BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I14

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABG27026.1|  phosophlipid protein                                    112   1e-27   Gymnadenia conopsea
gb|KEH29195.1|  Lipid transfer protein                                  105   1e-24   Medicago truncatula
ref|XP_009396874.1|  PREDICTED: non-specific lipid-transfer prote...    103   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001065988.1|  Os12g0115300                                       102   4e-24   
ref|NP_001065585.1|  Os11g0116000                                       102   4e-24   
gb|EAY79716.1|  hypothetical protein OsI_34868                          102   4e-24   Oryza sativa Indica Group [Indian rice]
gb|ABA96286.1|  Nonspecific lipid-transfer protein 3 precursor, p...    102   5e-24   Oryza sativa Japonica Group [Japonica rice]
emb|CAG28937.1|  lipid transfer protein                                 102   6e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...    101   2e-23   Populus euphratica
gb|EAY79718.1|  hypothetical protein OsI_34870                          100   2e-23   Oryza sativa Indica Group [Indian rice]
gb|ABK96515.1|  unknown                                                 100   4e-23   Populus trichocarpa x Populus deltoides
ref|XP_003605309.1|  Non-specific lipid-transfer protein                106   5e-23   
gb|ABK94706.1|  unknown                                               99.4    7e-23   Populus trichocarpa [western balsam poplar]
ref|XP_002305878.2|  lipid transfer family protein                    99.0    1e-22   
ref|NP_001065586.1|  Os11g0116200                                     99.4    1e-22   
gb|AAL27855.1|  lipid transfer protein precursor                      98.6    2e-22   Davidia involucrata
gb|AGN56423.1|  non-specific lipid transfer protein 3                 97.8    2e-22   Linum usitatissimum
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  97.8    3e-22   Populus euphratica
gb|AAT80663.1|  lipid transfer protein precursor                      97.8    3e-22   Malus domestica [apple tree]
gb|ADB12472.1|  lipid transfer protein                                97.1    4e-22   Crocus sativus [saffron crocus]
ref|XP_009384323.1|  PREDICTED: non-specific lipid-transfer prote...  97.8    4e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABE11609.1|  lipid-transfer protein precursor                      97.4    4e-22   Solanum chacoense
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  97.1    6e-22   Elaeis guineensis
gb|AAT80652.1|  lipid transfer protein precursor                      97.1    6e-22   Malus domestica [apple tree]
gb|AAT80650.1|  lipid transfer protein precursor                      96.7    7e-22   Malus domestica [apple tree]
emb|CDP14199.1|  unnamed protein product                              96.3    1e-21   Coffea canephora [robusta coffee]
gb|AFM35695.1|  nonspecific lipid transfer protein                    96.3    1e-21   Vitis pseudoreticulata
gb|AAY83343.1|  non-specific lipid transfer protein precursor         95.5    2e-21   Fragaria x ananassa
gb|AAT80665.1|  lipid transfer protein precursor                      95.5    2e-21   Malus domestica [apple tree]
ref|XP_010683515.1|  PREDICTED: non-specific lipid-transfer prote...  95.1    3e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|AAF71695.1|AF198168_1  phospholipid transfer protein               95.1    4e-21   Phalaenopsis japonica
dbj|BAI94497.1|  lipid transfer protein                               95.1    4e-21   Dianthus caryophyllus [carnation]
gb|AAT68263.1|  lipid transfer protein                                94.7    4e-21   Nicotiana glauca [glaucous tobacco]
gb|AFK38461.1|  unknown                                               94.7    5e-21   Lotus japonicus
gb|AAY83345.1|  non-specific lipid transfer protein precursor         94.7    5e-21   Fragaria x ananassa
dbj|BAI94496.1|  lipid transfer protein                               94.4    6e-21   Dianthus caryophyllus [carnation]
gb|AFK36168.1|  unknown                                               94.0    7e-21   Lotus japonicus
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  94.0    9e-21   Nicotiana tomentosiformis
gb|ACL01093.1|  lipid transfer protein                                94.0    1e-20   Castanea mollissima
gb|ADK60918.1|  lipid transfer protein                                94.0    1e-20   Castanea sativa
gb|AAX84944.1|  non-specific lipid transfer protein-like antimicr...  93.6    1e-20   Leonurus japonicus [Chinese motherwort]
gb|ABG54494.1|  putative allergen Rub i 3                             93.6    1e-20   Rubus idaeus [European raspberry]
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  93.2    2e-20   Fragaria vesca subsp. vesca
gb|ADV02772.1|  lipid transfer protein 1a                             93.2    2e-20   Ipomoea batatas [batate]
gb|AAY83346.1|  non-specific lipid transfer protein precursor         93.2    2e-20   Fragaria x ananassa
dbj|BAC77694.1|  lipid transfer protein                               93.2    2e-20   Atriplex nummularia
ref|XP_011466421.1|  PREDICTED: non-specific lipid-transfer prote...  92.8    2e-20   Fragaria vesca subsp. vesca
ref|XP_003579021.1|  PREDICTED: probable non-specific lipid-trans...  92.8    2e-20   Brachypodium distachyon [annual false brome]
sp|A0AT28.1|NLTP1_LENCU  RecName: Full=Non-specific lipid-transfe...  92.8    3e-20   Lens culinaris
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    3e-20   Fragaria vesca subsp. vesca
ref|XP_011091590.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    4e-20   Sesamum indicum [beniseed]
dbj|BAO51648.1|  lipid transfer protein                               92.4    4e-20   Suaeda japonica
ref|XP_009398877.1|  PREDICTED: non-specific lipid-transfer prote...  92.0    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABQ53932.1|  lipid transfer protein                                92.0    4e-20   Sesamum indicum [beniseed]
gb|AAT80649.1|  lipid transfer protein precursor                      92.0    5e-20   Malus domestica [apple tree]
gb|ABB96481.1|  non-specific lipid transfer protein precursor         91.7    7e-20   Malus domestica [apple tree]
ref|XP_009396871.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    7e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    91.3    8e-20   Malus domestica [apple tree]
gb|AFK44274.1|  unknown                                               91.3    8e-20   Medicago truncatula
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   91.3    9e-20   
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            91.7    9e-20   Cicer arietinum [garbanzo]
ref|XP_003605266.1|  Non-specific lipid-transfer protein              91.3    9e-20   Medicago truncatula
emb|CAC86258.1|  lipid transfer protein                               91.3    1e-19   Fragaria x ananassa
gb|AAR22488.1|  allergen Mal d 3                                      90.9    1e-19   Malus domestica [apple tree]
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  90.9    1e-19   
gb|AAT68265.1|  lipid transfer protein precursor                      90.5    1e-19   Nicotiana glauca [glaucous tobacco]
gb|ACM78613.1|  lipid transfer protein 1                              90.9    1e-19   Tamarix hispida
gb|AAK01293.1|AF331710_1  lipid transfer protein                      90.9    1e-19   Avicennia marina
gb|ACQ42221.1|  lipid transfer protein                                90.9    1e-19   Chimonanthus praecox [wintersweet]
emb|CDP14198.1|  unnamed protein product                              90.5    2e-19   Coffea canephora [robusta coffee]
gb|AAF28385.1|AF151214_1  lipid-transfer protein                      90.5    2e-19   Nicotiana glauca [glaucous tobacco]
ref|XP_008778766.1|  PREDICTED: non-specific lipid-transfer prote...  90.1    2e-19   Phoenix dactylifera
gb|AAY83344.1|  non-specific lipid transfer protein precursor         90.1    2e-19   Fragaria x ananassa
emb|CAB96874.1|  mal d 3                                              89.4    2e-19   Malus domestica [apple tree]
sp|A0AT30.1|NLTP3_LENCU  RecName: Full=Non-specific lipid-transfe...  90.1    2e-19   Lens culinaris
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   89.7    3e-19   Pyrus x bretschneideri [bai li]
gb|AES87466.2|  Lipid transfer protein                                90.5    3e-19   Medicago truncatula
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   89.7    3e-19   Pyrus x bretschneideri [bai li]
emb|CCD33109.1|  lipid transfer protein                               89.7    3e-19   Vigna radiata [mung bean]
gb|ACI47547.1|  nonspecific lipid transfer protein                    89.7    3e-19   Juglans regia
ref|XP_011091601.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    4e-19   Sesamum indicum [beniseed]
ref|XP_004516173.1|  PREDICTED: non-specific lipid-transfer prote...  89.4    4e-19   Cicer arietinum [garbanzo]
gb|AAS13435.1|  lipid-transfer protein                                89.4    5e-19   Nicotiana attenuata
ref|XP_006663744.1|  PREDICTED: probable non-specific lipid-trans...  89.0    6e-19   Oryza brachyantha
gb|ACM78614.1|  lipid transfer protein 2                              89.0    6e-19   Tamarix hispida
emb|CAA80809.1|  lipid transfer protein                               89.0    8e-19   Oryza sativa Indica Group [Indian rice]
sp|Q43766.1|NLTP3_HORVU  RecName: Full=Non-specific lipid-transfe...  88.6    8e-19   Hordeum vulgare [barley]
gb|ADR66947.1|  non-specific lipid transfer protein                   88.6    8e-19   Prunus armeniaca
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...  88.6    9e-19   Oryza brachyantha
ref|XP_008798560.1|  PREDICTED: non-specific lipid-transfer prote...  88.6    9e-19   Phoenix dactylifera
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...  88.6    9e-19   Oryza brachyantha
gb|ADR66948.1|  non-specific lipid transfer protein                   88.6    1e-18   Prunus armeniaca
gb|AGN56422.1|  non-specific lipid transfer protein 2                 88.6    1e-18   Linum usitatissimum
gb|AGN56421.1|  non-specific lipid transfer protein 1                 88.6    1e-18   Linum usitatissimum
gb|AAY83342.1|  non-specific lipid transfer protein precursor         88.6    1e-18   Fragaria x ananassa
ref|XP_003605269.1|  Non-specific lipid-transfer protein              89.7    1e-18   
dbj|BAK05751.1|  predicted protein                                    88.2    1e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABA33862.1|  phospholipid transfer protein 1                       88.2    1e-18   Zea diploperennis [chapule]
gb|ABA33857.1|  phospholipid transfer protein 1                       88.2    1e-18   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006662672.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    1e-18   Oryza brachyantha
ref|XP_007134701.1|  hypothetical protein PHAVU_010G069100g           88.2    1e-18   Phaseolus vulgaris [French bean]
ref|XP_008779709.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    1e-18   
ref|XP_009410515.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL25839.1|  lipid transfer precursor protein                      87.8    2e-18   Hevea brasiliensis [jebe]
gb|ABA33846.1|  phospholipid transfer protein 1                       87.8    2e-18   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010922734.1|  PREDICTED: non-specific lipid-transfer prote...  87.8    2e-18   Elaeis guineensis
gb|AHB19225.1|  non specific lipid transfer protein 1C                87.8    2e-18   Punica granatum [granado]
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...  87.8    2e-18   Nelumbo nucifera [Indian lotus]
sp|P81651.2|NLTP1_PRUAR  RecName: Full=Non-specific lipid-transfe...  87.0    2e-18   Prunus armeniaca
ref|XP_008244911.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    2e-18   Prunus mume [ume]
gb|AET05730.1|  lipid transfer protein isoform a                      87.0    2e-18   Pyrus communis
gb|ABA33848.1|  phospholipid transfer protein 1                       87.4    2e-18   Zea mays subsp. parviglumis [Balsas teosinte]
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  86.7    2e-18   Prunus domestica
gb|ABA33849.1|  phospholipid transfer protein 1                       87.4    2e-18   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33850.1|  phospholipid transfer protein 1                       87.4    3e-18   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33847.1|  phospholipid transfer protein 1                       87.4    3e-18   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105311.1|  non-specific lipid-transfer protein precursor    87.4    3e-18   
gb|AAQ74628.1|  lipid tranfer protein II                              87.4    3e-18   Vigna radiata [mung bean]
gb|ABA33858.1|  phospholipid transfer protein 1                       87.0    3e-18   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33866.1|  phospholipid transfer protein 1                       87.0    3e-18   Zea diploperennis [chapule]
gb|ABA33860.1|  phospholipid transfer protein 1                       87.0    3e-18   Zea diploperennis [chapule]
gb|AAP92127.1|  lipid transfer protein LPT1                           87.0    3e-18   Oryza sativa Japonica Group [Japonica rice]
pdb|1T12|A  Chain A, Solution Structure Of A New Ltp1                 86.3    3e-18   Nicotiana tabacum [American tobacco]
ref|XP_002442776.1|  hypothetical protein SORBIDRAFT_08g002690        87.0    3e-18   Sorghum bicolor [broomcorn]
gb|AAT68262.1|  lipid transfer protein                                87.0    3e-18   Nicotiana glauca [glaucous tobacco]
gb|ABA33853.1|  phospholipid transfer protein 1                       86.7    3e-18   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    3e-18   Sesamum indicum [beniseed]
ref|XP_009608993.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    4e-18   Nicotiana tomentosiformis
ref|XP_009631888.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    4e-18   Nicotiana tomentosiformis
ref|XP_008798559.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    4e-18   Phoenix dactylifera
ref|XP_010483551.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    4e-18   Nicotiana sylvestris
ref|XP_010443685.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008244970.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    4e-18   Prunus mume [ume]
gb|AFR43276.1|  lipid transfer protein precursor                      86.7    4e-18   Gossypium herbaceum subsp. africanum
emb|CDM80995.1|  unnamed protein product                              86.7    4e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010454878.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    5e-18   Camelina sativa [gold-of-pleasure]
sp|O23758.1|NLTP_CICAR  RecName: Full=Non-specific lipid-transfer...  86.7    5e-18   Cicer arietinum [garbanzo]
gb|AEN70936.1|  lipid transfer protein                                86.7    5e-18   Gossypium gossypioides
gb|AAK20395.1|AF334185_1  lipid transfer protein precursor            86.7    5e-18   Triticum aestivum [Canadian hard winter wheat]
gb|AFX65219.1|  lipid transfer precursor protein                      86.7    5e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009761744.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    5e-18   Nicotiana sylvestris
sp|P80273.2|NLTP3_VITSX  RecName: Full=Non-specific lipid-transfe...  85.9    5e-18   Vitis sp.
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            86.7    5e-18   Gossypium hirsutum [American cotton]
emb|CBI18043.3|  unnamed protein product                              87.0    5e-18   Vitis vinifera
ref|XP_008442324.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    6e-18   Cucumis melo [Oriental melon]
ref|XP_010690793.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    6e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    6e-18   Nelumbo nucifera [Indian lotus]
ref|XP_002270970.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    6e-18   Vitis vinifera
ref|XP_009132019.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    6e-18   Brassica rapa
gb|AET05731.1|  lipid transfer protein isoform b                      85.5    6e-18   Pyrus communis
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  86.3    6e-18   Oryza sativa Japonica Group [Japonica rice]
gb|AEC04836.1|  lipid transfer protein                                86.3    6e-18   Dimocarpus longan [longan]
gb|AAB70539.1|  lipid transfer protein LPT II                         86.3    6e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001176316.1|  Os11g0115466                                     86.3    7e-18   
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    7e-18   Prunus mume [ume]
ref|NP_001065986.1|  Os12g0115000                                     85.9    7e-18   
sp|Q43871.1|NLTP8_HORVU  RecName: Full=Non-specific lipid-transfe...  85.9    8e-18   Hordeum vulgare [barley]
gb|AAA74624.1|  lipid transfer protein precursor                      85.9    8e-18   Oryza sativa [red rice]
gb|ACJ62320.1|  lipid-transfer protein                                85.9    9e-18   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor   85.9    9e-18   Glycine max [soybeans]
gb|AFD32275.1|  stigma/style cysteine-rich adhesin                    85.9    9e-18   Lilium hybrid cultivar
gb|AFD32273.1|  stigma/style cysteine-rich adhesin                    85.9    9e-18   Lilium hybrid cultivar
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  85.9    1e-17   Pyrus communis
ref|XP_006362360.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    1e-17   Solanum tuberosum [potatoes]
ref|XP_011091599.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    1e-17   Sesamum indicum [beniseed]
emb|CAT99615.1|  lipid transfer protein                               84.7    1e-17   Malus domestica [apple tree]
ref|XP_010043171.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    1e-17   Eucalyptus grandis [rose gum]
gb|ADR66953.1|  non-specific lipid transfer protein                   85.5    1e-17   Prunus dulcis [sweet almond]
sp|Q03461.1|NLTP2_TOBAC  RecName: Full=Non-specific lipid-transfe...  85.5    1e-17   Nicotiana tabacum [American tobacco]
gb|AFK46170.1|  unknown                                               85.5    1e-17   Lotus japonicus
gb|ACJ62316.1|  lipid-transfer protein                                85.5    1e-17   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004978531.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    1e-17   Setaria italica
ref|NP_001150972.1|  nonspecific lipid-transfer protein 3 precursor   85.5    2e-17   
ref|NP_001142300.1|  uncharacterized protein LOC100274469 precursor   85.5    2e-17   Zea mays [maize]
ref|XP_009757911.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   Nicotiana sylvestris
gb|ABK96813.1|  lipid transfer protein isoform 1.1 precursor          85.1    2e-17   Lactuca sativa [cultivated lettuce]
gb|ABA33859.1|  phospholipid transfer protein 1                       85.1    2e-17   Zea diploperennis [chapule]
ref|NP_001275027.1|  non-specific lipid transfer protein a7 precu...  85.1    2e-17   Solanum tuberosum [potatoes]
ref|XP_009626829.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   Nicotiana tomentosiformis
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           85.5    2e-17   
gb|AAT68264.1|  lipid transfer protein                                85.1    2e-17   Nicotiana glauca [glaucous tobacco]
ref|XP_008244918.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   Prunus mume [ume]
gb|KHG21711.1|  Non-specific lipid-transfer                           85.1    2e-17   Gossypium arboreum [tree cotton]
ref|XP_007134675.1|  hypothetical protein PHAVU_010G066500g           85.1    2e-17   Phaseolus vulgaris [French bean]
sp|Q43193.1|NLTP1_SORBI  RecName: Full=Non-specific lipid-transfe...  85.1    2e-17   Sorghum bicolor [broomcorn]
dbj|BAH03575.1|  nonspecific lipid transfer protein                   84.7    2e-17   Citrus jambhiri [citronelle]
dbj|BAJ91878.1|  predicted protein                                    84.7    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010035997.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   Eucalyptus grandis [rose gum]
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       85.1    2e-17   Jatropha curcas
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  84.7    2e-17   Prunus dulcis [sweet almond]
ref|XP_006662670.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   Oryza brachyantha
ref|XP_011091591.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    2e-17   Sesamum indicum [beniseed]
ref|XP_011091597.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    2e-17   Sesamum indicum [beniseed]
gb|ADR66949.1|  non-specific lipid transfer protein                   84.7    2e-17   Prunus sargentii
ref|XP_006429570.1|  hypothetical protein CICLE_v10013139mg           84.7    2e-17   Citrus clementina [clementine]
ref|XP_010529189.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    2e-17   Tarenaya hassleriana [spider flower]
gb|ABY21307.1|  pollen allergen Pla o 3                               84.7    3e-17   Platanus orientalis
sp|P85105.1|NLTP5_VITSX  RecName: Full=Non-specific lipid-transfe...  84.0    3e-17   Vitis sp.
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    3e-17   Nelumbo nucifera [Indian lotus]
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    3e-17   Prunus mume [ume]
gb|AEN70915.1|  lipid transfer protein                                84.7    3e-17   Gossypium thurberi
gb|ACJ62381.1|  lipid-transfer protein                                84.7    3e-17   Zea mays subsp. parviglumis [Balsas teosinte]
gb|KJB71535.1|  hypothetical protein B456_011G128300                  84.7    3e-17   Gossypium raimondii
gb|AFD32274.1|  stigma/style cysteine-rich adhesin                    84.3    3e-17   Lilium hybrid cultivar
ref|NP_001275802.1|  lipid-transfer protein precursor                 84.3    3e-17   Citrus sinensis [apfelsine]
gb|ACG40474.1|  nonspecific lipid-transfer protein 2 precursor        84.7    3e-17   Zea mays [maize]
ref|XP_002442774.1|  hypothetical protein SORBIDRAFT_08g002670        84.7    3e-17   Sorghum bicolor [broomcorn]
gb|AEN70918.1|  lipid transfer protein                                84.3    3e-17   Gossypium turneri
gb|ACJ62387.1|  lipid-transfer protein                                84.3    4e-17   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001241144.1|  uncharacterized protein LOC100817318 precursor   84.3    4e-17   Glycine max [soybeans]
ref|XP_010043178.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    4e-17   Eucalyptus grandis [rose gum]
gb|ABH03042.1|  non-specific lipid transfer protein                   84.0    4e-17   Solanum sogarandinum
ref|NP_568905.1|  non-specific lipid-transfer protein 3               84.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB09777.1|  lipid transfer protein-like                          84.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KCW47519.1|  hypothetical protein EUGRSUZ_K01282                   84.0    4e-17   Eucalyptus grandis [rose gum]
gb|EYU41040.1|  hypothetical protein MIMGU_mgv1a016547mg              84.0    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_006355283.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    4e-17   Solanum tuberosum [potatoes]
gb|ACP43542.1|  lipid transfer protein                                84.0    5e-17   Chimonanthus praecox [wintersweet]
ref|XP_010690794.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    5e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|AAF23460.1|AF208834_1  non-specific lipid transfer protein pre...  84.0    5e-17   Capsicum annuum
ref|XP_006355281.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    5e-17   Solanum tuberosum [potatoes]
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            84.0    5e-17   
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           84.0    5e-17   Citrus clementina [clementine]
gb|KHG30577.1|  Non-specific lipid-transfer                           84.0    5e-17   Gossypium arboreum [tree cotton]
gb|ADY68820.1|  lipid transfer protein 3                              84.0    5e-17   Gossypium herbaceum subsp. africanum
gb|AAG29777.1|  lipid transfer protein 3 precursor                    84.0    5e-17   Gossypium hirsutum [American cotton]
