BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I11

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230753.1|  PREDICTED: scopoletin glucosyltransferase-like     224   2e-67   Solanum lycopersicum
dbj|BAG80549.1|  UDP-glucose:glucosyltransferase                        222   2e-66   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_006346386.1|  PREDICTED: scopoletin glucosyltransferase-like     222   2e-66   Solanum tuberosum [potatoes]
ref|XP_009625604.1|  PREDICTED: scopoletin glucosyltransferase-like     222   2e-66   Nicotiana tomentosiformis
ref|XP_006346384.1|  PREDICTED: scopoletin glucosyltransferase-like     219   2e-65   Solanum tuberosum [potatoes]
ref|XP_009602613.1|  PREDICTED: scopoletin glucosyltransferase-like     217   1e-64   Nicotiana tomentosiformis
ref|XP_009779862.1|  PREDICTED: scopoletin glucosyltransferase-like     216   3e-64   Nicotiana sylvestris
ref|XP_009792742.1|  PREDICTED: scopoletin glucosyltransferase-like     214   2e-63   Nicotiana sylvestris
ref|XP_011088741.1|  PREDICTED: scopoletin glucosyltransferase-like     214   2e-63   Sesamum indicum [beniseed]
ref|XP_011088224.1|  PREDICTED: scopoletin glucosyltransferase-like     211   2e-62   Sesamum indicum [beniseed]
gb|EYU37648.1|  hypothetical protein MIMGU_mgv1a005507mg                209   2e-61   Erythranthe guttata [common monkey flower]
ref|XP_010315221.1|  PREDICTED: LOW QUALITY PROTEIN: scopoletin g...    204   7e-60   Solanum lycopersicum
gb|EYU37649.1|  hypothetical protein MIMGU_mgv1a026287mg                186   6e-53   Erythranthe guttata [common monkey flower]
ref|XP_002298737.1|  hypothetical protein POPTR_0001s30980g             185   3e-52   Populus trichocarpa [western balsam poplar]
ref|XP_006346519.1|  PREDICTED: scopoletin glucosyltransferase-like     187   4e-52   
ref|XP_011000140.1|  PREDICTED: scopoletin glucosyltransferase-like     182   2e-51   Populus euphratica
ref|XP_002518707.1|  UDP-glucosyltransferase, putative                  180   3e-51   
ref|XP_010263455.1|  PREDICTED: scopoletin glucosyltransferase-like     182   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_006386501.1|  hypothetical protein POPTR_0002s12520g             181   8e-51   Populus trichocarpa [western balsam poplar]
ref|XP_007042491.1|  Anthocyanin 3'-O-beta-glucosyltransferase          176   2e-49   
ref|XP_011000141.1|  PREDICTED: scopoletin glucosyltransferase-like     177   2e-49   Populus euphratica
ref|XP_007042490.1|  Anthocyanin 3'-O-beta-glucosyltransferase          175   2e-48   
emb|CBI19486.3|  unnamed protein product                                173   3e-48   Vitis vinifera
ref|XP_002313133.1|  hypothetical protein POPTR_0009s10120g             174   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_006478662.1|  PREDICTED: scopoletin glucosyltransferase-like     174   4e-48   Citrus sinensis [apfelsine]
gb|KDO45786.1|  hypothetical protein CISIN_1g044012mg                   174   4e-48   Citrus sinensis [apfelsine]
ref|XP_006442846.1|  hypothetical protein CICLE_v10023414mg             174   4e-48   Citrus clementina [clementine]
ref|XP_002282952.2|  PREDICTED: scopoletin glucosyltransferase-like     172   1e-47   Vitis vinifera
ref|XP_007029404.1|  Anthocyanin 3'-O-beta-glucosyltransferase, p...    172   2e-47   
gb|KDO35868.1|  hypothetical protein CISIN_1g041444mg                   169   2e-47   Citrus sinensis [apfelsine]
ref|XP_006422969.1|  hypothetical protein CICLE_v10028305mg             169   2e-46   Citrus clementina [clementine]
ref|XP_011017167.1|  PREDICTED: scopoletin glucosyltransferase-like     170   2e-46   Populus euphratica
ref|XP_006487031.1|  PREDICTED: scopoletin glucosyltransferase-like     169   2e-46   Citrus sinensis [apfelsine]
gb|KDO36537.1|  hypothetical protein CISIN_1g036871mg                   166   7e-46   Citrus sinensis [apfelsine]
ref|XP_002510179.1|  UDP-glucosyltransferase, putative                  167   1e-45   Ricinus communis
ref|XP_006487030.1|  PREDICTED: scopoletin glucosyltransferase-like     166   2e-45   Citrus sinensis [apfelsine]
gb|KDP46894.1|  hypothetical protein JCGZ_24103                         166   3e-45   Jatropha curcas
ref|XP_002518708.1|  UDP-glucosyltransferase, putative                  165   5e-45   Ricinus communis
ref|XP_007042481.1|  UDP-glycosyltransferase 73B4, putative             164   1e-44   
ref|XP_009761805.1|  PREDICTED: scopoletin glucosyltransferase          164   2e-44   Nicotiana sylvestris
gb|KJB47380.1|  hypothetical protein B456_008G023800                    156   4e-44   Gossypium raimondii
emb|CAN65903.1|  hypothetical protein VITISV_004870                     163   4e-44   Vitis vinifera
ref|XP_002282463.1|  PREDICTED: scopoletin glucosyltransferase          162   5e-44   Vitis vinifera
sp|Q9AT54.1|SCGT_TOBAC  RecName: Full=Scopoletin glucosyltransfer...    162   8e-44   Nicotiana tabacum [American tobacco]
ref|XP_006422968.1|  hypothetical protein CICLE_v10029184mg             155   2e-43   
ref|XP_004230756.2|  PREDICTED: scopoletin glucosyltransferase-like     161   3e-43   
gb|KJB47381.1|  hypothetical protein B456_008G023900                    160   5e-43   Gossypium raimondii
ref|XP_011000865.1|  PREDICTED: scopoletin glucosyltransferase-like     159   8e-43   Populus euphratica
ref|XP_011000854.1|  PREDICTED: scopoletin glucosyltransferase-like     159   8e-43   Populus euphratica
ref|XP_007042483.1|  UDP-glucosyl transferase 73B3, putative            159   9e-43   
ref|XP_002518724.1|  UDP-glucosyltransferase, putative                  159   2e-42   
ref|XP_006346389.1|  PREDICTED: scopoletin glucosyltransferase-like     159   2e-42   Solanum tuberosum [potatoes]
ref|XP_011000135.1|  PREDICTED: scopoletin glucosyltransferase-like     158   2e-42   Populus euphratica
ref|XP_009377799.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    158   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_004137108.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    157   4e-42   Cucumis sativus [cucumbers]
ref|XP_002313131.2|  hypothetical protein POPTR_0009s10190g             157   6e-42   
ref|XP_002518723.1|  UDP-glucosyltransferase, putative                  157   8e-42   Ricinus communis
ref|XP_008454969.1|  PREDICTED: scopoletin glucosyltransferase-like     157   8e-42   Cucumis melo [Oriental melon]
gb|AFJ52947.1|  UDP-glycosyltransferase 1                               157   8e-42   Linum usitatissimum
gb|KJB79375.1|  hypothetical protein B456_013G046200                    157   8e-42   Gossypium raimondii
gb|AAK28304.1|AF346432_1  phenylpropanoid:glucosyltransferase 2         156   1e-41   Nicotiana tabacum [American tobacco]
ref|XP_009622522.1|  PREDICTED: scopoletin glucosyltransferase          156   1e-41   Nicotiana tomentosiformis
gb|AFJ52934.1|  UDP-glycosyltransferase 1                               156   1e-41   Linum usitatissimum
gb|AFJ52929.1|  UDP-glycosyltransferase 1                               155   3e-41   Linum usitatissimum
ref|XP_008236558.1|  PREDICTED: scopoletin glucosyltransferase-like     155   4e-41   Prunus mume [ume]
ref|XP_009354714.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    155   4e-41   Pyrus x bretschneideri [bai li]
gb|AFJ52946.1|  UDP-glycosyltransferase 1                               155   4e-41   Linum usitatissimum
ref|XP_002298733.1|  hypothetical protein POPTR_0001s31130g             154   5e-41   
ref|XP_008364526.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    154   6e-41   Malus domestica [apple tree]
ref|XP_003628776.1|  Glucosyltransferase                                154   7e-41   Medicago truncatula
ref|XP_006369760.1|  hypothetical protein POPTR_0001s31090g             154   7e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006487029.1|  PREDICTED: scopoletin glucosyltransferase-like     154   7e-41   Citrus sinensis [apfelsine]
ref|XP_004159901.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       154   7e-41   
gb|AAS55083.1|  UDP-glucose glucosyltransferase                         154   1e-40   Rhodiola sachalinensis
ref|XP_006379195.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    154   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_004230759.1|  PREDICTED: scopoletin glucosyltransferase          153   1e-40   
ref|XP_007200278.1|  hypothetical protein PRUPE_ppa014816mg             154   1e-40   Prunus persica
ref|XP_007200989.1|  hypothetical protein PRUPE_ppa004972mg             153   1e-40   Prunus persica
gb|KDO59780.1|  hypothetical protein CISIN_1g039991mg                   146   1e-40   Citrus sinensis [apfelsine]
ref|XP_008375156.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    153   1e-40   
gb|KDO59783.1|  hypothetical protein CISIN_1g046605mg                   153   1e-40   Citrus sinensis [apfelsine]
ref|XP_007157726.1|  hypothetical protein PHAVU_002G093300g             153   2e-40   Phaseolus vulgaris [French bean]
ref|XP_008245758.1|  PREDICTED: scopoletin glucosyltransferase-like     153   2e-40   Prunus mume [ume]
ref|XP_002518725.1|  UDP-glucosyltransferase, putative                  153   2e-40   Ricinus communis
ref|XP_009354715.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    152   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_008236488.1|  PREDICTED: scopoletin glucosyltransferase-like     152   3e-40   Prunus mume [ume]
ref|XP_006346388.1|  PREDICTED: scopoletin glucosyltransferase-like     152   3e-40   Solanum tuberosum [potatoes]
ref|XP_010690617.1|  PREDICTED: scopoletin glucosyltransferase-like     152   3e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008236559.1|  PREDICTED: scopoletin glucosyltransferase-like     152   3e-40   Prunus mume [ume]
ref|XP_007017169.1|  UDP-glucosyl transferase 73B5, putative            152   3e-40   
ref|XP_011000877.1|  PREDICTED: scopoletin glucosyltransferase-like     152   4e-40   Populus euphratica
ref|XP_011468623.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    151   5e-40   Fragaria vesca subsp. vesca
ref|XP_003518713.1|  PREDICTED: scopoletin glucosyltransferase-like     152   5e-40   Glycine max [soybeans]
ref|XP_007200988.1|  hypothetical protein PRUPE_ppa004924mg             152   5e-40   Prunus persica
gb|KJB79374.1|  hypothetical protein B456_013G046100                    151   7e-40   Gossypium raimondii
ref|XP_007042482.1|  UDP-glucosyl transferase 73B3, putative            151   8e-40   
ref|XP_009787720.1|  PREDICTED: scopoletin glucosyltransferase-like     151   1e-39   Nicotiana sylvestris
ref|XP_004137110.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    154   1e-39   
gb|KJB79373.1|  hypothetical protein B456_013G046100                    150   2e-39   Gossypium raimondii
ref|XP_007201773.1|  hypothetical protein PRUPE_ppa017305mg             150   2e-39   Prunus persica
ref|XP_003518714.1|  PREDICTED: scopoletin glucosyltransferase-like     150   2e-39   Glycine max [soybeans]
ref|XP_007199033.1|  hypothetical protein PRUPE_ppa018059mg             152   2e-39   
gb|KJB63893.1|  hypothetical protein B456_010G022300                    150   3e-39   Gossypium raimondii
ref|XP_008373858.1|  PREDICTED: anthocyanin 3'-O-beta-glucosyltra...    150   3e-39   
gb|AFJ52949.1|  UDP-glycosyltransferase 1                               149   3e-39   Linum usitatissimum
ref|XP_011013100.1|  PREDICTED: scopoletin glucosyltransferase-like     149   4e-39   Populus euphratica
ref|XP_010672458.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    149   6e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010107893.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    149   6e-39   Morus notabilis
ref|XP_008236496.1|  PREDICTED: abscisate beta-glucosyltransferas...    149   6e-39   
ref|XP_009762300.1|  PREDICTED: LOW QUALITY PROTEIN: scopoletin g...    147   7e-39   Nicotiana sylvestris
ref|XP_009772759.1|  PREDICTED: scopoletin glucosyltransferase-like     148   8e-39   Nicotiana sylvestris
gb|KHN12230.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7         142   1e-38   Glycine soja [wild soybean]
gb|AFJ52948.1|  UDP-glycosyltransferase 1                               148   1e-38   Linum usitatissimum
ref|XP_003518710.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      148   1e-38   Glycine max [soybeans]
ref|XP_008375155.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    148   1e-38   Malus domestica [apple tree]
ref|XP_002298739.2|  hypothetical protein POPTR_0001s30970g             147   1e-38   
emb|CAB56231.1|  betanidin-5-O-glucosyltransferase                      148   1e-38   Cleretum bellidiforme
gb|AFJ52930.1|  UDP-glycosyltransferase 1                               148   1e-38   Linum usitatissimum
gb|ADV71369.1|  glycosyltransferase GT14A05                             148   1e-38   Pueraria montana var. lobata [kudzu]
ref|XP_008354700.1|  PREDICTED: scopoletin glucosyltransferase-like     147   2e-38   
ref|XP_003533678.1|  PREDICTED: soyasapogenol B glucuronide galac...    147   2e-38   Glycine max [soybeans]
gb|KCW64673.1|  hypothetical protein EUGRSUZ_G02259                     147   2e-38   Eucalyptus grandis [rose gum]
ref|XP_010066692.1|  PREDICTED: scopoletin glucosyltransferase-like     147   2e-38   Eucalyptus grandis [rose gum]
ref|XP_009354713.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    147   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_008236556.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    147   2e-38   Prunus mume [ume]
dbj|BAG80550.1|  UDP-glucose:glucosyltransferase                        147   2e-38   Lycium barbarum [Duke of Argyll's teatree]
dbj|BAG80536.1|  UDP-glucose:glucosyltransferase                        147   3e-38   Lycium barbarum [Duke of Argyll's teatree]
gb|KCW63754.1|  hypothetical protein EUGRSUZ_G01414                     147   3e-38   Eucalyptus grandis [rose gum]
gb|ACJ72160.1|  UGT3                                                    147   3e-38   Pueraria montana var. lobata [kudzu]
ref|XP_010066838.1|  PREDICTED: scopoletin glucosyltransferase-like     147   3e-38   Eucalyptus grandis [rose gum]
gb|KCW64874.1|  hypothetical protein EUGRSUZ_G02440                     147   3e-38   Eucalyptus grandis [rose gum]
ref|XP_006369755.1|  hypothetical protein POPTR_0001s31040g             147   4e-38   Populus trichocarpa [western balsam poplar]
gb|AFJ52945.1|  UDP-glycosyltransferase 1                               147   4e-38   Linum usitatissimum
ref|XP_008375157.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    146   5e-38   
ref|XP_004304024.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    146   5e-38   Fragaria vesca subsp. vesca
ref|XP_010066005.1|  PREDICTED: scopoletin glucosyltransferase-like     146   5e-38   
ref|XP_006422965.1|  hypothetical protein CICLE_v10030025mg             141   5e-38   
gb|KDP24997.1|  hypothetical protein JCGZ_23980                         146   6e-38   Jatropha curcas
emb|CAA59450.1|  twi1                                                   145   7e-38   Solanum lycopersicum
ref|XP_002518719.1|  UDP-glucosyltransferase, putative                  145   8e-38   Ricinus communis
dbj|BAO51837.1|  UDP-glycosyltransferase 73A17                          145   9e-38   Camellia sinensis [black tea]
gb|KHN40682.1|  UDP-glycosyltransferase 73B4                            145   1e-37   Glycine soja [wild soybean]
ref|XP_003551588.1|  PREDICTED: soyasapogenol B glucuronide galac...    145   1e-37   Glycine max [soybeans]
ref|XP_007011136.1|  UDP-glucosyl transferase 73B3                      145   1e-37   
ref|XP_004252755.1|  PREDICTED: scopoletin glucosyltransferase-li...    145   2e-37   Solanum lycopersicum
ref|XP_004252827.2|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    144   2e-37   
ref|XP_002518721.1|  UDP-glucosyltransferase, putative                  145   2e-37   Ricinus communis
ref|XP_007201142.1|  hypothetical protein PRUPE_ppa016033mg             145   2e-37   Prunus persica
gb|AFK37676.1|  unknown                                                 145   2e-37   Lotus japonicus
dbj|BAI63589.1|  UDP-glucose glucosyltransferase                        145   2e-37   Lotus japonicus
gb|KHN40683.1|  UDP-glycosyltransferase 73B3                            144   2e-37   Glycine soja [wild soybean]
ref|XP_003622870.1|  Cytokinin-O-glucosyltransferase                    144   3e-37   
ref|XP_011000136.1|  PREDICTED: scopoletin glucosyltransferase-like     144   4e-37   Populus euphratica
ref|XP_003520067.1|  PREDICTED: scopoletin glucosyltransferase-like     144   4e-37   Glycine max [soybeans]
gb|KHN12234.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7         144   4e-37   Glycine soja [wild soybean]
ref|XP_009600997.1|  PREDICTED: scopoletin glucosyltransferase-like     144   5e-37   Nicotiana tomentosiformis
ref|XP_003623458.1|  Cytokinin-O-glucosyltransferase                    143   6e-37   Medicago truncatula
ref|XP_002518717.1|  UDP-glucosyltransferase, putative                  143   7e-37   Ricinus communis
gb|KCW64674.1|  hypothetical protein EUGRSUZ_G02260                     142   8e-37   Eucalyptus grandis [rose gum]
gb|KDO59784.1|  hypothetical protein CISIN_1g042879mg                   137   8e-37   Citrus sinensis [apfelsine]
ref|XP_010068736.1|  PREDICTED: scopoletin glucosyltransferase-like     143   9e-37   Eucalyptus grandis [rose gum]
gb|KJB36979.1|  hypothetical protein B456_006G185400                    141   9e-37   Gossypium raimondii
ref|XP_010547999.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      143   9e-37   Tarenaya hassleriana [spider flower]
ref|XP_010057243.1|  PREDICTED: scopoletin glucosyltransferase-like     142   1e-36   
ref|XP_010690618.1|  PREDICTED: scopoletin glucosyltransferase-like     142   1e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010066837.1|  PREDICTED: scopoletin glucosyltransferase-like     142   1e-36   Eucalyptus grandis [rose gum]
ref|XP_004305937.1|  PREDICTED: abscisate beta-glucosyltransferas...    142   1e-36   Fragaria vesca subsp. vesca
ref|XP_010028421.1|  PREDICTED: scopoletin glucosyltransferase-like     142   1e-36   
gb|ACO44747.1|  UDP glycosyltransferase                                 142   1e-36   Withania somnifera [ashwagandha]
ref|XP_007011132.1|  UDP-glucosyl transferase 73B3                      142   1e-36   
gb|KGN43910.1|  hypothetical protein Csa_7G073460                       137   2e-36   Cucumis sativus [cucumbers]
ref|XP_007042484.1|  UDP-glucosyl transferase 73B3                      142   2e-36   
gb|KDP25001.1|  hypothetical protein JCGZ_23984                         142   2e-36   Jatropha curcas
ref|XP_006342641.1|  PREDICTED: soyasapogenol B glucuronide galac...    141   3e-36   Solanum tuberosum [potatoes]
ref|XP_008236571.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    141   3e-36   Prunus mume [ume]
ref|XP_004305940.2|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    141   3e-36   Fragaria vesca subsp. vesca
gb|KGN43914.1|  hypothetical protein Csa_7G073500                       141   3e-36   Cucumis sativus [cucumbers]
ref|XP_008454970.1|  PREDICTED: scopoletin glucosyltransferase-like     141   3e-36   Cucumis melo [Oriental melon]
gb|KDO41467.1|  hypothetical protein CISIN_1g046582mg                   140   4e-36   Citrus sinensis [apfelsine]
ref|XP_006423816.1|  hypothetical protein CICLE_v10028297mg             141   5e-36   Citrus clementina [clementine]
ref|XP_002518718.1|  UDP-glucosyltransferase, putative                  140   5e-36   
gb|KDP24999.1|  hypothetical protein JCGZ_23982                         140   5e-36   Jatropha curcas
ref|XP_007140179.1|  hypothetical protein PHAVU_008G090600g             140   5e-36   Phaseolus vulgaris [French bean]
ref|XP_004305939.2|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    140   5e-36   Fragaria vesca subsp. vesca
ref|XP_007140178.1|  hypothetical protein PHAVU_008G090500g             140   6e-36   Phaseolus vulgaris [French bean]
ref|XP_003518712.1|  PREDICTED: scopoletin glucosyltransferase-like     140   6e-36   Glycine max [soybeans]
ref|XP_004505252.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      140   6e-36   Cicer arietinum [garbanzo]
ref|XP_010681315.1|  PREDICTED: scopoletin glucosyltransferase-like     140   6e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009606596.1|  PREDICTED: scopoletin glucosyltransferase-like     140   7e-36   Nicotiana tomentosiformis
ref|XP_002298734.2|  hypothetical protein POPTR_0001s31120g             140   8e-36   Populus trichocarpa [western balsam poplar]
ref|XP_004492515.1|  PREDICTED: soyasapogenol B glucuronide galac...    140   9e-36   Cicer arietinum [garbanzo]
dbj|BAG71127.1|  glucosyltransferase                                    140   9e-36   Phytolacca americana [common pokeberry]
emb|CDP09466.1|  unnamed protein product                                140   9e-36   Coffea canephora [robusta coffee]
gb|AFO67243.1|  putative UDP-glucose glucosyltransferase                133   1e-35   Aralia elata
ref|XP_006423821.1|  hypothetical protein CICLE_v10028465mg             139   1e-35   
ref|XP_004304025.2|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    140   1e-35   Fragaria vesca subsp. vesca
gb|KGN43909.1|  hypothetical protein Csa_7G073450                       140   1e-35   Cucumis sativus [cucumbers]
ref|XP_007153575.1|  hypothetical protein PHAVU_003G047100g             139   1e-35   Phaseolus vulgaris [French bean]
gb|KDO45022.1|  hypothetical protein CISIN_1g011142mg                   140   1e-35   Citrus sinensis [apfelsine]
ref|XP_006492619.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       140   1e-35   Citrus sinensis [apfelsine]
ref|XP_006342640.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    139   1e-35   Solanum tuberosum [potatoes]
ref|XP_006492609.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       139   1e-35   Citrus sinensis [apfelsine]
ref|XP_007153574.1|  hypothetical protein PHAVU_003G047000g             139   2e-35   Phaseolus vulgaris [French bean]
gb|KEH30902.1|  flavonoid glucosyltransferase                           139   2e-35   Medicago truncatula
ref|XP_010260609.1|  PREDICTED: scopoletin glucosyltransferase-like     139   2e-35   Nelumbo nucifera [Indian lotus]
gb|AIS39471.1|  flavonoid UDP-glucosyltransferase 2                     139   2e-35   Citrus x paradisi [grapefruit]
sp|Q2V6J9.1|UFOG7_FRAAN  RecName: Full=UDP-glucose flavonoid 3-O-...    139   3e-35   Fragaria x ananassa
ref|XP_004304021.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    139   3e-35   Fragaria vesca subsp. vesca
gb|AIS71990.1|  UDP-glycosyl transferase 1                              138   4e-35   Haloxylon ammodendron
ref|XP_004492513.1|  PREDICTED: soyasapogenol B glucuronide galac...    138   4e-35   
gb|ACS87992.1|  UDP-glucosyltransferase family 1 protein                138   4e-35   Citrus sinensis [apfelsine]
gb|KGN43915.1|  hypothetical protein Csa_7G073510                       138   5e-35   Cucumis sativus [cucumbers]
ref|XP_010107898.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    138   5e-35   
ref|XP_007201019.1|  hypothetical protein PRUPE_ppa005572mg             137   5e-35   
gb|KGN43913.1|  hypothetical protein Csa_7G073490                       138   6e-35   Cucumis sativus [cucumbers]
ref|XP_004137109.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       138   6e-35   
gb|AFK79039.1|  glycosyltransferase UGT7                                137   8e-35   Bupleurum chinense
ref|XP_002265409.1|  PREDICTED: UDP-glycosyltransferase 73C3            137   9e-35   
ref|XP_010905295.1|  PREDICTED: scopoletin glucosyltransferase-like     137   9e-35   Elaeis guineensis
gb|KDP25000.1|  hypothetical protein JCGZ_23983                         137   9e-35   Jatropha curcas
ref|XP_008454967.1|  PREDICTED: scopoletin glucosyltransferase-like     137   1e-34   
ref|XP_008241364.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       137   1e-34   Prunus mume [ume]
ref|XP_004249831.1|  PREDICTED: UDP-glycosyltransferase 73D1            137   1e-34   Solanum lycopersicum
ref|XP_004505253.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      137   1e-34   Cicer arietinum [garbanzo]
dbj|BAF49309.1|  putative glycosyltransferase                           137   1e-34   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_004306178.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       137   1e-34   Fragaria vesca subsp. vesca
ref|XP_010030443.1|  PREDICTED: scopoletin glucosyltransferase-like     132   2e-34   Eucalyptus grandis [rose gum]
ref|XP_010447140.1|  PREDICTED: UDP-glucosyl transferase 73B2 iso...    136   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009108750.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      137   2e-34   Brassica rapa
