BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I12

Length=588
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009784046.1|  PREDICTED: protein IRX15-LIKE-like               95.9    3e-20   Nicotiana sylvestris
ref|XP_009592679.1|  PREDICTED: protein IRX15-LIKE-like               89.0    9e-18   Nicotiana tomentosiformis
ref|XP_006346387.1|  PREDICTED: protein IRX15-like                    88.2    2e-17   Solanum tuberosum [potatoes]
ref|XP_004230754.1|  PREDICTED: protein IRX15-LIKE-like               85.9    1e-16   Solanum lycopersicum
ref|XP_011088226.1|  PREDICTED: protein IRREGULAR XYLEM 15-like       78.2    5e-14   Sesamum indicum [beniseed]
emb|CDO97204.1|  unnamed protein product                              74.3    1e-12   Coffea canephora [robusta coffee]
ref|XP_002283187.1|  PREDICTED: protein IRX15-LIKE                    61.6    3e-08   Vitis vinifera
gb|EYU37651.1|  hypothetical protein MIMGU_mgv1a010254mg              61.2    5e-08   Erythranthe guttata [common monkey flower]
gb|EYU42690.1|  hypothetical protein MIMGU_mgv1a011105mg              59.7    2e-07   Erythranthe guttata [common monkey flower]
gb|EPS67946.1|  hypothetical protein M569_06823                       53.9    1e-05   Genlisea aurea
ref|XP_004136972.1|  PREDICTED: uncharacterized protein LOC101203456  53.9    2e-05   Cucumis sativus [cucumbers]
ref|XP_008454974.1|  PREDICTED: protein IRX15-LIKE-like               52.8    4e-05   Cucumis melo [Oriental melon]
ref|XP_010270730.1|  PREDICTED: protein IRX15-LIKE-like               50.8    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010263448.1|  PREDICTED: protein IRX15-LIKE-like               49.7    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_002285113.1|  PREDICTED: protein IRX15-LIKE-like               49.3    6e-04   Vitis vinifera
emb|CAN74915.1|  hypothetical protein VITISV_041669                   49.3    7e-04   Vitis vinifera



>ref|XP_009784046.1| PREDICTED: protein IRX15-LIKE-like [Nicotiana sylvestris]
Length=311

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  248  NGAKLIVFHPSLQKQGLGIMPAASPRvlllvfvsffafafalsffsGRDAVPPAgsgggs  427
            N AKLIVFHPSL KQG G +  ASPR+  LVF+SFF FAFALSFF+ ++ +P + +   +
Sbjct  4    NSAKLIVFHPSLHKQGSGTVITASPRIWFLVFLSFFTFAFALSFFTAKETLPSSKTSSVT  63

Query  428  sA-RPELPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVLVF  586
            SA    LP  VFDAL+HYA+VN++ V+SRMSA E++ +AA LR C   CN LVF
Sbjct  64   SAVNSPLPATVFDALIHYASVNSSTVSSRMSAVELNTIAAVLRGCKKPCNFLVF  117



>ref|XP_009592679.1| PREDICTED: protein IRX15-LIKE-like [Nicotiana tomentosiformis]
Length=316

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = +2

Query  248  NGAKLIVFHPSLQKQGLGIMPAASPRvlllvfvsffafafalsffsGRDAVPPAgsgggs  427
            N AKLIVFHPSL KQG G    ASPR+  LVF+SFF FAFAL+FF+ ++ +P + +   +
Sbjct  4    NSAKLIVFHPSLHKQGSGTRITASPRIWFLVFLSFFTFAFALTFFTAKETLPSSKTSSVT  63

Query  428  sA-RPELPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVLVF  586
            SA    LP  VFDAL++YA+VN++ V+SRMS  E++ +A  LRRC   CN LVF
Sbjct  64   SAVNSPLPAAVFDALLYYASVNSSTVSSRMSPVELNTIADVLRRCKKPCNFLVF  117



>ref|XP_006346387.1| PREDICTED: protein IRX15-like [Solanum tuberosum]
Length=314