gb|AFD32272.1|  stigma/style cysteine-rich adhesin                    83.6    5e-17   Lilium hybrid cultivar
ref|XP_006346674.1|  PREDICTED: non-specific lipid-transfer prote...  83.6    5e-17   Solanum tuberosum [potatoes]
gb|AEV12221.1|  stigma/stylar cysteine-rich adhesin                   83.6    5e-17   Lilium longiflorum [Easter lily]
gb|AAQ74627.1|  lipid transfer protein I                              84.0    5e-17   Vigna radiata [mung bean]
gb|AAY43801.1|  FSLTP3                                                83.6    6e-17   Gossypium hirsutum [American cotton]
gb|ADR66946.1|  non-specific lipid transfer protein                   83.6    6e-17   Prunus armeniaca
gb|ACB05670.1|  putative non-specific lipid transfer protein          83.6    6e-17   Capsicum annuum
ref|XP_009757912.1|  PREDICTED: uncharacterized protein LOC104210662  86.3    6e-17   Nicotiana sylvestris
gb|ABA34089.1|  phospholipid transfer protein 2                       83.6    6e-17   Zea mays subsp. parviglumis [Balsas teosinte]
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...  83.6    6e-17   Lens culinaris
ref|XP_008370253.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    6e-17   
gb|EYU41041.1|  hypothetical protein MIMGU_mgv1a016543mg              83.6    6e-17   Erythranthe guttata [common monkey flower]
gb|ACZ06858.1|  lipid transfer protein                                83.6    6e-17   Glycine soja [wild soybean]
gb|KDO64078.1|  hypothetical protein CISIN_1g033544mg                 83.6    7e-17   Citrus sinensis [apfelsine]
gb|AEN70916.1|  lipid transfer protein                                83.6    7e-17   Gossypium laxum
gb|AEV23220.1|  stigma/stylar cysteine-rich adhesin                   83.6    7e-17   Lilium longiflorum [Easter lily]
gb|AFX66972.1|  non-specific lipid transfer protein 2                 83.6    7e-17   Solanum tuberosum [potatoes]
gb|AEN70919.1|  lipid transfer protein                                83.6    7e-17   Gossypium mustelinum
ref|XP_002864626.1|  hypothetical protein ARALYDRAFT_496059           83.6    7e-17   
gb|EYU41036.1|  hypothetical protein MIMGU_mgv1a016508mg              83.6    7e-17   Erythranthe guttata [common monkey flower]
ref|XP_006355280.1|  PREDICTED: non-specific lipid-transfer prote...  83.6    7e-17   Solanum tuberosum [potatoes]
emb|CAN70512.1|  hypothetical protein VITISV_005630                   83.6    7e-17   Vitis vinifera
gb|AAG27707.1|AF302788_1  lipid transfer protein precursor            83.2    7e-17   Triticum aestivum [Canadian hard winter wheat]
pdb|1FK0|A  Chain A, Structural Basis Of Non-Specific Lipid Bindi...  82.8    7e-17   Zea mays [maize]
gb|AEI70828.1|  non-specific lipid-transfer protein                   83.2    8e-17   Helianthus annuus
gb|ABA29446.1|  non-specific lipid transfer protein                   83.2    8e-17   Vitis vinifera
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           83.2    9e-17   Prunus persica
gb|AAK28533.1|AF329829_1  lipid transfer protein precursor            83.2    9e-17   Corylus avellana [European hazelnut]
emb|CAA65680.1|  lipid transfer protein 7a2b                          83.2    9e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009800887.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    9e-17   Nicotiana sylvestris
gb|AGH27866.1|  lipid transfer protein precursor                      83.2    9e-17   Prunus kansuensis [gan su tao]
emb|CAQ86909.1|  lipid transfer protein                               83.2    1e-16   Vigna radiata [mung bean]
gb|AAO33357.1|AF465408_1  nonspecific lipid transfer protein 1        83.2    1e-16   Vitis cinerea var. helleri x Vitis vinifera
emb|CAL07989.1|  lipid transfer protein                               83.2    1e-16   Platanus x hispanica [London plane tree]
emb|CAH69207.1|  type 1 non specific lipid transfer protein precu...  82.8    1e-16   Triticum aestivum [Canadian hard winter wheat]
gb|ABA33867.1|  phospholipid transfer protein 1                       83.2    1e-16   Zea diploperennis [chapule]
gb|AAY43800.1|  FSLTP2                                                83.2    1e-16   Gossypium hirsutum [American cotton]
gb|ADR66950.1|  non-specific lipid transfer protein                   82.8    1e-16   Prunus sargentii
gb|AET05733.1|  lipid transfer protein isoform d                      82.4    1e-16   Pyrus communis
gb|ADR66945.1|  non-specific lipid transfer protein                   82.8    1e-16   Prunus armeniaca
ref|WP_039311159.1|  hypothetical protein                             82.4    1e-16   
gb|AEN70933.1|  lipid transfer protein                                82.8    1e-16   Gossypium davidsonii
gb|ABA34098.1|  phospholipid transfer protein 2                       82.8    1e-16   Zea diploperennis [chapule]
gb|ABP01769.1|  lipid transfer protein 2                              82.8    1e-16   Salvia miltiorrhiza [Chinese salvia]
gb|AAT45202.1|  lipid transfer protein 1 precursor                    82.8    1e-16   Nicotiana tabacum [American tobacco]
gb|KHG09865.1|  Non-specific lipid-transfer P3                        82.8    1e-16   Gossypium arboreum [tree cotton]
gb|ABA33855.1|  phospholipid transfer protein 1                       82.8    1e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|KFK26696.1|  hypothetical protein AALP_AA8G281300                  82.4    1e-16   Arabis alpina [alpine rockcress]
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           82.4    1e-16   Arabidopsis lyrata subsp. lyrata
gb|ACG30522.1|  nonspecific lipid-transfer protein 1 precursor        82.8    1e-16   Zea mays [maize]
ref|XP_002442775.1|  hypothetical protein SORBIDRAFT_08g002680        82.4    2e-16   
ref|XP_009764784.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    2e-16   Nicotiana sylvestris
ref|XP_006292059.1|  hypothetical protein CARUB_v10018254mg           82.4    2e-16   
gb|AGV40204.1|  nonspecific lipid-transfer protein 3                  82.8    2e-16   
ref|XP_009797053.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    2e-16   
gb|AGC08426.1|  lipid transfer protein                                82.4    2e-16   
sp|Q43194.1|NLTP2_SORBI  RecName: Full=Non-specific lipid-transfe...  82.4    2e-16   
ref|XP_011091596.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    2e-16   
ref|XP_009797052.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    2e-16   
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            82.4    2e-16   
sp|Q9SW93.1|SCA_LILLO  RecName: Full=Stigma/stylar cysteine-rich ...  82.4    2e-16   
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  81.6    2e-16   
gb|ACQ42222.1|  lipid transfer protein 1                              82.4    2e-16   
ref|XP_008662435.1|  PREDICTED: non-specific lipid-transfer protein   82.4    2e-16   
tpg|DAA59277.1|  TPA: hypothetical protein ZEAMMB73_838830            83.2    2e-16   
gb|ACJ62323.1|  lipid-transfer protein                                82.4    2e-16   
gb|ACJ62315.1|  lipid-transfer protein                                82.4    2e-16   
emb|CAB96876.2|  pru p 1                                              81.6    2e-16   
gb|AAA86694.1|  phospholipid transfer protein precursor               82.0    2e-16   
ref|XP_009346911.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    2e-16   
gb|AFR43295.1|  lipid transfer protein precursor                      82.0    2e-16   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  82.0    2e-16   
gb|ACJ62339.1|  lipid-transfer protein                                82.0    2e-16   
gb|AFR43294.1|  lipid transfer protein precursor                      82.0    2e-16   
dbj|BAI94498.1|  lipid transfer protein                               82.0    2e-16   
ref|NP_568904.1|  non-specific lipid-transfer protein 4               82.0    2e-16   
gb|ABF14723.1|  non-specific lipid transfer protein 1 precursor       82.0    2e-16   
gb|AAM66088.1|  nonspecific lipid-transfer protein precursor-like...  82.0    2e-16   
gb|KHL91133.1|  hypothetical protein QW71_36410                       82.0    2e-16   
ref|XP_002864627.1|  predicted protein                                82.0    2e-16   
gb|KJB38056.1|  hypothetical protein B456_006G235000                  82.0    2e-16   
gb|AGW21344.1|  lipid transfer protein                                82.0    2e-16   
gb|AHB19226.1|  non specific lipid transfer protein 1B                82.0    2e-16   
sp|P85894.1|LTP1_MORNI  RecName: Full=Non-specific lipid-transfer...  81.3    2e-16   
gb|AAR83849.1|  nonspecific lipid transfer protein 2 precursor        82.0    2e-16   
ref|XP_006367394.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    3e-16   
gb|AEN70917.1|  lipid transfer protein                                82.0    3e-16   
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...  82.0    3e-16   
gb|AHG99490.1|  lipid-transfer protein                                82.0    3e-16   
gb|ACJ62319.1|  lipid-transfer protein                                82.0    3e-16   
gb|ACJ62318.1|  lipid-transfer protein                                82.0    3e-16   
gb|AAX08122.1|  lipid transfer protein III                            81.6    3e-16   
ref|XP_006367395.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    3e-16   
gb|AFD32278.1|  stigma/style cysteine-rich adhesin                    81.6    3e-16   
gb|ACP30545.1|  lipid transfer protein precursor                      81.6    3e-16   
gb|ACJ62355.1|  lipid-transfer protein                                81.6    3e-16   
gb|ABA33854.1|  phospholipid transfer protein 1                       82.0    3e-16   
sp|E6Y8S8.1|NLTP1_APIGR  RecName: Full=Non-specific lipid-transfe...  81.6    3e-16   
ref|XP_010277659.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    3e-16   
ref|NP_001268074.1|  lipid transfer protein precursor                 81.6    3e-16   
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  80.9    3e-16   
gb|ABA33856.1|  phospholipid transfer protein 1                       81.6    3e-16   
ref|XP_006573392.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    3e-16   
gb|AAA03283.1|  CW18=non-specific lipid transfer protein              80.9    3e-16   
gb|AGH32497.1|  non-specific lipid transfer protein                   81.6    3e-16   
gb|AET05732.1|  lipid transfer protein isoform c                      80.9    3e-16   
ref|XP_004249042.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    3e-16   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            81.6    3e-16   
gb|AAX20049.1|  putative non-specific lipid transfer protein          81.6    3e-16   
gb|ACJ62326.1|  lipid-transfer protein                                81.6    4e-16   
ref|NP_001233953.1|  non-specific lipid-transfer protein 2 precursor  81.3    4e-16   
gb|AAV40850.1|  lipid transfer protein 1 precursor                    81.3    4e-16   
ref|XP_011091603.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    4e-16   
gb|AEI70830.1|  non-specific lipid-transfer protein                   81.3    4e-16   
ref|XP_003605345.1|  Non-specific lipid-transfer protein              81.3    4e-16   
gb|AGW21333.1|  lipid transfer protein                                81.3    4e-16   
gb|AGH27864.1|  lipid transfer protein precursor                      81.3    4e-16   
ref|XP_006362358.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    4e-16   
gb|AFD32277.1|  stigma/style cysteine-rich adhesin                    81.3    4e-16   
ref|NP_001105392.1|  phospholipid transfer protein precursor          81.3    4e-16   
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           81.3    4e-16   
ref|XP_006403901.1|  hypothetical protein EUTSA_v10010826mg           81.3    4e-16   
ref|XP_010443684.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    4e-16   
ref|XP_009372014.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    5e-16   
emb|CBW38499.1|  lipid transfer protein                               80.9    5e-16   
gb|AFD32276.1|  stigma/style cysteine-rich adhesin                    81.3    5e-16   
gb|KJB71510.1|  hypothetical protein B456_011G128200                  81.3    5e-16   
emb|CAH03799.1|  lipid transfer protein                               80.5    5e-16   
gb|KJB71509.1|  hypothetical protein B456_011G128200                  81.3    5e-16   
ref|NP_001268120.1|  lipid transfer protein precursor                 81.3    5e-16   
ref|XP_010683517.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    5e-16   
gb|AEN70935.1|  lipid transfer protein                                81.3    6e-16   
gb|ACJ62361.1|  lipid-transfer protein                                80.9    6e-16   
ref|XP_006367396.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    6e-16   
gb|AGC08428.1|  lipid transfer protein                                80.9    6e-16   
ref|XP_007033544.1|  Non-specific lipid-transfer protein 3, putative  80.9    6e-16   
ref|NP_001274465.1|  non-specific lipid-transfer protein 3-like p...  80.9    6e-16   
ref|XP_009132002.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    6e-16   
ref|XP_008350568.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    7e-16   
ref|XP_009372010.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    7e-16   
gb|ABU49730.1|  putative non-specific lipid transfer protein b1       80.5    7e-16   
gb|ABK28789.1|  lipid transfer protein                                80.5    7e-16   
emb|CAH04990.1|  type 1 non-specific lipid transfer protein precu...  80.5    7e-16   
emb|CBW38498.1|  lipid transfer protein                               80.5    7e-16   
gb|AAC49860.1|  non-specific lipid transfer protein PvLTP-24          80.5    7e-16   
ref|XP_003605349.1|  Non-specific lipid-transfer protein              80.5    8e-16   
gb|ABB90546.1|  lipid transfer protein                                80.5    8e-16   
sp|Q43129.1|NLTP2_GOSHI  RecName: Full=Non-specific lipid-transfe...  80.5    8e-16   
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    8e-16   
ref|XP_006355279.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    9e-16   
ref|XP_004249048.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    9e-16   
sp|Q42762.1|NLTP1_GOSHI  RecName: Full=Non-specific lipid-transfe...  80.5    9e-16   
gb|AGH27863.1|  lipid transfer protein precursor                      80.5    9e-16   
emb|CAH69206.1|  type 1 non specific lipid transfer protein precu...  80.5    9e-16   
pir||S33460  lipid transfer protein - sorghum (fragment)              80.1    9e-16
emb|CBW38504.1|  lipid transfer protein                               80.1    9e-16   
ref|XP_008388341.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    9e-16   
ref|NP_001234735.1|  non-specific lipid transfer protein precursor    80.5    9e-16   
gb|AER92599.1|  putative lipid transfer protein                       80.5    1e-15   
ref|XP_010529176.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    1e-15   
gb|ACJ62342.1|  lipid-transfer protein                                80.5    1e-15   
gb|ADR66942.1|  non-specific lipid transfer protein                   80.1    1e-15   
gb|AHB19227.1|  non specific lipid transfer protein 1A                80.5    1e-15   
gb|ABA34080.1|  phospholipid transfer protein 2                       80.1    1e-15   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  80.1    1e-15   
emb|CBW38497.1|  lipid transfer protein                               79.7    1e-15   
gb|AEI70827.1|  non-specific lipid-transfer protein                   80.1    1e-15   
dbj|BAB09776.1|  lipid transfer protein-like                          80.1    1e-15   
gb|ADR66943.1|  non-specific lipid transfer protein                   80.1    1e-15   
gb|AGH13363.1|  lipid transfer protein                                79.7    1e-15   
gb|ABO28527.1|  lipid transfer protein                                80.1    1e-15   
emb|CBW38501.1|  lipid transfer protein                               79.7    1e-15   
ref|XP_008350569.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    1e-15   
gb|AAQ96338.1|  lipid transfer protein                                80.1    1e-15   
ref|XP_011095135.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    1e-15   
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       80.1    1e-15   
gb|KFK27462.1|  hypothetical protein AALP_AA8G386200                  79.7    1e-15   
ref|XP_010515586.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    1e-15   
gb|EMT04675.1|  Non-specific lipid-transfer protein 4.3               80.1    1e-15   
emb|CAH04988.1|  type 1 non-specific lipid transfer protein precu...  80.1    1e-15   
gb|KFK34403.1|  hypothetical protein AALP_AA5G140600                  80.1    1e-15   
ref|NP_001065989.2|  Os12g0115500                                     79.3    1e-15   
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               79.7    1e-15   
gb|AFV30232.1|  lipid transfer protein                                79.7    1e-15   
gb|ACG43443.1|  nonspecific lipid-transfer protein 4 precursor        79.3    2e-15   
gb|ADB12473.1|  lipid transfer protein                                79.0    2e-15   
ref|XP_006281283.1|  hypothetical protein CARUB_v10027331mg           80.5    2e-15   
gb|AGC08425.1|  lipid transfer protein                                80.1    2e-15   
ref|XP_006429568.1|  hypothetical protein CICLE_v10012953mg           80.9    2e-15   
emb|CAT99613.1|  lipid transfer protein                               79.0    2e-15   
gb|AFI61838.1|  harmalin                                              79.7    2e-15   
gb|AEV23221.1|  stigma/stylar cysteine-rich adhesin                   79.7    2e-15   
emb|CDM80963.1|  unnamed protein product                              79.7    2e-15   
ref|XP_006664278.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  79.7    2e-15   
prf||2115353B  lipid transfer protein                                 79.7    2e-15
sp|Q43767.1|NLT41_HORVU  RecName: Full=Non-specific lipid-transfe...  79.3    2e-15   
ref|XP_002532869.1|  Nonspecific lipid-transfer protein precursor...  79.7    2e-15   
sp|Q43748.1|NLTP_BETVU  RecName: Full=Non-specific lipid-transfer...  79.7    2e-15   
gb|AAB70538.1|  lipid transfer protein                                79.3    2e-15   
gb|ACG29829.1|  nonspecific lipid-transfer protein 1 precursor        79.7    2e-15   
emb|CDM80997.1|  unnamed protein product                              79.3    2e-15   
gb|EYU42014.1|  hypothetical protein MIMGU_mgv1a016509mg              79.3    2e-15   
ref|XP_006362359.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    2e-15   
ref|XP_010443683.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    2e-15   
ref|XP_010483549.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    2e-15   
pir||JH0379  phospholipid transfer protein 6B6 - maize (fragment)     79.0    2e-15
ref|XP_010529934.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    2e-15   
emb|CAH69190.1|  type 1 non specific lipid transfer protein precu...  79.3    2e-15   
ref|XP_006281350.1|  hypothetical protein CARUB_v10027406mg           79.0    2e-15   
gb|ABA34092.1|  phospholipid transfer protein 2                       79.3    3e-15   
ref|XP_008388344.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    3e-15   
ref|XP_004978536.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    3e-15   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           79.3    3e-15   
gb|AFK47623.1|  unknown                                               79.0    3e-15   
gb|AFR54362.1|  nonspecific lipid transfer protein 5                  79.0    3e-15   
ref|XP_011091598.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    3e-15   
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg              79.0    3e-15   
gb|AEI70829.1|  non-specific lipid-transfer protein                   79.0    3e-15   
gb|AEI70826.1|  non-specific lipid-transfer protein                   79.0    3e-15   
ref|XP_009757307.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    3e-15   
ref|XP_010043291.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    3e-15   
gb|ADK36632.1|  lipid transfer-like protein                           78.2    3e-15   
ref|XP_009608991.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    3e-15   
ref|XP_004977380.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    3e-15   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    3e-15   
ref|XP_006367397.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    4e-15   
gb|ACM78617.1|  non-specific lipid-transfer protein type 1 subfam...  79.0    4e-15   
gb|AFR31532.1|  lipid transfer protein                                79.0    4e-15   
sp|A0AT31.1|NLTP5_LENCU  RecName: Full=Non-specific lipid-transfe...  78.6    4e-15   
ref|XP_010253093.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    4e-15   
ref|XP_007206148.1|  hypothetical protein PRUPE_ppa013428mg           79.0    4e-15   
gb|ABU49732.1|  putative non-specific lipid transfer protein b3       78.6    4e-15   
emb|CBW38503.1|  lipid transfer protein                               78.2    4e-15   
ref|XP_007134674.1|  hypothetical protein PHAVU_010G066400g           78.6    4e-15   
ref|XP_004137680.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    4e-15   
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    4e-15   
gb|AAF23459.1|AF208833_1  non-specific lipid transfer protein pre...  78.6    4e-15   
gb|AAM22768.1|  lipid transfer protein                                77.8    4e-15   
gb|ACN11576.1|  lipid transfer protein 3 precursor                    78.6    5e-15   
gb|ABA34083.1|  phospholipid transfer protein 2                       78.6    5e-15   
ref|XP_004978532.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    5e-15   
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    5e-15   
ref|XP_010035998.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    5e-15   
prf||2115353A  lipid transfer protein                                 78.2    5e-15
gb|KJB71508.1|  hypothetical protein B456_011G128100                  78.6    6e-15   
gb|ABA91221.2|  Nonspecific lipid-transfer protein 1 precursor, p...  78.2    6e-15   
pir||EPRZ  phospholipid transfer protein homolog - rice               77.4    6e-15
ref|XP_004977378.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    6e-15   
sp|O24038.1|NLTP2_SOLPN  RecName: Full=Non-specific lipid-transfe...  78.2    6e-15   
ref|XP_009778825.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    6e-15   
ref|XP_002877812.1|  hypothetical protein ARALYDRAFT_485511           78.2    6e-15   
gb|AAA70046.1|  lipid transfer protein precursor                      77.8    6e-15   
gb|KFK26695.1|  hypothetical protein AALP_AA8G281200                  77.8    7e-15   
ref|NP_001065583.1|  Os11g0115400                                     78.2    7e-15   
emb|CAT99614.1|  lipid transfer protein                               77.0    7e-15   
ref|NP_001065987.1|  Os12g0115100                                     77.8    7e-15   
ref|XP_010683516.1|  PREDICTED: non-specific lipid-transfer protein   77.8    8e-15   
ref|XP_010454858.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    8e-15   
gb|AAZ32875.1|  lipid transfer protein precursor                      77.0    8e-15   
gb|KHN44832.1|  Non-specific lipid-transfer protein 1                 78.6    8e-15   
ref|XP_004302622.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    9e-15   
gb|AAM22767.2|  lipid transfer protein 2 precursor                    77.8    9e-15   
emb|CAH69194.1|  type 1 non specific lipid transfer protein precu...  77.4    1e-14   
emb|CAA85484.1|  lipid transfer protein precursor                     77.4    1e-14   
dbj|BAK04894.1|  predicted protein                                    77.4    1e-14   
ref|XP_010454869.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    1e-14   
emb|CAA69949.1|  lipid transfer protein                               77.4    1e-14   
dbj|BAK05317.1|  predicted protein                                    77.4    1e-14   
ref|NP_001234074.1|  non-specific lipid-transfer protein 1 precursor  77.4    1e-14   
ref|XP_003562719.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    1e-14   
emb|CAH04983.1|  type 1 non-specific lipid transfer protein precu...  77.4    1e-14   
ref|XP_010503854.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    1e-14   