ref|XP_010028420.1|  PREDICTED: scopoletin glucosyltransferase-like     136   2e-34   
ref|XP_007027510.1|  UDP-Glycosyltransferase superfamily protein        136   2e-34   
gb|KCW55162.1|  hypothetical protein EUGRSUZ_I01117                     136   2e-34   Eucalyptus grandis [rose gum]
ref|XP_002518722.1|  UDP-glucosyltransferase, putative                  136   2e-34   
ref|XP_004159929.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucose ...    136   2e-34   
ref|XP_008340172.1|  PREDICTED: scopoletin glucosyltransferase-like     136   2e-34   
gb|KCW54504.1|  hypothetical protein EUGRSUZ_I004473                    133   2e-34   Eucalyptus grandis [rose gum]
ref|XP_009386835.1|  PREDICTED: scopoletin glucosyltransferase-like     136   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006342639.1|  PREDICTED: scopoletin glucosyltransferase-like     135   3e-34   Solanum tuberosum [potatoes]
ref|XP_010246109.1|  PREDICTED: scopoletin glucosyltransferase-like     135   4e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010030422.1|  PREDICTED: scopoletin glucosyltransferase-like     132   5e-34   Eucalyptus grandis [rose gum]
ref|XP_009801094.1|  PREDICTED: UDP-glycosyltransferase 73D1            135   5e-34   Nicotiana sylvestris
ref|XP_010447141.1|  PREDICTED: UDP-glycosyltransferase 73B3 isof...    135   5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004492514.1|  PREDICTED: soyasapogenol B glucuronide galac...    135   6e-34   
ref|XP_009129082.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       132   6e-34   Brassica rapa
ref|XP_004492516.1|  PREDICTED: soyasapogenol B glucuronide galac...    135   6e-34   Cicer arietinum [garbanzo]
ref|XP_009407035.1|  PREDICTED: anthocyanin 3'-O-beta-glucosyltra...    134   7e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010048320.1|  PREDICTED: scopoletin glucosyltransferase-like     135   7e-34   Eucalyptus grandis [rose gum]
ref|XP_003623451.1|  UDP-glucuronosyltransferase 2B4                    134   8e-34   Medicago truncatula
ref|XP_008241359.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       134   9e-34   Prunus mume [ume]
ref|XP_004304714.1|  PREDICTED: scopoletin glucosyltransferase-like     134   9e-34   Fragaria vesca subsp. vesca
ref|XP_010107903.1|  Abscisate beta-glucosyltransferase                 134   9e-34   
ref|XP_003623434.1|  Cytokinin-O-glucosyltransferase                    134   9e-34   Medicago truncatula
dbj|BAF49308.1|  putative glycosyltransferase                           134   1e-33   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_010057244.1|  PREDICTED: scopoletin glucosyltransferase-like     134   1e-33   Eucalyptus grandis [rose gum]
ref|XP_009631488.1|  PREDICTED: UDP-glycosyltransferase 73D1            134   1e-33   Nicotiana tomentosiformis
ref|XP_008454968.1|  PREDICTED: scopoletin glucosyltransferase-like     134   1e-33   Cucumis melo [Oriental melon]
ref|XP_003518715.1|  PREDICTED: scopoletin glucosyltransferase-like     134   1e-33   
ref|XP_003538838.1|  PREDICTED: scopoletin glucosyltransferase-like     134   2e-33   Glycine max [soybeans]
ref|XP_004505250.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    134   2e-33   Cicer arietinum [garbanzo]
gb|AGU14082.1|  UDP-glycosyltransferase                                 134   2e-33   Cicer arietinum [garbanzo]
gb|KCW55169.1|  hypothetical protein EUGRSUZ_I01125                     133   2e-33   Eucalyptus grandis [rose gum]
gb|AAM65945.1|  glucosyltransferase-like protein                        131   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094568.1|  PREDICTED: UDP-glycosyltransferase 73D1            133   2e-33   Sesamum indicum [beniseed]
gb|EAZ12570.1|  hypothetical protein OsJ_02476                          133   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_567953.1|  UDP-glucosyl transferase 73B3                         133   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|EAY74811.1|  hypothetical protein OsI_02703                          133   2e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001043481.1|  Os01g0597800                                       133   2e-33   
ref|XP_003623440.1|  Anthocyanidin 3-O-glucosyltransferase              133   3e-33   Medicago truncatula
ref|XP_003552284.1|  PREDICTED: soyasapogenol B glucuronide galac...    133   3e-33   
ref|XP_010098833.1|  UDP-glycosyltransferase 73C3                       133   3e-33   Morus notabilis
ref|XP_007199157.1|  hypothetical protein PRUPE_ppa019699mg             133   3e-33   
emb|CDY53948.1|  BnaA02g36980D                                          130   3e-33   Brassica napus [oilseed rape]
ref|XP_004969274.1|  PREDICTED: anthocyanin 3'-O-beta-glucosyltra...    133   3e-33   Setaria italica
ref|NP_849492.1|  UDP-glucosyltransferase 73B2                          131   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008777036.1|  PREDICTED: scopoletin glucosyltransferase-like     133   4e-33   Phoenix dactylifera
ref|XP_010027898.1|  PREDICTED: scopoletin glucosyltransferase-like     133   4e-33   Eucalyptus grandis [rose gum]
emb|CDY65497.1|  BnaCnng47320D                                          132   4e-33   Brassica napus [oilseed rape]
gb|AES79645.2|  UDP-glucosyltransferase family protein                  132   4e-33   Medicago truncatula
ref|XP_004140708.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    132   4e-33   Cucumis sativus [cucumbers]
dbj|BAC42195.1|  putative glucosyl transferase                          132   5e-33   
ref|NP_181217.1|  UDP-glucosyl transferase 73C6                         132   5e-33   
dbj|BAD53422.1|  betanidin-5-O-glucosyltransferase-like                 132   5e-33   
dbj|BAG80555.1|  UDP-glucose:glucosyltransferase                        132   5e-33   
ref|XP_010437661.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       132   5e-33   
gb|ADV71361.1|  glycosyltransferase GT02J01                             132   5e-33   
ref|XP_004304493.2|  PREDICTED: UDP-glycosyltransferase 73C1-like       132   6e-33   
ref|XP_004304492.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       132   6e-33   
ref|XP_009119412.1|  PREDICTED: UDP-glycosyltransferase 73B5            132   6e-33   
emb|CDP01301.1|  unnamed protein product                                132   6e-33   
emb|CDY45706.1|  BnaC02g35080D                                          129   6e-33   
gb|EAY74812.1|  hypothetical protein OsI_02704                          132   7e-33   
ref|XP_010925730.1|  PREDICTED: scopoletin glucosyltransferase-like     132   7e-33   
emb|CDY36633.1|  BnaA07g04240D                                          132   7e-33   
ref|XP_007027513.1|  UDP-glucosyl transferase 73D1                      132   8e-33   
gb|KEH30901.1|  flavonoid glucosyltransferase                           132   8e-33   
ref|XP_006827589.1|  hypothetical protein AMTR_s00009p00235050          132   8e-33   
ref|XP_006492641.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       132   9e-33   
emb|CDX71221.1|  BnaC07g05000D                                          131   9e-33   
gb|KJB36470.1|  hypothetical protein B456_006G160600                    131   9e-33   
gb|ACU18051.1|  unknown                                                 131   9e-33   
gb|EYU42689.1|  hypothetical protein MIMGU_mgv1a018398mg                131   1e-32   
ref|XP_010027866.1|  PREDICTED: scopoletin glucosyltransferase-like     131   1e-32   
ref|XP_010027902.1|  PREDICTED: scopoletin glucosyltransferase-like     131   1e-32   
ref|XP_008777757.1|  PREDICTED: scopoletin glucosyltransferase-like     131   1e-32   
emb|CAN83017.1|  hypothetical protein VITISV_041696                     134   1e-32   
gb|AHV78225.1|  glucosyltransferase                                     131   1e-32   
ref|XP_004249471.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       131   1e-32   
ref|XP_010432459.1|  PREDICTED: UDP-glycosyltransferase 73B1-like       131   1e-32   
ref|XP_009387438.1|  PREDICTED: scopoletin glucosyltransferase-like     131   1e-32   
ref|XP_007201978.1|  hypothetical protein PRUPE_ppa004825mg             131   1e-32   
gb|AFK79034.1|  glycosyltransferase UGT2                                131   1e-32   
ref|XP_004304022.1|  PREDICTED: scopoletin glucosyltransferase-like     131   1e-32   
ref|XP_004492517.1|  PREDICTED: soyasapogenol B glucuronide galac...    131   1e-32   
ref|XP_009117049.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       131   1e-32   
ref|XP_010527922.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       131   1e-32   
ref|XP_009410978.1|  PREDICTED: scopoletin glucosyltransferase-like     131   2e-32   
gb|AES79668.2|  UDP-glucosyltransferase family protein                  131   2e-32   
ref|XP_003623444.1|  Anthocyanidin 3-O-glucosyltransferase              130   2e-32   
ref|XP_003623427.1|  Anthocyanin 3'-O-beta-glucosyltransferase          131   2e-32   
ref|XP_003637924.1|  Anthocyanin 3'-O-beta-glucosyltransferase          130   2e-32   
ref|XP_007029562.1|  UDP-glycosyltransferase 73C5                       132   2e-32   
ref|NP_567954.1|  UDP-glucosyltransferase 73B2                          130   2e-32   
emb|CDX69029.1|  BnaC01g04240D                                          130   2e-32   
ref|XP_002276781.1|  PREDICTED: scopoletin glucosyltransferase          130   2e-32   
ref|XP_003623450.1|  Cytokinin-O-glucosyltransferase                    133   2e-32   
ref|XP_008241361.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       130   2e-32   
gb|AID60126.1|  UDP-glucosyl transferase 73B1                           130   2e-32   
ref|XP_009108748.1|  PREDICTED: UDP-glycosyltransferase 73B1-like       130   2e-32   
emb|CDX76263.1|  BnaA08g11370D                                          130   2e-32   
ref|XP_009116435.1|  PREDICTED: UDP-glycosyltransferase 73B1            130   2e-32   
ref|XP_009116544.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       130   3e-32   
ref|XP_006492611.1|  PREDICTED: UDP-glycosyltransferase 73C6-like...    130   3e-32   
ref|XP_006492612.1|  PREDICTED: UDP-glycosyltransferase 73C6-like...    130   3e-32   
ref|XP_003623449.1|  UDP-glucuronosyltransferase 1-1                    130   3e-32   
ref|XP_008788905.1|  PREDICTED: scopoletin glucosyltransferase-like     130   3e-32   
ref|XP_010027900.1|  PREDICTED: scopoletin glucosyltransferase-like     130   3e-32   
ref|XP_006367256.1|  PREDICTED: UDP-glycosyltransferase 73D1-like       130   3e-32   
ref|XP_007140180.1|  hypothetical protein PHAVU_008G090700g             130   3e-32   
gb|KDO52536.1|  hypothetical protein CISIN_1g010940mg                   130   4e-32   
ref|XP_004230760.1|  PREDICTED: scopoletin glucosyltransferase-like     129   4e-32   
ref|XP_007203738.1|  hypothetical protein PRUPE_ppa018454mg             129   5e-32   
emb|CDX75399.1|  BnaA01g03030D                                          129   5e-32   
ref|XP_002881469.1|  don-glucosyltransferase                            129   5e-32   
ref|XP_006423822.1|  hypothetical protein CICLE_v10028248mg             129   5e-32   
ref|XP_010683973.1|  PREDICTED: UDP-glycosyltransferase 73C2-like       129   6e-32   
ref|XP_006286265.1|  hypothetical protein CARUB_v10007840mg             129   6e-32   
ref|XP_010027899.1|  PREDICTED: scopoletin glucosyltransferase-like     129   6e-32   
ref|XP_002867135.1|  predicted protein                                  129   6e-32   
ref|XP_007154187.1|  hypothetical protein PHAVU_003G097300g             129   7e-32   
gb|KJB62325.1|  hypothetical protein B456_009G411700                    129   7e-32   
ref|XP_009623857.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       129   7e-32   
ref|XP_008457740.1|  PREDICTED: soyasapogenol B glucuronide galac...    127   8e-32   
ref|XP_009796871.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       129   8e-32   
ref|XP_010050390.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       129   8e-32   
gb|EYU41583.1|  hypothetical protein MIMGU_mgv1a005332mg                129   9e-32   
gb|KDO49691.1|  hypothetical protein CISIN_1g042970mg                   129   9e-32   
ref|XP_010447136.1|  PREDICTED: UDP-glycosyltransferase 73B1 isof...    129   9e-32   
gb|KDO49689.1|  hypothetical protein CISIN_1g044823mg                   129   9e-32   
gb|AES79656.2|  UDP-glucosyltransferase family protein                  129   9e-32   
ref|XP_006423825.1|  hypothetical protein CICLE_v10030204mg             129   9e-32   
ref|XP_006339094.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       129   1e-31   
ref|XP_006412270.1|  hypothetical protein EUTSA_v10024935mg             129   1e-31   
ref|XP_008456146.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    128   1e-31   
ref|XP_003623438.1|  UDP-glucuronosyltransferase 2A1                    129   1e-31   
emb|CDX76261.1|  BnaA08g11390D                                          128   1e-31   
emb|CDX69027.1|  BnaC01g04260D                                          128   1e-31   
ref|XP_003623422.1|  Anthocyanin 3'-O-beta-glucosyltransferase          128   1e-31   
ref|XP_003623459.1|  Cytokinin-O-glucosyltransferase                    128   1e-31   
ref|XP_006346390.1|  PREDICTED: scopoletin glucosyltransferase-like     128   1e-31   
gb|AID60125.1|  UDP-glucosyl transferase 73B2                           128   2e-31   
gb|AHL38663.1|  glycosyltransferase                                     128   2e-31   
emb|CDY13143.1|  BnaA09g16740D                                          128   2e-31   
ref|XP_008792116.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       128   2e-31   
gb|EAZ12571.1|  hypothetical protein OsJ_02477                          127   2e-31   
ref|XP_007162809.1|  hypothetical protein PHAVU_001G182600g             128   2e-31   
ref|XP_010432461.1|  PREDICTED: UDP-glycosyltransferase 73B3-like       128   2e-31   
ref|XP_006428486.1|  hypothetical protein CICLE_v10013516mg             128   2e-31   
sp|Q8H0F2.1|ANGT_GENTR  RecName: Full=Anthocyanin 3'-O-beta-gluco...    128   2e-31   
gb|KFK30051.1|  hypothetical protein AALP_AA7G210600                    128   2e-31   
dbj|BAF75890.1|  tetrahydroxychalcone glucosyltransferase               128   2e-31   
ref|XP_009771644.1|  PREDICTED: scopoletin glucosyltransferase-like     128   2e-31   
gb|AID60124.1|  UDP-glucosyl transferase 73B3                           128   2e-31   
gb|ACD03255.1|  UDP-glycosyltransferase UGT703A5                        128   2e-31   
gb|ACD03249.1|  UDP-glycosyltransferase                                 128   2e-31   
ref|XP_009406299.1|  PREDICTED: anthocyanin 3'-O-beta-glucosyltra...    127   2e-31   
ref|XP_010437662.1|  PREDICTED: UDP-glycosyltransferase 73B1-like       127   2e-31   
gb|AAS94329.1|  UDP-glucose:flavonoid-O-glucosyltransferase             127   2e-31   
ref|XP_003528666.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    127   2e-31   
ref|XP_003623441.1|  UDP-glucuronosyltransferase 2A1                    127   2e-31   
ref|XP_006294083.1|  hypothetical protein CARUB_v10023077mg             127   2e-31   
ref|XP_008777755.1|  PREDICTED: scopoletin glucosyltransferase-like     127   2e-31   
ref|XP_006283463.1|  hypothetical protein CARUB_v10004508mg             128   2e-31   
ref|XP_002519442.1|  UDP-glucosyltransferase, putative                  127   3e-31   
gb|KFK30052.1|  hypothetical protein AALP_AA7G210700                    127   3e-31   
dbj|BAF75887.1|  tetrahydroxychalcone glucosyltransferase               127   3e-31   
ref|XP_010691725.1|  PREDICTED: scopoletin glucosyltransferase-like     127   3e-31   
ref|XP_002456024.1|  hypothetical protein SORBIDRAFT_03g029060          127   3e-31   
ref|XP_010028418.1|  PREDICTED: scopoletin glucosyltransferase-like     127   3e-31   
ref|XP_004252482.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       122   3e-31   
ref|XP_006283647.1|  hypothetical protein CARUB_v10004704mg             127   3e-31   
ref|XP_011467732.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    127   4e-31   
gb|KHN18701.1|  UDP-glycosyltransferase 73C1                            127   4e-31   
ref|XP_008775115.1|  PREDICTED: scopoletin glucosyltransferase-like     127   4e-31   
ref|XP_010513015.1|  PREDICTED: UDP-glycosyltransferase 73C4-like       128   4e-31   
ref|XP_011094571.1|  PREDICTED: UDP-glycosyltransferase 73C5            127   5e-31   
ref|XP_003520672.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       127   5e-31   
gb|EMS59980.1|  Anthocyanin 3'-O-beta-glucosyltransferase               125   5e-31   
ref|XP_011039112.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       127   5e-31   
ref|NP_567955.1|  UDP-glucosyl transferase 73B1                         127   5e-31   
ref|XP_010107901.1|  UDP-glucose flavonoid 3-O-glucosyltransferase 7    126   5e-31   
ref|XP_006292242.1|  hypothetical protein CARUB_v10018449mg             127   5e-31   
ref|NP_181218.1|  UDP-glycosyltransferase 73C5                          126   6e-31   
ref|XP_003625719.1|  Glucosyltransferase                                127   6e-31   
gb|KFK30053.1|  hypothetical protein AALP_AA7G210800                    126   6e-31   
dbj|BAF75894.1|  glucosyltransferase                                    126   6e-31   
ref|XP_006297553.1|  hypothetical protein CARUB_v10013576mg             126   6e-31   
gb|AGZ84551.1|  glycosyltransferase KGT39                               126   6e-31   
gb|KFK40015.1|  hypothetical protein AALP_AA3G318900                    126   6e-31   
ref|XP_010530757.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      126   6e-31   
dbj|BAD44686.1|  UDP-glucose:anthocyanin 3'-O-glucosyltransferase       126   7e-31   
ref|XP_007027505.1|  UDP-glucosyl transferase 73C6                      126   7e-31   
ref|XP_010516905.1|  PREDICTED: UDP-glycosyltransferase 73C4            126   7e-31   
ref|XP_008798341.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    125   7e-31   
ref|XP_007162811.1|  hypothetical protein PHAVU_001G182800g             126   8e-31   
emb|CDY65498.1|  BnaCnng47330D                                          126   8e-31   
gb|KDO45024.1|  hypothetical protein CISIN_1g013951mg                   125   8e-31   
ref|XP_010515803.1|  PREDICTED: UDP-glycosyltransferase 73D1            126   8e-31   
ref|XP_008800733.1|  PREDICTED: scopoletin glucosyltransferase-like     126   8e-31   
gb|KDP25003.1|  hypothetical protein JCGZ_23986                         125   1e-30   
dbj|BAD44687.1|  UDP-glucose:anthocyanin 3'-O-glucosyltransferase       125   1e-30   
ref|XP_011470604.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    125   1e-30   
ref|XP_007203728.1|  hypothetical protein PRUPE_ppa018836mg             125   1e-30   
emb|CDX69028.1|  BnaC01g04250D                                          125   1e-30   
ref|XP_002519419.1|  UDP-glucosyltransferase, putative                  125   1e-30   
emb|CDY65110.1|  BnaUnng01010D                                          125   1e-30   
ref|XP_010027867.1|  PREDICTED: scopoletin glucosyltransferase-like     125   1e-30   
ref|XP_010691729.1|  PREDICTED: scopoletin glucosyltransferase-like     125   1e-30   
gb|KDO36684.1|  hypothetical protein CISIN_1g044094mg                   123   1e-30   
ref|NP_973469.1|  UDP-glycosyltransferase 73B4                          122   2e-30   
ref|XP_006423818.1|  hypothetical protein CICLE_v10028312mg             125   2e-30   
ref|XP_010526965.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      125   2e-30   
ref|NP_181215.1|  UDP-glucosyl transferase 73C4                         125   2e-30   
ref|XP_010683974.1|  PREDICTED: UDP-glycosyltransferase 73D1-like       125   2e-30   
ref|XP_006492617.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       125   2e-30   
gb|ADV71372.1|  glycosyltransferase GT18P15                             125   2e-30   
ref|XP_008800734.1|  PREDICTED: scopoletin glucosyltransferase-like     125   2e-30   
ref|XP_006296609.1|  hypothetical protein CARUB_v10013563mg             125   2e-30   
gb|KCW55161.1|  hypothetical protein EUGRSUZ_I01116                     125   2e-30   
ref|XP_003569425.1|  PREDICTED: scopoletin glucosyltransferase-like     125   2e-30   
ref|XP_008805120.1|  PREDICTED: scopoletin glucosyltransferase-like     125   2e-30   
emb|CAA17559.1|  glucosyltransferase-like protein                       125   2e-30   
ref|XP_008792118.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       125   2e-30   
gb|ACU16826.1|  unknown                                                 121   2e-30   
ref|XP_010925706.1|  PREDICTED: scopoletin glucosyltransferase-like     125   2e-30   
gb|KHN18697.1|  UDP-glycosyltransferase 73C5                            125   2e-30   
ref|XP_003520669.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       125   2e-30   
ref|XP_004305941.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    124   3e-30   
gb|KEH15805.1|  UDP-glucosyltransferase family protein                  124   3e-30   
ref|XP_010505227.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       124   3e-30   
ref|XP_006410850.1|  hypothetical protein EUTSA_v10016560mg             124   3e-30   
ref|XP_002456026.1|  hypothetical protein SORBIDRAFT_03g029080          124   3e-30   
emb|CDP15306.1|  unnamed protein product                                124   3e-30   
dbj|BAF75893.1|  tetrahydroxychalcone glucosyltransferase               124   3e-30   
gb|KEH30899.1|  flavonoid glucosyltransferase                           124   3e-30   
ref|XP_002883897.1|  UDP-glucosyl transferase 73B5                      124   3e-30   
gb|KHN46668.1|  UDP-glycosyltransferase 73C3                            124   3e-30   
ref|XP_010041236.1|  PREDICTED: scopoletin glucosyltransferase-like     123   3e-30   
ref|XP_006602967.1|  PREDICTED: UDP-glycosyltransferase 73C3-like...    124   3e-30   
ref|XP_010027864.1|  PREDICTED: scopoletin glucosyltransferase-like     124   3e-30   
ref|XP_010488961.1|  PREDICTED: UDP-glycosyltransferase 73B5-like       124   4e-30   
gb|KFK30050.1|  hypothetical protein AALP_AA7G210500                    124   4e-30   
ref|XP_002531930.1|  UDP-glucosyltransferase, putative                  124   4e-30   
ref|XP_003625715.1|  UDP-glucosyltransferase family 1 protein           124   4e-30   
ref|XP_003551776.2|  PREDICTED: UDP-glycosyltransferase 73C3-like...    124   4e-30   
ref|XP_006602968.1|  PREDICTED: UDP-glycosyltransferase 73C3-like...    124   4e-30   
gb|KFK36551.1|  hypothetical protein AALP_AA4G138400                    124   4e-30   
gb|KHN29555.1|  UDP-glycosyltransferase 73B5                            124   4e-30   
ref|XP_006346605.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       124   4e-30   
ref|XP_004494094.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       124   5e-30   
ref|XP_008811539.1|  PREDICTED: scopoletin glucosyltransferase-like     124   5e-30   
ref|XP_002518735.1|  UDP-glucosyltransferase, putative                  124   5e-30   
ref|XP_010461668.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       124   5e-30   
ref|XP_010546526.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       124   5e-30   
ref|XP_009139428.1|  PREDICTED: UDP-glycosyltransferase 73D1            124   5e-30   
ref|XP_004962453.1|  PREDICTED: anthocyanin 3'-O-beta-glucosyltra...    124   5e-30   
gb|AIS39473.1|  flavonoid UDP-glucosyltransferase 4                     124   6e-30   
ref|XP_010098834.1|  UDP-glycosyltransferase 73C3                       124   6e-30   
ref|XP_002456025.1|  hypothetical protein SORBIDRAFT_03g029070          124   6e-30   
ref|XP_004252303.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       124   6e-30   
ref|XP_010027835.1|  PREDICTED: scopoletin glucosyltransferase-like     124   6e-30   
ref|XP_009399770.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       124   6e-30   
ref|XP_010479272.1|  PREDICTED: UDP-glycosyltransferase 73C5            124   7e-30   
dbj|BAJ11652.1|  glucosyltransferase                                    123   7e-30   
ref|XP_002867133.1|  UDP-glucosyl transferase 73B1                      123   7e-30   
ref|XP_003550516.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    123   7e-30   
gb|KFK34552.1|  hypothetical protein AALP_AA5G160900                    124   7e-30   
ref|XP_007157236.1|  hypothetical protein PHAVU_002G054100g             123   7e-30   
ref|XP_009623864.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       123   7e-30   
ref|XP_006293528.1|  hypothetical protein CARUB_v10025042mg             123   7e-30   
gb|AHA84292.1|  anthocyanin 3'-O-beta-glucosyltransferase               123   7e-30   



