T  KTVA+G ++D+VFY L++G F M
Sbjct  125  RKTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_009468144.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Nipponia nippon]
Length=389

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 92/148 (62%), Gaps = 5/148 (3%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLT-HPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLN  286
            EEG  +   L +A   FLL+  P   D      RDE+  AV  ++MAP Y+ L  +    
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLRPRAPDPAA---RDELMAAVRLHNMAPYYEALCKSLEWQ  64

Query  287  LDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQL  466
            +D  +L+ M+   +EELK+LD ++ DAE+ LGESE+R+A +AK+ +  RIGDK+ AL   
Sbjct  65   IDMDLLNKMKKANEEELKRLDNELEDAEKILGESEIRDAMMAKAEYLCRIGDKEGALTAF  124

Query  467  KVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            + T  KTVA+G ++D+VFY L++G F M
Sbjct  125  RKTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|KFR02323.1| 26S proteasome non-ATPase regulatory subunit 6, partial [Nipponia 
nippon]
Length=390

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 92/148 (62%), Gaps = 5/148 (3%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLT-HPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLN  286
            EEG  +   L +A   FLL+  P   D      RDE+  AV  ++MAP Y+ L  +    
Sbjct  9    EEGLPKNPDLRIAQLRFLLSLRPRAPDPAA---RDELMAAVRLHNMAPYYEALCKSLEWQ  65

Query  287  LDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQL  466
            +D  +L+ M+   +EELK+LD ++ DAE+ LGESE+R+A +AK+ +  RIGDK+ AL   
Sbjct  66   IDMDLLNKMKKANEEELKRLDNELEDAEKILGESEIRDAMMAKAEYLCRIGDKEGALTAF  125

Query  467  KVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            + T  KTVA+G ++D+VFY L++G F M
Sbjct  126  RKTYDKTVALGHRLDIVFYLLRIGLFYM  153



>ref|XP_010295301.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X3 [Phaethon lepturus]
Length=389

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 92/148 (62%), Gaps = 5/148 (3%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLT-HPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLN  286
            EEG  +   L +A   FLL+  P   D      RDE+  AV  ++MAP Y+ L  +    
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLRPRAPDTAA---RDELMAAVRKDNMAPYYEALCKSLEWQ  64

Query  287  LDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQL  466
            +D  +L+ M+   +EELK+LD ++ DAE+ LGESE+R+A +AK+ +  RIGDK+ AL   
Sbjct  65   IDVDLLNKMKKANEEELKRLDNELEDAEKILGESEIRDAMMAKAEYLCRIGDKEGALTAF  124

Query  467  KVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            + T  KTVA+G ++D+VFY L++G F M
Sbjct  125  RKTYDKTVALGHRLDIVFYLLRIGLFYM  152



>gb|EFA83237.1| 26S proteasome non-ATPase regulatory subunit 6 [Polysphondylium 
pallidum PN500]
Length=367

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 76/119 (64%), Gaps = 9/119 (8%)
 Frame = +2

Query  221  NAVVAND---------MAPLYQTLIANSVLNLDQKVLDSMRakideelkkldekiadAEE  373
            NAVV  D         M PLY+ L+       D+++ + +R + ++EL +L+ KI DAEE
Sbjct  26   NAVVKKDLLVEIEKYQMLPLYKKLVEQLKWEEDRQLSEKLRVENEKELTELNFKIKDAEE  85

Query  374  NLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            N GESE+REA LAKS ++ RIGDKDKA    + T  KTV +GQK+DL+F  ++MG F M
Sbjct  86   NFGESEIREAFLAKSDYYCRIGDKDKAYSSYRQTYEKTVPLGQKLDLIFTVIRMGIFWM  144



>emb|CDQ00191.1| Protein BM-RPN-7 [Brugia malayi]
Length=408

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 92/147 (63%), Gaps = 0/147 (0%)
 Frame = +2

Query  104  MEGEEGTQTQQLILANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            +E E  ++   L +A   FLL+HPD+D   K    +++   +  N+M P Y+ +  +   
Sbjct  16   VEKEVISKIPNLDIAQLRFLLSHPDIDSKVKKDSWEKLIELIKENEMGPYYKLVCTDIGT  75

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +++ +   ++   ++ LK+++++IADAE+NLGESEVR+A+L KS +  +IGDKD A+  
Sbjct  76   TMNESLFTDLKEANEKRLKEINDEIADAEQNLGESEVRQAYLRKSEYLCKIGDKDAAVAS  135

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFF  544
             + T  KTV +G ++DL+F  +++G F
Sbjct  136  FRQTYEKTVGIGYRIDLIFNLIRLGLF  162



>ref|XP_006010999.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Latimeria chalumnae]
Length=389