>gb|ABG27026.1| phosophlipid protein [Gymnadenia conopsea]
Length=121

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +2

Query  161  HAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
             A AAI+CG VASSL  CF YI G  PL   CC GV+ L AAA+TT DRQTAC CLK+L+
Sbjct  26   EASAAISCGQVASSLGRCFSYITGKGPLPQQCCNGVQGLNAAARTTPDRQTACTCLKTLS  85

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G++SG NP LAAG+PG+CGV++ YPIST+TDCS++H
Sbjct  86   GRISGLNPNLAAGLPGRCGVSIPYPISTTTDCSRVH  121



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAITCGTV  SL  C  Y+KG    +AACC GVK L +AA TT DRQ ACNCLKS 
Sbjct  76   PMAEAAITCGTVTGSLAPCIGYLKGGSGPSAACCGGVKRLNSAATTTPDRQAACNCLKSA  135

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            AG +SG NP +AAG+PGKCGVN+ Y ISTST+C+ I
Sbjct  136  AGAISGLNPNIAAGLPGKCGVNIPYKISTSTNCATI  171



>ref|XP_009396874.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=117

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PH   AITCG V S+L SC  Y  G  PL+ ACC GVK L +AAKTTADR+TAC C+KS 
Sbjct  21   PHVTLAITCGQVTSALSSCISYATGKGPLSTACCSGVKSLNSAAKTTADRKTACTCIKST  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
              +LSG   G  AG+PGKCGV++GYPIS STDCSK+
Sbjct  81   VSRLSGAQAGAIAGIPGKCGVSIGYPISASTDCSKV  116



>ref|NP_001065988.1| Os12g0115300 [Oryza sativa Japonica Group]
 gb|ABA96285.1| Nonspecific lipid-transfer protein precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF29007.1| Os12g0115300 [Oryza sativa Japonica Group]
 gb|EAY82036.1| hypothetical protein OsI_37222 [Oryza sativa Indica Group]
 gb|EAZ19436.1| hypothetical protein OsJ_34997 [Oryza sativa Japonica Group]
 dbj|BAG88412.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87093.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLK+L
Sbjct  22   PGASAAITCGQVGSAIAPCISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            AG +   N G AAG+PGKCGVNVG+PIS STDCSK+
Sbjct  82   AGTIKSLNLGAAAGIPGKCGVNVGFPISLSTDCSKV  117



>ref|NP_001065585.1| Os11g0116000 [Oryza sativa Japonica Group]
 gb|ABA91223.1| Nonspecific lipid-transfer protein precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27430.1| Os11g0116000 [Oryza sativa Japonica Group]
 gb|EAZ17209.1| hypothetical protein OsJ_32721 [Oryza sativa Japonica Group]
 dbj|BAG87779.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93418.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87082.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLK+L
Sbjct  22   PGASAAITCGQVGSAIAPCISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            AG +   N G AAG+PGKCGVNVG+PIS STDCSK+
Sbjct  82   AGTIKSLNLGAAAGIPGKCGVNVGFPISLSTDCSKV  117



>gb|EAY79716.1| hypothetical protein OsI_34868 [Oryza sativa Indica Group]
Length=118

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLK+L
Sbjct  22   PGASAAITCGQVGSAIAPCISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            AG +   N G AAG+PGKCGVNVG+PIS STDCSK+
Sbjct  82   AGTIKSLNLGAAAGIPGKCGVNVGFPISLSTDCSKV  117



>gb|ABA96286.1| Nonspecific lipid-transfer protein 3 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY82041.1| hypothetical protein OsI_37228 [Oryza sativa Indica Group]
 gb|EAZ19437.1| hypothetical protein OsJ_34998 [Oryza sativa Japonica Group]
Length=118

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSL
Sbjct  22   PGASAAITCGQVGSAIAPCISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            AG +   N G  AGVPGKCGVNVG+PIS STDC+K+
Sbjct  82   AGSIKSLNLGTVAGVPGKCGVNVGFPISLSTDCNKV  117



>emb|CAG28937.1| lipid transfer protein [Oryza sativa Japonica Group]
 gb|ABA91227.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ17211.1| hypothetical protein OsJ_32723 [Oryza sativa Japonica Group]
 dbj|BAG89260.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSL
Sbjct  22   PGASAAITCGQVGSAIAPCISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            AG +   N G  AGVPGKCGVNVG+PIS STDC+K+
Sbjct  82   AGSIKSLNLGTVAGVPGKCGVNVGFPISLSTDCNKV  117



>ref|XP_011007240.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAITCG V+SSL  C  Y++    + AACC G+K L +AA TT DRQ  CNCLKSL
Sbjct  22   PLAEAAITCGQVSSSLAQCIGYLQKGGAVPAACCSGLKSLNSAAATTPDRQGVCNCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AGK+SG N GLAAG+P KCGV++ Y IS STDC  + 
Sbjct  82   AGKISGLNYGLAAGLPSKCGVSISYKISPSTDCKTVK  118



>gb|EAY79718.1| hypothetical protein OsI_34870 [Oryza sativa Indica Group]
Length=121

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSL
Sbjct  22   PGASAAITCGQVGSAIAPCISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  442
            AG +   N G  AGVPGKCGVNVG+PIS STDC+K
Sbjct  82   AGSIKSLNLGTVAGVPGKCGVNVGFPISLSTDCNK  116



>gb|ABK96515.1| unknown [Populus trichocarpa x Populus deltoides]
Length=118

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAI+CG V+SSL  C  Y++    + AACC G+K L +AA TTADRQ  CNCLKSL
Sbjct  22   PLAEAAISCGQVSSSLAQCIGYLQKGGAVPAACCSGLKGLNSAATTTADRQGVCNCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AGK+SG N GLAAG+P KCGV++ Y IS STDC  + 
Sbjct  82   AGKISGINYGLAAGLPSKCGVSISYKISPSTDCKSVK  118



>ref|XP_003605309.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=545

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAITCGTV  SL  C  Y+KG    +AACC GVK L +AA TT DRQ ACNCLKS 
Sbjct  448  PMAEAAITCGTVTGSLAPCIGYLKGGSGPSAACCGGVKRLNSAATTTPDRQAACNCLKSA  507

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +SG NP +AAG+PGKCGVN+ Y ISTST+C+ I 
Sbjct  508  AGAISGLNPNIAAGLPGKCGVNIPYKISTSTNCATIR  544


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAI+CGTV S+L  C  Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  
Sbjct  19   PMADAAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH*NRLW  463
            AG +SG N   A+ +PGKCGVN+ Y ISTST+C +     +W
Sbjct  79   AGAISGLNTAAASALPGKCGVNIPYKISTSTNCHQGMKMMMW  120



>gb|ABK94706.1| unknown [Populus trichocarpa]
 gb|ABK95013.1| unknown [Populus trichocarpa]
 gb|ABK95765.1| unknown [Populus trichocarpa]
 gb|ABK95817.1| unknown [Populus trichocarpa]
Length=118

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAI+CG V+SSL  C  Y++    + AACC G+K L +AA TTADRQ  CNCLKSL
Sbjct  22   PLAEAAISCGQVSSSLAQCITYLQKGGAVPAACCSGLKGLNSAATTTADRQGVCNCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AGK+SG N G+AAG+P KCGV++ Y IS STDC  + 
Sbjct  82   AGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSVK  118



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAI+CG V+SSL  C  Y++    + AACC G+K L +AA TTADRQ  CNCLKSL
Sbjct  22   PLAEAAISCGQVSSSLAQCIGYLQKGGAVPAACCSGLKGLNSAATTTADRQGVCNCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AGK+SG N G+AAG+P KCGV++ Y IS STDC  + 
Sbjct  82   AGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSVK  118



>ref|NP_001065586.1| Os11g0116200 [Oryza sativa Japonica Group]
 dbj|BAF27431.1| Os11g0116200 [Oryza sativa Japonica Group]
Length=132

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A AAITCG V S++  C  Y+ G   LT  CC GVK L  AA+TTADRQ AC CLKSL
Sbjct  22   PGASAAITCGQVGSAIAPCISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  442
            AG +   N G  AGVPGKCGVNVG+PIS STDC+ 
Sbjct  82   AGSIKSLNLGTVAGVPGKCGVNVGFPISLSTDCNN  116



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEAAITCGTV  SL  C  Y+K   P+  ACC G+K L AAAKTTADRQ ACNCLK+ 
Sbjct  24   PHAEAAITCGTVTVSLAPCLNYLKKGGPVPPACCNGIKSLNAAAKTTADRQAACNCLKTA  83

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +  ++G N   A+ +PGKCGVNV Y IS STDCSK+ 
Sbjct  84   STSIAGINLSYASSLPGKCGVNVPYKISPSTDCSKVQ  120



>gb|AGN56423.1| non-specific lipid transfer protein 3 [Linum usitatissimum]
Length=103

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  343
            A+ AITCG VAS +  C  YI+G  PLT ACC G+K L AAA +T DRQ AC CLKS A 
Sbjct  11   ADGAITCGRVASGIAPCLGYIRGMAPLTPACCGGIKSLNAAASSTVDRQAACRCLKSAAS  70

Query  344  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCS  439
             + G N GLA G+PGKCGVNVG+PIS S +C+
Sbjct  71   GVRGINYGLAGGLPGKCGVNVGFPISQSVNCA  102



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAITCG V+SSL  C  Y++    L  ACC G+K L +AAKTT DRQ  CNCLKSL
Sbjct  22   PLAEAAITCGQVSSSLAQCIGYLQKGGALPPACCSGLKSLNSAAKTTPDRQGVCNCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AGK+SG N GLAAG+P KCGV++ Y IS +TDC  + 
Sbjct  82   AGKISGLNYGLAAGLPSKCGVSIPYKISPATDCKTVK  118



>gb|AAT80663.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80664.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+S+LV CF Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +S
Sbjct  24   AITCGQVSSNLVPCFDYVRSDGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVS  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  114



>gb|ADB12472.1| lipid transfer protein, partial [Crocus sativus]
Length=91

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  355
            ++C TVAS++  C  Y++G   LT ACC GVK LAAAA TT DR+TAC+CLKS+AGK+SG
Sbjct  1    VSCSTVASAISPCIGYVRGQGALTGACCSGVKGLAAAAATTPDRRTACSCLKSMAGKISG  60

Query  356  FNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
             NP LA G+PGKCG +V Y ISTSTDC+K+
Sbjct  61   LNPSLAKGLPGKCGASVPYVISTSTDCTKV  90



>ref|XP_009384323.1| PREDICTED: non-specific lipid-transfer protein-like [Musa acuminata 
subsp. malaccensis]
Length=117

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  158  PH-AEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            PH A+AAI CG + S L+ C  Y +GT PLT  CC GV+ L  AA+TT DRQ  CNCLK 
Sbjct  20   PHTAQAAIGCGQIISYLIPCLGYAQGTGPLTDGCCSGVRALNGAAQTTPDRQATCNCLKR  79

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             A  +SG  PGL AG+P KCG+NV Y IS STDCS++ 
Sbjct  80   SAAGVSGIQPGLIAGIPSKCGINVPYRISPSTDCSRVR  117



>gb|ABE11609.1| lipid-transfer protein precursor [Solanum chacoense]
Length=115

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEAA+TCG V SSL SC  Y++ T PL   CC GVK L   A+TTADRQTACNCLKS 
Sbjct  20   PHAEAALTCGQVTSSLFSCLPYLRNTGPL-GDCCSGVKKLKGQAQTTADRQTACNCLKST  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG + G N G AA +P  C VN+ Y IS STDCSK+ 
Sbjct  79   AGSIKGLNFGKAASLPSTCSVNIPYEISPSTDCSKVQ  115



>ref|XP_010931358.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=118

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHA  AITCG VASS+  C  Y++    + A+CC GV+ LA +AKTTADR+T CNCLKS 
Sbjct  22   PHAANAITCGQVASSVSGCISYVRSGGSIPASCCSGVRSLAGSAKTTADRRTVCNCLKST  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            A ++SG  P LAAG+P KCGV + + IS STDCSK+
Sbjct  82   AARISGIKPALAAGLPSKCGVRIPFTISPSTDCSKV  117



>gb|AAT80652.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80660.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80661.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80662.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+S+LV CF Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +S
Sbjct  24   AITCGQVSSNLVPCFDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVS  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  114



>gb|AAT80650.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80651.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80653.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80654.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80655.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80656.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80657.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80658.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80659.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+S+LV CF Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +S
Sbjct  24   AITCGQVSSNLVPCFDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVS  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  114



>emb|CDP14199.1| unnamed protein product [Coffea canephora]
Length=117

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA ITC TVA  L +C  Y++    + A CC G++ L + AKTT DR+TAC+CLKSL
Sbjct  23   PHAEA-ITCNTVAGDLGACLGYLQKGGAVPAGCCTGIRSLNSQAKTTVDRRTACSCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG++   N GLAAG+PGKCGVNVGYPISTST+C+ + 
Sbjct  82   AGRVR-VNQGLAAGLPGKCGVNVGYPISTSTNCNSVQ  117



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  346
            EAAITCG V SSL  C  Y+K   P+   CC G+K+L +AA+TTADRQTAC CLKSL+G 
Sbjct  26   EAAITCGQVTSSLSPCLNYLKSGGPVPPGCCSGIKNLNSAAQTTADRQTACKCLKSLSGS  85

Query  347  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            + G N GLA+G+PGKCGV+V Y IS STDCSK+
Sbjct  86   IPGINYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+A ITCG VASS+  C  Y+K    + AACC GV+ L +AAKTTADRQT CNCLK  
Sbjct  22   PIAQA-ITCGQVASSIAPCVNYVKSGGAVPAACCNGVRSLNSAAKTTADRQTTCNCLKQA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +G + G NP LAAG+PGKCGVNV Y ISTST+C+ + 
Sbjct  81   SGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK  117



>gb|AAT80665.1| lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+S+LV CF Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +S
Sbjct  24   AITCGQVSSNLVPCFDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVS  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NPG    +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNVESLPGKCGVNVPYKISTSTNCATV  114



>ref|XP_010683515.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEAA+TCG V SSL+ C  Y++G    + ACC G+K L + A T ADR+TAC CLKS 
Sbjct  20   PHAEAAVTCGQVTSSLLPCLGYLQGGASPSPACCGGIKSLNSMASTPADRKTACGCLKSA  79

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G +   A+G+PGKC V++ YPISTSTDCSK++
Sbjct  80   AASVKGIDMSAASGLPGKCDVSIPYPISTSTDCSKVN  116



>gb|AAF71695.1|AF198168_1 phospholipid transfer protein [Hygrochilus japonicus]
Length=120

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  161  HAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
             A   ITCG V S+L  C  YI+G   L   CC GVK L A A T+ DRQ AC+CLK+LA
Sbjct  25   EASGTITCGQVVSTLTPCISYIRGDSTLPQTCCSGVKKLNALASTSPDRQGACSCLKNLA  84

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +   NP  AAG+PG CGV+V YPISTSTDCSK+ 
Sbjct  85   SHIPNLNPARAAGLPGNCGVSVPYPISTSTDCSKVR  120



>dbj|BAI94497.1| lipid transfer protein [Dianthus caryophyllus]
Length=119

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P+A  A+TCG V+ SL SC  Y+KG    + ACC G+K L   A+T  DR+TAC CLKS 
Sbjct  23   PYATEALTCGQVSGSLASCISYLKGAPGPSGACCGGIKRLNGMAQTPPDRKTACGCLKSA  82

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  +SG N GLA  +PGKCGV++ YPIS +TDCS++H
Sbjct  83   AAAISGINYGLANALPGKCGVSIPYPISPNTDCSRVH  119



>gb|AAT68263.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHA+AAI+CG V +SL  C  Y++    + AACC G+K L + A +T DRQTACNC+KS 
Sbjct  21   PHADAAISCGQVVTSLTPCINYVRQGGAIPAACCSGIKTLNSQATSTPDRQTACNCIKSA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  +SG N GLA+ +PGKCGVN+ Y IS S DCS + 
Sbjct  81   ARSISGINFGLASSLPGKCGVNLPYKISPSIDCSTVQ  117



>gb|AFK38461.1| unknown [Lotus japonicus]
Length=115

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAITCG + S+L+ C  YI+G    +  CC GV+ + +AA +TADR+ ACNCLKS 
Sbjct  19   PMAEAAITCGAIVSALIPCTAYIQGGAGPSPPCCAGVRRVNSAASSTADRRAACNCLKSA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG  S FN G AA +PGKCGVN+ Y ISTST+C+ I 
Sbjct  79   AGSFSRFNAGNAASLPGKCGVNIPYKISTSTNCANIK  115



>gb|AAY83345.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+A ITCG VASS+  C  Y+K    + AACC G++ L +AAKTTADRQT CNCLK  
Sbjct  22   PIAQA-ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQTTCNCLKQA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +G + G NP LAAG+PGKCGVNV Y ISTST+C+ + 
Sbjct  81   SGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK  117



>dbj|BAI94496.1| lipid transfer protein [Dianthus caryophyllus]
Length=119

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P+A AA+TCG V+ +L  C  Y+KG    +A CC G+K L   A+T  DR+TAC CLKS 
Sbjct  23   PYATAAMTCGQVSGNLGPCITYLKGAPGPSALCCAGIKRLNGMAQTPPDRKTACGCLKSA  82

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  +SG N GLA+G+PGKCGV++ YPIS STDCSK++
Sbjct  83   AAAISGLNYGLASGLPGKCGVSIPYPISPSTDCSKVN  119



>gb|AFK36168.1| unknown [Lotus japonicus]
Length=115

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAITCG +AS+L+ C  YI+G    +  CC GV+ + +AA +TADR+ ACNCLKS 
Sbjct  19   PMAEAAITCGAIASALIPCTAYIQGGAGPSPPCCAGVRRVNSAASSTADRRAACNCLKSA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG    FN G AA +PGKCGVN+ Y ISTST+C+ I 
Sbjct  79   AGSFPRFNAGNAASLPGKCGVNIPYKISTSTNCANIK  115



>ref|XP_009631889.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +2

Query  161  HAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            HAEA +TCGTVA+ L  C  Y++    + A CC G++ L +AA TT DRQT CNC+KS A
Sbjct  23   HAEAVVTCGTVATDLSPCLDYVRMGGAIPAMCCNGIRSLFSAASTTQDRQTVCNCMKSAA  82

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G +SG N  LAA +P KCGVN+ Y IS S DC+K+ 
Sbjct  83   GAISGVNLNLAAALPNKCGVNIPYKISPSIDCAKVQ  118



>gb|ACL01093.1| lipid transfer protein [Castanea mollissima]
Length=118

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAI+CG V SSLV+C  Y++     T ACC GVK L  AAKTTADRQ AC CLK+ 
Sbjct  22   PVAQAAISCGQVQSSLVACIPYLRSGGSPTQACCNGVKSLNNAAKTTADRQAACECLKTA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +SG +P  AA +PGKCGVNV Y ISTST+C  + 
Sbjct  82   AGSISGLSPANAASLPGKCGVNVPYKISTSTNCKNVK  118