>ref|XP_004230753.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum lycopersicum]
Length=485

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 122/163 (75%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD ++  LHVYFLP++APGHMIP+VD+ARQFARHGVK T +TTPLNA K +K I ++RE 
Sbjct  1    MDKRADQLHVYFLPMMAPGHMIPLVDMARQFARHGVKVTIVTTPLNATKFTKTIQKDREV  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            GS I IR  EFP KE+GLPEGCENL++TTT E T  F  AL  F+ P+E+   ED PDC+
Sbjct  61   GSDICIRTTEFPCKEAGLPEGCENLASTTTSEMTMKFIKALYLFEQPVEKFMEEDHPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VAG  + W+ D AAK GIPRL+F G+G  P+C +N L  HKPH
Sbjct  121  VAGTFFAWAVDVAAKLGIPRLAFNGTGLLPMCAYNCLMEHKPH  163



>dbj|BAG80549.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=485

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD ++  LH+YFLP++APGHMIP+VD+ARQFARHGVK T +TTPLNA+K SK I R+RE 
Sbjct  1    MDRKTDKLHIYFLPMMAPGHMIPLVDIARQFARHGVKVTVITTPLNASKFSKTIQRDREL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            GS ISIR  EFP KE+GLPEGCEN+++TT+     +F   L  FQ PIE+   ED PDC+
Sbjct  61   GSDISIRTTEFPCKEAGLPEGCENIASTTSTLMYLNFIKGLSLFQKPIEQFLEEDHPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +A P ++W+ D AAK GIPRL F G+GFFP+C  +SL  HKPH
Sbjct  121  IAAPQFSWAVDVAAKLGIPRLFFNGAGFFPLCALHSLMEHKPH  163



>ref|XP_006346386.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=484

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 125/163 (77%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD ++  LHVYFLP++APGHMIP+VD+ARQF+RHGVK T +TTPLNA K SK I ++RE 
Sbjct  1    MDKRTDQLHVYFLPMMAPGHMIPLVDMARQFSRHGVKVTIITTPLNATKFSKTIQKDREL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            GS ISIR +EFP KE+GLPEGCENL++TT+ E +  F  AL  FQ P+E+   ED PDC+
Sbjct  61   GSDISIRTIEFPCKEAGLPEGCENLASTTSSEMSLKFVIALYLFQQPVEQFMEEDHPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +AG  ++W+ D AAK GIPRL+F G+G  P+C ++S   HKPH
Sbjct  121  IAGTFFSWAVDVAAKLGIPRLAFNGTGLLPMCAYHSFMEHKPH  163



>ref|XP_009625604.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana tomentosiformis]
Length=485

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD ++  LH+YFLP++APGHMIP+VD+ARQF R GVKAT +TTPLNA K SK I R+RE 
Sbjct  1    MDKRTDQLHIYFLPMMAPGHMIPLVDMARQFTRRGVKATLVTTPLNAPKFSKTIQRDREL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G+ ISIR +EFP KE+GLP+GCENL++TT+ E T  F  AL  FQ P+E+   ED PDC+
Sbjct  61   GNDISIRTIEFPCKEAGLPDGCENLASTTSTEMTLKFIKALYLFQQPVEQFLEEDHPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +AG L+ W+ D AAK GIPRL F G+G  P+C ++SL  HKPH
Sbjct  121  IAGTLFPWTVDVAAKLGIPRLVFSGTGLLPLCAYHSLMEHKPH  163



>ref|XP_006346384.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
 ref|XP_006346385.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=484

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD +S  LH+YFLP++APGHMIP+VD+ARQFARHGVKAT +TTPLNA+K SK I R+RE 
Sbjct  1    MDKRSDQLHIYFLPMMAPGHMIPLVDIARQFARHGVKATIITTPLNASKFSKTIQRDREM  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            GS ISIR ++FP KE+GLPEGCEN+++TT+     +F   L  FQ PIE+   ED PDC+
Sbjct  61   GSDISIRTVKFPCKEAGLPEGCENIASTTSTLMYLNFIMGLSLFQNPIEQFLEEDHPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +A P ++W+ D A K  IP L+F GSGFFP+C  +SL  HKPH
Sbjct  121  IAAPQFSWAVDVATKLEIPTLAFNGSGFFPLCALHSLMEHKPH  163



>ref|XP_009602613.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana tomentosiformis]
Length=483

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD ++  LH++FLP++APGHMIP+VD+ARQFAR G KAT +TTPLNA+K SKAI R+RE 
Sbjct  1    MDRRTDQLHIFFLPMMAPGHMIPLVDIARQFARRGAKATIITTPLNASKFSKAIQRDREL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            GS ISIR  EFP KE+GLP+GCEN+++TT+ E    F  +L  FQ P E+   ED PDC+
Sbjct  61   GSDISIRTTEFPCKEAGLPDGCENIASTTSTEMYLKFIMSLSLFQQPFEQFLEEDHPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA P ++W+ D AAK GIPRL F G+GFFP+C  +SL  HKPH
Sbjct  121  VAAPQFSWAVDVAAKLGIPRLFFNGTGFFPLCAIHSLMEHKPH  163



>ref|XP_009779862.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana sylvestris]
Length=485

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 122/163 (75%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M+ ++  LH YF P++APGHMIP+VD+ARQFAR GVKAT +TTPLNA K SK I RERE 
Sbjct  1    MNKRTDQLHAYFFPVMAPGHMIPLVDMARQFARRGVKATLVTTPLNAPKFSKTIQREREL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            GS ISIR +EFP KE+GLP+GCENL++TT+ E T  F  AL  FQ PIE+   ED PDC+
Sbjct  61   GSDISIRTIEFPCKEAGLPDGCENLASTTSTEMTQKFIKALYLFQQPIEQFLEEDHPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +A  L+ W+ D AAK GIPRL F G+G  P+C ++SL  +KPH
Sbjct  121  IASTLFPWTVDVAAKLGIPRLVFSGTGLLPICAYHSLMEYKPH  163



>ref|XP_009792742.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana sylvestris]
Length=481

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 121/163 (74%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD ++  LH+YFLP++APGHMIP+VD+ARQFARHG K T +TTPLNA+  SKAI R+RE 
Sbjct  1    MDRKTDQLHMYFLPMMAPGHMIPLVDIARQFARHGAKITIITTPLNASTFSKAIQRDREL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            GS ISIR  EFP KE+GLP+GCEN+++TT+ E    F   L  FQ P E+   ED PDC+
Sbjct  61   GSDISIRTTEFPCKEAGLPDGCENIASTTSTEMYLKFIMGLSLFQQPFEQFLEEDHPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA P ++W+ D AAK GIPR+ F G+GFFP+C  +SL  H PH
Sbjct  121  VAAPQFSWAVDVAAKLGIPRIFFNGTGFFPLCALHSLMEHTPH  163



>ref|XP_011088741.1| PREDICTED: scopoletin glucosyltransferase-like [Sesamum indicum]
Length=484

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = +3

Query  51   QSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQ  230
            +S  LHV+FLP++APGH IPM+D+ARQFAR+G KAT ++TPLNA+  S+ I+R+RE G +
Sbjct  5    KSHQLHVFFLPMMAPGHTIPMIDIARQFARNGAKATIISTPLNASHFSQTIERDRENGLE  64

Query  231  ISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAG  410
            ISI L+EFP +E+GLPEGCENLS+TTTLE + +F+ A+D  Q P+E+L  E+ PD IVAG
Sbjct  65   ISITLIEFPCQEAGLPEGCENLSSTTTLEMSLTFYRAMDLLQQPVEKLLRENHPDAIVAG  124

Query  411  PLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
              + W++D A   G+PRL F G+GFFP+C++N+LR HKP+
Sbjct  125  LFFWWADDVARNLGVPRLQFNGTGFFPMCIYNALRAHKPY  164



>ref|XP_011088224.1| PREDICTED: scopoletin glucosyltransferase-like [Sesamum indicum]
Length=484

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQSP-PLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M T +P  LHVYFLP++APGH IPM+D+ARQFAR+G KAT ++TPLNA+  S+ I+R+R+
Sbjct  1    MSTANPHQLHVYFLPMMAPGHTIPMIDIARQFARNGAKATIISTPLNASHFSQTIERDRK  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G +ISI L+EFP +E+GLPEGCENLS+ TT E   +F  A+D  Q P+E+L  E+ PD 
Sbjct  61   IGLEISISLIEFPCQEAGLPEGCENLSSITTPEMVRNFCRAMDLLQEPVEKLLRENHPDA  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            IVAG  + W+ND A KF IPRL F+G+GFFP+C++++L+ HKPH
Sbjct  121  IVAGLFFWWANDLAQKFNIPRLQFYGTGFFPMCLYHTLKEHKPH  164



>gb|EYU37648.1| hypothetical protein MIMGU_mgv1a005507mg [Erythranthe guttata]
Length=481

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 132/166 (80%), Gaps = 3/166 (2%)
 Frame = +3

Query  42   MDTQSPPL-HVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            MD+++  L  +YF+P++APGHMIPM+D+ARQFAR G K+T +TT  NA++ S+ I+R+R 
Sbjct  1    MDSETRQLLSIYFIPVMAPGHMIPMIDIARQFARLGAKSTIITTSSNASQFSQTIERDRR  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVE--DRP  392
             GSQISI L++FP +E+GLP+GCENLS+TTTLE + +F  A+D  + P+E+L  E  +RP
Sbjct  61   NGSQISISLVKFPCREAGLPDGCENLSSTTTLEMSMNFMKAIDLLREPVEKLLHEKGNRP  120

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            DCIVAG  ++W+ND A +  IPRL+F+G+GFFP+CV+ SLR +KPH
Sbjct  121  DCIVAGAFFSWANDVALRLNIPRLTFYGTGFFPMCVYRSLRDNKPH  166



>ref|XP_010315221.1| PREDICTED: LOW QUALITY PROTEIN: scopoletin glucosyltransferase 
[Solanum lycopersicum]
Length=479

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 117/163 (72%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD  S  LH+YFL ++APGHMIP+VD+ARQF RHGVKA  +TT LNA+K SK I R+RE 
Sbjct  1    MDKXSDQLHIYFLSMMAPGHMIPLVDIARQFGRHGVKAPIITTLLNASKFSKTIQRDREM  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            GS ISI  ++FP KE+GLPEGCEN+++TT+     +F   L  F  PIER   ED PDC+
Sbjct  61   GSDISIHTVKFPCKEAGLPEGCENIASTTSRLMYLNFTKGLSLFXKPIERFLEEDHPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             A P ++W+ + AAK GIPRL+F G+GFFP C  + L  HKPH
Sbjct  121  TAAPQFSWAVELAAKLGIPRLAFNGTGFFPFCALHGLMEHKPH  163



>gb|EYU37649.1| hypothetical protein MIMGU_mgv1a026287mg [Erythranthe guttata]
Length=477