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +2

Query  248  NGAKLIVFHPSLQKQGLGIMPAASPRvlllvfvsffafafalsffsGRDAVPPAgsgggs  427
            + AKLIVFHPSL KQG G +  ASPR+  LVF+SFF FAFAL+FF+ +DA+P A +G  +
Sbjct  4    SNAKLIVFHPSLHKQGSGTI-TASPRIWFLVFLSFFTFAFALTFFTAKDAIPIAKTGTDT  62

Query  428  sARPE-LPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVLVF  586
            +A    LP  VF+AL+HYA++N++ V+SRMSA E+  +A  LRRC   CN LVF
Sbjct  63   AAGSSPLPATVFNALLHYASLNSSTVSSRMSAVELKTIANVLRRCKAPCNFLVF  116



>ref|XP_004230754.1| PREDICTED: protein IRX15-LIKE-like [Solanum lycopersicum]
Length=314

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = +2

Query  248  NGAKLIVFHPSLQKQGLGIMPAASPRvlllvfvsffafafalsffsGRDAVPPAgsgggs  427
            N AK+IVFHPSL KQG G +  ASPR+  LVF+SFF FAFAL+FF+ +DA+P + +G  +
Sbjct  4    NNAKVIVFHPSLHKQGSGTI-TASPRIWFLVFLSFFTFAFALTFFTAKDAIPTSKTGTDT  62

Query  428  sARPE-LPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVLVF  586
            +A    LP  VF+ L++YA++N++ V+SRMSA E+ ++A  LRRC   CN LVF
Sbjct  63   AAGSSPLPAAVFNTLLYYASLNSSTVSSRMSAVELKSIATVLRRCKAPCNFLVF  116



>ref|XP_011088226.1| PREDICTED: protein IRREGULAR XYLEM 15-like [Sesamum indicum]
Length=315

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 74/120 (62%), Gaps = 5/120 (4%)
 Frame = +2

Query  242  MKNGAKLIVFHPSLQKQGLGIM---PAASPRvlllvfvsffafafalsffsGRD--AVPP  406
            MK  AK IV HPSL K G G       AS R  L+VFV FF F FA + FS RD  +   
Sbjct  1    MKTSAKFIVLHPSLHKPGGGGGGTPTVASHRAWLVVFVLFFIFTFAFTLFSTRDTGSAAK  60

Query  407  AgsgggssARPELPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVLVF  586
              +   + A+ +LP PVFDAL+HYA+ N T+ A RMS AEV +VAA+LRRC   CN LVF
Sbjct  61   IATNAAARAKSQLPRPVFDALLHYASENITSSAGRMSFAEVKSVAASLRRCATPCNFLVF  120



>emb|CDO97204.1| unnamed protein product [Coffea canephora]
Length=325

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 84/120 (70%), Gaps = 9/120 (8%)
 Frame = +2

Query  248  NGAKLIVFHPS-LQKQGLGIMPAASPRvlllvfvsffafafalsffsGRDAVPPAgsggg  424
            + AKLI+ HPS L KQG+ I  AAS R+ LL+F+SFFA AF L+  + +DA+  A +   
Sbjct  4    SSAKLILVHPSSLHKQGVAI--AASHRLWLLLFLSFFALAFTLTLITTKDAMTAAAANAA  61

Query  425  ss---ARPELPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNA---CNVLVF  586
            S+    +  LP PVFDAL+HYA+VN +AV SR SA+E++AVAA LRRC +    CN+LVF
Sbjct  62   SASATVKAPLPRPVFDALLHYASVNYSAVGSRFSASELAAVAAVLRRCNSNAAPCNLLVF  121



>ref|XP_002283187.1| PREDICTED: protein IRX15-LIKE [Vitis vinifera]
Length=310

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 70/122 (57%), Gaps = 15/122 (12%)
 Frame = +2

Query  242  MKNG---AKLIVFHPSLQKQGLGIMPAASPRvlllvfvsffafafalsffsGRDAVPPAg  412
            MKNG    KLI+ HP +QKQG      +S R+ LL F+SFF  AF L+    RD++P   
Sbjct  1    MKNGNGNTKLILLHPYIQKQG------SSNRLWLLAFISFFTLAFLLTLIYTRDSIPTTV  54