>gb|ADK60918.1| lipid transfer protein [Castanea sativa]
Length=118

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAI+CG V SSLV+C  Y++     T ACC GVK L  AAKTTADRQ AC CLK+ 
Sbjct  22   PVAQAAISCGQVQSSLVACIPYLRSGGSPTQACCNGVKSLNNAAKTTADRQAACECLKTA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +SG +P  AA +PGKCGVNV Y ISTST+C  + 
Sbjct  82   AGSISGLSPANAASLPGKCGVNVPYKISTSTNCKNVK  118



>gb|AAX84944.1| non-specific lipid transfer protein-like antimicrobial protein 
[Leonurus japonicus]
Length=115

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAI C TVAS +  C  Y+ G  PL   CC GVK L  AA+TT DRQ  CNCLK+L
Sbjct  20   PLAEAAIGCNTVASKMAPCLPYVTGKGPL-GGCCGGVKGLIDAARTTPDRQAVCNCLKTL  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A   SG N G AAG+PGKCGV++ Y IS +TDCSK+H
Sbjct  79   AKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKVH  115



>gb|ABG54494.1| putative allergen Rub i 3 [Rubus idaeus]
Length=117

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V  ++  CF Y+K    + AACC GV++L + AKTTADRQ  CNCLK+ AG + 
Sbjct  26   AITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIP  85

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G NP LAAG+PGKCGV+V Y ISTST+C+ + 
Sbjct  86   GLNPSLAAGLPGKCGVSVPYKISTSTNCATVK  117



>ref|XP_004302608.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=116

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+A ITCG V  ++  CF Y+K    + AACC G++ L +AAKTTADR+  CNCLKS 
Sbjct  21   PVAQA-ITCGQVTQNVAPCFNYVKSGGAVPAACCNGIRSLNSAAKTTADRKQTCNCLKSA  79

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG + G N  LAAG+PGKCGVNV Y ISTST+C+ + 
Sbjct  80   AGSIKGLNANLAAGLPGKCGVNVPYKISTSTNCNNVK  116



>gb|ADV02772.1| lipid transfer protein 1a [Ipomoea batatas]
Length=120

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P AEAAITCG++ + L SC  Y++G  T    AACC  +K + + A TT DRQ AC CLK
Sbjct  22   PSAEAAITCGSMVAKLSSCLSYVQGKVTGGPPAACCGAIKSINSVATTTPDRQAACKCLK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             +AG  S  N G+ + +P KCGVN+GYPISTS DC+K+H
Sbjct  82   QMAGSYSSVNMGVVSSLPSKCGVNIGYPISTSVDCAKVH  120



>gb|AAY83346.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  355
            ITCG V  ++  CF Y+K    + AACCKGV +L + AKTTADRQ  CNCLKS AG + G
Sbjct  27   ITCGQVTHNVAPCFNYVKSGGAVPAACCKGVSNLNSMAKTTADRQQTCNCLKSAAGSIKG  86

Query  356  FNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
             N  LAAG+PGKCGVNV Y ISTST+C+ +
Sbjct  87   LNANLAAGLPGKCGVNVPYKISTSTNCNNV  116



>dbj|BAC77694.1| lipid transfer protein [Atriplex nummularia]
Length=117

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA +TCG V SS+  C  Y+ G    T ACC GVK L + A T ADR+ AC CLKS 
Sbjct  22   PHAEA-LTCGQVTSSMTPCMSYLTGGGSPTPACCGGVKSLNSMASTPADRKAACGCLKSA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG ++  N G AA +PGKCG+++ YPISTSTDCSK++
Sbjct  81   AGAMTNLNMGNAASLPGKCGISLPYPISTSTDCSKVN  117



>ref|XP_011466421.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=116

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+A ITCG V  ++  CF Y+K    + AACC G++ L +AAKTTADR+  CNCLKS 
Sbjct  21   PVAQA-ITCGQVTQNVAPCFNYVKSGGAVPAACCNGIRSLNSAAKTTADRKQTCNCLKSA  79

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG + G N  LAAG+PGKCGVNV Y ISTST+C+ + 
Sbjct  80   AGSIKGLNANLAAGLPGKCGVNVPYKISTSTNCAAVK  116



>ref|XP_003579021.1| PREDICTED: probable non-specific lipid-transfer protein 3 [Brachypodium 
distachyon]
Length=123

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +2

Query  161  HAEAAITCGTVASSLVSCFKYIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
             A AA+TCG V SS+  C  Y+ G    ++  CC G++ L   A+TTADRQ AC CLKS+
Sbjct  27   QASAAVTCGQVGSSIAPCVAYVTGKAAAVSPGCCSGIRGLNNMARTTADRQAACRCLKSM  86

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            AG +   N G  AGVPGKCGVNVG+PIS STDC+K+
Sbjct  87   AGSIKALNMGKVAGVPGKCGVNVGFPISMSTDCNKV  122



>sp|A0AT28.1|NLTP1_LENCU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; 
Flags: Precursor [Lens culinaris]
 gb|AAX35806.1| lipid transfer protein 1 precursor [Lens culinaris]
Length=118

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAI+CGTV+ +LV C  Y+KG    +  CC GVK L  AA+TT DR+ ACNCLKS 
Sbjct  21   PMAEAAISCGTVSGALVPCLTYLKGGPGPSPQCCGGVKRLNGAARTTIDRRAACNCLKSS  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +SG  PG  A +PGKCGV + Y ISTST+C+ I 
Sbjct  81   AGSISGLKPGNVATLPGKCGVRLPYTISTSTNCNTIR  117



>ref|XP_004302624.1| PREDICTED: non-specific lipid-transfer protein 1-like [Fragaria 
vesca subsp. vesca]
 gb|AAY83341.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+A ITCG VASS+  C  Y+K    + AACC G++ L +AAKTTADRQ  CNCLK  
Sbjct  22   PIAQA-ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQATCNCLKQA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +G + G NP LAAG+PGKCGV+V Y ISTST+C+ + 
Sbjct  81   SGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAVK  117



>ref|XP_011091590.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P +EAAITCGTV S L SC  Y+    PL  +CC GVK L  AAKTT DRQ+ CNCLKSL
Sbjct  23   PRSEAAITCGTVVSDLDSCLSYLTNKGPL-GSCCSGVKGLYGAAKTTQDRQSVCNCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A   +  +   AAG+PG+CGVN+ Y IS STDCS +H
Sbjct  82   ADSYTDVDLSKAAGLPGQCGVNIPYKISPSTDCSTVH  118



>dbj|BAO51648.1| lipid transfer protein [Suaeda japonica]
Length=118

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAITCG V S L  C  Y+K     TAACC GVK L + A T ADR+ AC CLKS 
Sbjct  22   PFAEAAITCGQVTSKLAPCMGYLKSGGAPTAACCGGVKSLNSMASTPADRKAACGCLKSA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  +SG N   A+ +P KCGV++ YPISTS DC+K++
Sbjct  82   AASISGMNTAAASSLPSKCGVSIPYPISTSVDCAKVN  118



>ref|XP_009398877.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=117

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A  A+TCG V S L SC  Y +G   LT +CC GV+ L  AAKTT DRQTAC+CLKS 
Sbjct  21   PRATEALTCGQVVSFLQSCIPYARGQGLLTKSCCSGVRSLNDAAKTTPDRQTACSCLKST  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
               L G   G  AG+PGKCGV+V YPISTS DCSK+ 
Sbjct  81   VAGLKGIQSGTVAGIPGKCGVSVPYPISTSVDCSKVK  117



>gb|ABQ53932.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P  EAAI CGTV S L SCF Y+ GT  L   CCKG+KDL AAA+TTADRQ+ C+CLK L
Sbjct  23   PEGEAAIGCGTVVSYLNSCFPYVTGTGAL-GGCCKGIKDLYAAAQTTADRQSVCDCLKDL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A   +G + G AAG+P +CG+N+ Y I  STDCSK+ 
Sbjct  82   AASTTGVDLGKAAGLPSQCGLNIPYKIIPSTDCSKVQ  118



>gb|AAT80649.1| lipid transfer protein precursor [Malus domestica]
 gb|ABB96482.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V SSL  C  Y++    +  ACC G++ + + A+TTADRQTACNCLK+LAG +S
Sbjct  24   AITCGQVTSSLAPCIGYVRNGGAVPPACCNGIRTINSLARTTADRQTACNCLKNLAGSIS  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NP  AAG+PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|ABB96481.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V SSL  C  Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +S
Sbjct  24   AITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSIS  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NP  AAG+PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>ref|XP_009396871.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=116

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PH   AITCG V S L  C  Y  G   LT+ CC GVK L +AAKT+ADR+TAC C+KSL
Sbjct  20   PHVTQAITCGQVTSDLSPCIPYATGKGSLTSGCCNGVKSLNSAAKTSADRKTACTCIKSL  79

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              + S  N G+ +G+PGKCGV++ Y IS STDCSK++
Sbjct  80   VSRFSSANTGVVSGIPGKCGVSIPYTISPSTDCSKVN  116



>ref|NP_001281295.1| non-specific lipid-transfer protein precursor [Malus domestica]
 sp|Q9M5X7.1|NLTP_MALDO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Mal d 3; Flags: Precursor [Malus domestica]
 gb|AAF26450.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80633.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80634.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80635.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80636.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80637.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80638.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80639.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80640.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80641.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80642.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80643.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80644.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80645.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80646.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80647.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80648.1| lipid transfer protein precursor [Malus domestica]
 gb|AAV64878.1| major allergen and lipid transfer protein Mal d 3 [Malus domestica]
Length=115

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V SSL  C  Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +S
Sbjct  24   AITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSIS  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NP  AAG+PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|AFK44274.1| unknown [Medicago truncatula]
Length=116

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAI+CGTV S+L  C  Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  
Sbjct  19   PMADAAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +SG N   A+ +PGKCGVN+ Y ISTST+C+ I 
Sbjct  79   AGAISGLNTAAASALPGKCGVNIPYKISTSTNCATIR  115



>ref|XP_008391369.1| PREDICTED: non-specific lipid-transfer protein [Malus domestica]
Length=113

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+S+L  C  Y++G  P+  ACC G++ + + A+TT DRQ  CNCLKSLA  +S
Sbjct  24   AITCGQVSSNLAPCIGYLRGGGPVPPACCNGIRTINSLAETTPDRQAVCNCLKSLASSVS  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCS  439
            G NPG A  +PGKCGVNV Y ISTST+C+
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCT  112



>gb|AII99870.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=130

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AE+AITCG V+++L  C  Y++G    +A CC GV++L +AA TT DRQ ACNCLKS 
Sbjct  19   PMAESAITCGRVSAALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +S  N   AA +PGKCGVN+ Y ISTST+C+  H
Sbjct  79   AGSISRLNANNAAALPGKCGVNIPYKISTSTNCATYH  115



>ref|XP_003605266.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES87463.1| Lipid transfer protein [Medicago truncatula]
Length=116

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAI+CGTV S+L  C  Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  
Sbjct  19   PMADAAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +SG N   A+ +PGKCGVN+ Y ISTST+C+ I 
Sbjct  79   AGAISGLNTAAASALPGKCGVNIPYKISTSTNCATIR  115



>emb|CAC86258.1| lipid transfer protein [Fragaria x ananassa]
Length=117

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+A ITCG VAS++  C  Y+K    + AACC G+++L   AKTTADRQ ACNCLK  
Sbjct  22   PIAQA-ITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMAKTTADRQAACNCLKQA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG + G NP LAAG+PGKCGV+V Y IST+T+C+ + 
Sbjct  81   AGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK  117



>gb|AAR22488.1| allergen Mal d 3 [Malus domestica]
Length=115

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V SSL  C  Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +S
Sbjct  24   AITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSIS  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NP  AAG+PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>ref|XP_004506429.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AE+AITCG V+++L  C  Y++G    +A CC GV++L +AA TT DRQ ACNCLKS 
Sbjct  19   PMAESAITCGRVSAALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +S  N   AA +PGKCGVN+ Y ISTST+C+ I 
Sbjct  79   AGSISRLNANNAAALPGKCGVNIPYKISTSTNCATIR  115



>gb|AAT68265.1| lipid transfer protein precursor [Nicotiana glauca]
Length=112

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHA+AAI+CG V +SL  C  Y++    +  ACC G+K L + A +T DRQTACNC+KS 
Sbjct  21   PHADAAISCGQVVTSLTPCINYVRQGGDIPTACCSGIKTLNSQATSTPDRQTACNCIKSA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTD  433
            AG +SG N GLA+ +PGKCGVN+ Y IS S D
Sbjct  81   AGSISGINFGLASSLPGKCGVNLPYKISPSID  112



>gb|ACM78613.1| lipid transfer protein 1 [Tamarix hispida]
Length=118

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P+ EAAITCG V   L  C  +++   P  A CC  +K L +  ++T DR+ AC CLKS 
Sbjct  22   PYTEAAITCGMVTQKLAPCLTFLQRGGPPAAGCCGAIKSLNSMVRSTPDRKAACGCLKSA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A    G N G AA +PGKCGVN+GYPISTS DCS++ 
Sbjct  82   AKSFPGINMGNAAALPGKCGVNIGYPISTSVDCSRVK  118



>gb|AAK01293.1|AF331710_1 lipid transfer protein [Avicennia marina]
Length=117

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PH EAAI+CGTVAS L  C  Y+    PL   CC GVK L   A+TT DRQ+ C CLKSL
Sbjct  23   PHGEAAISCGTVASKLAPCIPYVTNRGPL-GGCCGGVKSLYGLARTTPDRQSVCGCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A   +  N G AAG+PG+CGVN+ Y IS STDCSK+H
Sbjct  82   ASSYN-VNLGKAAGLPGQCGVNIPYKISPSTDCSKVH  117



>gb|ACQ42221.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P+ EAA+TCGTV S+L  C  Y++    + A+CC+GV  L +AAKTTADRQ AC+CLKS 
Sbjct  23   PYVEAALTCGTVTSALSPCITYVRNGGSVPASCCQGVAALNSAAKTTADRQAACSCLKSA  82

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
               +SG  P LA+ +PGKCGV++ Y IS STDCSK+ 
Sbjct  83   LSSVSGIQPSLASSLPGKCGVSIPYQISPSTDCSKVK  119



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA ITCG V+ ++  C  Y++    +  +CC G++ L  AAKTTADR+TACNCLKS 
Sbjct  23   PHAEA-ITCGQVSGAVAPCINYVRSGGVVPPSCCGGIRGLVGAAKTTADRRTACNCLKSA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            AG++ G  PGLAAG+PGKCGV+V +PISTS +C+ +
Sbjct  82   AGRIPGLKPGLAAGLPGKCGVSVPFPISTSVNCNTV  117



>gb|AAF28385.1|AF151214_1 lipid-transfer protein [Nicotiana glauca]
Length=117

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAI+CG V SSL  C  Y+     + A CC G+K L   A +T DRQTACNC+KS 
Sbjct  21   PQADAAISCGQVVSSLTPCISYVTKGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             G +SG N GLA+ +PGKCGVN+ Y IS S DCS + 
Sbjct  81   VGSISGINFGLASSLPGKCGVNLPYKISPSIDCSTVQ  117



>ref|XP_008778766.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHA  AITCG VAS+L  C  Y +    +   CC GV+ LA+ AKTTADR+T CNCLK+ 
Sbjct  22   PHAANAITCGQVASALAGCISYARNGGSIPPNCCSGVRGLASRAKTTADRRTVCNCLKNA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
               + G  PGL  G+PGKCGV + Y IS STDCSK++
Sbjct  82   ISSIRGLKPGLVNGIPGKCGVRIPYTISPSTDCSKVN  118



>gb|AAY83344.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+A ITCG VASS+  C  Y+K    + A CC G++ L +AAKTTADRQT CNCLK  
Sbjct  22   PIAQA-ITCGQVASSIAPCVNYVKSGGAVPAGCCNGIRSLNSAAKTTADRQTTCNCLKQA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +G + G NP LAAG+PGK GVNV Y ISTST+C+ + 
Sbjct  81   SGAIKGLNPNLAAGLPGKXGVNVPYKISTSTNCAAVK  117



>emb|CAB96874.1| mal d 3 [Malus domestica]
Length=91

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  355
            ITCG V SSL  C  Y++    +  ACC G++ +   A+TTADRQTACNCLK+LAG +SG
Sbjct  1    ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISG  60

Query  356  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             NP  AAG+PGKCGVNV Y ISTST+C+ + 
Sbjct  61   VNPNNAAGLPGKCGVNVPYKISTSTNCATVK  91



>sp|A0AT30.1|NLTP3_LENCU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP3; 
Flags: Precursor [Lens culinaris]
 gb|AAX35808.1| lipid transfer protein 3 precursor [Lens culinaris]
Length=118

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAA++CGTV   L  C  Y+ G    T +CC GVK L AAA TTADRQ ACNCLK+ 
Sbjct  21   PMAEAAVSCGTVTGDLAPCIPYLTGGAGPTDSCCAGVKKLLAAAPTTADRQAACNCLKTA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG ++  NPG AA +PGKC VN+ Y IST+T+C+ I 
Sbjct  81   AGNINNLNPGNAAALPGKCNVNIPYKISTTTNCNTIK  117



>ref|XP_009346912.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+S+L  C  Y++    +  ACC G+K + A AKTT DRQ ACNCLKSL+G +S
Sbjct  24   AITCGQVSSNLAPCINYVRSGGAVPPACCNGIKTINALAKTTPDRQAACNCLKSLSGSIS  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  114



>gb|AES87466.2| Lipid transfer protein [Medicago truncatula]
Length=139

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAI+CGTV S+L  C  Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  
Sbjct  19   PMADAAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +SG N   A+ +PGKCGVN+ Y ISTST+C+ + 
Sbjct  79   AGAISGLNTAAASALPGKCGVNIPYKISTSTNCATVR  115



>ref|XP_009372013.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V SSL  C  Y KG   +  ACC G++ +   A+TTADRQ ACNCLK+LAG + 
Sbjct  24   AITCGQVTSSLAPCINYAKGGGVVPPACCNGIRTINGIARTTADRQAACNCLKNLAGSIR  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NP  AA +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPNNAAALPGKCGVNVPYKISTSTNCATV  114



>emb|CCD33109.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +2

Query  161  HAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            H   AITCG VASSL  C  Y++     +A+CC GVK L +AA TTADR+TACNCLK+LA
Sbjct  21   HMAHAITCGQVASSLAPCISYLQKGGVPSASCCSGVKALNSAASTTADRKTACNCLKNLA  80

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G  SG N G AA +PGKC VNV Y ISTST+C+ I
Sbjct  81   GPKSGINEGNAASLPGKCKVNVPYKISTSTNCANI  115



>gb|ACI47547.1| nonspecific lipid transfer protein [Juglans regia]
Length=119

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTEP-LTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            ITCG VASS+ SC  Y++GT P +  +CC GVK L  AA TTADRQ AC CLK  +G + 
Sbjct  28   ITCGQVASSVGSCIGYLRGTVPTVPPSCCNGVKSLNKAAATTADRQAACECLKKTSGSIP  87

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G NPGLAAG+PGKCGV+V Y ISTST+C  + 
Sbjct  88   GLNPGLAAGLPGKCGVSVPYKISTSTNCKAVK  119



>ref|XP_011091601.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P  EAAI CGTV S L  C  Y+ GT  L   CCKG+ DL AAA+TTADRQ+ C CLK L
Sbjct  23   PEGEAAIGCGTVVSYLNPCLPYVTGTGAL-GGCCKGINDLYAAAQTTADRQSVCGCLKDL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A   SG N G AAG+P +CG+N+ Y IS STDCSK+ 
Sbjct  82   AASTSGVNLGKAAGLPSQCGLNIPYKISPSTDCSKVQ  118



>ref|XP_004516173.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cicer 
arietinum]
Length=118

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAA++CG++ S+LV C  Y+KG    +++CC GVK + AAA TT DR+ ACNCLK+ 
Sbjct  21   PMAEAAVSCGSITSALVPCISYLKGGPGPSSSCCGGVKRVNAAAATTPDRRAACNCLKNA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +SG   G AA +P KCGVN+ Y  STST+C+ I+
Sbjct  81   AGSISGLKAGNAAALPSKCGVNIPYKFSTSTNCNSIN  117



>gb|AAS13435.1| lipid-transfer protein [Nicotiana attenuata]
Length=117

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHA+AAI+CG V +SL  C  Y++    + A CC G+K L   A +T DRQTACNC+KS 
Sbjct  21   PHADAAISCGQVVASLSPCISYVRQGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  ++G N  LA  +P KCGVN+ Y IS S DCS +H
Sbjct  81   AAAINGINYSLAGSLPSKCGVNLPYKISPSIDCSTVH  117



>ref|XP_006663744.1| PREDICTED: probable non-specific lipid-transfer protein 3-like 
[Oryza brachyantha]
Length=116

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  343
             AAITCG V +++  C  Y+ G +  L+  CC GVK L +AA++TADRQ AC CLKSL G
Sbjct  22   SAAITCGQVGTAIAPCIPYVTGRSSALSQGCCNGVKGLNSAARSTADRQAACRCLKSLVG  81

Query  344  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             +   N G AAG+P KCGVNVG+PI  STDC+K+ 
Sbjct  82   TVKSLNLGTAAGIPAKCGVNVGFPIRLSTDCNKVR  116