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 120/167 (72%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            MD++S   LH+YF+P++APGHMIPM++ ARQFAR G K+T +TT  NAA+ S+ I+R+R+
Sbjct  1    MDSKSHQILHIYFIPMMAPGHMIPMINTARQFARLGAKSTIITTSSNAARFSQTIERDRK  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDR---  389
             GSQISI L+ FP +E+GLPE CENLS+ TT+E + +F  AL   + PIE L  +     
Sbjct  61   NGSQISISLIRFPCQEAGLPESCENLSSVTTVEMSMNFKKALHLLREPIEDLLQKQANCY  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDCIVA   + W+ND A K  IPR+ F+G+G FPVCV+ SL  +K H
Sbjct  121  PDCIVADSFFLWANDVALKLNIPRVLFYGTGSFPVCVYKSLMENKSH  167



>ref|XP_002298737.1| hypothetical protein POPTR_0001s30980g [Populus trichocarpa]
 gb|EEE83542.1| hypothetical protein POPTR_0001s30980g [Populus trichocarpa]
Length=491

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 117/163 (72%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD++S  LHV FLP +APGHMIP+VD+AR FAR GVKAT ++TPLNA   SKAI+R+ + 
Sbjct  1    MDSKSYQLHVLFLPYMAPGHMIPIVDMARLFARRGVKATIISTPLNAPFFSKAIERDGQL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G  ISIR+++FP  E+GLPEGCENLS+  + +   +F  A+   Q PIE+L  E  P C+
Sbjct  61   GHDISIRIIKFPSAEAGLPEGCENLSSIISWDMHANFLKAMSMLQQPIEQLLEECHPHCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   +TW+ + A K  IPRL F G+ +F +CV +SL+R++PH
Sbjct  121  VADMTFTWATEVADKLRIPRLYFSGTSYFAMCVFDSLKRYEPH  163



>ref|XP_006346519.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=690

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 114/170 (67%), Gaps = 10/170 (6%)
 Frame = +3

Query  21   ISQPTNKMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKA  200
            + +  +  DT++P          AP H   +VD+ARQF+RHGVKAT +TTPLNA K SK 
Sbjct  207  VKESAHNFDTKTP----------APHHSYLIVDMARQFSRHGVKATIITTPLNATKFSKT  256

Query  201  IDREREFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAV  380
            I ++RE GS I IR  EFP KE+GLPEGCENL++TT+ E +  F  AL  FQ P+E+   
Sbjct  257  IQKDRELGSDIIIRTTEFPCKEAGLPEGCENLASTTSSEMSLKFIKALYLFQQPVEKFME  316

Query  381  EDRPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            ED PDC++AG L+ W+ D A K GIPRL+F G+G  P+C ++ L  HKPH
Sbjct  317  EDHPDCLIAGTLFPWAVDVATKLGIPRLAFNGTGLLPMCAYHCLMEHKPH  366



>ref|XP_011000140.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 116/163 (71%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD++   LHV FLP +APGHMIP +D+AR FAR GVKAT ++TPLNA   SKAI+R+ + 
Sbjct  1    MDSKPCQLHVLFLPYMAPGHMIPTIDMARLFARRGVKATIISTPLNAPFFSKAIERDGQL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G  ISIR+++FP  E+GLPEGCENLS+  + +   +FF A+   Q PIE+L  E  P C+
Sbjct  61   GHDISIRIIKFPAAEAGLPEGCENLSSIKSWDMHANFFKAMSMLQQPIEQLLEECHPHCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   +TW+ + A K  IPRL F G+ +F +CV +SL+R++PH
Sbjct  121  VADMTFTWATEVADKLRIPRLYFNGTSYFAMCVFDSLKRYEPH  163



>ref|XP_002518707.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43632.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=387

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 113/163 (69%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD+Q   LH+ F P +A GHMIP +D+AR FARHGVKAT +TTP NA+ ISK I+R+R+ 
Sbjct  1    MDSQPYQLHIAFFPYMAHGHMIPTMDMARLFARHGVKATIITTPFNASLISKTIERDRQK  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I I+L+ F   E+GLPEGCEN S+  T E    FF A+   Q P+E +  E  P+C+
Sbjct  61   GFEIGIQLINFASAETGLPEGCENASSIRTQEMAAKFFKAISLLQQPLEHVLKECHPNCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA  ++ W+ + A+KFGIPRL F G   F +CV+NSLR ++PH
Sbjct  121  VADMMFPWATEVASKFGIPRLVFHGISTFSLCVYNSLRHYEPH  163



>ref|XP_010263455.1| PREDICTED: scopoletin glucosyltransferase-like [Nelumbo nucifera]
Length=496

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  +   LHV+  P +A GHMIP +D+ARQFA  GVK T +TTPLNA  +SK +DR+RE 
Sbjct  1    MGPEDRQLHVFLFPFMAHGHMIPFMDMARQFALRGVKVTIVTTPLNAILLSKTVDRDREL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I I  + FP KE+GLPEGCEN+++ TT E + +FF AL+  Q P ++L  E  PDCI
Sbjct  61   GIEIDIHSIPFPTKEAGLPEGCENVNSITTPELSSNFFKALNMLQQPFQKLLEEHHPDCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   + W+ DFA K GIPRL F GS FF  CV +S+ R+ PH
Sbjct  121  VADMFFPWTTDFAGKLGIPRLVFHGSCFFSSCVPDSISRYAPH  163



>ref|XP_006386501.1| hypothetical protein POPTR_0002s12520g [Populus trichocarpa]
 gb|ERP64298.1| hypothetical protein POPTR_0002s12520g [Populus trichocarpa]
Length=501

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 114/163 (70%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD++   +HV FLP LAPGHM+PMVD+AR  A +G+K T +TT +NAA+   AIDR+ + 
Sbjct  1    MDSEEKQIHVMFLPYLAPGHMMPMVDMARLLAGNGLKVTIITTTMNAAQFKNAIDRDIKS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G QIS+  L FP  E+GLPEGCENLS+TTT E T   F+ ++  Q  I+ +  + RPDCI
Sbjct  61   GRQISLATLRFPSIEAGLPEGCENLSSTTTPEMTLKLFHGIELLQPHIKMILQKHRPDCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             +  L+ W+ D A + GIPRL+F GSGFF +CV NS+  H+PH
Sbjct  121  ASDYLFPWTVDVAIELGIPRLAFNGSGFFNLCVANSIDCHQPH  163



>ref|XP_007042491.1| Anthocyanin 3'-O-beta-glucosyltransferase [Theobroma cacao]
 gb|EOX98322.1| Anthocyanin 3'-O-beta-glucosyltransferase [Theobroma cacao]
Length=425

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 113/163 (69%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++S  LH+ FLP LA GH+IP VD+AR FARHGVK T  TTPLNA   +K I R+ E 
Sbjct  1    MASKSLQLHIVFLPQLAHGHLIPTVDMARLFARHGVKVTIATTPLNAHLFAKTIQRDSES  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I   +++FP  E GLPEGCEN+S+ T+ E    FF A++ FQ P+E+L  E RPDC+
Sbjct  61   GFEIGTYIIKFPSAEVGLPEGCENVSSLTSQEMQNKFFKAVNLFQQPLEQLLEELRPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA  +++W+ D A+KFGIPRL F G+  F + + +S+ RH P+
Sbjct  121  VADLMFSWATDVASKFGIPRLVFHGTSCFSISIVDSVIRHAPY  163



>ref|XP_011000141.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = +3

Query  51   QSPP--LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFG  224
            +SPP  LH+ F P +A GH+IP VD+AR FARHGVKAT +TTPLNA   S+ I+R+ E G
Sbjct  2    ESPPFQLHIAFFPFMAQGHIIPTVDMARTFARHGVKATIITTPLNAPLFSRTIERDIEMG  61

Query  225  SQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIV  404
            S+I I +++FP  ++GLPEGCEN S+  TLE    FF A+   Q P+E L  E RP+C+V
Sbjct  62   SKIRILIMKFPSADAGLPEGCENASSIETLEMVPKFFKAVSLLQQPLEYLLEECRPNCLV  121

Query  405  AGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            A  ++ W+   A KFGIPRL F G+ +F +CV + L+R +P+
Sbjct  122  ADMMFPWATKVANKFGIPRLVFHGTSYFALCVSDCLKRFEPY  163



>ref|XP_007042490.1| Anthocyanin 3'-O-beta-glucosyltransferase [Theobroma cacao]
 gb|EOX98321.1| Anthocyanin 3'-O-beta-glucosyltransferase [Theobroma cacao]
Length=484

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++S  LH+ FLP LA G +IP VD+AR  ARHGVK T  TTPLNA   +K I R+RE 
Sbjct  1    MASKSRQLHIVFLPQLAHGILIPTVDMARLCARHGVKVTIATTPLNAHLFAKTIQRDRES  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +IS  +++FP  E GLPEGCEN S+ T+ E    F  A + FQ P+E+L  E RPDC+
Sbjct  61   GFEISTYIIKFPSAEVGLPEGCENASSLTSQEMQTKFLKAANLFQQPLEQLLAELRPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VAG ++TW+ D A+KFGIPRL F G+  F + + +S+ RH P+
Sbjct  121  VAGMMFTWATDVASKFGIPRLVFHGTSCFSISILDSVIRHAPY  163



>emb|CBI19486.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 110/163 (67%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++   LHV FLP +APGHM+P+VD+AR FA HGV+ T +TT +NA +   AI R+ E 
Sbjct  1    MGSKDDELHVMFLPYMAPGHMMPLVDMARLFAAHGVRITIITTTMNAFRFQNAIHRDIEA  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G QI + +L+FP  E+GLPEGCENL +T T E +   F A+   +  +E L    RPDCI
Sbjct  61   GRQIGLEILQFPSVEAGLPEGCENLISTPTPEMSMKLFQAIRMMKPRMETLLRNHRPDCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             +  L+ W+ D AA+ GIPRLSF GSG+F +CV + + R++PH
Sbjct  121  ASDVLFHWTVDVAAELGIPRLSFSGSGYFNLCVSHCVERYQPH  163



>ref|XP_002313133.1| hypothetical protein POPTR_0009s10120g [Populus trichocarpa]
 gb|EEE87088.1| hypothetical protein POPTR_0009s10120g [Populus trichocarpa]
Length=491

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 112/163 (69%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD+    LH+ F P +A GHMIP VD+AR FAR GVKAT ++TPLNA   SK I+R+R+ 
Sbjct  1    MDSMPYQLHILFFPYMAHGHMIPTVDMARLFARRGVKATIVSTPLNAPLCSKTIERDRQL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G  ISI +++FP  E+GLPEGCENLS+  + +   +F  A+   Q P+E+L  E  P C+
Sbjct  61   GLDISIHIIKFPSAEAGLPEGCENLSSIPSPDMLSNFLKAIGMLQQPLEQLLEECHPSCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA  ++ W+ + A K  IPRL F G+GFFP CV +SL+R++PH
Sbjct  121  VADMVFPWATEAANKLRIPRLFFSGTGFFPACVFDSLKRYEPH  163



>ref|XP_006478662.1| PREDICTED: scopoletin glucosyltransferase-like [Citrus sinensis]
Length=490

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 112/162 (69%), Gaps = 0/162 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +++  LHV FLP +APGHM+PMVD+AR FA +G++ T + T +NA +   AIDR+   
Sbjct  1    MVSENQKLHVMFLPYIAPGHMVPMVDMARLFAANGIQVTIILTTMNARRFQNAIDRDSRL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +IS+R+L FP +E+GLPEGCENL +T+T E T   F AL+  +  IE+L  E  P+CI
Sbjct  61   GREISLRILRFPSQEAGLPEGCENLMSTSTPETTKKLFPALELLRPEIEKLFREQNPNCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            V+  L+ W+   A + GIPRL+F GSGFF  CV +SL  H+P
Sbjct  121  VSDNLFPWTVSIAEELGIPRLAFTGSGFFNNCVSHSLEHHQP  162



>gb|KDO45786.1| hypothetical protein CISIN_1g044012mg [Citrus sinensis]
Length=490

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 112/162 (69%), Gaps = 0/162 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +++  LHV FLP +APGHM+PMVD+AR FA +G++ T + T +NA +   AIDR+   
Sbjct  1    MVSENQKLHVMFLPYIAPGHMVPMVDMARLFAANGIQVTIILTTMNARRFQNAIDRDSRL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +IS+R+L FP +E+GLPEGCENL +T+T E T   F AL+  +  IE+L  E  P+CI
Sbjct  61   GREISLRILRFPSQEAGLPEGCENLMSTSTPETTKKLFPALELLRPEIEKLFREQNPNCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            V+  L+ W+   A + GIPRL+F GSGFF  CV +SL  H+P
Sbjct  121  VSDNLFPWTVSIAEELGIPRLAFTGSGFFNNCVSHSLEHHQP  162



>ref|XP_006442846.1| hypothetical protein CICLE_v10023414mg [Citrus clementina]
 gb|ESR56086.1| hypothetical protein CICLE_v10023414mg [Citrus clementina]
Length=490

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 112/162 (69%), Gaps = 0/162 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +++  LHV FLP +APGHM+PMVD+AR FA +G++ T + T +NA +   AIDR+   
Sbjct  1    MVSENQKLHVMFLPYIAPGHMVPMVDMARLFAANGIQVTIILTTMNARRFQNAIDRDSRL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +IS+R+L FP +E+GLPEGCENL +T+T E T   F AL+  +  IE+L  E  P+CI
Sbjct  61   GREISLRILRFPSQEAGLPEGCENLMSTSTPETTKKLFPALELLRPEIEKLFREQNPNCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            V+  L+ W+   A + GIPRL+F GSGFF  CV +SL  H+P
Sbjct  121  VSDNLFPWTVSIAEELGIPRLAFTGSGFFNNCVSHSLEHHQP  162



>ref|XP_002282952.2| PREDICTED: scopoletin glucosyltransferase-like [Vitis vinifera]
Length=496

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 110/163 (67%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++   LHV FLP +APGHM+P+VD+AR FA HGV+ T +TT +NA +   AI R+ E 
Sbjct  1    MGSKDDELHVMFLPYMAPGHMMPLVDMARLFAAHGVRITIITTTMNAFRFQNAIHRDIEA  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G QI + +L+FP  E+GLPEGCENL +T T E +   F A+   +  +E L    RPDCI
Sbjct  61   GRQIGLEILQFPSVEAGLPEGCENLISTPTPEMSMKLFQAIRMMKPRMETLLRNHRPDCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             +  L+ W+ D AA+ GIPRLSF GSG+F +CV + + R++PH
Sbjct  121  ASDVLFHWTVDVAAELGIPRLSFSGSGYFNLCVSHCVERYQPH  163



>ref|XP_007029404.1| Anthocyanin 3'-O-beta-glucosyltransferase, putative [Theobroma 
cacao]
 gb|EOY09906.1| Anthocyanin 3'-O-beta-glucosyltransferase, putative [Theobroma 
cacao]
Length=484

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 108/162 (67%), Gaps = 0/162 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M + S  LH  F P LA GH+IP VD+AR FA HGVK T +TTPLNA   +  I RE++ 
Sbjct  1    MASNSRQLHFIFFPQLAHGHLIPTVDMARLFAMHGVKVTIVTTPLNALLFASKIQREKQL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G  IS  +++FP  E GLPEGCEN+S+ T+ E    F  A++ FQ P+ER+  E RPDC+
Sbjct  61   GFDISTLVIKFPASEVGLPEGCENVSSITSQEMIPKFLKAINLFQQPLERILEELRPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            VA  ++ W+ D A KFGIPRL F G+  F +CV ++L RH+P
Sbjct  121  VADWMFPWATDIAGKFGIPRLVFHGTSCFALCVVDTLIRHEP  162



>gb|KDO35868.1| hypothetical protein CISIN_1g041444mg, partial [Citrus sinensis]
Length=367

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 110/166 (66%), Gaps = 3/166 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++ P LHV+F P +A GHMIP+VD+A+ FA  GVKA+ +TTP NA  +SK+++R  E 
Sbjct  1    MGSKIPQLHVFFFPFMAHGHMIPIVDMAKLFATRGVKASVITTPANAPYVSKSVERANEL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATT---TLEQTFSFFNALDHFQGPIERLAVEDRP  392
            G ++ ++ ++FP  E+GLP+GCENL A T     E    F  A    Q P+E+L  + +P
Sbjct  61   GIELDVKTIKFPSVEAGLPDGCENLDAITNEVNKELIVKFLGATTKLQEPLEQLLRDHKP  120

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            DC+VA   + W+ D AAKFGIPRL F G+ FF +C  N LR ++PH
Sbjct  121  DCLVADIFFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLRLYEPH  166



>ref|XP_006422969.1| hypothetical protein CICLE_v10028305mg [Citrus clementina]
 gb|ESR36209.1| hypothetical protein CICLE_v10028305mg [Citrus clementina]
Length=490

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 110/166 (66%), Gaps = 3/166 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++ P LHV+F P +A GHMIP+VD+A+ FA  GVKA+ +TTP NA  +SK+++R  E 
Sbjct  1    MGSKIPQLHVFFFPFMAHGHMIPIVDMAKLFATRGVKASVITTPANAPYVSKSVERANEL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATT---TLEQTFSFFNALDHFQGPIERLAVEDRP  392
            G ++ ++ ++FP  E+GLP+GCENL A T     E    F  A    Q P+E+L  + +P
Sbjct  61   GIELDVKTIKFPSVEAGLPDGCENLDAITNEVNKELIVKFLGATTKLQEPLEQLLRDHKP  120

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            DC+VA   + W+ D AAKFGIPRL F G+ FF +C  N LR ++PH
Sbjct  121  DCLVADIFFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLRLYEPH  166



>ref|XP_011017167.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=561

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 113/163 (69%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD++   +HV FLP LAPGHM+PMVD+AR  A +G+K T +TT  NAA+   AIDR+ + 
Sbjct  61   MDSEEKQIHVMFLPYLAPGHMMPMVDMARLLAGNGLKVTIITTTTNAAQFKNAIDRDIKS  120

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G QIS+  + FP  E+GLPEGCENLS+TTT E T   F+ ++  Q  I+ +  + RPDCI
Sbjct  121  GRQISLATVRFPSIEAGLPEGCENLSSTTTPEMTLKLFHGIELLQPHIKMILQKHRPDCI  180

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             +  L+ W+ D A + GIPRL+F GSGFF +CV NS+  H+PH
Sbjct  181  ASDYLFPWTVDVAIELGIPRLAFNGSGFFNLCVANSIDCHRPH  223



>ref|XP_006487031.1| PREDICTED: scopoletin glucosyltransferase-like [Citrus sinensis]
 gb|KDO59781.1| hypothetical protein CISIN_1g010093mg [Citrus sinensis]
Length=518

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 109/166 (66%), Gaps = 3/166 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++ P LHV+F P +A GHMIP+VD+A+ FA  GVKA+ +TTP NA  +SK+++R  E 
Sbjct  29   MGSEIPQLHVFFFPFMAHGHMIPIVDMAKLFATRGVKASVITTPANAPYVSKSVERANEL  88

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQ---TFSFFNALDHFQGPIERLAVEDRP  392
            G ++ ++ ++FP  E+GLPEGCENL A T          FF A    Q P+E+L  E +P
Sbjct  89   GIEMDVKTIKFPSVEAGLPEGCENLDAITNEVNKGLIVKFFGATMKLQEPLEQLLQEHKP  148

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            DC+VA   + W+ D AAKFGIPRL F G+ FF +C  N L  ++PH
Sbjct  149  DCLVADTFFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLALYEPH  194



>gb|KDO36537.1| hypothetical protein CISIN_1g036871mg, partial [Citrus sinensis]
Length=383

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 108/166 (65%), Gaps = 3/166 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++ P LHV+F P +A GHMIP+VD+A+ FA  GVKA+ +TTP N   +SK+++R  E 
Sbjct  1    MGSKVPQLHVFFFPFMAHGHMIPIVDMAKLFASRGVKASVITTPANGPYVSKSVERANEM  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATT---TLEQTFSFFNALDHFQGPIERLAVEDRP  392
            G ++ ++ ++FP  E+GLPEGCENL A T     E    F  A    Q P+E+L  + +P
Sbjct  61   GIELDVKTIKFPSVEAGLPEGCENLDAITNEVNKELIVKFVGATTKLQEPLEQLLRDHKP  120

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            DC+VA   + W+ D AAKFGIPRL F G+ FF +C  N L  ++PH
Sbjct  121  DCLVADIFFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLALYEPH  166



>ref|XP_002510179.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF52366.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=498