Query  413  sgggssA----RPELPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVL  580
            +   S+A     P L +PV DALVHYA+   T+    MS AE+  ++  LR+C   CN L
Sbjct  55   AAAASAAPKSANPLLAKPVVDALVHYASNYNTS--GHMSNAELKMISDVLRKCSPPCNFL  112

Query  581  VF  586
            VF
Sbjct  113  VF  114



>gb|EYU37651.1| hypothetical protein MIMGU_mgv1a010254mg [Erythranthe guttata]
Length=318

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 72/117 (62%), Gaps = 5/117 (4%)
 Frame = +2

Query  248  NGAKLIVFHPSLQKQGLGIM--PAASPRvlllvfvsffafafalsffsGRDAVPPAgsgg  421
              AK IV HPS+ K   G     AAS R  L VFV FF F+FA +  + RDA   A +  
Sbjct  6    TSAKFIVLHPSVHKTTGGGGGPTAASHRAWLAVFVLFFIFSFAFTLLTTRDAASAAKAAA  65

Query  422  gssARP--ELPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVLVF  586
             ++AR   +LP+PVFDAL+HYA  N T+ + RMS+ E+S +A+ LR C   CN+LVF
Sbjct  66   SAAARAKSQLPDPVFDALLHYAAANATS-SGRMSSVEMSHIASVLRGCAAPCNLLVF  121



>gb|EYU42690.1| hypothetical protein MIMGU_mgv1a011105mg [Erythranthe guttata]
Length=292

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = +2

Query  443  LPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRC--GNACNVLVF  586
            LP+PV DAL+HYAT N TA + RMS AE   +A+ LRRC  G ACN+LVF
Sbjct  66   LPKPVADALLHYATANATA-SGRMSTAETEKMASVLRRCAAGGACNLLVF  114



>gb|EPS67946.1| hypothetical protein M569_06823, partial [Genlisea aurea]
Length=298

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 60/114 (53%), Gaps = 4/114 (4%)
 Frame = +2

Query  257  KLIVFHPSL---QKQGLGIMPAASPRvlllvfvsffafafalsffsGRDAVPPAgsgggs  427
            K IV HP +   +  G G   A SPR  L +F+ FF F F L+F + RD      S    
Sbjct  1    KFIVLHPPVPVHKSGGFGGGFAVSPRAWLAIFIIFFVFTFVLTFVTVRDVAGNRDSLTPV  60

Query  428  sARP-ELPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVLVF  586
             A     P+PV +AL+HYA+ N +  A RM+A EV  VA  L RC   CN LVF
Sbjct  61   GADVFHFPKPVVEALIHYASENISYSAGRMTADEVRYVAGVLGRCAVPCNFLVF  114



>ref|XP_004136972.1| PREDICTED: uncharacterized protein LOC101203456 [Cucumis sativus]
 ref|XP_004170986.1| PREDICTED: uncharacterized protein LOC101227615 [Cucumis sativus]
Length=320

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 61/124 (49%), Gaps = 12/124 (10%)
 Frame = +2

Query  251  GAKLIVFHPSLQKQGLGIM------PAASPRvlllvfvsffafafalsffsGRDAVPPAg  412
             AKLI+ HPS+ KQ L         P  SPR  L  F++FF  AF L+  +   +   A 
Sbjct  6    NAKLILLHPSIHKQPLPTPTPASGPPTLSPRRWLFSFLTFFTLAFTLTLINSTFSTSTAS  65

Query  413  sgggssARPE------LPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACN  574
                +   P       LP P+  AL+HYA  +T +    MS AE+S++A  L  C  ACN
Sbjct  66   RRSLAGHAPNVASTAPLPHPISSALLHYAAADTNSTKPHMSTAELSSIAVALSPCAPACN  125

Query  575  VLVF  586
             L+F
Sbjct  126  FLIF  129



>ref|XP_008454974.1| PREDICTED: protein IRX15-LIKE-like [Cucumis melo]
Length=320

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 61/123 (50%), Gaps = 12/123 (10%)
 Frame = +2