>gb|ACM78614.1| lipid transfer protein 2 [Tamarix hispida]
Length=116

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEAAI+CGTV S L  C  +++G      ACC G+++L + A++T DRQ AC CLKS 
Sbjct  23   PHAEAAISCGTVVSKLAPCLGFLRGGGSPPPACCSGIRNLQSMARSTPDRQAACGCLKSA  82

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            +   +G N   AA +PGKCGVN+GYPIS S DCS++
Sbjct  83   S---AGVNMRNAAALPGKCGVNIGYPISRSVDCSRV  115



>emb|CAA80809.1| lipid transfer protein [Oryza sativa Indica Group]
Length=117

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 2/98 (2%)
 Frame = +2

Query  158  PHAE-AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            PH   AAI+CG V S++  C  Y +G  P +AACC GV+ L +AA TTADR+TACNCLK+
Sbjct  21   PHTTMAAISCGQVNSAVSPCLSYARGLRP-SAACCSGVRSLNSAASTTADRRTACNCLKN  79

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +AG +SG N G AA +P KCGV++ Y IS S DCS+++
Sbjct  80   VAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSRVN  117



>sp|Q43766.1|NLTP3_HORVU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; AltName: Full=CW-19; AltName: Full=CW-20; Short=CW20; Flags: 
Precursor [Hordeum vulgare]
 emb|CAA48623.1| Cw-19 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
Length=118

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 3/96 (3%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKGT--EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +AAI+CG V+S+L  C  Y +G   +P   ACC GVK LA AA++TAD+Q AC CLKSLA
Sbjct  24   DAAISCGQVSSALSPCISYARGNGAKP-PVACCSGVKRLAGAAQSTADKQAACRCLKSLA  82

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              + G N G  +GVPGKCGV+V +PIS STDC+K+H
Sbjct  83   TSIKGINMGKVSGVPGKCGVSVPFPISMSTDCNKVH  118



>gb|ADR66947.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DR+TACNCLK L+G +S
Sbjct  26   AITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSIS  85

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVNIPYKISASTNCATVK  117



>ref|XP_006662671.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Oryza 
brachyantha]
Length=117

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAE-AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            PHA  AAI+CG V S++  C  Y +G    ++ACC GV+ L++AA TTADR+TACNCLK+
Sbjct  20   PHATMAAISCGQVNSAVGPCLSYARGGAGPSSACCSGVRSLSSAASTTADRRTACNCLKN  79

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
             AG +SG N G AA +P KCGV++ Y ISTS DCS++
Sbjct  80   AAGSISGLNAGNAASIPSKCGVSIPYTISTSIDCSRV  116



>ref|XP_008798560.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P    AITCG V S L  C  Y +   P+ A CC GVK L AAAK+T DRQTAC+CLK  
Sbjct  22   PRMADAITCGQVVSFLTPCIAYARNGGPIPAGCCSGVKGLVAAAKSTPDRQTACSCLKRA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  +SG N GL AGVP KCGV + Y IS STDCSK+ 
Sbjct  82   AASISGLNTGLIAGVPAKCGVRIPYSISPSTDCSKVK  118



>ref|XP_006663743.1| PREDICTED: non-specific lipid-transfer protein 2B-like isoform 
X1 [Oryza brachyantha]
Length=117

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAE-AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            PHA  AAI+CG V S++  C  Y +G    ++ACC GV+ L++AA TTADR+TACNCLK+
Sbjct  20   PHATMAAISCGQVNSAVGPCLSYARGGAGPSSACCSGVRSLSSAASTTADRRTACNCLKN  79

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
             AG +SG N G AA +P KCGV++ Y ISTS DCS++
Sbjct  80   AAGSISGLNAGNAASIPSKCGVSIPYTISTSIDCSRV  116



>gb|ADR66948.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DR+TACNCLK L+G +S
Sbjct  26   AITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSIS  85

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVNIPYKISISTNCAAVK  117



>gb|AGN56422.1| non-specific lipid transfer protein 2, partial [Linum usitatissimum]
Length=116

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P   + +TCG V+S + +C  Y+ G  P+T ACC G++ L   AKTTADR+ AC CLK+ 
Sbjct  20   PITVSGLTCGQVSSGMAACLTYLTGRAPVTPACCNGMRGLLNMAKTTADRRLACTCLKTA  79

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCS  439
            AG + G NP +AAG+PGKCGV + Y ISTST+C+
Sbjct  80   AGNVPGLNPAIAAGLPGKCGVKIPYKISTSTNCN  113



>gb|AGN56421.1| non-specific lipid transfer protein 1 [Linum usitatissimum]
Length=116

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P   + +TCG V+S + +C  Y+ G  P+T ACC G++ L   AKTTADR+ AC CLK+ 
Sbjct  20   PITVSGLTCGQVSSGMAACLTYLTGRAPVTPACCNGMRGLLNMAKTTADRRLACTCLKTA  79

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCS  439
            AG + G NP +AAG+PGKCGV + Y ISTST+C+
Sbjct  80   AGNVPGLNPAIAAGLPGKCGVKIPYKISTSTNCN  113



>gb|AAY83342.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+A ITCG VAS++  C  Y+K    + A CC G+++L   AKTTADRQ  CNCLK  
Sbjct  22   PIAQA-ITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMAKTTADRQATCNCLKQA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG + G NP LAAG+PGKCGV+V Y IST+T+C+ + 
Sbjct  81   AGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK  117



>ref|XP_003605269.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=166

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 72/118 (61%), Gaps = 5/118 (4%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAI+CGTV S+L  C  Y+KG    + ACC GVK L  AA TT DRQ ACNCLK  
Sbjct  19   PMADAAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH*NRLWESAGFLRQAITENYDD  511
            AG +SG N   A+ +PGKCGVN+ Y ISTST+C+         S+G        NY +
Sbjct  79   AGAISGLNTAAASALPGKCGVNIPYKISTSTNCATAT-----RSSGLEDDVAASNYAN  131



>dbj|BAK05751.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=117

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGTEPL-TAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            A  A+TCG V SS+  C  Y  G     +A CC GV+ L   A T ADRQ AC CLK+LA
Sbjct  22   ASGAVTCGDVTSSIAPCMSYATGKASAPSAGCCSGVRSLNGKASTAADRQAACRCLKNLA  81

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G   G + G AAG+PGKCGV+V +PISTS DC+K+H
Sbjct  82   GSFKGISMGNAAGIPGKCGVSVSFPISTSVDCNKLH  117



>gb|ABA33862.1| phospholipid transfer protein 1, partial [Zea diploperennis]
 gb|ABA33863.1| phospholipid transfer protein 1, partial [Zea diploperennis]
Length=111

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GVK L  AA+TTADR+ ACNCLK+ A
Sbjct  16   SEAAISCGQVASAIAPCISYARGQGSAPSAGCCSGVKSLNNAARTTADRRAACNCLKNAA  75

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  76   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  111



>gb|ABA33857.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSAPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  84

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  85   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>ref|XP_006662672.1| PREDICTED: non-specific lipid-transfer protein 1-like [Oryza 
brachyantha]
Length=117

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHA  AITCG V+S++  C  Y +G    ++ACC GVK L AAA+TTADR+TACNCLK+ 
Sbjct  21   PHATVAITCGQVSSAISPCLAYARGGAGPSSACCTGVKSLNAAARTTADRRTACNCLKNA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            A  + G N G AA +P KCGV+V Y IS S DCS++
Sbjct  81   ARGIRGLNAGNAASIPSKCGVSVPYTISASIDCSRV  116



>ref|XP_007134701.1| hypothetical protein PHAVU_010G069100g [Phaseolus vulgaris]
 gb|ADC80503.1| non-specific lipid transfer protein 1b precursor [Phaseolus vulgaris]
 gb|ESW06695.1| hypothetical protein PHAVU_010G069100g [Phaseolus vulgaris]
Length=118

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A AAI+CG V SSL SC  ++    P+ A+CC GV+ L AAAKTT DRQ  CNCLKS 
Sbjct  21   PTAHAAISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSLNAAAKTTPDRQAVCNCLKSA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            AG + GFN   A  +PGKCGV++ Y ISTST+C+ I
Sbjct  81   AGAIPGFNANNAGILPGKCGVSIPYKISTSTNCATI  116



>ref|XP_008779709.1| PREDICTED: non-specific lipid-transfer protein 1-like, partial 
[Phoenix dactylifera]
Length=115

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PH+  AITCG VAS +  C  Y +    +   CC GV+ L ++AKT+ADR+T CNCLK  
Sbjct  22   PHSANAITCGQVASGVSGCISYARSGGSIPPNCCSGVRGLVSSAKTSADRRTVCNCLKRT  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCS  439
            A  +SG  PGL AG+PGKCGV + Y IS STDCS
Sbjct  82   ASSISGLKPGLVAGIPGKCGVRIPYTISPSTDCS  115



>ref|XP_009410515.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=114

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  343
            A AAI+CG V S L  C  Y +   PLTA CC GV+ L  AA+TT DRQT CNCLK    
Sbjct  20   AHAAISCGQVVSYLTPCLGYARAIGPLTAGCCSGVRALDGAARTTPDRQTTCNCLKRSTA  79

Query  344  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
             + G  PGL +G+P KCGVN+ Y I  STDCS++
Sbjct  80   GIQGLQPGLISGIPRKCGVNIPYSIGPSTDCSRV  113



>gb|AAL25839.1| lipid transfer precursor protein [Hevea brasiliensis]
Length=116

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLT-AACCKGVKDLaaaakttadrqtaCNCLKS  334
            P    AITCG V S+LV C  Y+K T P   A CC GV+ +  AAKTTADR+TAC CLKS
Sbjct  19   PMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKS  78

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             AG + G NP   AG+PGKCGVN+ Y IS ST+C+ + 
Sbjct  79   AAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATVK  116



>gb|ABA33846.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GVK L  AA+TTADR+ ACNCLK+ A
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAA  84

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  85   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>ref|XP_010922734.1| PREDICTED: non-specific lipid-transfer protein 1 [Elaeis guineensis]
Length=118

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P+   AITCG V S L  C  Y +    + A CC GVK L AAA+TTADR+TAC CLK+ 
Sbjct  22   PYTAHAITCGQVVSYLTPCISYARSGGQVPAGCCSGVKGLVAAARTTADRRTACTCLKNT  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            A  LSG  PGL +G+PGKCGV V Y IS STDCS++
Sbjct  82   AAGLSGLKPGLISGIPGKCGVRVPYAISPSTDCSRV  117



>gb|AHB19225.1| non specific lipid transfer protein 1C [Punica granatum]
Length=120

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            AEA ITCG V+SSL  C +Y +G    P+  ACC G++ L +AAKTT DRQ AC CLKSL
Sbjct  24   AEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSL  83

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  +SG N GL AG PGKCGV++ Y I+ ST+C  + 
Sbjct  84   ASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK  120



>ref|XP_010252072.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +2

Query  161  HAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            H +AAI+CG +AS L  C  Y     PL  ACC GV+ L +AAKTTADRQ  C CLKS A
Sbjct  27   HVDAAISCGQLASLLSPCVNYFVKGGPLPPACCSGVRTLNSAAKTTADRQATCQCLKSAA  86

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              + G N GLA  +PGKCGVN  Y IS STDCS++ 
Sbjct  87   ASIPGLNLGLANSIPGKCGVNFPYKISPSTDCSRVR  122



>sp|P81651.2|NLTP1_PRUAR RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru ar 3; AltName: Allergen=Pur 
ar 3 [Prunus armeniaca]
Length=91

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  355
            ITCG V+SSL  C  Y++G   +  ACC G++++   A+TT DR+TACNCLK L+G +SG
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG  60

Query  356  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATVK  91



>ref|XP_008244911.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X1 [Prunus 
mume]
Length=132

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A AA++CG V +SL  C  Y+    PL  +CC GVK L + A+TTADRQ+ CNCLK  
Sbjct  25   PKAMAAVSCGQVVNSLTPCLSYVSNNGPLNPSCCTGVKSLYSMAQTTADRQSICNCLKQA  84

Query  338  AGKL--SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH*NRLWESA  472
               +  +  N GLAAG+PGKCGVN+ Y IS STDC       LW+ A
Sbjct  85   VNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKASSERFLWKPA  131



>gb|AET05730.1| lipid transfer protein isoform a, partial [Pyrus communis]
Length=94

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITC  V+S+L  C  Y++    +  ACC G+K +   A TT DRQ ACNCLK+LAG +S
Sbjct  3    AITCSQVSSNLAPCINYVRSGGAVPPACCNGIKTINGLANTTPDRQAACNCLKNLAGSVS  62

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  63   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  93



>gb|ABA33848.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=110

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GVK L  AA+TTADR+ ACNCLK+ A
Sbjct  15   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAA  74

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  75   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  110



>sp|P82534.1|NLTP1_PRUDO RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Major allergen Pru d 3; AltName: Allergen=Pur 
d 3 [Prunus domestica]
Length=91

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  355
            ITCG V+S+L  C  Y+KG   +  ACC G++++   A+TTADR+ ACNCLK L+G + G
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG  60

Query  356  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             NP  AA +PGKCGVNV Y IS ST+C+ + 
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATVK  91



>gb|ABA33849.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=119

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A
Sbjct  24   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  83

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  84   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  119



>gb|ABA33850.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  84

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  85   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>gb|ABA33847.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  84

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  85   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>ref|NP_001105311.1| non-specific lipid-transfer protein precursor [Zea mays]
 sp|P19656.1|NLTP_MAIZE RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Allergen=Zea m 14; Flags: Precursor [Zea mays]
 gb|AAA33493.1| phospholipid transfer protein precursor [Zea mays]
 gb|ABA33851.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
 gb|ABA33852.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  84

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  85   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>gb|AAQ74628.1| lipid tranfer protein II [Vigna radiata]
 emb|CCF23017.1| lipid transfer protein [Vigna radiata]
 emb|CCF23314.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +2

Query  161  HAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            H   AITCG VASSL  C  Y++     +A+CC GVK L +AA TTADR+TACNCLK+LA
Sbjct  21   HMAHAITCGQVASSLAPCISYLQKGGVPSASCCSGVKALNSAASTTADRKTACNCLKNLA  80

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G  SG N G AA +PGKC VNV Y IST T+C+ I
Sbjct  81   GPKSGINEGNAASLPGKCKVNVPYKISTFTNCANI  115



>gb|ABA33858.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=116

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A
Sbjct  21   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  80

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  81   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  116



>gb|ABA33866.1| phospholipid transfer protein 1, partial [Zea diploperennis]
Length=114

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A
Sbjct  19   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  78

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  79   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  114



>gb|ABA33860.1| phospholipid transfer protein 1, partial [Zea diploperennis]
Length=109

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A
Sbjct  14   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  73

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  74   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  109



>gb|AAP92127.1| lipid transfer protein LPT1 [Oryza sativa]
Length=118

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = +2

Query  158  PHAE-AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            PH   AAI+CG V S++  C  Y +G  P +AACC GV+ L +AA TTADR+TACNCLK+
Sbjct  21   PHTTMAAISCGQVNSAVSPCLSYARGLRP-SAACCSGVRSLNSAASTTADRRTACNCLKN  79

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  442
            +AG +SG N G AA +P KCGV++ Y IS S DCS+
Sbjct  80   VAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSR  115



>pdb|1T12|A Chain A, Solution Structure Of A New Ltp1
Length=91

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 63/92 (68%), Gaps = 1/92 (1%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V S+L  C  Y++ T PL   CC GVK L  +A+TT DRQ AC CLKS AG +S
Sbjct  1    AITCGQVTSNLAPCLAYLRNTGPL-GRCCGGVKALVNSARTTEDRQIACTCLKSAAGAIS  59

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G N G AAG+P  CGVN+ Y IS STDCSK+ 
Sbjct  60   GINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ  91



>ref|XP_002442776.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
 gb|EES16614.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
Length=119

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG V+S++  C  Y +G     +A CC GV+ L +AA+TTADR+ ACNCLK+ A
Sbjct  24   SEAAISCGQVSSAIAPCLSYARGQGSAPSAGCCSGVRSLNSAARTTADRRAACNCLKNAA  83

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV+V Y ISTSTDCS+++
Sbjct  84   RGISGLNAGNAASIPSKCGVSVPYTISTSTDCSRVN  119



>gb|AAT68262.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHA+AAI+CG V SSL  C  Y+     + A CC G++ L   A +T DRQTACNC+KS 
Sbjct  21   PHADAAISCGQVVSSLTPCISYVTKGGAIPAPCCNGIESLNNQATSTPDRQTACNCIKSA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G N  LA  +PGKCGVN+ Y IS S DCS + 
Sbjct  81   AASIKGINFSLAGSLPGKCGVNLPYKISPSIDCSTVQ  117



>gb|ABA33853.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=109

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A
Sbjct  14   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  73

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  74   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  109



>ref|XP_011095133.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
 gb|ABQ53931.1| lipid transfer protein [Sesamum indicum]
Length=119

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 67/101 (66%), Gaps = 6/101 (6%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYI----KGTEPLTAACCKGVKDLaaaakttadrqtaCNC  325
            P AEAAI+CGTVA+ L  C  Y+     GT P+   CC G+K L   A +TADRQ  C C
Sbjct  21   PQAEAAISCGTVANDLSPCINYVMYGGAGTPPVP--CCTGIKTLYNQASSTADRQAVCGC  78

Query  326  LKSLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            LKS+AG+ S    G AA +PGKCGV++ Y IS STDCSK+H
Sbjct  79   LKSVAGQASPAIIGTAAALPGKCGVSIPYEISPSTDCSKVH  119



>ref|XP_009608993.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHA+AAI+CG V + L  C  Y++    L A CC G+K L   A TT DRQ ACNC+KS 
Sbjct  22   PHADAAISCGQVVTRLSPCINYVRQGGALPAPCCSGIKALNNQATTTPDRQAACNCIKSA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  +SG N  LA  +P KCGVN+ Y IS S DCS + 
Sbjct  82   AASISGINFNLAGSLPSKCGVNLPYKISPSIDCSTVQ  118



>ref|XP_009631888.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana tomentosiformis]
 sp|Q42952.1|NLTP1_TOBAC RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Pathogenesis-related protein 14; Short=PR-14; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA44267.1| lipid transferase [Nicotiana tabacum]
Length=114

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEA ITCG V S+L  C  Y++ T PL   CC GVK L  +A+TT DRQ AC CLKS 
Sbjct  20   PCAEA-ITCGQVTSNLAPCLAYLRNTGPL-GRCCGGVKALVNSARTTEDRQIACTCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +SG N G AAG+P  CGVN+ Y IS STDCSK+ 
Sbjct  78   AGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ  114



>ref|XP_008798559.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=117

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PH   AITCG V S L  C  Y++    +  ACC GV+ LAAAAKTT DR+TAC CLK+ 
Sbjct  22   PHTADAITCGQVVSYLTPCINYVRNGGQIPGACCSGVRGLAAAAKTTPDRRTACTCLKNA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  442
            A  +SG   GL AG+PGKCGV V Y IS STDCS+
Sbjct  82   AAGISGLKTGLIAGIPGKCGVRVPYAISPSTDCSR  116



>ref|XP_010483551.1| PREDICTED: non-specific lipid-transfer protein 3 [Camelina sativa]
Length=115

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  343
            A+AAI+CGTVASSL  C  Y+     +   CC+GVK L   A+TT DRQ AC CL+S A 
Sbjct  21   ADAAISCGTVASSLAPCANYLSKGGVVPGPCCEGVKSLNGMAQTTPDRQQACRCLQSTAK  80

Query  344  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             LSG +P LA+G+PGKCGV++ YPIS ST+C  + 
Sbjct  81   GLSGLDPSLASGLPGKCGVSIPYPISMSTNCDNVK  115



>ref|XP_009760676.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=118

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +2

Query  161  HAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            HAEA +TCGTVA+ L  C  Y++    +   CC G+++L +AA TT DRQT CNC+KS A
Sbjct  23   HAEAVVTCGTVATDLSPCLDYVRMGGAIPTMCCNGIRNLFSAASTTQDRQTVCNCMKSAA  82

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N  LAA +P KCGV + Y IS S DC+K+ 
Sbjct  83   RVISGVNLNLAAALPSKCGVIIPYKISPSIDCAKVQ  118



>ref|XP_010443685.1| PREDICTED: non-specific lipid-transfer protein 3 [Camelina sativa]
Length=115

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  343
            A+AAI+CGTVASSL  C  Y+     +   CC+GVK L   A+TT DRQ AC CL+S A 
Sbjct  21   ADAAISCGTVASSLAPCANYLSKGGVVPGPCCEGVKSLNGMAQTTPDRQQACRCLQSTAK  80

Query  344  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             LSG +P LA+G+PGKCGV++ YPIS ST+C  + 
Sbjct  81   GLSGLDPSLASGLPGKCGVSIPYPISMSTNCDNVK  115



>ref|XP_008244970.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+SSL  C  Y++    +  ACC G++ +   A+TT DR+ ACNCLK L+G +S
Sbjct  26   AITCGQVSSSLAPCINYVRKGGVVPPACCNGIRAVNGLARTTPDRRAACNCLKQLSGSIS  85

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G NP  AAG+PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAGLPGKCGVNIPYKISASTNCATVK  117