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M + +  +HV FLP LAPGHM+PM+D+AR FA +G+K T +TT  NA +   +IDR+ + 
Sbjct  1    MVSGAEQIHVMFLPYLAPGHMMPMIDIARLFASNGIKVTIITTTKNAIRFKSSIDRDIQA  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G  IS+ +L FP  E+GLPEGCENL++T T E +   F+ +   +  I+ + ++  PDCI
Sbjct  61   GRNISLEILRFPSAEAGLPEGCENLASTPTPEMSIKLFHGIGLLEPEIKTIFLKHSPDCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            V+  L+ W+ D A + GIPRL+F GSGFF +CV NS+  ++PH
Sbjct  121  VSDYLFPWTVDVAVELGIPRLAFSGSGFFNLCVANSIECNRPH  163



>ref|XP_006487030.1| PREDICTED: scopoletin glucosyltransferase-like [Citrus sinensis]
Length=490

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 108/166 (65%), Gaps = 3/166 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++ P LHV+F P +A GHMIP+VD+A+ FA  GVKA+ +TTP N   +SK+++R  E 
Sbjct  1    MGSKVPQLHVFFFPFMAHGHMIPIVDMAKLFASRGVKASVITTPANGPYVSKSVERANEM  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATT---TLEQTFSFFNALDHFQGPIERLAVEDRP  392
            G ++ ++ ++FP  E+GLPEGCENL A T     E    F  A    Q P+E+L  + +P
Sbjct  61   GIELDVKTIKFPSVEAGLPEGCENLDAITNEVNKELIVKFVGATTKLQEPLEQLLRDHKP  120

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            DC+VA   + W+ D AAKFGIPRL F G+ FF +C  N L  ++PH
Sbjct  121  DCLVADIFFPWATDAAAKFGIPRLVFHGTSFFSLCASNCLALYEPH  166



>gb|KDP46894.1| hypothetical protein JCGZ_24103 [Jatropha curcas]
Length=515

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  +   +HV FLP +APGHM+PMVD+AR FA +GV+ T +TT +NA +   +ID++   
Sbjct  1    MSLREEQIHVMFLPYMAPGHMMPMVDMARLFAANGVRVTIVTTKMNAIRFKNSIDKDFRS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G  IS+ +L FP  ++GLP+GCENLS+TTT E T   F+ +   +  I+ +  + RPDCI
Sbjct  61   GRNISLEILSFPSLQAGLPQGCENLSSTTTPEMTIKLFHGIGLLEPQIKIVFQQHRPDCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            ++  L+ W+ D AA+ GIPR++F GS FF +CV NS+  ++PH
Sbjct  121  ISDYLFPWTVDVAAELGIPRIAFSGSSFFNLCVANSIECNRPH  163



>ref|XP_002518708.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43633.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=485

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 2/165 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE-  218
            MD++   LH+ F P +A GHMIP V++AR FARHGVKAT +TTPLNAA  SK I+R+RE 
Sbjct  1    MDSRRSQLHIVFFPFMADGHMIPTVNMARVFARHGVKATVITTPLNAATFSKTIERDREL  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRP-D  395
             G  IS+R+L+FP   +GLPEGCEN+S+ +  E   +F  A+   Q P+  +  E +P D
Sbjct  61   LGVDISVRMLKFPCAVAGLPEGCENVSSISKPEMNPNFLVAVSLLQRPLAYVLEECQPAD  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            C+VA  ++ W+ + A K  IPRL F GS  F  CV + LRR++P+
Sbjct  121  CLVADMMFPWATEVAGKLEIPRLFFNGSSCFAACVSDCLRRYQPY  165



>ref|XP_007042481.1| UDP-glycosyltransferase 73B4, putative [Theobroma cacao]
 gb|EOX98312.1| UDP-glycosyltransferase 73B4, putative [Theobroma cacao]
Length=485

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 109/168 (65%), Gaps = 5/168 (3%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++ P +H++F PL+A GHMIP VD+A+ FA  GVK T +TTPLNA+  +K I+R +E 
Sbjct  1    MGSEIPQVHMFFFPLMAHGHMIPTVDMAKVFATRGVKTTIVTTPLNASFFTKTIERSKES  60

Query  222  GSQISIRLLEFPYKESGLPEGCEN-----LSATTTLEQTFSFFNALDHFQGPIERLAVED  386
            G  I I++L+FP  E+GLPEGCEN      S   + +    FF A    Q P+E+L  E 
Sbjct  61   GIDIGIKILKFPAVEAGLPEGCENADLIPTSQDESGDMLGKFFKATFMLQEPLEQLLQEC  120

Query  387  RPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +PDC+VA   + W+ D A KFGIPRL F G+ FF +C   S+R ++PH
Sbjct  121  KPDCLVADMFFPWATDAANKFGIPRLVFHGTSFFSLCASESMRLYEPH  168



>ref|XP_009761805.1| PREDICTED: scopoletin glucosyltransferase [Nicotiana sylvestris]
 gb|AAB36653.1| immediate-early salicylate-induced glucosyltransferase [Nicotiana 
tabacum]
Length=476

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P++A GHMIP +D+A+ FA  GVKAT +TTPLN    SKAI R +  G +I IR
Sbjct  4    LHIFFFPVMAHGHMIPTLDMAKLFASRGVKATIITTPLNEFVFSKAIQRNKHLGIEIEIR  63

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L++FP  E+GLPE CE L    + E+  +FF A+   Q P+E+L  E RPDC+++     
Sbjct  64   LIKFPAVENGLPEECERLDQIPSDEKLPNFFKAVAMMQEPLEQLIEECRPDCLISDMFLP  123

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W+ D AAKF IPR+ F G+ FF +CV NS+R +KP
Sbjct  124  WTTDTAAKFNIPRIVFHGTSFFALCVENSVRLNKP  158



>gb|KJB47380.1| hypothetical protein B456_008G023800 [Gossypium raimondii]
Length=204

 Score =   156 bits (395),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 5/166 (3%)
 Frame = +3

Query  48   TQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGS  227
            T++P LHV F P +  GHMIPMVD+ + FA  GVK T +TTPLN   IS  I+R +  G 
Sbjct  6    TENPKLHVLFFPFMGHGHMIPMVDMTKLFAMRGVKTTIVTTPLNVPFISSTIERSKNSGF  65

Query  228  QISIRLLEFPYKESGLPEGCENL-----SATTTLEQTFSFFNALDHFQGPIERLAVEDRP  392
             I +++L FP  E+GLPEGCEN      S    L+    FF A D F+ P E+L  E +P
Sbjct  66   DIHLKVLNFPCVEAGLPEGCENFDSIPSSQGVNLDMIAKFFKAADMFEQPFEQLIQECKP  125

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            DC++    +TW++D A K+ IPRL F G  F  +C+ +S+  ++P 
Sbjct  126  DCLLVDMFFTWASDIADKYDIPRLMFNGGNFLSLCISDSVSLYEPQ  171



>emb|CAN65903.1| hypothetical protein VITISV_004870 [Vitis vinifera]
Length=482

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 108/163 (66%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  ++  LHV F P +A GHMIP +D+A+ F+  GV+AT +TTPLNA  +SK ++R    
Sbjct  1    MGNETDQLHVLFFPFMALGHMIPTIDMAKLFSARGVRATIITTPLNAPVVSKTMERGHYL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G+QI +R+++FP  ++GLP+G ENL    + E    FF A+  FQ P+E+L  E RP  +
Sbjct  61   GAQIGLRVIQFPSVQAGLPQGLENLDQDASPEIRLKFFLAMSLFQQPLEQLLQEYRPHGL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   + W+ D A+KFGIPRL+F G+GFF +C   SL  HKP+
Sbjct  121  VADAFFPWALDVASKFGIPRLAFQGTGFFAMCALQSLTAHKPY  163



>ref|XP_002282463.1| PREDICTED: scopoletin glucosyltransferase [Vitis vinifera]
Length=482

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 108/163 (66%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  ++  LHV F P +A GHMIP +D+A+ F+  GV+AT +TTPLNA  +SK ++R    
Sbjct  1    MGNETDQLHVLFFPFMALGHMIPTIDMAKLFSARGVRATIITTPLNAPVVSKTMERGHYL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G+QI +R+++FP  ++GLP+G ENL    + E    FF A+  FQ P+E+L  E RP  +
Sbjct  61   GAQIGLRVIQFPSVQAGLPQGLENLDQDASPEIRLKFFLAMSLFQQPLEQLLQEYRPHGL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   + W+ D A+KFGIPRL+F G+GFF +C   SL  HKP+
Sbjct  121  VADAFFPWALDVASKFGIPRLAFQGTGFFAMCALQSLTAHKPY  163



>sp|Q9AT54.1|SCGT_TOBAC RecName: Full=Scopoletin glucosyltransferase; AltName: Full=Phenylpropanoid:glucosyltransferase 
1 [Nicotiana tabacum]
 gb|AAK28303.1|AF346431_1 phenylpropanoid:glucosyltransferase 1, partial [Nicotiana tabacum]
Length=476

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH +F P++A GHMIP +D+A+ FA  GVKAT +TTPLN    SKAI R +  G +I IR
Sbjct  4    LHFFFFPVMAHGHMIPTLDMAKLFASRGVKATIITTPLNEFVFSKAIQRNKHLGIEIEIR  63

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L++FP  E+GLPE CE L    + E+  +FF A+   Q P+E+L  E RPDC+++     
Sbjct  64   LIKFPAVENGLPEECERLDQIPSDEKLPNFFKAVAMMQEPLEQLIEECRPDCLISDMFLP  123

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W+ D AAKF IPR+ F G+ FF +CV NS+R +KP
Sbjct  124  WTTDTAAKFNIPRIVFHGTSFFALCVENSVRLNKP  158



>ref|XP_006422968.1| hypothetical protein CICLE_v10029184mg [Citrus clementina]
 gb|ESR36208.1| hypothetical protein CICLE_v10029184mg [Citrus clementina]
Length=240

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P LA GHMIP VD+A+ F   GVKA+ +TTP NA  +S++I +  E G ++ ++
Sbjct  8    LHIFFFPFLAHGHMIPTVDMAKLFTTRGVKASVITTPGNAPHLSRSIQKASELGIELDVK  67

Query  243  LLEFPYKESGLPEGCENLSATT---TLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGP  413
            +++FP  E+GLPEG ENL A T     E    F+ A    Q P+E+L  E +PDC+VA  
Sbjct  68   IIKFPSAEAGLPEGWENLDAITNEVNRELIVKFYMATTKLQKPLEQLLQEHKPDCLVADM  127

Query  414  LYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            L+ W+ D AAKFGIPRL F G+ FF +C    L  ++PH
Sbjct  128  LFPWATDAAAKFGIPRLVFHGTSFFSLCAIKCLALYEPH  166



>ref|XP_004230756.2| PREDICTED: scopoletin glucosyltransferase-like [Solanum lycopersicum]
Length=514

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +3

Query  60   PLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISI  239
            PLH +F P++A GHMIP +D+A+  A  GVKAT +TTPLN +  S +I+R +  G +I I
Sbjct  3    PLHFFFFPMMAQGHMIPTLDMAKLVALRGVKATIITTPLNESVFSDSIERNKHLGIEIDI  62

Query  240  RLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLY  419
            RL+ F   E+ LPEGCE L    +     +FF A    Q P E L  E RPDCIV+  LY
Sbjct  63   RLITFQAVENDLPEGCERLDLVPSPVLFNNFFKATAMMQEPFENLVKECRPDCIVSDMLY  122

Query  420  TWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
             WS D AAKF IPR+ F G+GFF +CV  S++R+KP
Sbjct  123  PWSTDSAAKFNIPRIVFHGTGFFALCVAESIKRNKP  158



>gb|KJB47381.1| hypothetical protein B456_008G023900 [Gossypium raimondii]
Length=487

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 103/166 (62%), Gaps = 5/166 (3%)
 Frame = +3

Query  48   TQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGS  227
            T++P LHV F P +  GHMIPMVD+A+ FA  GVK T +TTPLN   IS  I+R +  G 
Sbjct  6    TENPKLHVLFFPFMGHGHMIPMVDMAKLFAMRGVKTTIVTTPLNVPFISTTIERSKNSGF  65

Query  228  QISIRLLEFPYKESGLPEGCENL-----SATTTLEQTFSFFNALDHFQGPIERLAVEDRP  392
             I I++L FP  E+GLPEGCENL     S    L+    FF A D F+ P E+L  E +P
Sbjct  66   DIHIKVLNFPCVEAGLPEGCENLDSIPSSQGVNLDMIAKFFKAADMFEQPFEQLIQECKP  125

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            DC++    +TW++D A K+ IPRL F G  F  +C+ +S+  ++P 
Sbjct  126  DCLLVDMFFTWASDIANKYDIPRLMFNGCSFLSLCISDSVNLYEPQ  171



>ref|XP_011000865.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 103/167 (62%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++   LH  F P +A GHMIP+VD+A+ FA  G+K T +TTPLN    SK + R +  
Sbjct  1    MCSEVNQLHALFFPFMAHGHMIPLVDMAKLFASRGLKTTIVTTPLNVPLFSKTVQRTKNL  60

Query  222  GSQISIRLLEFPYKESGLPEGCEN----LSATTTLEQTFSFFNALDHFQGPIERLAVEDR  389
            G +I+IR +EF   E+GLPEGCEN    +S     +    FF A    Q P+ERL  E  
Sbjct  61   GFEINIRTIEFSTVETGLPEGCENADLIISQAMGWDMLKKFFAATTFLQEPLERLLEEIH  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDC++A   + W+ D AAKFGIPRL F G+ FF +CV  SLR ++PH
Sbjct  121  PDCLIADMFFPWTTDAAAKFGIPRLVFHGTSFFSLCVGQSLRLYEPH  167



>ref|XP_011000854.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=486

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 103/167 (62%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++   LH  F P +A GHMIP+VD+A+ FA  G+K T +TTPLN    SK + R +  
Sbjct  1    MCSEVNQLHALFFPFMAHGHMIPLVDMAKLFASRGLKTTIVTTPLNVPLFSKTVQRTKNL  60

Query  222  GSQISIRLLEFPYKESGLPEGCEN----LSATTTLEQTFSFFNALDHFQGPIERLAVEDR  389
            G +I+IR +EF   E+GLPEGCEN    +S     +    FF A    Q P+ERL  E  
Sbjct  61   GFEINIRTIEFSTVETGLPEGCENADLIISQAMGWDMLKKFFAATTFLQEPLERLLEEIH  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDC++A   + W+ D AAKFGIPRL F G+ FF +CV  SLR ++PH
Sbjct  121  PDCLIADMFFPWTTDAAAKFGIPRLVFHGTSFFSLCVGQSLRLYEPH  167



>ref|XP_007042483.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
 gb|EOX98314.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
Length=489

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 102/168 (61%), Gaps = 5/168 (3%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD++S  LH++F+P LAPGHMIP VD+A+ FA  G + T +TTP NA+  S  I R +  
Sbjct  1    MDSESHQLHMFFIPFLAPGHMIPAVDMAKMFAMRGAQTTIITTPFNASLFSNTIQRCKNS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTT-----LEQTFSFFNALDHFQGPIERLAVED  386
            G  I I++L+FP  E GLPEGCENL   TT      E    F       Q P+E+L  E 
Sbjct  61   GLDIDIKVLKFPCVEVGLPEGCENLDLITTPKDANREMVVKFCKGAAMLQEPLEQLLQEL  120

Query  387  RPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +PDCIVA     W+ D A KFGIPRL F G+GFF +C    +R ++P 
Sbjct  121  KPDCIVADVFLHWTFDAANKFGIPRLVFHGTGFFSLCGLECMRLYEPQ  168



>ref|XP_002518724.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43649.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=486

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P +A GH+IP +D+A+ FA  GVK+T +TTPLNA  ISK I R +  G  I IR
Sbjct  9    LHIFFFPFMAHGHIIPTIDMAKLFASRGVKSTVITTPLNAKTISKTIQRTKNSGFDIDIR  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQ----TFSFFNALDHFQGPIERLAVEDRPDCIVAG  410
            +LEFP  E+GLPEGCEN+    + +        FF A+   Q P+E L  E +PDC+VA 
Sbjct  69   ILEFP-AEAGLPEGCENMDVIISHQDGKDLVMKFFRAIARLQQPLENLLGECKPDCLVAD  127

Query  411  PLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
              + W+ D AAKFGIPRL F G  FF +C    ++ ++PH
Sbjct  128  MFFPWTTDAAAKFGIPRLVFHGINFFSLCTGECIKLYEPH  167



>ref|XP_006346389.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=507

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 99/155 (64%), Gaps = 0/155 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
             H +F PL+A GHMIP +D+A+  A  GVKAT +TTPLN +  S +I R +  G +I IR
Sbjct  31   FHFFFFPLMAQGHMIPTLDMAKLVASRGVKATIITTPLNESVFSDSIQRNKHLGIEIDIR  90

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L+ F   E+ LPEGCE L    + E   +FF A    Q P E L  E RPDCIV+  L+ 
Sbjct  91   LITFQAVENDLPEGCERLDLVPSPELFKNFFKATAMMQEPFENLVKECRPDCIVSDMLFP  150

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            WS D AAKF IPR+ F G+GFF +CV  S++R+KP
Sbjct  151  WSTDSAAKFNIPRIVFHGTGFFALCVAESIKRNKP  185



>ref|XP_011000135.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=483

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 104/167 (62%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  +   LH++F P +A GHMIP +D+A+ FA  GVKAT +TTPLNA  +S+ I R +  
Sbjct  1    MGGEENQLHIFFFPFMAHGHMIPTIDMAKLFASRGVKATIVTTPLNAPLVSRTIQRSKGL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTT----LEQTFSFFNALDHFQGPIERLAVEDR  389
            G  I+I+ ++FP  E GLPEGCEN  + T+     E T +FF A    Q P+E+L  E  
Sbjct  61   GFDINIKTIKFPAVEVGLPEGCENADSITSHETQGEMTKNFFMATAMLQQPLEKLLQECH  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDC++A     W+ D AAKFGIPRL F G   F +C  + L R+KP+
Sbjct  121  PDCLIADMFLPWTTDAAAKFGIPRLVFHGISCFSLCTSDCLNRYKPY  167



>ref|XP_009377799.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
 ref|XP_009377807.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=477

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+S   LH++F P +A GH IP++++A+ FA HGVK+T +TTPLNA   SKAI   ++
Sbjct  1    METKSHKQLHIFFFPYMAQGHTIPLINMAKLFASHGVKSTLMTTPLNAPLFSKAIQSTKQ  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  I I +++FP +E GLP+GCE+ +  TT E    FF A    Q  IE++  E RP C
Sbjct  61   LGFDIEILVIKFPTEEVGLPQGCESGNLATTTEMKEKFFKATFLLQPQIEQILDEHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D AAKFGIPR+ F G GFF +C   S+  ++PH
Sbjct  121  LVADAFFPWATDLAAKFGIPRIVFHGVGFFALCATLSVLLYEPH  164



>ref|XP_004137108.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Cucumis sativus]
 gb|KGN43912.1| hypothetical protein Csa_7G073480 [Cucumis sativus]
Length=480

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 103/164 (63%), Gaps = 4/164 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M TQ   LH++ LP +A GHMIPMVDLA+  +  G+K T +TTPLNA  IS +I   +  
Sbjct  1    MGTQ---LHMFLLPFMARGHMIPMVDLAKLLSSRGIKITIVTTPLNAISISNSIQNSKSL  57

Query  222  G-SQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
              SQI + +L+FP  E GLP+GCENL +  T +    F +A + FQ P E   +E RP C
Sbjct  58   STSQIQLLVLKFPSAEVGLPDGCENLDSVITPDMFPKFISAFNLFQNPFEEAVMEQRPHC  117

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            I+A   + W+ND AAKFGIPRL F G+ FF  C    +R H+P+
Sbjct  118  IIADMYFPWANDVAAKFGIPRLIFHGTSFFSSCASEFMRIHEPY  161



>ref|XP_002313131.2| hypothetical protein POPTR_0009s10190g [Populus trichocarpa]
 gb|EEE87086.2| hypothetical protein POPTR_0009s10190g [Populus trichocarpa]
Length=486

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 103/167 (62%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++   LH  F P +A GHMIP+VD+A+ FA  G+K T +TTPLN    SK + R +  
Sbjct  1    MGSEVNQLHALFFPFMAHGHMIPLVDMAKLFASRGLKTTIVTTPLNVPFFSKTVQRIKNL  60

Query  222  GSQISIRLLEFPYKESGLPEGCEN----LSATTTLEQTFSFFNALDHFQGPIERLAVEDR  389
            G +I+IR +EF   E+GLPEGCEN    +S     +    FF A    Q P+ERL  E  
Sbjct  61   GFEINIRTIEFSTVETGLPEGCENADLIISQAMGWDMLKKFFVATTILQEPLERLLEEIH  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDC++A   + W+ D AAKFGIPRL F G+ FF +CV  S+R ++PH
Sbjct  121  PDCLIADMFFPWTTDAAAKFGIPRLVFHGTSFFSLCVGESMRLYEPH  167