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 93/148 (63%), Gaps = 5/148 (3%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLTHPDVDDLQK-VRLRDEVFNAVVANDMAPLYQTLIANSVLN  286
            EEG  +   L +A   FLLT   +D  +   +++ E+  A+  N+MAP Y+ L       
Sbjct  8    EEGLPKNPDLRIAQLKFLLT---LDGYRSDAKVKGELMEAIKENNMAPYYEALCKELSWQ  64

Query  287  LDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQL  466
            ++  +L  M+   +EELK+LD+ + DAE+NLGESE+R+A +AK+ +  RIGDK+ AL   
Sbjct  65   VETGLLSKMKKANEEELKRLDDVLEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAF  124

Query  467  KVTESKTVAVGQKMDLVFYTLQMGFFDM  550
            + T  KTVA+G ++D+VFY L++G F M
Sbjct  125  RKTYDKTVALGHRLDIVFYLLRIGLFYM  152



>ref|XP_005053297.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 isoform 
X1 [Ficedula albicollis]
Length=390

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = +2

Query  113  EEG-TQTQQLILANKIFLLT--HPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVL  283
            EEG  +   L +A   FLL+   P   D      RDE+  AV  ++MAP Y+ L  +   
Sbjct  8    EEGLPKNPDLRIAQLRFLLSLLRPRAPDPAA---RDELMAAVRLHNMAPYYEALCKSLEW  64

Query  284  NLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQ  463
             +D  +L+ M+   +EELK+LD ++ DAE+ LGESE+R+A +AK+ +  RIGDK+ AL  
Sbjct  65   QMDTDLLNKMKKANEEELKRLDNELEDAEKILGESEIRDAMMAKAEYLCRIGDKEGALTA  124

Query  464  LKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
             + T  KTVA+G ++D+VFY L++G F M
Sbjct  125  FRKTYDKTVALGHRLDIVFYLLRIGLFYM  153



>gb|ERL91028.1| hypothetical protein D910_08370 [Dendroctonus ponderosae]
Length=422

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +2

Query  158  FLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSMRakideel  337
            FLLT P+  + + V  +  +  A+  +DMAP Y+ +  ++   +D+K L  ++AK +E+L
Sbjct  24   FLLTLPEFKNDKSVHAK--ITEAIKKDDMAPWYELICQDADWKMDEKFLKILKAKNEEQL  81

Query  338  kkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQKMDLV  517
            KKL++ I DAE+NLGE EVREA+L K+ ++ RIGDKD A+   + T  KTV++G ++D++
Sbjct  82   KKLNDAIEDAEKNLGEMEVREAYLRKAEYYSRIGDKDNAVSTFRQTYDKTVSLGHRLDII  141

Query  518  FYTLQMGFFDM  550
            F+ +++G F M
Sbjct  142  FHLIRIGLFFM  152



>ref|XP_320986.2| AGAP002061-PA [Anopheles gambiae str. PEST]
 gb|EAA01099.3| AGAP002061-PA [Anopheles gambiae str. PEST]
Length=389

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  LANKIFLLTHPDVDDLQKVRLRDEVFNAVVANDMAPLYQTLIANSVLNLDQKVLDSMRak  322
            L++  FLL+ P+    +K  L +++  A+ A +MAP Y+ +  +    +DQK L  MR  
Sbjct  19   LSHCKFLLSLPEFASDKK--LSEKLLAAIKAENMAPWYEQVCTDLGWTVDQKQLAEMRET  76

Query  323  ideelkkldekiadAEENLGESEVREAHLAKSLFFIRIGDKDKALEQLKVTESKTVAVGQ  502
              ++L++LD  I DAE+NLGE EVREA+L KS +  RIGDK+ A+   + T  KTV++G 
Sbjct  77   NRKKLEQLDAAIEDAEKNLGEMEVREANLRKSEYLCRIGDKEGAITAFRKTYEKTVSLGH  136

Query  503  KMDLVFYTLQMGFF  544
            ++D+VF+ +++G F
Sbjct  137  RLDIVFHQIRIGLF  150



>ref|XP_005731273.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6-like 
isoform X2 [Pundamilia nyererei]
Length=350

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +2

Query  239  DMAPLYQTLIANSVLNLDQKVLDSMRakideelkkldekiadAEENLGESEVREAHLAKS  418
            DMAP Y++L       LD  +L  M+   +EELK+LD+ + DAE+NLGESE+R+A +AK+
Sbjct  10   DMAPYYESLCKELKWQLDSDLLSKMKEANEEELKRLDDVLEDAEKNLGESEIRDAMMAKA  69

Query  419  LFFIRIGDKDKALEQLKVTESKTVAVGQKMDLVFYTLQMGFFDM  550
             + IRIGDK+ AL   + T  KTVA+G ++D+VFY L++G F M
Sbjct  70   EYLIRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYM  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720