>gb|AFR43276.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43278.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEP--LTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ A+TCG V SSL  C  Y++GT    +   CC G+K L +AA+TT DRQ AC C+K
Sbjct  22   PLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLNSAAQTTPDRQAACKCIK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            S A  + G N GLA+G+PGKCGVN+ Y IS STDCS + 
Sbjct  82   SAAAGIPGINFGLASGLPGKCGVNIPYKISPSTDCSSVK  120



>emb|CDM80995.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 6/96 (6%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +AAI+CG V+S+L  C  Y KG  T P + ACC GV+ LA  A++TAD+Q  C CLKS+A
Sbjct  24   DAAISCGQVSSALAPCVAYAKGSGTSP-SGACCSGVRKLAGLARSTADKQATCRCLKSVA  82

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G   G NP  AAG+P KCGV+V Y IS S DCSKIH
Sbjct  83   G---GLNPNKAAGIPSKCGVSVPYTISASVDCSKIH  115



>ref|XP_010454878.1| PREDICTED: non-specific lipid-transfer protein 3-like [Camelina 
sativa]
Length=115

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  343
            A+AAI+CGTVASSL  C  Y+     +   CC+GVK L   A+TT DRQ AC CL+S A 
Sbjct  21   ADAAISCGTVASSLAPCANYLSKGGVVPGPCCEGVKSLNGMAQTTPDRQQACRCLQSTAK  80

Query  344  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             LSG +P LA+G+PGKCGV + YPIS ST+C  + 
Sbjct  81   GLSGLDPSLASGLPGKCGVTIPYPISMSTNCENVK  115



>sp|O23758.1|NLTP_CICAR RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Cicer arietinum]
 emb|CAA05771.1| lipid transfer protein [Cicer arietinum]
Length=116

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AE+AITCG V ++L  C  Y++G    +A CC GV++L +AA TT DRQ ACNCLKS 
Sbjct  19   PMAESAITCGRVDTALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +S  N   AA +PGKC VN+ Y ISTST+C+ I 
Sbjct  79   AGSISRLNANNAAALPGKCVVNIPYKISTSTNCATIR  115



>gb|AEN70936.1| lipid transfer protein [Gossypium gossypioides]
Length=119

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTE-PLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            P A+ A+TCG V +SL  C  Y++G   P+   CC G+K L +AA+TT DRQ AC C+KS
Sbjct  22   PLAQGAVTCGQVTTSLAPCITYLRGKGGPVPQGCCGGIKSLNSAAQTTPDRQAACKCIKS  81

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  442
             A  +SG N G+A+G+PGKCGVN+ Y IS STDC++
Sbjct  82   AAAGISGINYGIASGLPGKCGVNIPYKISPSTDCNR  117



>gb|AAK20395.1|AF334185_1 lipid transfer protein precursor [Triticum aestivum]
 gb|AAV28706.1| lipid transfer protein [Triticum aestivum]
 emb|CAH69208.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=115

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 6/96 (6%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +AAI+CG V+S+L  C  Y KG  T P + ACC GV+ LA  A++TAD+Q  C CLKS+A
Sbjct  24   DAAISCGQVSSALTPCVAYAKGSGTSP-SGACCSGVRKLAGLARSTADKQATCRCLKSVA  82

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G   G NP  AAG+P KCGV+V Y IS S DCSKIH
Sbjct  83   G---GLNPNKAAGIPSKCGVSVPYTISASVDCSKIH  115



>gb|AFX65219.1| lipid transfer precursor protein, partial [Triticum aestivum]
Length=121

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 6/96 (6%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +AAI+CG V+S+L  C  Y KG  T P + ACC GV+ LA  A++TAD+Q  C CLKS+A
Sbjct  30   DAAISCGQVSSALTPCVAYAKGSGTSP-SGACCNGVRKLAGLARSTADKQATCRCLKSVA  88

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G   G NP  AAG+P KCGV+V Y IS S DCSKIH
Sbjct  89   G---GLNPNKAAGIPSKCGVSVPYTISASVDCSKIH  121



>ref|XP_009761744.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana sylvestris]
Length=114

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA +TCG V S+L  C  Y++   PL   CC GVK L  AA+TT DRQTAC CLKS 
Sbjct  20   PHAEA-LTCGQVTSNLAPCLPYLRNKGPL-GRCCSGVKGLLNAARTTQDRQTACTCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +SG N   AAG+P  CGVN+ Y IS STDCSK+ 
Sbjct  78   AGAISGINLRKAAGLPSTCGVNIPYNISPSTDCSKVQ  114



>sp|P80273.2|NLTP3_VITSX RecName: Full=Non-specific lipid-transfer protein P3; Short=LTP 
P3 [Vitis sp.]
Length=91

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  355
            ++CG VA+ + SC  Y++G  PL AACC GVK+L  +A TT DR+TAC CL S +  +SG
Sbjct  1    LSCGDVATQMASCINYLRGAGPLPAACCNGVKNLKNSATTTQDRRTACKCLISASKTISG  60

Query  356  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             N GLAAG+P KCGV++ Y IS ST+C +++
Sbjct  61   VNFGLAAGLPAKCGVSIPYKISPSTNCDQVN  91



>gb|AAF35186.1|AF195865_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26698.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43277.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEP--LTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ A+TCG V SSL  C  Y++GT    +   CC G+K L +AA+TT DRQ AC C+K
Sbjct  22   PLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLNSAAQTTPDRQAACKCIK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            S A  + G N GLA+G+PGKCGVN+ Y IS STDCS + 
Sbjct  82   SAAAGIPGINFGLASGLPGKCGVNIPYKISPSTDCSSVK  120



>emb|CBI18043.3| unnamed protein product [Vitis vinifera]
Length=139

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A   ++CG VA+ L  C  Y++   PL  ACC GVK+L  +A TT DR+TAC CL + 
Sbjct  43   PMAVEGLSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNSAATTQDRRTACKCLINA  102

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +  +SG N GLAAG+PGKCGVN+ Y IS ST+C +++
Sbjct  103  SKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQVN  139



>ref|XP_008442324.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cucumis 
melo]
Length=117

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  343
            EAA+TCG+VA+++  C  Y++  +  + A CC G++ L   A TTADR+TACNCLKS A 
Sbjct  23   EAAVTCGSVATAMGPCIPYLRSPSASVPAGCCSGIRSLNGQAATTADRRTACNCLKSAAK  82

Query  344  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             +SG N   AAG+PGKCGV++ YPIS +TDCS+++
Sbjct  83   SISGINYKAAAGLPGKCGVSISYPISPNTDCSRVN  117



>ref|XP_010690793.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=118

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEAA++CGTV  ++  C  Y+KG +  +  CC GV  L   A T AD++TAC CLKS 
Sbjct  22   PHAEAAMSCGTVTKNIAQCITYLKGGDSPSKGCCDGVTTLKNLASTPADKKTACACLKSA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G +   AAG+P KCGV++ Y IS +TDCSK++
Sbjct  82   AASIKGLDEKKAAGLPDKCGVSISYSISPNTDCSKVN  118



>ref|XP_010252074.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=120

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P+AEAAITCG VA+ +  C  Y++   P+ AACC GVK L  AAKTT DRQT C+C+KS 
Sbjct  24   PNAEAAITCGMVATQMTPCVNYLQNGGPVPAACCNGVKTLYGAAKTTPDRQTTCSCMKSA  83

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A ++     G AA +PGKCG+ + Y IS +TDCSK+ 
Sbjct  84   ATQVPTIKVGNAASLPGKCGITIPYKISPTTDCSKVK  120



>ref|XP_002270970.1| PREDICTED: non-specific lipid-transfer protein P5 [Vitis vinifera]
Length=118

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A   ++CG VA+ L  C  Y++   PL  ACC GVK+L  +A TT DR+TAC CL + 
Sbjct  22   PMAVEGLSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNSAATTQDRRTACKCLINA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +  +SG N GLAAG+PGKCGVN+ Y IS ST+C +++
Sbjct  82   SKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQVN  118



>ref|XP_009132019.1| PREDICTED: non-specific lipid-transfer protein 3-like [Brassica 
rapa]
 emb|CDX88678.1| BnaA03g09710D [Brassica napus]
Length=125

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +2

Query  170  AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  349
            A I+CGTV  S+  C  Y+ G   LTAACC GV+DL A A+TT DRQ  C CL+++A K+
Sbjct  22   APISCGTVVQSMSPCITYLSGRMDLTAACCGGVRDLNAIAQTTPDRQQTCKCLQAVAKKI  81

Query  350  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             GFN   A+ +PGKC V+  +PIS ST+C  +H
Sbjct  82   PGFNQTRASDLPGKCRVSFPFPISISTNCDNVH  114



>gb|AET05731.1| lipid transfer protein isoform b, partial [Pyrus communis]
Length=94

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITC  V+++L  C  Y++    +  ACC G+K +   AKTT DRQ ACNCLK+LAG +S
Sbjct  3    AITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVS  62

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  63   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  93



>sp|Q2QYL2.1|NLT2B_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2B; Short=LTP 
2B; AltName: Full=LTP B1; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABA96283.1| Nonspecific lipid-transfer protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19434.1| hypothetical protein OsJ_34995 [Oryza sativa Japonica Group]
 gb|AGT42307.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=117

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  158  PHAE-AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            PH   AAI+CG V S++  C  Y +G    +AACC GV+ L +AA TTADR+TACNCLK+
Sbjct  20   PHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKN  79

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +AG +SG N G AA +P KCGV++ Y IS S DCS ++
Sbjct  80   VAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  117



>gb|AEC04836.1| lipid transfer protein [Dimocarpus longan]
Length=115

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAITCG V SS+  C +Y++    +   CC G+K L  AA+TT DRQ AC CL++ 
Sbjct  19   PVAQAAITCGQVTSSVAPCIQYLRSGGSVPPPCCNGIKSLNNAARTTPDRQQACRCLQNA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G N  LAAG+PGKCGVN+ Y ISTST+C+ + 
Sbjct  79   AKAIPGINTNLAAGLPGKCGVNIPYKISTSTNCASVK  115



>gb|AAB70539.1| lipid transfer protein LPT II [Oryza sativa Indica Group]
Length=118

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +2

Query  158  PHAE-AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            PH   AAI+CG V S++  C  Y +G    +AACC GV++L +AA TTADR+TACNCLK+
Sbjct  21   PHTTMAAISCGQVNSAVSPCLSYPRGGSGPSAACCSGVRNLNSAASTTADRRTACNCLKN  80

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +AG +SG N G AA +P KCGV++ Y IS S DCS ++
Sbjct  81   VAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  118



>ref|NP_001176316.1| Os11g0115466 [Oryza sativa Japonica Group]
 sp|A2ZAT0.1|NLTP2_ORYSI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Oryza sativa Indica Group]
 sp|Q7XJ39.2|NLT2A_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2A; Short=LTP 
2A; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91217.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY79714.1| hypothetical protein OsI_34863 [Oryza sativa Indica Group]
 gb|EAY82034.1| hypothetical protein OsI_37220 [Oryza sativa Indica Group]
 gb|EAZ17206.1| hypothetical protein OsJ_32715 [Oryza sativa Japonica Group]
 dbj|BAH95044.1| Os11g0115466 [Oryza sativa Japonica Group]
 gb|AGT42306.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=118

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  158  PHAE-AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            PH   AAI+CG V S++  C  Y +G    +AACC GV+ L +AA TTADR+TACNCLK+
Sbjct  21   PHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKN  80

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +AG +SG N G AA +P KCGV++ Y IS S DCS ++
Sbjct  81   VAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  118



>ref|XP_008244959.1| PREDICTED: non-specific lipid-transfer protein 1-like [Prunus 
mume]
Length=117

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+S+L  C  Y+KG   +  ACCKG++ ++  AKTTADRQ ACNCLK L+G +S
Sbjct  26   AITCGQVSSNLAPCIPYVKGGGAVPPACCKGIRTVSGLAKTTADRQAACNCLKQLSGSIS  85

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G NP  AA +PGKCGVNV Y I+T  +C+ + 
Sbjct  86   GVNPNNAAALPGKCGVNVPYKINTFINCAAVK  117



>ref|NP_001065986.1| Os12g0115000 [Oryza sativa Japonica Group]
 dbj|BAF29005.1| Os12g0115000, partial [Oryza sativa Japonica Group]
Length=110

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  158  PHAE-AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            PH   AAI+CG V S++  C  Y +G    +AACC GV+ L +AA TTADR+TACNCLK+
Sbjct  13   PHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKN  72

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +AG +SG N G AA +P KCGV++ Y IS S DCS ++
Sbjct  73   VAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  110



>sp|Q43871.1|NLTP8_HORVU RecName: Full=Non-specific lipid-transfer protein Cw18; Short=LTP 
Cw-18; AltName: Full=PKG2316; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA48622.1| Cw-18 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
 emb|CAA85483.1| lipid transfer protein precursor [Hordeum vulgare subsp. vulgare]
 dbj|BAK01310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 68/97 (70%), Gaps = 6/97 (6%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            A+AAITCG V+S+L  C  Y KG  T P +A CC GVK LA  A++TAD+Q  C CLKS+
Sbjct  23   ADAAITCGQVSSALGPCAAYAKGSGTSP-SAGCCSGVKRLAGLARSTADKQATCRCLKSV  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG    +N G AAG+P +CGV+V Y IS S DCSKIH
Sbjct  82   AG---AYNAGRAAGIPSRCGVSVPYTISASVDCSKIH  115



>gb|AAA74624.1| lipid transfer protein precursor [Oryza sativa]
Length=118

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +2

Query  158  PHAE-AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            PH   AAI+CG V S++  C  Y +G    +AACC GV+ L +AA TTADR+TACNCLK+
Sbjct  21   PHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKN  80

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +AG +SG N G AA +P KCGV + Y IS S DCS ++
Sbjct  81   VAGSISGLNAGNAASIPSKCGVTIPYTISPSIDCSSVN  118



>gb|ACJ62320.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62321.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62322.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62327.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62334.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62336.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62359.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62360.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62386.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            ITCG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +S
Sbjct  30   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVS  89

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>ref|NP_001240073.1| uncharacterized protein LOC100815185 precursor [Glycine max]
 gb|ACU20651.1| unknown [Glycine max]
Length=122

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAITCG VA  +  CF Y++     + ACC GVK L++AAKTTADRQ AC+CLK+L
Sbjct  24   PMAQAAITCGQVAGDMSPCFSYLRSGGKPSQACCNGVKSLSSAAKTTADRQGACSCLKNL  83

Query  338  AGKL-SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  +    N G AA +PGKCGVN+ Y ISTST+C+ I 
Sbjct  84   ANNMGQSLNAGNAASLPGKCGVNIPYKISTSTNCATIK  121



>gb|AFD32275.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=114

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +2

Query  170  AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  349
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  22   SAITCGQVDSDLTSCLAYARNGGQIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  81

Query  350  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             G N  + AG+PGKCGVN+ YPIS  TDC+K+ 
Sbjct  82   LGLNANIVAGIPGKCGVNIPYPISMQTDCNKVR  114



>gb|AFD32273.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +2

Query  170  AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  349
            +AITCG V S L SC  Y +    +   CC+GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLTSCLGYSRNGGEIPPGCCEGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  350  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             G N  + AG+PGKCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNANIVAGIPGKCGVNIPYPISMQTDCNKVR  113



>sp|Q9M5X6.1|NLTP_PYRCO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pyr c 3; Flags: Precursor [Pyrus communis]
 gb|AAF26451.1| lipid transfer protein precursor [Pyrus communis]
Length=115

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITC  V+++L  C  Y++    +  ACC G+K +   AKTT DRQ ACNCLK+LAG +S
Sbjct  24   AITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVS  83

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G NPG A  +PGKCGVNV Y ISTST+C+ +
Sbjct  84   GVNPGNAESLPGKCGVNVPYKISTSTNCATV  114



>ref|XP_006362360.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA +TCG V S L  C  Y++G  P+   CC GVK L  AAKT ADR+TAC CLKS 
Sbjct  20   PHAEA-LTCGQVTSGLAPCLPYLQGRGPI-GGCCGGVKGLLGAAKTPADRKTACTCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G + G AAG+PG CGVN+ Y IS STDCSKI 
Sbjct  78   ANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSKIQ  114



>ref|XP_011091599.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=118

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P  EAAI CGTV S L  C  Y+ G   L   CCKG+K L   AK+T DRQ+ CNCLK L
Sbjct  23   PEGEAAIGCGTVVSKLSPCIPYVTGKGAL-GGCCKGIKGLYDLAKSTGDRQSVCNCLKFL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A   SG N G AA +PG+CGV++ Y IS STDCSK+ 
Sbjct  82   AASTSGVNLGKAAALPGQCGVSIPYKISPSTDCSKVK  118



>emb|CAT99615.1| lipid transfer protein [Malus domestica]
Length=82

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = +2

Query  185  GTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGFNP  364
            G V+S+LV CF Y++   P+  ACC G++ +   AKTT DRQ ACNCLKSLAG +SG NP
Sbjct  1    GQVSSNLVPCFDYVRSGGPVPPACCNGIRTINGLAKTTPDRQAACNCLKSLAGSVSGVNP  60

Query  365  GLAAGVPGKCGVNVGYPISTST  430
            G A  +PGKCGVNV Y ISTST
Sbjct  61   GNAESLPGKCGVNVPYKISTST  82



>ref|XP_010043171.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88335.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
 gb|KCW88336.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  346
            E+A+TCG VAS +  C  Y++    L +ACC G++ L +AA+TT DRQTAC CL+S AG 
Sbjct  23   ESAVTCGQVASCVAPCLGYLRAGGTLPSACCSGIRSLNSAARTTPDRQTACRCLQSAAGN  82

Query  347  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            + G N GL + +PGKCGV+V Y IS STDCS++ 
Sbjct  83   IRGLNLGLVSALPGKCGVSVPYKISPSTDCSRVK  116



>gb|ADR66953.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+S+L  C  Y+KG   +  ACC G++++   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSNLAPCIPYVKGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVNIPYQISPSTNCANVK  117



>sp|Q03461.1|NLTP2_TOBAC RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA03044.1| lipid transfer protein [Nicotiana tabacum]
Length=114

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA ++CG V S L  C  Y++G  PL  +CC GVK L  AAK+ +DR+TAC CLKS 
Sbjct  20   PHAEA-LSCGQVQSGLAPCLPYLQGRGPL-GSCCGGVKGLLGAAKSLSDRKTACTCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G + G AAG+PG CGVN+ Y IS STDCSK+ 
Sbjct  78   ANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ  114



>gb|AFK46170.1| unknown [Lotus japonicus]
Length=119

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAAI+CG+V  +L  C  Y+ G    +  CC GVK+L AAA TT DR+TAC CLK+ 
Sbjct  22   PMAEAAISCGSVIGALTPCMPYLTGGPAPSPQCCAGVKNLNAAASTTPDRKTACGCLKNA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +   N G AA +PGKCGVN+ Y ISTST+C+ I 
Sbjct  82   AGSMPNLNAGNAAALPGKCGVNIPYKISTSTNCNTIK  118



>gb|ACJ62316.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62332.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62333.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62337.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62380.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62382.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62383.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62384.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
 gb|ACJ62385.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=116

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            ITCG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +S
Sbjct  25   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVS  84

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  85   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  116



>ref|XP_004978531.1| PREDICTED: non-specific lipid-transfer protein 3-like [Setaria 
italica]
Length=121

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            ITCG VASSL  C  Y  G  + + + CC GV+ L +AA+T+ADRQ AC CLKSLAG + 
Sbjct  30   ITCGQVASSLAPCIPYATGNAKAMPSGCCGGVRSLNSAARTSADRQAACRCLKSLAGSIK  89

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
              N G  AG+PGKCGV+V +PIS STDC+K+
Sbjct  90   KLNMGTVAGIPGKCGVSVPFPISMSTDCNKV  120



>ref|NP_001150972.1| nonspecific lipid-transfer protein 3 precursor [Zea mays]
 gb|ACG41114.1| nonspecific lipid-transfer protein 3 precursor [Zea mays]
Length=122

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            ITCG V SSL  C  Y  G    L A+CC GVK L +AA+T+ADRQ AC CLKSLA  + 
Sbjct  31   ITCGQVGSSLAPCIPYATGRASALPASCCSGVKSLNSAARTSADRQAACRCLKSLANSVK  90

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
              N G  A +PGKCGV+VG+PIS STDC+KI
Sbjct  91   SVNMGTVATIPGKCGVSVGFPISMSTDCNKI  121



>ref|NP_001142300.1| uncharacterized protein LOC100274469 precursor [Zea mays]
 gb|ACF79347.1| unknown [Zea mays]
 gb|ACF86436.1| unknown [Zea mays]
 gb|ACF88133.1| unknown [Zea mays]
 gb|ACR36788.1| unknown [Zea mays]
 tpg|DAA59276.1| TPA: non-specific lipid-transfer protein [Zea mays]
Length=123

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKG-TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            ITCG V SSL  C  Y  G    L A+CC GVK L +AA+T+ADRQ AC CLKSLA  + 
Sbjct  32   ITCGQVGSSLAPCIPYATGRASALPASCCSGVKSLNSAARTSADRQAACRCLKSLANSVK  91

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
              N G  A +PGKCGV+VG+PIS STDC+KI
Sbjct  92   SVNMGTVATIPGKCGVSVGFPISMSTDCNKI  122