>ref|XP_002518723.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43648.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=479

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 107/166 (64%), Gaps = 3/166 (2%)
 Frame = +3

Query  42   MDTQS---PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRE  212
            MD+ +   P L+ +F P +A GH IP++D+A+ FA  G K + +TTP+NA  ISKAI+R 
Sbjct  1    MDSDAKRHPELYFFFFPFMAQGHSIPLIDMAKLFASRGQKVSIITTPVNAPDISKAIERS  60

Query  213  REFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRP  392
            R  G +I I +++FP  E+GLPEGCE+L   T+ E   +FF A D    P+E L  + RP
Sbjct  61   RVLGHEIDILIIKFPCVEAGLPEGCEHLELVTSPEMGLNFFMATDILAKPLEHLLKQYRP  120

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            DC+VA   + WSN+ A+K GIPR+ F G+ FF  C    + +++P+
Sbjct  121  DCLVADTFFPWSNEAASKSGIPRIVFSGTCFFSSCASQCVNKYQPY  166



>ref|XP_008454969.1| PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]
Length=512

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 105/167 (63%), Gaps = 4/167 (2%)
 Frame = +3

Query  33   TNKMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRE  212
            T KM TQ   LH++ LP +A GHMIPMVDLA+  +  G+K T +TTPLN+  IS +I   
Sbjct  30   TTKMGTQ---LHMFLLPFMARGHMIPMVDLAKLLSSRGIKITIVTTPLNSISISNSIQNS  86

Query  213  REFG-SQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDR  389
            +    SQI + +L+FP  E GLP+GCENL +  T +    F +A + FQ P E   ++ R
Sbjct  87   KSLSTSQIQLLILKFPSAEVGLPDGCENLDSVITPDMFPKFISAFNLFQNPFEEAVMKQR  146

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            P CI+A   + W+ND AAKFGIPRL+F  + FF  C    +R H+P+
Sbjct  147  PHCILADMYFPWANDVAAKFGIPRLNFHATSFFSSCASEFMRIHEPY  193



>gb|AFJ52947.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=496

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 102/159 (64%), Gaps = 0/159 (0%)
 Frame = +3

Query  51   QSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQ  230
            +S  LHV F P +A GHMIP+VD+AR FAR G K+T +TTPLNA   S  I RE   G Q
Sbjct  2    ESKQLHVVFFPFMAQGHMIPLVDMARLFARQGAKSTIVTTPLNAPLFSDKIKRESNQGLQ  61

Query  231  ISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAG  410
            I   +++FP+ E+GLPEGCEN+ A  +    F FF ++  F+ PIE L    RPDCIVA 
Sbjct  62   IQTHVIDFPFLEAGLPEGCENVKALKSPAMIFQFFLSMHVFKQPIEELLRLWRPDCIVAD  121

Query  411  PLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
             ++ W+ + A   GIPRL F G+G F +C+ +  +R+ P
Sbjct  122  LVFHWATESAHSLGIPRLFFNGTGSFSMCLIDCFKRYDP  160



>gb|KJB79375.1| hypothetical protein B456_013G046200 [Gossypium raimondii]
Length=490

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 111/162 (69%), Gaps = 0/162 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD++  PLH+ F P LA GHMIP +D+AR FAR GVKAT LTT LNA+  SK I+R+R+ 
Sbjct  1    MDSKPDPLHILFFPHLAHGHMIPTIDMARVFARQGVKATILTTHLNASFFSKVIERDRKL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I I +++FP  E+GLPEG EN+S+ T+ E  +  F A+   Q P++++  +  P+C+
Sbjct  61   GFEIDIVMIKFPSMEAGLPEGIENISSITSQEMGYKLFKAVRLLQQPLQQVLEDCHPNCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            VA  ++ W+ + A K GIPRL F+G+ +   CV +S  R++P
Sbjct  121  VADGMFPWATEVARKVGIPRLVFYGTSYLACCVLDSFLRYEP  162



>gb|AAK28304.1|AF346432_1 phenylpropanoid:glucosyltransferase 2, partial [Nicotiana tabacum]
Length=476

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH +F P++A GHMIP +D+A+  A  GVKAT +TTPLN +  SK+I R +  G +I IR
Sbjct  4    LHFFFFPVMAHGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKSIQRNKHLGIEIEIR  63

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L++FP  E+GLPE CE L    + ++  +FF A+   Q P+E+L  E RP+C+V+     
Sbjct  64   LIKFPAVENGLPEECERLDLIPSDDKLPNFFKAVAMMQEPLEQLIEECRPNCLVSDMFLP  123

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W+ D AAKF +PR+ F G+ FF +CV NS+R +KP
Sbjct  124  WTTDTAAKFNMPRIVFHGTSFFALCVENSIRLNKP  158



>ref|XP_009622522.1| PREDICTED: scopoletin glucosyltransferase [Nicotiana tomentosiformis]
 gb|AAB36652.1| immediate-early salicylate-induced glucosyltransferase [Nicotiana 
tabacum]
Length=476

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH +F P++A GHMIP +D+A+  A  GVKAT +TTPLN +  SK+I R +  G +I IR
Sbjct  4    LHFFFFPVMAHGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKSIQRNKHLGIEIEIR  63

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L++FP  E+GLPE CE L    + ++  +FF A+   Q P+E+L  E RP+C+V+     
Sbjct  64   LIKFPAVENGLPEECERLDLIPSDDKLPNFFKAVAMMQEPLEQLIEECRPNCLVSDMFLP  123

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W+ D AAKF +PR+ F G+ FF +CV NS+R +KP
Sbjct  124  WTTDTAAKFNMPRIVFHGTSFFALCVENSIRLNKP  158



>gb|AFJ52934.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=499

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 98/152 (64%), Gaps = 0/152 (0%)
 Frame = +3

Query  75   FLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIRLLEF  254
            F+P LAPGHM+PMVD+AR FA +GV  T LTT  NA  IS AID +   G  IS+  L F
Sbjct  2    FIPFLAPGHMLPMVDIARLFAANGVNVTILTTTTNARLISSAIDHDARSGLHISLLTLRF  61

Query  255  PYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYTWSND  434
            P KE+GLPEGCENL +  T E  F  F+ +   Q  +E++     PDC+ +  L+ WS D
Sbjct  62   PGKEAGLPEGCENLISAPTPEINFKLFHGIKLLQPEMEKIIRAHNPDCLASDYLFPWSAD  121

Query  435  FAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             A+  GIPRL+F GSGFF +C+ +S+  + PH
Sbjct  122  IASDLGIPRLAFSGSGFFNLCIADSIESNNPH  153



>gb|AFJ52929.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=495

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 104/161 (65%), Gaps = 5/161 (3%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE-FGSQISI  239
            LHV+F P LA GHMIP +D+A+ FA  GVK T +TTPLN    SK I +  E  GS+I I
Sbjct  13   LHVFFFPFLAHGHMIPAIDMAKIFASRGVKVTIVTTPLNVPFFSKTISKHSESTGSEIRI  72

Query  240  RLLEFPYKESGLPEGCENLSATTTLE---QTFS-FFNALDHFQGPIERLAVEDRPDCIVA  407
            + L+FP  E GLPEGCEN    T++    +TFS FF A    Q  +E+L  EDRPDC+VA
Sbjct  73   QTLKFPTTEFGLPEGCENAEVITSMNLGWETFSKFFLASTKLQESLEKLLEEDRPDCLVA  132

Query  408  GPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
               + W+ D + KFGIPRL F G+ FF + V + L R++PH
Sbjct  133  DMFFPWATDSSEKFGIPRLLFHGTSFFSLTVMDVLSRYEPH  173



>ref|XP_008236558.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=485

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 107/167 (64%), Gaps = 7/167 (4%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAI--DRER  215
            M +Q+   HV+  P +A GHMIP+ D+A+ FA  GVK T +TTPLNA   SKAI   +  
Sbjct  1    MGSQNRDFHVFLFPFMAHGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKAIRSSKTN  60

Query  216  EFGSQISIRLLEFPYKESGLPEGCENLSA---TTTLEQTFSFFNALDHFQGPIERLAVED  386
              G +I I+ ++FP +E+GLPEGCENL +   T  L    SFF A    Q P+ERL +ED
Sbjct  61   SGGIEIEIKTIKFPSQEAGLPEGCENLDSLPPTPVLAD--SFFKAAGLLQEPLERLLLED  118

Query  387  RPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            +P C+VA   + W+ D AAKFGIPRL F G+ FF +   + +RR++P
Sbjct  119  QPTCLVADMFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVRRYEP  165



>ref|XP_009354714.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=477

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 104/164 (63%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+S   LH++F P +  GH IP++++AR FA  GVK+T + TPLNA   SKAI   ++
Sbjct  1    METKSHKQLHIFFFPYMVQGHFIPLINIARLFASRGVKSTLIATPLNAPLFSKAIQSSKK  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  + I +++FP +E GLP+GCEN +  TTLE    F  A    Q  IE++  + RP C
Sbjct  61   LGIDVDILVIKFPTEEVGLPQGCENANLVTTLEMNEKFIKATFLLQPQIEQILDKHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D AAKFGIPR+ F G GFF +C   S+  ++PH
Sbjct  121  LVADTFFPWATDVAAKFGIPRIIFHGMGFFALCASRSVALYEPH  164



>gb|AFJ52946.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=496

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 104/159 (65%), Gaps = 0/159 (0%)
 Frame = +3

Query  51   QSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQ  230
            +S  LH  F P +A GHMIP+VD+AR FAR G K+T +TTPLNA   S  I RE + G Q
Sbjct  2    ESKQLHAVFFPFMAQGHMIPLVDMARLFARRGAKSTIVTTPLNAPLFSDKIKRETQQGLQ  61

Query  231  ISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAG  410
            I   +++FP+ E+GLPEGCEN+++  +    F FF ++  F+ PIE L    +PDCIVA 
Sbjct  62   IQTHVIDFPFLEAGLPEGCENVTSLKSPAMIFQFFLSMHVFKQPIEELLKLWKPDCIVAD  121

Query  411  PLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
             ++ W+ + A + GIPRL F G+G F +C+ +  +R+ P
Sbjct  122  VVFHWATESAHRLGIPRLFFNGTGSFSMCLIDCFKRYDP  160



>ref|XP_002298733.1| hypothetical protein POPTR_0001s31130g [Populus trichocarpa]
 gb|EEE83538.1| hypothetical protein POPTR_0001s31130g [Populus trichocarpa]
Length=483

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 102/167 (61%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  +   +H++F P +A GHMIP +D+A+ FA  GVKAT +TTPLNA  +S+ I R +  
Sbjct  1    MGGEENQVHIFFFPFMAHGHMIPTIDMAKLFASRGVKATIVTTPLNAPLVSRTIQRSKGL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTL----EQTFSFFNALDHFQGPIERLAVEDR  389
            G  I+I+ ++FP  E GLPEGCEN  + T+     E T   F A    Q P+E+L  E  
Sbjct  61   GFDINIKTIKFPAVEVGLPEGCENADSITSHETQGEMTKKLFMATAMLQQPLEKLLQECH  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDC++A     W+ D AAKFGIPRL F G   F +C  + L R+KP+
Sbjct  121  PDCLIADMFLPWTTDAAAKFGIPRLVFHGISCFSLCTSDCLNRYKPY  167



>ref|XP_008364526.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=477

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            MDT+S   LH++F P +A GH IP++++A+ FA HGVK+T +TTPLNA   SKAI   ++
Sbjct  1    MDTKSHKQLHIFFFPYMAQGHTIPLINMAKLFASHGVKSTLITTPLNAPLFSKAIQGTKQ  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  I I +++FP +E GLP+GCE+ +  TT E    FF A    Q  IE++  E RP C
Sbjct  61   LGFDIEILVIKFPTEEVGLPQGCESGNLATTTEMKEKFFKATFLLQPQIEQVLDEHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D AAKFGIPR+ F G GFF +    S+  ++PH
Sbjct  121  LVADAFFPWATDLAAKFGIPRIIFHGVGFFALYATLSVLLYEPH  164



>ref|XP_003628776.1| Glucosyltransferase [Medicago truncatula]
 gb|AET03252.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=489

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD+QS PLH+   P +  GH IP +D+A+ FA  GV+ T +TTPLN   ISKA+++ +  
Sbjct  1    MDSQSNPLHILVFPFMGHGHTIPTIDMAKLFASKGVRVTIVTTPLNKPPISKALEQSKIH  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
             + I I+ ++FP  E+GLPEGCEN+ +  ++    +FF A+   Q P E L ++ +P C+
Sbjct  61   FNNIDIQTIKFPCVEAGLPEGCENVDSIPSVSFVPAFFAAIRLLQQPFEELLLQQKPHCV  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   + W+ D AAKFGIPR+ F G+ FF +C    +++++P+
Sbjct  121  VADMFFPWATDSAAKFGIPRIVFHGTSFFSLCASQCMKKYQPY  163



>ref|XP_006369760.1| hypothetical protein POPTR_0001s31090g [Populus trichocarpa]
 gb|ERP66329.1| hypothetical protein POPTR_0001s31090g [Populus trichocarpa]
Length=483

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 102/167 (61%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  +   +H++F P +A GHMIP +D+A+ FA  GVKAT +TTPLNA  +S+ I R +  
Sbjct  1    MGGEENQVHIFFFPFMAHGHMIPTIDMAKLFASRGVKATIVTTPLNAPLVSRTIQRSKGL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTT----LEQTFSFFNALDHFQGPIERLAVEDR  389
            G  I+I+ ++FP  E GLPEGCEN  + T+     E T   F A    Q P+E+L  E  
Sbjct  61   GFDINIKTIKFPAVEVGLPEGCENADSITSHETQGEMTKKVFMATTMLQQPLEKLLQECH  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDC++A     W+ D AAKFGIPRL F G   F +C  + L R+KP+
Sbjct  121  PDCLIADMFLPWTTDAAAKFGIPRLVFHGISCFSLCASDCLNRYKPY  167



>ref|XP_006487029.1| PREDICTED: scopoletin glucosyltransferase-like [Citrus sinensis]
Length=487

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 102/159 (64%), Gaps = 3/159 (2%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P LA GHMIP VD+A+ F   GVKA+ +TTP NA  +S++I +  E G ++ ++
Sbjct  8    LHIFFFPFLAHGHMIPTVDMAKLFTTRGVKASVITTPANAPHLSRSIQKASELGIELDVK  67

Query  243  LLEFPYKESGLPEGCENLSATT---TLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGP  413
            +++FP  E+GLPEG ENL A T     E    F+ A    Q P+E+L  E +PDC+VA  
Sbjct  68   IIKFPSAEAGLPEGWENLDAITNEVNRELIVKFYMATTKLQKPLEQLLQEHKPDCLVADM  127

Query  414  LYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             + W+ D AAKFGIPRL F G+ FF +C    L  ++PH
Sbjct  128  FFPWATDAAAKFGIPRLVFHGTSFFSLCAIKCLALYEPH  166



>ref|XP_004159901.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Cucumis sativus]
Length=483

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 105/166 (63%), Gaps = 6/166 (4%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M+TQ   LH++  P++APGHMIPMVD+A+  +  GVK T +TTPLN+  IS +I    + 
Sbjct  1    METQ---LHMFLFPIMAPGHMIPMVDMAKLLSSRGVKITIVTTPLNSISISNSIHNNSKS  57

Query  222  GS---QISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRP  392
             S   +I + +L+FP  E GLP+GCENL + T       F +A +  Q P E   +E RP
Sbjct  58   ISPPPKIHLLILKFPSAEVGLPDGCENLDSVTGNAMIPKFISACNLLQTPFEEAVMEHRP  117

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             CI+A   + W+ND AAKFGIPRL+F G+GFF  C    +R H+P+
Sbjct  118  HCILADIFFPWANDVAAKFGIPRLTFHGTGFFSTCASEFIRIHEPY  163



>gb|AAS55083.1| UDP-glucose glucosyltransferase [Rhodiola sachalinensis]
Length=480

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 103/163 (63%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +++ PL ++F P +A GHMIPMVD+AR FA  GV+ T +TTP N   I+++I + +  
Sbjct  1    MGSETRPLSIFFFPFMAHGHMIPMVDMARLFASQGVRCTIVTTPGNQPLIARSIGKVQLL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I +  + F   E GLP+GCENL +  + +  F FF A    + P E+L  E +PDC+
Sbjct  61   GFEIGVTTIPFRGTEFGLPDGCENLDSVPSPQHVFHFFEAAGSLREPFEQLLEEHKPDCV  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            V    + WS D AAKFGIPRL F G+ +F +C   ++R HKP+
Sbjct  121  VGDMFFPWSTDSAAKFGIPRLVFHGTSYFALCAGEAVRIHKPY  163



>ref|XP_006379195.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|ERP56992.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=486

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 101/168 (60%), Gaps = 5/168 (3%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +    LH++F P LA GHMIP VD+A+ FA  GVK T +TTPLNA   SK I + ++ 
Sbjct  1    MGSLGHQLHIFFFPFLAHGHMIPTVDMAKLFASRGVKTTIITTPLNAPLFSKTIQKTKDL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTL-----EQTFSFFNALDHFQGPIERLAVED  386
            G  I I+ ++FP  E+GLPEGCEN  A  T      E T  FF A    Q P E++  E 
Sbjct  61   GFDIDIQTIKFPAAEAGLPEGCENTDAFITTNENAGEMTKKFFIATTFLQEPFEKVLQER  120

Query  387  RPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             PDC+VA   + W+ D AAKFGIPRL F G+  F +    S+R ++PH
Sbjct  121  HPDCVVADMFFPWATDAAAKFGIPRLVFHGTSNFALSAGESVRLYEPH  168



>ref|XP_004230759.1| PREDICTED: scopoletin glucosyltransferase [Solanum lycopersicum]
Length=470

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 101/155 (65%), Gaps = 0/155 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH +F P++A GHMIP +D+A+  A  GVKAT +TTPLN +  SKAI+R +  G +I IR
Sbjct  4    LHFFFFPMMAQGHMIPTLDMAKLVACRGVKATIITTPLNESVFSKAIERNKHLGIEIDIR  63

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            LL+FP KE+ LPE CE L    + ++  +F  A    +   E L  E RPDC+V+     
Sbjct  64   LLKFPAKENDLPEDCERLDLVPSDDKLPNFLKAAAMMKDEFEELIGECRPDCLVSDMFLP  123

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W+ D AAKF IPR+ F G+ +F +CV +S+RR+KP
Sbjct  124  WTTDSAAKFSIPRIVFHGTSYFALCVGDSIRRNKP  158



>ref|XP_007200278.1| hypothetical protein PRUPE_ppa014816mg [Prunus persica]
 gb|EMJ01477.1| hypothetical protein PRUPE_ppa014816mg [Prunus persica]
Length=485

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 108/167 (65%), Gaps = 6/167 (4%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE-  218
            M +Q+  LHV+  P +A GHMIP+ D+A+ FA  GVK T +T  LNA   SKAI R R+ 
Sbjct  1    MASQNRELHVFLFPFMAHGHMIPVSDMAKLFAAQGVKTTIITNTLNAPTFSKAI-RSRKT  59

Query  219  ----FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVED  386
                 G +I I+ ++FP +E+GLPEGCENL +  T E   +FF A+   Q P+E+L +ED
Sbjct  60   NSCGCGIEIEIKTIKFPSQEAGLPEGCENLDSLPTPELAGNFFKAMGLLQAPLEQLLLED  119

Query  387  RPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            +P C+VA   + W+ D AAKFGIPRL F G+ FF +   + + R++P
Sbjct  120  QPTCLVADMFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVWRYEP  166



>ref|XP_007200989.1| hypothetical protein PRUPE_ppa004972mg [Prunus persica]
 gb|EMJ02188.1| hypothetical protein PRUPE_ppa004972mg [Prunus persica]
Length=483

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 107/164 (65%), Gaps = 2/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +++   H++ LP +A GHMIP+ D+A+ FA  GVK T +TTPLNA   SKA    +  
Sbjct  1    MSSENREFHIFLLPFMAYGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKATRSSKTN  60

Query  222  GSQISIRL--LEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPD  395
              +I +++  ++FP +E+GLPEGCENL +  T E   +F  AL   Q P+ERL +ED+P 
Sbjct  61   SGRIEVQIKTIKFPSQEAGLPEGCENLDSLPTPEFANNFSKALGLLQEPLERLLLEDQPS  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            C+VA   + W+ D AAKFGIPRL F G+ FF +   + +RR++P
Sbjct  121  CLVADMFFPWATDAAAKFGIPRLLFHGTSFFTLAASDCVRRYQP  164