Query  254  AKLIVFHPSLQKQGLGIM------PAASPRvlllvfvsffafafalsffsGRDAVPPAgs  415
            AKLI+ HPS+ KQ L         P  SPR  L  F++FF  AF L+  +   +   A  
Sbjct  7    AKLILLHPSIHKQPLPTSTPATGAPTLSPRRWLFSFLTFFTLAFTLTLINSTFSTSTASR  66

Query  416  gggssARPE------LPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNV  577
               +   P       LP  +  AL+HYA  +T +    MS AE+S++AA L  C  ACN 
Sbjct  67   RSLAGHGPNVAASTALPHSISSALLHYAAADTNSTKPHMSTAELSSIAAALSPCAPACNF  126

Query  578  LVF  586
            L+F
Sbjct  127  LIF  129



>ref|XP_010270730.1| PREDICTED: protein IRX15-LIKE-like [Nelumbo nucifera]
Length=322

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 2/52 (4%)
 Frame = +2

Query  431  ARPELPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVLVF  586
             +P+LP+ V DAL+HY T N+ A   RMS AE+ ++A  L+RC   CN LVF
Sbjct  68   GQPQLPKSVADALLHY-TSNSNATG-RMSDAELKSIADVLQRCPTPCNFLVF  117



>ref|XP_010263448.1| PREDICTED: protein IRX15-LIKE-like [Nelumbo nucifera]
Length=312

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 14/119 (12%)
 Frame = +2

Query  248  NGAKLIVFHPSLQKQGLGIMPAASPRvlllvfvsffafafalsffsGRDAVPPAgsgggs  427
            N  K+I+ HPS+ KQG+        RV LL FV+FF FAF L+ F+ RD+     +    
Sbjct  8    NNTKVILIHPSVHKQGV------PHRVWLLAFVTFFTFAFLLTLFNTRDSAKSTAATTSV  61

Query  428  s------ARPELPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVLVF  586
            +          LP+ V DAL+HYA+++   V  RMS AE+  +   L+RC + CN LVF
Sbjct  62   TSSSSVSGHSRLPKSVADALLHYASISN--VTGRMSDAELKMITDVLQRCPSPCNFLVF  118



>ref|XP_002285113.1| PREDICTED: protein IRX15-LIKE-like [Vitis vinifera]
Length=304

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 64/114 (56%), Gaps = 9/114 (8%)
 Frame = +2

Query  248  NG-AKLIVFHPSLQKQGLGIMPAASPRvlllvfvsffafafalsffsGRDAVPPAgsggg  424
            NG  KLIV HPS+ KQG      AS R+ LL FV FF  AF L+  +     P   +   
Sbjct  4    NGNTKLIVLHPSIHKQG-----GASHRLWLLFFVCFFTLAFVLTLINTAVPTPTTAASAA  58

Query  425  ssARPELPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVLVF  586
            S+  P LP    +AL+HYA  +   +   M+AAE++++A  LRRC + CN L+F
Sbjct  59   SAHFP-LPHSAMEALLHYAAASN--ITGHMTAAEMASIAGVLRRCSSPCNFLIF  109



>emb|CAN74915.1| hypothetical protein VITISV_041669 [Vitis vinifera]
Length=342

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 9/114 (8%)
 Frame = +2

Query  248  NGA-KLIVFHPSLQKQGLGIMPAASPRvlllvfvsffafafalsffsGRDAVPPAgsggg  424
            NG+ KLIV HPS+ KQG      AS R+ LL FV FF  AF L+  +     P   +   
Sbjct  4    NGSTKLIVLHPSIHKQG-----GASHRLWLLFFVCFFTLAFVLTLINTAVPTPTTAASAA  58

Query  425  ssARPELPEPVFDALVHYATVNTTAVASRMSAAEVSAVAATLRRCGNACNVLVF  586
            S+  P LP    +AL+HYA  +   +   M+AAE++++A  LRRC + CN L+F
Sbjct  59   SAHFP-LPHSAMEALLHYAAASN--ITGHMTAAEMASIAGVLRRCSSPCNFLIF  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925