>ref|XP_009757911.1| PREDICTED: non-specific lipid-transfer protein 2 [Nicotiana sylvestris]
 dbj|BAK19151.1| lipid transfer protein [Nicotiana tabacum]
Length=114

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA ++CG V S L  C  Y++G  PL  +CC GVK L  AAK+ +DR+TAC CLKS 
Sbjct  20   PHAEA-LSCGQVQSGLAPCLPYLQGRGPL-GSCCGGVKGLLGAAKSPSDRKTACTCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G + G AAG+PG CGVN+ Y IS STDCSK+ 
Sbjct  78   ANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ  114



>gb|ABK96813.1| lipid transfer protein isoform 1.1 precursor [Lactuca sativa]
Length=114

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P+AEAAITCG V SSL  C  Y++    +  ACC GVK L +AA+TT DRQT C CLK  
Sbjct  21   PYAEAAITCGQVVSSLSQCASYLRNGGAVPPACCSGVKSLNSAARTTPDRQTVCGCLKRA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +G   G N   AA +PGKCGVN+ Y IS STDCSK+ 
Sbjct  81   SG---GVNASNAASLPGKCGVNIPYKISPSTDCSKVQ  114



>gb|ABA33859.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33861.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33864.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33865.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=118

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTADR+ ACNCLK+ A
Sbjct  23   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAA  82

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KC V++ Y ISTSTDCS+++
Sbjct  83   AGVSGLNAGNAASIPSKCSVSIPYTISTSTDCSRVN  118



>ref|NP_001275027.1| non-specific lipid transfer protein a7 precursor [Solanum tuberosum]
 gb|ABU49727.1| non-specific lipid transfer protein a7 [Solanum tuberosum]
 gb|ABU49729.1| putative non-specific lipid transfer protein f10 [Solanum tuberosum]
Length=114

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA ++CG V S L  C  Y++G+ PL   CC GVK L  AAKT  DR+TAC CLKS 
Sbjct  20   PHAEA-LSCGQVTSGLAPCLPYLQGSGPL-GGCCGGVKGLLGAAKTPEDRKTACTCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G + G AAG+PG CGVN+ Y IS STDCSK+ 
Sbjct  78   ANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSKVQ  114



>ref|XP_009626829.1| PREDICTED: non-specific lipid-transfer protein 2 [Nicotiana tomentosiformis]
 gb|AAM74206.1|AF519812_1 non-specific lipid transfer protein [Nicotiana tabacum]
 dbj|BAK19150.1| lipid transfer protein [Nicotiana tabacum]
Length=114

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA +TCG V SSL  C  Y+ G  PL   CC GVK L  AA+T ADR+TACNCLKS 
Sbjct  20   PHAEA-LTCGQVQSSLAPCVPYLLGRGPL-GGCCGGVKRLLGAARTPADRKTACNCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A    G + G AA +PG CGVN+ Y IS STDCSK+ 
Sbjct  78   ANTFKGIDMGNAARLPGTCGVNIPYKISPSTDCSKVQ  114



>ref|XP_006281297.1| hypothetical protein CARUB_v10027347mg, partial [Capsella rubella]
 gb|EOA14195.1| hypothetical protein CARUB_v10027347mg, partial [Capsella rubella]
Length=137

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  343
            A+AAI+CGTVA+SL  C  Y+     +   CC GVK L + A+TT DRQ AC CL+S A 
Sbjct  43   ADAAISCGTVATSLAPCANYLSKGGEVPVPCCGGVKSLISMAQTTPDRQQACRCLQSTAK  102

Query  344  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
             +SG +P LA+G+PGKCGV++ YPIS ST+C  +
Sbjct  103  GMSGLDPSLASGLPGKCGVSIPYPISMSTNCDNV  136



>gb|AAT68264.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHA+AAI CG V SSL+ C  Y+     + A CC G+K L   A +T DRQTACNC+KS 
Sbjct  21   PHADAAIFCGRVVSSLIPCINYVIKGGAIPAPCCNGIKSLNNQATSTPDRQTACNCIKSA  80

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G N   A  +PGKCGVN+ Y IS S DCS + 
Sbjct  81   AASIKGINFSHAGSLPGKCGVNLPYKISPSIDCSTVQ  117



>ref|XP_008244918.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X2 [Prunus 
mume]
Length=123

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A AA++CG V +SL  C  Y+    PL  +CC GVK L + A+TTADRQ+ CNCLK  
Sbjct  25   PKAMAAVSCGQVVNSLTPCLSYVSNNGPLNPSCCTGVKSLYSMAQTTADRQSICNCLKQA  84

Query  338  AGKL--SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
               +  +  N GLAAG+PGKCGVN+ Y IS STDC  I 
Sbjct  85   VNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKSIK  123



>gb|KHG21711.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 67/99 (68%), Gaps = 2/99 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEP--LTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ A+TCG V SSL  C  Y++GT    +   CC G+K L +AA+TT DRQ AC C+K
Sbjct  22   PLAQGAVTCGQVTSSLAPCISYLRGTGAGAIPPGCCSGIKSLNSAAQTTPDRQAACKCIK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            S A  + G N GLA+G+PGKCGVN+ Y IS STDC+ + 
Sbjct  82   SAATGIRGINFGLASGLPGKCGVNIPYKISPSTDCNSVK  120



>ref|XP_007134675.1| hypothetical protein PHAVU_010G066500g [Phaseolus vulgaris]
 gb|ADC80502.1| non-specific lipid transfer protein 1a precursor [Phaseolus vulgaris]
 gb|ESW06669.1| hypothetical protein PHAVU_010G066500g [Phaseolus vulgaris]
Length=115

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +2

Query  161  HAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            H    +TCG V S+LV C  +++    + A CC GV+++  +A++TADR+  CNCLK+ A
Sbjct  20   HTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAA  79

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G + G NP  A  +PGKCGVN+ Y ISTST+C+ I+
Sbjct  80   GAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASIN  115



>sp|Q43193.1|NLTP1_SORBI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Sorghum bicolor]
 emb|CAA50660.1| lipid transfer protein [Sorghum bicolor]
Length=118

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (73%), Gaps = 3/96 (3%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT--EPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            +EAAI+CG V+S++  C  Y +G    P +A CC GV+ L +AA+TTADR+ ACNCLK+ 
Sbjct  23   SEAAISCGQVSSAIALCLSYARGQGFAP-SAGCCSGVRSLNSAARTTADRRAACNCLKNA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            A  +SG N G AA +P KCGV+V Y ISTSTDCS++
Sbjct  82   ARGISGLNAGNAASIPSKCGVSVPYTISTSTDCSRV  117



>dbj|BAH03575.1| nonspecific lipid transfer protein [Citrus jambhiri]
Length=115

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P +  AITCG V+S+L  C  Y++   P+   CC GV+ L AAA+TT DRQTACNCLK  
Sbjct  19   PLSAQAITCGQVSSALAPCIFYLRAGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +   NP  A G+P  CGV++ Y IS STDCSK+ 
Sbjct  79   AGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR  115



>dbj|BAJ91878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 6/97 (6%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKG--TEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            A+AAITCG V+S+L  C  Y KG  T P +A CC GVK LA  A++TAD+Q  C CLKS+
Sbjct  23   ADAAITCGQVSSALGPCAAYAKGSGTSP-SAGCCSGVKRLAGLARSTADKQATCRCLKSV  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG    +N G AAG+P +CGV+V Y IS S DC+KIH
Sbjct  82   AG---AYNAGRAAGIPSRCGVSVPYTISASVDCTKIH  115



>ref|XP_010035997.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW47517.1| hypothetical protein EUGRSUZ_K01282 [Eucalyptus grandis]
Length=118

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  355
            ITC  ++SS+  C  Y++G+ PL++ACC GVK L  AA+TTADRQ AC CL+S AG + G
Sbjct  28   ITCSQISSSMGPCIGYLRGSGPLSSACCSGVKSLNTAARTTADRQAACRCLQSAAGSIQG  87

Query  356  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             +  LAAG+PGKCGV+V Y IS +TDC  + 
Sbjct  88   IDFNLAAGLPGKCGVSVPYKISPTTDCKSVK  118



>gb|KDP27368.1| hypothetical protein JCGZ_20192 [Jatropha curcas]
Length=117

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYI-KGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            P AEAAITCG VASS+ +C  Y+ KG      ACC GV+ L AAAKTTADRQ AC CLKS
Sbjct  22   PLAEAAITCGQVASSVSACIPYLRKGVAAPPPACCSGVRSLNAAAKTTADRQQACKCLKS  81

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  442
             +  + G +  LAAG+PGKCGV++ Y IS S DCSK
Sbjct  82   ASNSIPGIDLNLAAGLPGKCGVSIPYKISPSVDCSK  117



>sp|Q43017.1|NLTP1_PRUDU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Prunus dulcis]
 emb|CAA65475.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80964.1| putative allergen Pru du 3.01 [Prunus dulcis x Prunus persica]
 gb|ACH58427.1| lipid transfer protein [Prunus dulcis]
 gb|ADR66954.1| non-specific lipid transfer protein [Prunus dulcis]
Length=117

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+S+L  C  Y++G   +  ACC G++++   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVNIPYQISPSTNCANVK  117



>ref|XP_006662670.1| PREDICTED: non-specific lipid-transfer protein 3-like [Oryza 
brachyantha]
 ref|XP_006663742.1| PREDICTED: non-specific lipid-transfer protein 3-like [Oryza 
brachyantha]
Length=119

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGTEPL-TAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            A AA++CG V S++  C  Y+ G     +++CC GVK L   A ++ADR+TAC+CLKS+A
Sbjct  24   ASAAVSCGDVTSAIAPCLSYVTGRMSAPSSSCCSGVKTLNGKASSSADRRTACSCLKSMA  83

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G +   N G AA +P KCGV+V +PISTS DCSKI+
Sbjct  84   GSVRNLNMGNAATIPSKCGVSVAFPISTSVDCSKIN  119



>ref|XP_011091591.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091594.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091595.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 gb|ABQ53933.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P  EAAI CGTV S L  C  Y+    PL  +CC GVK L  AA+T  DRQ+ C+CLKSL
Sbjct  23   PRGEAAIGCGTVVSYLNPCLPYVTNKGPL-GSCCGGVKGLYGAAQTAQDRQSVCSCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG     +   AAG+PG+CGVN+ Y IS STDCSK++
Sbjct  82   AGSYKDVDLNKAAGLPGQCGVNIPYKISPSTDCSKVN  118



>ref|XP_011091597.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P  EAAI CGTV S L  C  Y+    PL  +CC GVK L  AA+T  DRQ+ C+CLKSL
Sbjct  23   PRGEAAIGCGTVVSYLNPCLPYVTNKGPL-GSCCGGVKGLYGAAQTAQDRQSVCSCLKSL  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG     +   AAG+PG+CGVN+ Y IS STDCSK++
Sbjct  82   AGSYKDVDLNKAAGLPGQCGVNIPYKISPSTDCSKVN  118



>gb|ADR66949.1| non-specific lipid transfer protein [Prunus sargentii]
Length=117

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+S+L  C  Y++G   +  ACC G++D+   A+TT DRQ ACNCLK L+  + 
Sbjct  26   AITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRDVNNLARTTPDRQAACNCLKQLSASVP  85

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G NP  AA +PGKCGVN+ Y IS ST+C+ + 
Sbjct  86   GVNPNNAAVLPGKCGVNIPYKISPSTNCATVK  117



>ref|XP_006429570.1| hypothetical protein CICLE_v10013139mg [Citrus clementina]
 ref|XP_006481183.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42810.1| hypothetical protein CICLE_v10013139mg [Citrus clementina]
Length=117

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+AA+TCG V SSL +C  Y+ G     +  ACC G+K L +AA TT DRQ+ CNCLK
Sbjct  19   PIAQAAVTCGQVTSSLQACMPYVTGPGGGAVPPACCSGIKSLNSAATTTPDRQSVCNCLK  78

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            + AG +   N  LA+G+P +CGVN+ Y IS S DCS++ 
Sbjct  79   TAAGSIRNLNLNLASGLPRQCGVNIPYQISPSVDCSRVR  117



>ref|XP_010529189.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=117

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  343
            AEA I+CGTVAS +  C  Y+    PL  ACC GV+ L + A TT  RQ AC CL+S A 
Sbjct  23   AEAQISCGTVASRVAPCIAYLTRGGPLPPACCAGVRSLNSLANTTPARQAACRCLQSAAR  82

Query  344  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             + G N G A+G+P  CGV + YPIST+T+C+ + 
Sbjct  83   SIPGLNQGAASGLPRACGVRISYPISTTTNCNNVK  117



>gb|ABY21307.1| pollen allergen Pla o 3 [Platanus orientalis]
Length=118

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEAAITCGTV + L  C  Y++    +  ACC GVK L   AKTT DRQ AC CLK+ 
Sbjct  22   PHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +  +SG   G AA + GKCGVN+ Y IS + DCSK+ 
Sbjct  82   STSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK  118



>sp|P85105.1|NLTP5_VITSX RecName: Full=Non-specific lipid-transfer protein P5; Short=LTP 
P5 [Vitis sp.]
Length=91

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  355
            ++CG VA+ L  C  Y++   PL  ACC GVK+L  +A TT DR+TAC CL + +  +SG
Sbjct  1    LSCGDVATQLAPCINYLRSAGPLPVACCNGVKNLKNSAATTQDRRTACKCLINASKSISG  60

Query  356  FNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             N GLAAG+PGKCGVN+ Y IS ST+C +++
Sbjct  61   VNFGLAAGLPGKCGVNIPYKISPSTNCDQVN  91



>ref|XP_010253094.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=119

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAE-AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKS  334
            PH E AAITCG V SS+  C  Y++    +  ACC GVK L +AAKTT DRQTACNCLKS
Sbjct  22   PHQEVAAITCGQVVSSIAPCLNYLQKGGAVPPACCSGVKSLNSAAKTTPDRQTACNCLKS  81

Query  335  LAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
             A        GLA+ +P KCGVNV Y IS STDCSK+
Sbjct  82   AAVSNPSIQAGLASSLPAKCGVNVPYKISPSTDCSKV  118



>ref|XP_008244937.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V+S+L  C  Y+ G   +  ACC G++++   A TTADRQ ACNCLK L+G + 
Sbjct  26   AITCGQVSSNLAPCIPYVIGGGAVPPACCNGIRNVDNLANTTADRQAACNCLKQLSGSIP  85

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G NP  AA +PGKCGVN+ Y IS+ST+C+ + 
Sbjct  86   GVNPNNAASLPGKCGVNIPYNISSSTNCATVK  117



>gb|AEN70915.1| lipid transfer protein [Gossypium thurberi]
 gb|AEN70938.1| lipid transfer protein [Gossypium trilobum]
Length=120

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYI--KGTEPLTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ A+TCG V SSL  CF Y+   G   +   CC G+K L +AA+TT DRQ AC C+K
Sbjct  22   PLAQGAVTCGQVTSSLAPCFAYLTGNGAGSVPPRCCGGIKSLNSAAQTTPDRQAACKCIK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            S A  +SG N G+A+G+PGKCGVN+ Y IS STDC++ 
Sbjct  82   SAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCNRF  119



>gb|ACJ62381.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  349
            ITCG V+S++  C  Y +GT   P T+ CC GV++L +AA T ADR+ ACNCLK+ A  +
Sbjct  30   ITCGQVSSAIAPCLSYARGTASGPSTS-CCSGVRNLQSAASTAADRRAACNCLKNAARGV  88

Query  350  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  89   SGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>gb|KJB71535.1| hypothetical protein B456_011G128300 [Gossypium raimondii]
Length=120

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTA--ACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ AI+CG + S+L  C  Y+KG    +A  ACC G++ L +AAKTT DRQ AC+C+K
Sbjct  22   PLAQGAISCGQITSALAPCIAYLKGNGAGSAPPACCNGIRSLNSAAKTTPDRQAACSCIK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            S A  +SG N   AAG+PGKCG+N+ Y IS STDC + H
Sbjct  82   SAATGISGINYSTAAGLPGKCGINIPYKISPSTDCKRFH  120



>gb|AFD32274.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +2

Query  170  AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  349
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGEIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  350  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             G N  + AG+PGKCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNANIVAGIPGKCGVNIPYPISMQTDCNKVR  113



>ref|NP_001275802.1| lipid-transfer protein precursor [Citrus sinensis]
 gb|AAM21292.1|AF369931_1 lipid-transfer protein [Citrus sinensis]
Length=115

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P +  AITCG V+ SL  C  +++   P+   CC GV+ L AAA+TT DRQTACNCLK  
Sbjct  19   PLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +   N   AAG+PG CGV++ Y ISTSTDCSK+ 
Sbjct  79   AGSIPNLNLNNAAGLPGACGVSIPYKISTSTDCSKVR  115



>gb|ACG40474.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
Length=120

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  AEAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            +EAAI+CG VAS++  C  Y +G     +A CC GV+ L  AA+TTA R+ ACNCLK+ A
Sbjct  25   SEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTAXRRAACNCLKNAA  84

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              +SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  85   AGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>ref|XP_002442774.1| hypothetical protein SORBIDRAFT_08g002670 [Sorghum bicolor]
 gb|EES16612.1| hypothetical protein SORBIDRAFT_08g002670 [Sorghum bicolor]
Length=123

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +2

Query  182  CGTVASSLVSCFKYIKGTEPL-TAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSGF  358
            CG V S++  C  Y +GT    +AACC GV+ L +AA +TAD++TACNCLKS AG++SG 
Sbjct  34   CGQVNSAISPCLAYARGTGTAPSAACCSGVRSLNSAASSTADKRTACNCLKSAAGRVSGL  93

Query  359  NPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            N G AA +P KCGVN+ Y IS S DCS+++
Sbjct  94   NAGNAASIPSKCGVNIPYTISASIDCSRVN  123



>gb|AEN70918.1| lipid transfer protein [Gossypium turneri]
 gb|AEN70931.1| lipid transfer protein [Gossypium armourianum]
 gb|AEN70932.1| lipid transfer protein [Gossypium harknessii]
Length=120

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEP--LTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ A+TCG V SSL  C  Y++G     +   CC G+K L +AA+TT DRQ AC C+K
Sbjct  22   PLAQGAVTCGQVTSSLAPCINYLRGNGAGAVPPGCCGGIKSLNSAAQTTPDRQAACKCIK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            S A  +SG N G+A+G+PGKCGVN+ Y IS STDC++ 
Sbjct  82   SAAASISGINFGIASGLPGKCGVNIPYKISPSTDCNRF  119



>gb|ACJ62387.1| lipid-transfer protein, partial [Zea mays subsp. parviglumis]
Length=116

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  349
            ITCG V+S++  C  Y +GT   P T+ CC GV++L +AA T ADR+ ACNCLK+ A  +
Sbjct  25   ITCGQVSSAIAPCLSYARGTASGPSTS-CCSGVRNLQSAASTAADRRAACNCLKNAARGV  83

Query  350  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            SG N G AA +P KCGV++ Y ISTSTDCS+++
Sbjct  84   SGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  116



>ref|NP_001241144.1| uncharacterized protein LOC100817318 precursor [Glycine max]
 gb|ACU20523.1| unknown [Glycine max]
Length=122

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAITCG VA  +  C  Y++     + ACC GVK L+ AAKTTADRQ ACNCLK+L
Sbjct  24   PMAQAAITCGQVAGDVSPCLSYLRSGGKPSDACCNGVKSLSGAAKTTADRQAACNCLKNL  83

Query  338  AGKL-SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  +    N G AA +PGKCGVN+ Y ISTST+C+ I 
Sbjct  84   ANNMGQSLNAGNAASLPGKCGVNIPYKISTSTNCATIK  121



>ref|XP_010043178.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88337.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P  E+AITCG V S +  C  Y++    + +ACC G++ L  AA+TT DR+T C C++S 
Sbjct  20   PLTESAITCGQVRSWVAPCLGYLRAGGKIPSACCSGIRSLNNAARTTHDRRTTCRCVQSA  79

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            AG + G N GL + +PGKCGV + Y IS STDCS++
Sbjct  80   AGNIQGLNLGLVSALPGKCGVRIPYKISPSTDCSRV  115



>gb|ABH03042.1| non-specific lipid transfer protein [Solanum sogarandinum]
Length=114

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA +TCG V SSL  CF Y+    PL   CC GVK L   A+TTADRQTAC CLKS 
Sbjct  20   PHAEA-LTCGQVTSSLAPCFPYLMNRGPL-GGCCGGVKSLLGQAQTTADRQTACTCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A   +G + G AAG+P  C VN+ Y IS STDCSK+ 
Sbjct  78   ASSFTGLDLGKAAGLPSACSVNIPYKISPSTDCSKVQ  114



>ref|NP_568905.1| non-specific lipid-transfer protein 3 [Arabidopsis thaliana]
 sp|Q9LLR7.1|NLTP3_ARATH RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF76929.1| lipid transfer protein 3 [Arabidopsis thaliana]
 gb|AAL38769.1| putative nonspecific lipid-transfer protein precursor [Arabidopsis 
thaliana]
 gb|AAM19801.1| AT5g59320/mnc17_210 [Arabidopsis thaliana]
 gb|AAM20222.1| putative nonspecific lipid-transfer precursor [Arabidopsis thaliana]
 gb|AAN60256.1| unknown [Arabidopsis thaliana]
 gb|AED97171.1| non-specific lipid-transfer protein 3 [Arabidopsis thaliana]
Length=115