>gb|KDO59780.1| hypothetical protein CISIN_1g039991mg, partial [Citrus sinensis]
Length=172

 Score =   146 bits (369),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 95/144 (66%), Gaps = 3/144 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++ P LHV+F P +A GHMIP+VD+A+ F   GVKA+ +TTP N   +SK+++R  E 
Sbjct  29   MGSEIPQLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANEL  88

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATT---TLEQTFSFFNALDHFQGPIERLAVEDRP  392
            G ++ ++ ++FP  E+GLP+GCENL A T     E    FF A    Q P+E+L  + +P
Sbjct  89   GIEMDVKTVKFPSVEAGLPDGCENLDAITNEVNKELIVKFFGATTKLQEPLEQLLRDHKP  148

Query  393  DCIVAGPLYTWSNDFAAKFGIPRL  464
            DC+VA   + W+ D AAKFGIPRL
Sbjct  149  DCLVADIFFPWATDAAAKFGIPRL  172



>ref|XP_008375156.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=475

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 105/164 (64%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+S   LH++F P +  GH IP++++A+ FA  GVK+T +TTPLNA   SKAI   ++
Sbjct  1    METKSHMQLHIFFFPYMIQGHFIPLINMAKLFASRGVKSTLITTPLNAPLFSKAIQSSKK  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  + I +++FP +E GLP+GCEN +  TT E    F  A    Q  IE++  E RP C
Sbjct  61   LGFDVDILVIKFPTEEVGLPQGCENANLATTREMNEKFIKATFLLQPQIEQILYEHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D AAKFGIPR+ F G GFF +C  +S+  ++PH
Sbjct  121  LVADNFFPWATDVAAKFGIPRIIFQGLGFFALCAFHSVALYEPH  164



>gb|KDO59783.1| hypothetical protein CISIN_1g046605mg [Citrus sinensis]
Length=487

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 102/159 (64%), Gaps = 3/159 (2%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P LA GHMIP VD+A+ F   GVKA+ +TTP NA  +S++I +  E G ++ ++
Sbjct  8    LHIFFFPFLAHGHMIPTVDMAKLFTTRGVKASVITTPGNAPHLSRSIQKASELGIELDVK  67

Query  243  LLEFPYKESGLPEGCENLSATT---TLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGP  413
            +++FP  E+GLPEG ENL A T     E    F+ A    Q P+E+L  E +PDC+VA  
Sbjct  68   IIKFPSAEAGLPEGWENLDAITNEVNRELIVKFYMATTKLQKPLEQLLQEHKPDCLVADM  127

Query  414  LYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             + W+ D AAKFGIPRL F G+ FF +C    L  ++PH
Sbjct  128  FFPWATDAAAKFGIPRLVFHGTSFFSLCAIKCLALYEPH  166



>ref|XP_007157726.1| hypothetical protein PHAVU_002G093300g [Phaseolus vulgaris]
 gb|ESW29720.1| hypothetical protein PHAVU_002G093300g [Phaseolus vulgaris]
Length=472

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 104/163 (64%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  +   LHV+F+P LA GH IP VD+A+ FA  GVKAT +TTPLNA  I+KAI + +  
Sbjct  1    MSNEVHSLHVFFIPFLAYGHFIPTVDMAKLFAEKGVKATIITTPLNAPFITKAIGKTKTS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
             + I ++ +E P  E+GLP GCEN ++ TT     +FF A    Q P E+L +E RP+C+
Sbjct  61   STMIHVKTIELPCAEAGLPNGCENTNSLTTGTLFPAFFRACGLLQYPFEQLLLEQRPNCV  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA  ++ W+ D AAK G+P L + G+ FF +C +  +  ++P+
Sbjct  121  VADVMFPWATDSAAKLGVPSLVYDGTSFFSICANQCMGLYEPY  163



>ref|XP_008245758.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=486

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 108/166 (65%), Gaps = 4/166 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAI-DRERE  218
            M +Q+ P HV+  P +A GHMIP+ D+A+  A  GV+ T +TTPLNA   SKA   R+  
Sbjct  1    MVSQNRPFHVFLFPFMAHGHMIPVSDMAKLLAAQGVETTIITTPLNAPTFSKATRSRKTN  60

Query  219  FGS---QISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDR  389
             GS   +I I+ ++FP +E+GLPEGCEN  +  T E   +FF A+   Q P+E+L +ED+
Sbjct  61   SGSCGIEIKIKTIKFPSQEAGLPEGCENPDSLPTPELASNFFKAVGLLQAPLEQLLLEDQ  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            P C+VA   + W+ D AAKFGIPRL F G+ FF +   + +RR++P
Sbjct  121  PTCLVADMFFPWATDAAAKFGIPRLVFHGTSFFSLAASDCVRRYEP  166



>ref|XP_002518725.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43650.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=483

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 107/167 (64%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +++   H++F P +A GHMIP VD+A+ FA  G+K T +TTPLN + ISK I R +  
Sbjct  1    MGSEANVPHIFFFPFMAHGHMIPTVDMAKLFASRGLKTTIVTTPLNESFISKPIQRTKNL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTT----LEQTFSFFNALDHFQGPIERLAVEDR  389
            G +I+I++L+FP  E+GLPEGCENL   T+    +E    F  A+   Q P+E+L    R
Sbjct  61   GLEINIKILKFPTVEAGLPEGCENLDFITSQNMDMEIVNKFLKAIALLQEPLEKLLSACR  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDC+VA   + W+ + ++KF IPRL F G+ FF +C   S+  H+PH
Sbjct  121  PDCLVADMFFPWATEASSKFRIPRLVFHGTSFFSLCATISVVLHEPH  167



>ref|XP_009354715.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=475

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 99/156 (63%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P +  GH IP++D+A+ FA  GVK+T +TTPLNA   SKAI   ++ G  + I 
Sbjct  9    LHIFFFPYMIQGHFIPLIDMAKLFASRGVKSTLITTPLNAPLFSKAIQSSKKLGFDVDIL  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            +++FP +E GLP+GCEN +  TT E    F  A    Q  IE+L  E RP C+VA     
Sbjct  69   VIKFPTEEVGLPQGCENANLVTTREMNEKFIRATFLLQPQIEQLLDEHRPHCLVADNFLP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D AAKFGIPR+ F G GFF +C  +S+  ++PH
Sbjct  129  WATDVAAKFGIPRIIFQGLGFFALCAFHSVALYEPH  164



>ref|XP_008236488.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=483

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 105/164 (64%), Gaps = 2/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +++   H++  P +A GHMIP+ D+A+ FA  GVK T +TTPLNA   SKA    R  
Sbjct  1    MSSENREFHIFLFPFMAYGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKATRSRRTN  60

Query  222  GSQISIRL--LEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPD  395
              +I +++  ++FP +E+GLPEGCENL +  T E   +F  AL   Q P+ERL  ED+P 
Sbjct  61   SGRIEVQIKTIKFPSQEAGLPEGCENLESLPTPELANNFSKALGLLQEPLERLLHEDQPS  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            C+VA   + W+ D AAKFGIPRL F G+ FF +   + +RR++P
Sbjct  121  CLVADMFFPWATDAAAKFGIPRLVFHGTSFFTLAASDCVRRYQP  164



>ref|XP_006346388.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=474

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 102/155 (66%), Gaps = 0/155 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH +F P++A GHMIP +D+A+  A  GVKAT +TTPLN +  SKAI+R +  G +I IR
Sbjct  4    LHFFFFPMMAQGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKAIERNKHLGIEIDIR  63

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            LL+FP KE+ LPE CE L    + ++  +F  A    +   E+L  E RP+C+V+     
Sbjct  64   LLKFPAKENDLPEDCERLDLIPSDDKLPNFLKAAAMMKDEFEQLIEECRPNCLVSDMFLP  123

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W+ D AAKF IPR+ F G+ +F +CV +S+RR+KP
Sbjct  124  WTTDSAAKFDIPRIVFHGTSYFALCVVDSIRRNKP  158



>ref|XP_010690617.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 105/161 (65%), Gaps = 1/161 (1%)
 Frame = +3

Query  51   QSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAID-REREFGS  227
            Q+   H++FLP +APGH+IP +D+AR FA  G+K+T +TTP N    ++ +D   ++ G 
Sbjct  6    QAGRYHIFFLPFMAPGHIIPTLDMARLFATQGIKSTVVTTPANLHYFTETLDVHTQKPGI  65

Query  228  QISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVA  407
            +I +  + FPY+E+GLPEGCEN  + T+ E  +  F A+D  Q P   L  + +P+C+VA
Sbjct  66   EIDLLTMIFPYEEAGLPEGCENFDSITSPEMFYKLFKAIDLLQHPFTNLMEKYQPNCLVA  125

Query  408  GPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             P + W+N  A KFG+PRL F GS +F  C+ ++L R +PH
Sbjct  126  DPFFYWANSIATKFGVPRLVFNGSSYFSRCIISNLLRFEPH  166



>ref|XP_008236559.1| PREDICTED: scopoletin glucosyltransferase-like [Prunus mume]
Length=485

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 108/166 (65%), Gaps = 4/166 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAI-DRERE  218
            M +Q+  LHV+  P +A GHMIP+ D+A+  A  GV+ T +TTPLNA   SKA   R+  
Sbjct  1    MASQNRELHVFLFPFMAHGHMIPVSDMAKLLAAQGVETTIITTPLNAPTFSKATRSRKTN  60

Query  219  FGS---QISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDR  389
             GS   +I I+ ++FP +E+GLPEGCEN  +  T E   +FF A+   Q P+E+L +ED+
Sbjct  61   SGSCGIEIKIKTIKFPSQEAGLPEGCENPDSLPTPELASNFFKAVGLLQAPLEQLLLEDQ  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            P C+VA   + W+ D AAKFGIPRL F G+ FF +   + +RR++P
Sbjct  121  PTCLVADMFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVRRYEP  166



>ref|XP_007017169.1| UDP-glucosyl transferase 73B5, putative [Theobroma cacao]
 gb|EOY14394.1| UDP-glucosyl transferase 73B5, putative [Theobroma cacao]
Length=495

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARH-GVKATFLTTPLNAAKISKAIDRERE  218
            M T+   +H  FLP +APGHM+PMVD AR  A   G K T + T +NA +I  AID + +
Sbjct  1    MGTEDGKIHAMFLPYMAPGHMMPMVDAARLLAAAAGTKVTIIVTAMNALRIKNAIDGDVQ  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G QIS+ +L FP  + GLPEGCEN+ +T T E +   F+A++  Q  IE+L  E  P+C
Sbjct  61   SGHQISLEILSFPGAQVGLPEGCENMISTPTPEMSMKLFHAIELLQPNIEKLFREYHPNC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            I++  L+ W+ D A   GIPR++F GSGFF +CV +S+ R++PH
Sbjct  121  IISDSLFPWTLDAANDLGIPRIAFNGSGFFNLCVTDSIIRYQPH  164



>ref|XP_011000877.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=485

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 101/167 (60%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +    LH +F P LA GHMIP VD+A+ FA  GVK T +TTPLNA   SK I + ++ 
Sbjct  1    MGSSGNQLHFFFFPFLAHGHMIPSVDMAKLFASRGVKTTIITTPLNAPFFSKTIQKTKDL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQ----TFSFFNALDHFQGPIERLAVEDR  389
            G  I I+ ++FP  E+GLPEGCEN  A  T E     T  FF A+   Q P E++  E  
Sbjct  61   GFDIDIQTIKFPTAEAGLPEGCENTDAFITNENAGEMTKKFFIAITLLQEPFEKVLQERH  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDC+VA   + W+ D AAKFGIPRL F G+  F +   + +R ++PH
Sbjct  121  PDCVVADMFFPWATDAAAKFGIPRLVFHGTSNFALSAGDCVRLYEPH  167



>ref|XP_011468623.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=445

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 111/167 (66%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPP-LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+S   LH++F P + PGH IP++++A+QFA + VK+T +TTPLNA + SKAI R + 
Sbjct  1    METESQQQLHIFFFPFMGPGHSIPIIEIAKQFASYSVKSTIITTPLNAPQFSKAIQRRKH  60

Query  219  FG--SQISIRLLEFPYKESGLPEGCENLS-ATTTLEQTFSFFNALDHFQGPIERLAVEDR  389
             G   +I + LL+FP  E+GLP+ CE+ + AT+TLE   +FF A+   +   E++  + R
Sbjct  61   LGFDHEIELLLLKFPSVEAGLPQECESYNLATSTLEMELTFFKAITLLEPQFEQVLDKHR  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            P C+V   ++ W+   A+KFGIP L F G+GFF +C   S+  H+PH
Sbjct  121  PHCLVVDTMFPWATTAASKFGIPSLLFHGTGFFSLCASKSIIIHQPH  167



>ref|XP_003518713.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
 gb|KHN12233.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Glycine soja]
Length=481

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 100/156 (64%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P LA GHMIP VD+A+ FA  GVKAT +TTPLN   I  AI + +  G++I I+
Sbjct  9    LHIFFFPFLAHGHMIPTVDMAKLFAEKGVKATIITTPLNEPFIYNAIGKSKTNGNKIHIQ  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             +EFP  E+GL +GCEN  +  + E    FF A    Q P+E+L  +  PDCIVA   + 
Sbjct  69   TIEFPSAEAGLLDGCENTESVPSPELLNPFFMATHFLQEPLEQLLQKQLPDCIVADMFFP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D AAKFGIPRL F G+ FF +CV   +  ++PH
Sbjct  129  WATDSAAKFGIPRLVFHGTSFFSLCVTTCMPFYEPH  164



>ref|XP_007200988.1| hypothetical protein PRUPE_ppa004924mg [Prunus persica]
 gb|EMJ02187.1| hypothetical protein PRUPE_ppa004924mg [Prunus persica]
Length=485

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 106/167 (63%), Gaps = 7/167 (4%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAI--DRER  215
            M +Q+   HV+  P +A GHMIP+ D+A+ FA  GVK T +TTPLNA   SKA    +  
Sbjct  1    MCSQNRDFHVFLFPFMAHGHMIPVSDMAKLFAAQGVKTTIITTPLNAPTFSKATRSSKTN  60

Query  216  EFGSQISIRLLEFPYKESGLPEGCENLSA---TTTLEQTFSFFNALDHFQGPIERLAVED  386
              G +I I+ ++FP +E+GLPEGCENL +   T  L    SFF A    Q P+ERL +ED
Sbjct  61   SGGIEIEIKTIKFPSQEAGLPEGCENLDSLPPTPVLAD--SFFKAAGLLQEPLERLLLED  118

Query  387  RPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            +P C+VA   + W+ D AAKFGIPRL F G+ FF +   + +RR++P
Sbjct  119  QPTCLVADMFFPWATDAAAKFGIPRLVFHGTSFFALAASDCVRRYEP  165



>gb|KJB79374.1| hypothetical protein B456_013G046100 [Gossypium raimondii]
Length=482

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 97/161 (60%), Gaps = 5/161 (3%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++FLP LA GH+IP +D+A+ FA  GVK T +TTP+NAA  S  I+R +E G  I + 
Sbjct  5    LHMFFLPFLAHGHLIPTLDMAKLFASRGVKTTIVTTPVNAAFFSNTIERSKESGIHIGVE  64

Query  243  LLEFPYKESGLPEGCEN-----LSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVA  407
            LL FP  + GLPEGCEN      S    LE    FF A    Q P E+L  E +PDC+VA
Sbjct  65   LLNFPAVDVGLPEGCENDDLIPTSQDGNLEMITKFFQASLMLQQPFEKLLQERKPDCLVA  124

Query  408  GPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
               + W+ D A KFGIPRL F G  +F +C    +  +KP+
Sbjct  125  DMFFHWATDAANKFGIPRLVFHGISYFSLCASECMSLYKPY  165



>ref|XP_007042482.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
 gb|EOX98313.1| UDP-glucosyl transferase 73B3, putative [Theobroma cacao]
Length=485

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 101/168 (60%), Gaps = 5/168 (3%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++ P +H++F P++A GH+IP VD+A+ FA  GVK T +TTP NA+  SK I R +E 
Sbjct  1    MGSEIPQVHIFFFPIMAQGHVIPTVDMAKLFATRGVKTTIITTPANASFFSKTIQRSKES  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQ-----TFSFFNALDHFQGPIERLAVED  386
            G  + +++L++  +E+GLPEGCEN     T           FF A    Q P+ERL  E 
Sbjct  61   GLDVDVKILKYSTEEAGLPEGCENADLLPTSRDEPKDIVSKFFKAKVMLQEPLERLLQEC  120

Query  387  RPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +PDC+VA   + W+ D A KFGIPRL F+G   F  C    +  ++PH
Sbjct  121  KPDCLVAHMFFPWATDAADKFGIPRLVFYGVSVFSTCAMECMTLYEPH  168



>ref|XP_009787720.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana sylvestris]
Length=483

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 100/155 (65%), Gaps = 0/155 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH +F P +A GHMIP +D+A+  A  GVKAT +TTPLN +  SK+I R +  G +I IR
Sbjct  4    LHFFFFPFMAHGHMIPTLDMAKLVASRGVKATIVTTPLNKSVFSKSIQRNKHLGLEIDIR  63

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L+ F   E+GLPEGCE L    + +  F+F  A    Q  +E+L  E RP+C+V+  L+ 
Sbjct  64   LITFQAVENGLPEGCERLDLVPSQDLFFNFLKATAMMQETLEQLIEECRPNCLVSDMLFP  123

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W+ D AAKF IPRL F+G+ +F +C  +S R +KP
Sbjct  124  WTTDSAAKFNIPRLVFYGTSYFSLCPGDSNRLNKP  158



>ref|XP_004137110.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101218912 
[Cucumis sativus]
Length=987

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 105/167 (63%), Gaps = 6/167 (4%)
 Frame = +3

Query  39   KMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            KM+TQ   LH++  P++APGHMIPMVD+A+  +  GVK T +TTPLN+  IS +I    +
Sbjct  504  KMETQ---LHMFLFPIMAPGHMIPMVDMAKLLSSRGVKITIVTTPLNSISISNSIHNNSK  560

Query  219  FGS---QISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDR  389
              S   +I + +L+FP  E GLP+GCENL + T       F +  +  Q P E   +E R
Sbjct  561  SISPPPKIHLLILKFPSAEVGLPDGCENLDSVTGNAMIPKFISVCNLLQTPFEEAVMEHR  620

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            P CI+A   + W+ND AAKFGIPRL+F G+GFF  C    +R H+P+
Sbjct  621  PHCILADIFFPWANDVAAKFGIPRLTFHGTGFFSTCASEFIRIHEPY  667


 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 99/164 (60%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE-  218
            M T    LH++  P LA GHMIP+VD+A+  +  G+K T +TTPLN+  IS +I   +  
Sbjct  1    MSTHDSVLHIFLFPFLAQGHMIPIVDMAKLLSSRGIKITIVTTPLNSISISNSIKSSKSL  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
            + S I + +L+FP  E GLP+GCENL    +      F +AL+  Q P E   +E RP C
Sbjct  61   YASNIHLLILKFPSAEVGLPDGCENLDFVISPAMIPKFISALNLLQTPFEEAVMEHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            I+A   + W+ND AAK GIPRL+F GS FF  C    +R H+P+
Sbjct  121  IIADMFFPWANDVAAKVGIPRLNFHGSCFFSFCASEFVRIHQPY  164



>gb|KJB79373.1| hypothetical protein B456_013G046100 [Gossypium raimondii]
Length=482

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 96/161 (60%), Gaps = 5/161 (3%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            +H++FLP LA GH+IP+VD+A+ FA  GVK T +TTP+NA   S  I R +E G  I + 
Sbjct  5    IHMFFLPFLAHGHLIPVVDMAKMFASRGVKTTIVTTPVNALLFSNTIARSKESGIHIGVE  64

Query  243  LLEFPYKESGLPEGCEN-----LSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVA  407
            LL FP  + GLPEGCEN      S    LE    FF A    Q P E+L  E +PDC+VA
Sbjct  65   LLNFPAVDVGLPEGCENDDLIPTSQDGNLEMITKFFQASLMLQQPFEKLLQERKPDCLVA  124

Query  408  GPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
               + W+ D A KFGIPRL F G  +F +C    +  +KP+
Sbjct  125  DMFFHWATDAANKFGIPRLVFHGISYFSLCASECMSLYKPY  165



>ref|XP_007201773.1| hypothetical protein PRUPE_ppa017305mg [Prunus persica]
 gb|EMJ02972.1| hypothetical protein PRUPE_ppa017305mg [Prunus persica]
Length=498