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  346
            +AAI+CGTVA SL  C  Y+     +  +CC GVK L + AKTT DRQ AC C++S A  
Sbjct  22   DAAISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKS  81

Query  347  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +SG NP LA+G+PGKCGV++ YPIS ST+C+ I 
Sbjct  82   ISGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK  115



>dbj|BAB09777.1| lipid transfer protein-like [Arabidopsis thaliana]
Length=113

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  346
            +AAI+CGTVA SL  C  Y+     +  +CC GVK L + AKTT DRQ AC C++S A  
Sbjct  22   DAAISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKS  81

Query  347  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  442
            +SG NP LA+G+PGKCGV++ YPIS ST+C+K
Sbjct  82   ISGLNPSLASGLPGKCGVSIPYPISMSTNCNK  113



>gb|KCW47519.1| hypothetical protein EUGRSUZ_K01282 [Eucalyptus grandis]
Length=116

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLSG  355
            ITC  ++SS+  C  Y++G+ PL++ACC GVK L  AA+TTADRQ AC CL+S AG + G
Sbjct  28   ITCSQISSSMGPCIGYLRGSGPLSSACCSGVKSLNTAARTTADRQAACRCLQSAAGSIQG  87

Query  356  FNPGLAAGVPGKCGVNVGYPISTSTDC  436
             +  LAAG+PGKCGV+V Y IS +TDC
Sbjct  88   IDFNLAAGLPGKCGVSVPYKISPTTDC  114



>gb|EYU41040.1| hypothetical protein MIMGU_mgv1a016547mg [Erythranthe guttata]
Length=117

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P  EAAI CGTV S +  C  Y+ G+ PL   CC G+K L +AAKTT DRQ+ C CLKSL
Sbjct  25   PRGEAAIGCGTVVSYMKPCLPYVTGSGPL-GGCCGGIKGLNSAAKTTPDRQSVCACLKSL  83

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG   G N G AA +PG+CGVN+ Y IS STDCSK+ 
Sbjct  84   AG---GVNLGKAAALPGQCGVNIPYKISPSTDCSKVK  117



>ref|XP_006355283.1| PREDICTED: non-specific lipid-transfer protein 2 isoform X2 [Solanum 
tuberosum]
Length=114

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA ++CG V S L  C  Y++G+ P+   CC GVK L  AAKT  DR+TAC CLKS 
Sbjct  20   PHAEA-LSCGEVTSGLAPCLPYLQGSGPI-GGCCGGVKGLLGAAKTPEDRKTACTCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G + G AAG+PG CGVN+ Y IS STDCSK+ 
Sbjct  78   ANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSKVQ  114



>gb|ACP43542.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +2

Query  161  HAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
             AEAA +CGTV SSL  C  Y+K    +   CC GVK L AAAKTT DRQTACNC+K+ A
Sbjct  24   QAEAAFSCGTVVSSLTPCLTYLKSGGSVPTTCCSGVKSLNAAAKTTPDRQTACNCMKNAA  83

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
              ++G    LA  +P KCGVN+ Y IS STDCSK++
Sbjct  84   AGITGLKLELAGSLPTKCGVNIPYKISPSTDCSKVN  119



>ref|XP_010690794.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=118

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEAAI CG V+ SL +C  +++  +   AACC GVK L     TT D++TAC C+KS 
Sbjct  22   PHAEAAINCGLVSQSLAACLGFLENGQGPNAACCNGVKTLRNLTPTTQDKRTACRCMKSA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G N   +A +PGKCGV++  P+    DCS+IH
Sbjct  82   ASAIPGINHKYSAALPGKCGVSIPGPVGPQADCSQIH  118



>gb|AAF23460.1|AF208834_1 non-specific lipid transfer protein precursor [Capsicum annuum]
Length=114

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA +TCG V S +  C  Y+ G+ PL   CC GVK L  AAKT ADR+T C+CLKS 
Sbjct  20   PHAEA-LTCGQVQSRMTPCLPYLTGSGPL-GRCCGGVKGLLGAAKTPADRKTVCSCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG + G N   AAG+P  CGVN+ Y IS STDC+K+ 
Sbjct  78   AGSIGGINVRKAAGLPNMCGVNIPYQISPSTDCTKVQ  114



>ref|XP_006355281.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=116

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA ++CG V S L  C  Y++G  PL   CC GVK L  AAKT ADR+TAC CLKS 
Sbjct  22   PHAEA-LSCGQVTSGLAPCLPYLQGRGPL-GGCCGGVKGLLGAAKTPADRKTACTCLKSA  79

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G + G AAG+P  CGVN+ Y IS STDCSK+ 
Sbjct  80   ASAIKGIDVGKAAGIPSACGVNIPYKISPSTDCSKVQ  116



>ref|XP_010091033.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
 gb|EXB41951.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
Length=121

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEA ITCG V+SS+  C  Y+K    + AACC GV+ L +AAKTTADRQ ACNCLK+ 
Sbjct  20   PLAEA-ITCGQVSSSVAPCINYLKVGGAVPAACCNGVRSLNSAAKTTADRQAACNCLKTA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +  + G N  LAAG+PGKCGV+V Y IS ST+C++ +
Sbjct  79   SASIKGINLSLAAGLPGKCGVSVPYKISPSTNCNRYN  115



>ref|XP_006429567.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
 ref|XP_006481182.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42807.1| hypothetical protein CICLE_v10012953mg [Citrus clementina]
Length=115

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P +  AITCG V  SL  C  Y++   P+   CC GV+ L AAA+TT DRQTACNCLK  
Sbjct  19   PLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQA  78

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG +   NP  A G+P  CGV++ Y IS STDCSK+ 
Sbjct  79   AGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR  115



>gb|KHG30577.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEP--LTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ A+TCG V +SL  C  Y++G+    +   CC G+K L +AA+TT DRQ AC C+K
Sbjct  22   PLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPVCCSGIKSLNSAAQTTPDRQAACRCIK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            S A  ++G N GLA+G+PGKCGVN+ Y IS STDC+ + 
Sbjct  82   SAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK  120



>gb|ADY68820.1| lipid transfer protein 3 [Gossypium herbaceum subsp. africanum]
 gb|ADY68822.1| lipid transfer protein 3 [Gossypium barbadense]
 gb|ADY68824.1| lipid transfer protein 3 [Gossypium hirsutum]
 gb|AEN70921.1| lipid transfer protein [Gossypium darwinii]
 gb|AEN70923.1| lipid transfer protein [Gossypium tomentosum]
 gb|AEN70925.1| lipid transfer protein [Gossypium barbadense var. brasiliense]
 gb|AEN70927.1| lipid transfer protein [Gossypium barbadense var. peruvianum]
 gb|AEN70929.1| lipid transfer protein [Gossypium hirsutum subsp. latifolium]
Length=120

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEP--LTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ A+TCG V +SL  C  Y++G+    +   CC G+K L +AA+TT DRQ AC C+K
Sbjct  22   PLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLNSAAQTTPDRQAACRCIK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            S A  ++G N GLA+G+PGKCGVN+ Y IS STDC++ 
Sbjct  82   SAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNRF  119



>gb|AAG29777.1| lipid transfer protein 3 precursor [Gossypium hirsutum]
 gb|ACI26697.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43270.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43271.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43272.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEP--LTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ A+TCG V +SL  C  Y++G+    +   CC G+K L +AA+TT DRQ AC C+K
Sbjct  22   PLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLNSAAQTTPDRQAACRCIK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            S A  ++G N GLA+G+PGKCGVN+ Y IS STDC+ + 
Sbjct  82   SAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK  120



>gb|AFD32272.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +2

Query  170  AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  349
            +AITCG V SSL SC  Y +    +   CC GV+ L   AKTT DR+TACNCLKSL    
Sbjct  21   SAITCGQVVSSLTSCLGYARKGGEIPPGCCAGVRTLNNLAKTTPDRKTACNCLKSLVNPS  80

Query  350  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             G N  + AG+PGKCGV++ YPIS  TDC+K+ 
Sbjct  81   LGLNANIVAGIPGKCGVSIPYPISMQTDCNKVR  113



>ref|XP_006346674.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
tuberosum]
Length=110

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 68/95 (72%), Gaps = 2/95 (2%)
 Frame = +2

Query  161  HAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLA  340
            H EA + CG V S ++ C  Y++GT PL   CC GV++LA+AAK+T DR+TAC CLKS A
Sbjct  17   HTEA-LNCGQVTSYIIPCLGYLRGTAPL-GGCCGGVRNLASAAKSTPDRKTACTCLKSAA  74

Query  341  GKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            G +SG N   AAG+P  CGVN+ Y IS STDCSK+
Sbjct  75   GAISGINYSKAAGLPSTCGVNIPYKISPSTDCSKV  109



>gb|AEV12221.1| stigma/stylar cysteine-rich adhesin [Lilium longiflorum]
Length=113

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +2

Query  170  AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  349
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  350  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             G N  + AG+PGKCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNAAIVAGIPGKCGVNIPYPISMQTDCNKVR  113



>gb|AAQ74627.1| lipid transfer protein I [Vigna radiata]
Length=117

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 65/92 (71%), Gaps = 0/92 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG VASSL SC  +I     +  +CC GVK L AAAKTT DRQ  CNCLKS AG++ 
Sbjct  25   AITCGQVASSLTSCIPFITKGGIVPPSCCAGVKSLNAAAKTTPDRQAVCNCLKSEAGRIG  84

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            GFN   AA +PGKCGV++ Y ISTST+C+ I 
Sbjct  85   GFNANNAAILPGKCGVSIPYKISTSTNCASIK  116



>gb|AAY43801.1| FSLTP3 [Gossypium hirsutum]
Length=116

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEP--LTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ A+TCG V +SL  C  Y++G+    +   CC G+K L +AA+TT DRQ AC C+K
Sbjct  18   PLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLNSAAQTTPDRQAACRCIK  77

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKI  445
            S A  ++G N GLA+G+PGKCGVN+ Y IS STDC++ 
Sbjct  78   SAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNRF  115



>gb|ADR66946.1| non-specific lipid transfer protein [Prunus armeniaca]
Length=117

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +2

Query  173  AITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            AITCG V++S+  C  Y+ G   +  ACC G++++   AKTTADRQ ACNCLK L+G + 
Sbjct  26   AITCGQVSNSVAPCIPYVIGGGAVPPACCNGIRNVENLAKTTADRQAACNCLKQLSGSIP  85

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            G NP  AA +PGKCGVNV Y IS ST+C+ + 
Sbjct  86   GVNPNNAAALPGKCGVNVPYKISISTNCAAVK  117



>gb|ACB05670.1| putative non-specific lipid transfer protein [Capsicum annuum]
Length=112

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA +TCG V S +  C  Y+ G+ PL   CC GVK L  AAKT ADR+T C CLKS 
Sbjct  18   PHAEA-LTCGQVQSRMTPCLPYLTGSGPL-GRCCGGVKGLLGAAKTPADRKTVCTCLKSA  75

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG + G N   AAG+P  CGVN+ Y IS STDC+K+ 
Sbjct  76   AGSIGGINVRKAAGLPNMCGVNIPYQISPSTDCTKVQ  112



>ref|XP_009757912.1| PREDICTED: uncharacterized protein LOC104210662 [Nicotiana sylvestris]
Length=260

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 6/115 (5%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA ++CG V S L  C  Y++G  PL  +CC GVK L  AAK+ ADR+TAC CLKS 
Sbjct  20   PHAEA-LSCGQVQSGLAPCLPYLQGRGPL-GSCCGGVKGLLGAAKSPADRKTACTCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH*NRLWESAGFLRQAITEN  502
            A  + G + G AAG+PG CGVN+ Y IS STDCSK +     ES   L+ +IT  
Sbjct  78   ANAIKGIDIGKAAGLPGACGVNIPYKISPSTDCSKYN----IESNSALKTSITHE  128



>gb|ABA34089.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34091.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
Length=119

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +2

Query  176  ITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKLS  352
            ITCG V+S++  C  Y +GT    +A+CC GV++L +AA T ADR+ ACNCLK+ A  +S
Sbjct  30   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVS  89

Query  353  GFNPGLAAGVPGKCGVNVGYPISTSTDCSK  442
            G N G AA +P KCGV++ Y ISTSTDCS+
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCSR  119



>sp|A0AT33.1|NLTP4_LENCU RecName: Full=Non-specific lipid-transfer protein 4; Short=LTP4; 
Contains: RecName: Full=Non-specific lipid-transfer protein 
8; Short=LTP8; Flags: Precursor, partial [Lens culinaris]
 gb|AAX35811.1| lipid transfer protein 4 precursor, partial [Lens culinaris subsp. 
culinaris]
Length=110

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AE AI+CG V S L  C  Y+ G    +  CC GVK L AAA TT DRQ ACNCLKS 
Sbjct  13   PMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSA  72

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG ++  N   AA +PGKCGVN+ Y ISTST+C+ + 
Sbjct  73   AGSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK  109



>ref|XP_008370253.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
 ref|XP_008363932.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
Length=123

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P AEAA+TCG V +SLV C  Y+     L  ACC GVK L   A+TT DRQ  CNCLK  
Sbjct  25   PKAEAAVTCGQVVNSLVPCLSYVTNGGALNPACCNGVKTLYNLAQTTPDRQNVCNCLKQA  84

Query  338  AGKL--SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
               +  +  N GLAAG+P +CGVN+ Y IS STDC  + 
Sbjct  85   INGIPYTNTNAGLAAGLPARCGVNIPYKISPSTDCKSVK  123



>gb|EYU41041.1| hypothetical protein MIMGU_mgv1a016543mg [Erythranthe guttata]
Length=117

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 68/97 (70%), Gaps = 4/97 (4%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P  EAAI CGTV S +  C  Y+ G+ PL   CC G+K L +AAKTT DRQ+AC+CLKSL
Sbjct  25   PLGEAAIGCGTVVSYIKPCLPYVTGSGPL-GGCCGGIKGLNSAAKTTPDRQSACSCLKSL  83

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            AG   G N G AA +PG+CGVN+ Y IS STDCSK+ 
Sbjct  84   AG---GVNLGKAAALPGQCGVNIPYKISPSTDCSKVK  117



>gb|ACZ06858.1| lipid transfer protein [Glycine soja]
Length=122

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A+AAITCG VA  +  CF Y++     + ACC GVK L++AAKTTADRQ AC+CLK+L
Sbjct  24   PMAQAAITCGQVAGDMSPCFSYLRSGGKPSQACCNGVKSLSSAAKTTADRQGACSCLKNL  83

Query  338  AGKL-SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  +    N G AA +PGKCGV++ Y ISTST+C+ I 
Sbjct  84   ANNMGQSLNAGNAASLPGKCGVSIPYKISTSTNCATIK  121



>gb|KDO64078.1| hypothetical protein CISIN_1g033544mg [Citrus sinensis]
Length=117

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTE--PLTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+AA+TCG V SSL +C  Y+ G     +  ACC G+K L +AA TT DRQ+ CNCLK
Sbjct  19   PIAQAAVTCGQVTSSLQACIPYVTGPRGGAVPPACCSGIKSLNSAATTTPDRQSVCNCLK  78

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            + AG +   N  LA+ +P +CGVN+ Y IS S DCS++ 
Sbjct  79   TAAGSIKNLNLNLASRLPRQCGVNIPYQISPSVDCSRVR  117



>gb|AEN70916.1| lipid transfer protein [Gossypium laxum]
Length=120

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGT--EPLTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ A+TCG V +SL  C  Y++G     +   CC G+K L +AA+TT DRQ AC C+K
Sbjct  22   PLAQGAVTCGQVTTSLAPCITYLRGNGAAAVPPGCCGGIKSLNSAAQTTPDRQAACKCIK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  442
            S A  +SG N G+A+G+PGKCGVN+ Y IS STDC++
Sbjct  82   SAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCNR  118



>gb|AEV23220.1| stigma/stylar cysteine-rich adhesin [Lilium longiflorum]
Length=113

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +2

Query  170  AAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGKL  349
            +AITCG V S L SC  Y +    +   CC GV+ L   AKTT DRQTACNCLKSL    
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPS  80

Query  350  SGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
             G N  + AG+PGKCGVN+ YPIS  TDC+K+ 
Sbjct  81   LGLNAAIVAGIPGKCGVNILYPISMQTDCNKVR  113



>gb|AFX66972.1| non-specific lipid transfer protein 2 [Solanum tuberosum]
Length=114

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA ++CG V S L  C  Y++G  PL   CC GVK L  AA+T ADR+TAC CLKS 
Sbjct  20   PHAEA-LSCGQVTSGLAPCLPYLQGRGPL-GGCCSGVKGLLGAARTPADRKTACTCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G + G AAG+P  CGVN+ Y IS STDCSK+ 
Sbjct  78   ASAIKGIDVGKAAGIPSVCGVNIPYKISPSTDCSKVQ  114



>gb|AEN70919.1| lipid transfer protein [Gossypium mustelinum]
 gb|AEN70920.1| lipid transfer protein [Gossypium mustelinum]
Length=120

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEP--LTAACCKGVKDLaaaakttadrqtaCNCLK  331
            P A+ A+TCG V SSL  C  Y+ G     + ++CC G+K L +AA+TT DRQ AC C+K
Sbjct  22   PLAQGAVTCGQVTSSLAPCIAYLTGNGAGGVPSSCCGGIKSLNSAAQTTPDRQAACKCIK  81

Query  332  SLAGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  442
            S A  +SG N G+A+G+PGKCGVN+ Y IS STDC++
Sbjct  82   SAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCNR  118



>ref|XP_002864626.1| hypothetical protein ARALYDRAFT_496059 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40885.1| hypothetical protein ARALYDRAFT_496059 [Arabidopsis lyrata subsp. 
lyrata]
Length=115

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAGK  346
            +AAI+CGTVA SL  C  Y+     +   CC GVK L   A+TT DRQ AC C++S A  
Sbjct  22   DAAISCGTVAGSLAPCATYLSKGGLVPPPCCAGVKKLNGMAQTTPDRQQACRCIQSTAKS  81

Query  347  LSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            +SG NP LA+G+PGKCGV++ YPIS ST+C+ I 
Sbjct  82   ISGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK  115



>gb|EYU41036.1| hypothetical protein MIMGU_mgv1a016508mg [Erythranthe guttata]
Length=118

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 61/95 (64%), Gaps = 1/95 (1%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P  EAAI CG V S +  C  Y+ G  PL   CC G+K L  AAKTT DRQ+ C CLKSL
Sbjct  25   PPGEAAIGCGAVVSYMQPCLPYVTGNSPL-GGCCGGIKSLNNAAKTTPDRQSVCACLKSL  83

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSK  442
            A   SG N G AAG+P  CG+N+ Y IS STDCSK
Sbjct  84   ASSFSGVNFGKAAGLPATCGINIPYKISPSTDCSK  118



>ref|XP_006355280.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            PHAEA ++CG V S L  C  Y++G  PL   CC GVK L  AAKT ADR+TAC CLKS 
Sbjct  20   PHAEA-LSCGQVTSGLAPCLPYLQGRGPL-GGCCGGVKGLLGAAKTPADRKTACTCLKSA  77

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
            A  + G + G AAG+P  CGVN+ Y IS STDCSK+ 
Sbjct  78   ATAIKGIDVGKAAGIPSACGVNIPYKISPSTDCSKVQ  114



>emb|CAN70512.1| hypothetical protein VITISV_005630 [Vitis vinifera]
Length=115

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = +2

Query  158  PHAEAAITCGTVASSLVSCFKYIKGTEPLTAACCKGVKDLaaaakttadrqtaCNCLKSL  337
            P A   ++CG VA+ L  C  Y++   PL  ACC GVK+L  +A TT DR+TAC CL + 
Sbjct  22   PMAVEGLSCGDVATQLAPCINYLRSAGPLPPACCNGVKNLKNSAATTQDRRTACKCLINA  81

Query  338  AGKLSGFNPGLAAGVPGKCGVNVGYPISTSTDC  436
            +  +SG N GLAAG+PGKCGVN+ Y IS ST+C
Sbjct  82   SKSISGVNFGLAAGLPGKCGVNIPYKISPSTNC  114



>gb|AAG27707.1|AF302788_1 lipid transfer protein precursor [Triticum aestivum]
 gb|AAS84745.1| lipid transfer protein [Triticum aestivum]
 gb|AAV65513.1| lipid transfer protein [Triticum aestivum]
 gb|EMT15838.1| Non-specific lipid-transfer protein 4.3 [Aegilops tauschii]
Length=115

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 65/95 (68%), Gaps = 4/95 (4%)
 Frame = +2

Query  167  EAAITCGTVASSLVSCFKYIKGT-EPLTAACCKGVKDLaaaakttadrqtaCNCLKSLAG  343
            +AAI+CG V S+L SC  Y KG+      ACC GV+ LA  A++TAD+Q AC C+KS AG
Sbjct  24   DAAISCGQVNSALASCVSYAKGSGASPPGACCSGVRRLAGLARSTADKQAACRCIKSAAG  83

Query  344  KLSGFNPGLAAGVPGKCGVNVGYPISTSTDCSKIH  448
               G NPG AA +P KCGV++ Y IS S DCSKIH
Sbjct  84   ---GLNPGKAASIPSKCGVSIPYSISASVDCSKIH  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370