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 96/164 (59%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            MD+Q+ P L ++F P +  GH+IPM+DLAR FA HGVKAT +TTP N       I R+++
Sbjct  1    MDSQAEPKLEIFFFPYILGGHLIPMIDLARLFASHGVKATIVTTPHNVLLFQSPILRDQK  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  I    L F  +E GLP GCEN   TT  +     F A    Q P+ +L  E RPDC
Sbjct  61   LGYDIGFHTLNFRSEEFGLPNGCENELTTTNGDMFIKLFMAAMKLQDPLGKLLCEIRPDC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +V+  LY W+ D     GIPR+ F GSG F  CV  SLRR+ PH
Sbjct  121  LVSDRLYPWTADVTDGLGIPRIVFDGSGCFSHCVEESLRRYAPH  164



>ref|XP_003518714.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
Length=487

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 107/166 (64%), Gaps = 3/166 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDR---E  212
            M  +   LHV+F+P LA GH+IP +D+A+ FA  G+K T +TTPLN   ISKAI +   E
Sbjct  1    MSNEVRSLHVFFIPFLAHGHIIPTIDMAKLFAGKGLKTTIITTPLNVPFISKAIGKAESE  60

Query  213  REFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRP  392
                + I I  +EFPY E+GLP+GCEN ++ T++    +FF AL   Q P E+L ++  P
Sbjct  61   SNDNNVIHIETIEFPYAEAGLPKGCENTNSITSMHLYPAFFKALGLLQHPFEQLLLQQHP  120

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +C+VA  ++ W+ + +AKFG+P L + G+ FF +C +   R ++P+
Sbjct  121  NCVVADVMFPWATNSSAKFGVPSLVYDGTSFFSICANECTRLYEPY  166



>ref|XP_007199033.1| hypothetical protein PRUPE_ppa018059mg [Prunus persica]
 gb|EMJ00232.1| hypothetical protein PRUPE_ppa018059mg [Prunus persica]
Length=769

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 105/164 (64%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+S   LH++F P +A GH IP++D+A+ FA  GVK+T +TTPLNA  +SKAI   + 
Sbjct  1    METKSHEQLHIFFFPYMAQGHSIPLIDIAKLFASRGVKSTLITTPLNAPLLSKAIQSSKN  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  I I ++ FP +E GLP GCE  S TTT E    FF A    +  IE++  + RP C
Sbjct  61   LGFDIEILVIIFPTEEVGLPPGCEIASMTTTHEMKEKFFKATFLLEPQIEQILDQHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA  L+ W+   AAKFGIPRL F G GFFP+C    ++ ++PH
Sbjct  121  LVADSLFPWATYVAAKFGIPRLIFHGPGFFPLCALLGVKLYEPH  164


 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +3

Query  330  FFNALDHFQGPIERLAVEDRPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNS  509
            FF A    +  +E++  + RP C++A  L+ W+ D AAKFGIPRL F G+GFFP+C   S
Sbjct  383  FFRATTLLRPQLEQILDQQRPHCLLADTLFPWATDVAAKFGIPRLIFHGTGFFPLCASLS  442

Query  510  LRRHKPH  530
            +  ++PH
Sbjct  443  VILYEPH  449



>gb|KJB63893.1| hypothetical protein B456_010G022300 [Gossypium raimondii]
Length=502

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 101/163 (62%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +    +H  F P +APGHM+PMVD+AR FA  G K T + T +NA +I   IDR+ + 
Sbjct  1    MGSDGNQIHAMFFPYMAPGHMMPMVDMARMFAAFGAKVTIIITTMNALRIKNVIDRDVKL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G  I++ ++  P  E GLPEGCEN+ +  T E +   F+A++  Q  I++L  +  PDCI
Sbjct  61   GRDITLEIISLPSTEVGLPEGCENVVSAPTPEMSIKLFHAIELLQPKIKKLFSDLHPDCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            V+  L  W+ D A + GI R++F GSGFF +C+  ++  ++PH
Sbjct  121  VSDSLCPWTLDIANELGIARIAFNGSGFFNLCLLENITLYEPH  163



>ref|XP_008373858.1| PREDICTED: anthocyanin 3'-O-beta-glucosyltransferase-like [Malus 
domestica]
Length=498

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 96/164 (59%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            MD+Q+ P L ++F P +  GH+IPM+DLAR FA HGVKAT +TTP N       I R+++
Sbjct  1    MDSQAEPKLEIFFFPYILGGHLIPMIDLARLFASHGVKATIVTTPHNVLLFQNPILRDQQ  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  I    L FP +E GLP GCEN   TT  +     F A    Q P+ +L  + RPDC
Sbjct  61   LGYDIGFLTLXFPAEEFGLPNGCENELTTTNGDMFTKLFMAAMKLQDPLRKLLSQTRPDC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +++  LY W  D     GIPR+ F GSG F  CV  SLRR+ PH
Sbjct  121  LISDRLYPWIADVTNGLGIPRVVFDGSGCFSHCVEESLRRYAPH  164



>gb|AFJ52949.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=473

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 102/158 (65%), Gaps = 1/158 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M++Q   LH+ FLP +A GHMIP++D+AR FARHG K+T +TTPLNA   S  + R+   
Sbjct  1    MNSQHQ-LHIIFLPFMAHGHMIPLLDMARHFARHGAKSTIITTPLNAPTFSDKVTRDARL  59

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I   ++EF    +GLPEGCEN++   + E  F+FF ++D FQ P+  L V+ RPD I
Sbjct  60   GLRIQTHIIEFDPVATGLPEGCENVNLIESPEMLFTFFKSMDAFQEPVRDLLVQWRPDAI  119

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLR  515
            VA   + W+ + A   GIPRL F G+G F +C+   L+
Sbjct  120  VADFAFHWATETAHGLGIPRLFFNGTGSFAMCLFERLK  157



>ref|XP_011013100.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=485

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 99/167 (59%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +    LH +F P LA GH+IP VD+A+ FA  GVK T +TTPLNA   SK I + ++ 
Sbjct  1    MGSSGNQLHFFFFPFLAHGHLIPTVDMAKLFASRGVKTTIITTPLNAPFFSKTIQKTKDL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQ----TFSFFNALDHFQGPIERLAVEDR  389
            G  I I+ ++FP  E+GLPEGCEN  A  T E     T  FF A    Q P E++  E  
Sbjct  61   GFDIDIQTIKFPAAEAGLPEGCENTDAFITNENAGEMTKKFFIATTFLQEPFEKVLQERH  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDC+VA   + W+ D AAKFGIPRL F G+  F +     +R ++PH
Sbjct  121  PDCVVADMFFPWATDAAAKFGIPRLVFHGTSNFALSAGECVRLYEPH  167



>ref|XP_010672458.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Beta vulgaris subsp. vulgaris]
Length=492

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 7/157 (4%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARH-GVKATFLTTPLNAAKISKAIDREREFGSQISI  239
            LH+ FLP +APGH++PMVD+AR FA     KAT +TTP NAA+      R+      ++I
Sbjct  13   LHIIFLPYMAPGHLMPMVDIARVFANQPNTKATIITTPANAARFHSTTSRD------VAI  66

Query  240  RLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLY  419
              +  P KE GLPEGCENL +T T E TF  F A++     +E + +E+ PDCIV+  LY
Sbjct  67   LNVSLPLKEVGLPEGCENLVSTPTRETTFKLFKAIEMLHPKLEIMLLENNPDCIVSDYLY  126

Query  420  TWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             W+ D A K GIPRL+F G  FF  CV  +L +++PH
Sbjct  127  PWTVDVAHKLGIPRLAFSGGCFFNNCVCFNLEKYRPH  163



>ref|XP_010107893.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
 gb|EXC17293.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
Length=484

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = +3

Query  48   TQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGS  227
            T++  LH++F P LA G  IP +D+A  FA  G K T + TP+NA+  +K I+R R  G 
Sbjct  4    TKTSQLHIFFFPYLAHGRTIPALDIANLFASRGFKTTIILTPVNASIYAKTIERSRNLGL  63

Query  228  QISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVA  407
            QI + L++FP +E  LP+GCE     TT E   +F  A    + P+E+L  E RPDC+VA
Sbjct  64   QIRVLLIKFPAEEFRLPKGCEIARLATTNEMLATFHTATIRLEHPLEQLIAEHRPDCLVA  123

Query  408  GPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
              L+TW+   AA+FGI RL F G+ FF +C   S+ +++PH
Sbjct  124  DSLFTWATRVAARFGITRLEFDGTNFFSMCASMSMNKYQPH  164



>ref|XP_008236496.1| PREDICTED: abscisate beta-glucosyltransferase-like [Prunus mume]
Length=498

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 95/164 (58%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            MD+Q+ P L ++F P +  G +IPM+DLAR FA HGVKAT +TTP N       I R+++
Sbjct  1    MDSQAEPKLEIFFFPYILGGRLIPMIDLARLFASHGVKATIVTTPHNVLLFQNPILRDQK  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  I    L F  +E GLP GCEN   TT  +     F A    Q P+ +L  E RPDC
Sbjct  61   LGYDIGFHTLNFRSEEFGLPNGCENELTTTNGDMFIKLFMAAMKLQDPLGKLLCETRPDC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +V+  LY W+ D     GIPR+ F GSG F  CV  SLRR+ PH
Sbjct  121  LVSDSLYPWTADVTDGLGIPRIVFDGSGCFSHCVEESLRRYAPH  164



>ref|XP_009762300.1| PREDICTED: LOW QUALITY PROTEIN: scopoletin glucosyltransferase-like 
[Nicotiana sylvestris]
Length=376

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 98/155 (63%), Gaps = 0/155 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH +F PL+A GHMIP +D+A+  A  GVKAT +TTPLN +  SKAI R ++ G +I IR
Sbjct  4    LHFFFFPLMAHGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKAIQRSKQVGIEIDIR  63

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L++F   E+GLPEGCE +    + +   +F  A    Q P E+L  E RPDC+V+     
Sbjct  64   LIKFQAVENGLPEGCERIDLIPSDDLINNFSTATTMMQKPFEQLLQERRPDCLVSDMFLP  123

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W++D A  F IPRL F G+ +F +C  +S+R + P
Sbjct  124  WTSDSADXFNIPRLVFHGTSYFALCAADSIRHYMP  158



>ref|XP_009772759.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana sylvestris]
Length=479

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 97/155 (63%), Gaps = 0/155 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH +F P++A GHMIP +D+A+  A  GVKAT +TTPLN +  SKAI R +  G +I IR
Sbjct  4    LHFFFFPMMAHGHMIPTLDMAKLVALRGVKATIITTPLNESVFSKAIQRNKNLGIEIDIR  63

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L++F   E GL E CE L    + +   +FF A    Q P+E L  E RP+C+V+   + 
Sbjct  64   LIKFQAVEHGLHEECERLDLIPSDDLLLNFFKATVMMQEPLEHLIQECRPNCLVSDIFFP  123

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W+ D AAKF IPRL+  G+ FF +C   S+R HKP
Sbjct  124  WTIDTAAKFNIPRLAIHGTSFFALCAGESIRLHKP  158



>gb|KHN12230.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Glycine soja]
Length=207

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 96/156 (62%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P  A GH+IP +D+A+ FA  GVKAT +TTPLNA  ISKAI + +   ++I I+
Sbjct  9    LHIFFFPFFAHGHVIPTLDMAKLFAEKGVKATIVTTPLNAPFISKAIGKSKTKHNRIHIQ  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             +E P  E+ LP+ CEN  + T+ +   SF  A    Q P E+L  +  PDCIVA   + 
Sbjct  69   TIELPCAEAVLPDSCENTDSITSQDLFESFCMATCFLQEPFEQLIEKQHPDCIVADMFFP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D AAKFGIPRL F G  F  +C  + +  +K H
Sbjct  129  WATDSAAKFGIPRLVFHGYSFISLCATSCMELYKSH  164



>gb|AFJ52948.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=473

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 97/151 (64%), Gaps = 0/151 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH+ FLP +A GHMIP++D+AR FARHG K+T +TTPLNA   S  I R+   G QI   
Sbjct  7    LHIIFLPFMAHGHMIPLLDMARHFARHGAKSTIITTPLNAPTFSDKITRDARLGLQIQTH  66

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            ++EF    +GLP+GCEN+++  + +  F+FF ++D FQ P+  L V+ RPD IVA   + 
Sbjct  67   IIEFDPVLTGLPKGCENVNSIESPDMLFAFFKSMDAFQAPVRDLLVKWRPDAIVADFAFH  126

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLR  515
            W+ + A   GIPRL F G G F  C+   L+
Sbjct  127  WATETAHGLGIPRLFFNGMGSFATCLFERLK  157



>ref|XP_003518710.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Glycine max]
Length=475

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 101/164 (62%), Gaps = 6/164 (4%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  ++  LHV F P  A GH+IP +DLAR FA  G+K T +TTPLN   IS+ I +    
Sbjct  1    MGNENRELHVLFFPFPANGHIIPSIDLARVFASRGIKTTVVTTPLNVPLISRTIGK----  56

Query  222  GSQISIRLLEFP-YKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             + I I+ ++FP ++E+GLPEGCEN  +  + +   +F  A    + P+E L  ++ PDC
Sbjct  57   -ANIKIKTIKFPSHEETGLPEGCENSDSALSSDLIMTFLKATVLLRDPLENLMQQEHPDC  115

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            ++A   Y W+ D AAKFGIPR+ F G GFFP CV   +R +KP 
Sbjct  116  VIADMFYPWATDSAAKFGIPRVVFHGMGFFPTCVSACVRTYKPQ  159



>ref|XP_008375155.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=474

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 103/164 (63%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+S   LH++F P +A GH IP++++A+ FA  G K+T +TTPLNA   SK I   ++
Sbjct  1    METKSHEQLHIFFFPYMAQGHFIPLINMAKLFASRGEKSTLITTPLNAPLFSKEIQSSKK  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  + I +++FP +E GLP+GCEN +  TT E    F  A    Q  IE++  E RP C
Sbjct  61   LGFDVEIFVIKFPTEEVGLPQGCENANLATTREMKEKFIKATFLLQPQIEQILDEHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D AAKFG+PR+ F G GFF +C   S+  ++PH
Sbjct  121  LVADVFFPWATDVAAKFGVPRIIFHGIGFFAMCASLSVALYEPH  164



>ref|XP_002298739.2| hypothetical protein POPTR_0001s30970g [Populus trichocarpa]
 gb|EEE83544.2| hypothetical protein POPTR_0001s30970g [Populus trichocarpa]
Length=460

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 95/137 (69%), Gaps = 0/137 (0%)
 Frame = +3

Query  120  LARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIRLLEFPYKESGLPEGCENLS  299
            +AR FARHGVKAT +TTPLNA   S+ I+R+ + GS+I I +++FP  E+GLPEGCEN S
Sbjct  1    MARTFARHGVKATIITTPLNAPLFSRKIERDIDMGSKICILIMKFPSAEAGLPEGCENAS  60

Query  300  ATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYTWSNDFAAKFGIPRLSFWGS  479
            +  TLE    F  A+   Q P+E L  E RP+C+VA  ++ W+   A+KFGIPRL F G+
Sbjct  61   SIKTLEMVPKFLKAVSLLQQPLEYLLEECRPNCLVADMMFPWATKVASKFGIPRLVFHGT  120

Query  480  GFFPVCVHNSLRRHKPH  530
             +F +CV + L+R +P+
Sbjct  121  SYFALCVSDCLKRFEPY  137



>emb|CAB56231.1| betanidin-5-O-glucosyltransferase [Cleretum bellidiforme]
Length=489

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 100/162 (62%), Gaps = 1/162 (1%)
 Frame = +3

Query  48   TQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE-FG  224
            + +P LHV F P LA GHMIP +D+A+ FA  GVK T +TTPLNA+  +KAI++ R+   
Sbjct  5    STAPDLHVVFFPFLAHGHMIPSLDIAKLFAARGVKTTIITTPLNASMFTKAIEKTRKNTE  64

Query  225  SQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIV  404
            +Q+ I +  FP +E+GLP GCENL     +     FFNA +  +  +E   V+ RP+C+V
Sbjct  65   TQMEIEVFSFPSEEAGLPLGCENLEQAMAIGANNEFFNAANLLKEQLENFLVKTRPNCLV  124

Query  405  AGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            A   +TW+ D  AKF IP L F G  FF  C    + R+KP+
Sbjct  125  ADMFFTWAADSTAKFNIPTLVFHGFSFFAQCAKEVMWRYKPY  166



>gb|AFJ52930.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=495

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 101/161 (63%), Gaps = 5/161 (3%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE-FGSQISI  239
            LHV+F P LA GHMIP +D+A+ FA  GVK T +TTPLN    SK I +  E  GS+I I
Sbjct  13   LHVFFFPFLAHGHMIPAIDMAKIFASRGVKVTIVTTPLNVPFFSKTISKHSESTGSEIRI  72

Query  240  RLLEFPYKESGLPEGCENLSATTTLE---QTFS-FFNALDHFQGPIERLAVEDRPDCIVA  407
            R L+FP  E  LPEGCEN    T+L    +TFS F  A    Q  +E+L  E RPDC+VA
Sbjct  73   RTLKFPTAEFRLPEGCENTEVITSLNLGWETFSKFLLASTKLQESLEKLLEEARPDCLVA  132

Query  408  GPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
               + W+ D + KFGIPRL F G+ FF + V + + R++PH
Sbjct  133  DMFFPWATDSSEKFGIPRLLFHGTSFFSLSVMDVVSRYEPH  173



>gb|ADV71369.1| glycosyltransferase GT14A05 [Pueraria montana var. lobata]
Length=475

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  ++  LHV+F P  A GH+IP +DLAR FA  G++ T +TTPLN   IS+ I +    
Sbjct  1    MGNENRELHVFFFPFPANGHIIPSIDLARVFASRGIRTTVVTTPLNEPLISRTIGK----  56

Query  222  GSQISIRLLEFPYKE-SGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             + I IR ++FP  E +GLPEGCEN  +  + +   +F  A    + P+E L  +++PDC
Sbjct  57   -ANIKIRTIKFPSPEQTGLPEGCENSDSALSPDMIMAFLKATVLLRDPLEHLMEQEKPDC  115

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            I+A   + W+ D AAKFGIPR+ F G GFFP CV   +R++KP 
Sbjct  116  IIADMFFPWATDSAAKFGIPRIVFHGMGFFPTCVSACVRQYKPQ  159



>ref|XP_008354700.1| PREDICTED: scopoletin glucosyltransferase-like [Malus domestica]
Length=481

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 104/164 (63%), Gaps = 2/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +++   H+ F P +A GHMIP+ D+A+ FA  GVK T +TTPLNA   S A    + +
Sbjct  1    MGSKNRDFHICFFPYMAHGHMIPISDMAKLFASQGVKTTIVTTPLNAPTFSXATQSSKTY  60

Query  222  --GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPD  395
              G ++ I+ ++FP  E+GLPEGCENL +  + E + +F  A    Q P+E+L  E+ P 
Sbjct  61   SGGXEVKIKTIKFPSVEAGLPEGCENLDSLPSPELSTNFLKATSFLQEPLEQLLFEENPS  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            C+VA  L+ W+ D AAKF IPRL F G+GFF +   + +R+++P
Sbjct  121  CLVADVLFPWATDAAAKFDIPRLIFHGTGFFAMAASHVVRKYEP  164



>ref|XP_003533678.1| PREDICTED: soyasapogenol B glucuronide galactosyltransferase-like 
[Glycine max]
Length=495

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 97/164 (59%), Gaps = 0/164 (0%)
 Frame = +3

Query  39   KMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            K D  +  L++ FLP L+PGH+ PMVD AR FARHG   T +TTP NA    KAID +  
Sbjct  2    KTDLHANQLNLIFLPYLSPGHLNPMVDTARLFARHGASVTIITTPANALTFQKAIDSDFN  61

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  I  +++ FP  + GLP+G ENL   T+LE        +   QG IE L  + +PDC
Sbjct  62   CGYHIRTQVVPFPSAQLGLPDGAENLKDGTSLEILGKIMYGISMLQGQIEPLFQDLQPDC  121

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +V   LY W+ + AAK GIPRL F+ + +F  C    +R+HKPH
Sbjct  122  LVTDVLYPWTVESAAKLGIPRLYFYSASYFASCATYFIRKHKPH  165



>gb|KCW64673.1| hypothetical protein EUGRSUZ_G02259 [Eucalyptus grandis]
Length=498

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 98/156 (63%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            L ++F P +A GH++P +D+A+ FA  G+KAT +TTPLNA   ++ I R ++ G++I ++
Sbjct  9    LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVK  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             ++FP  E+GLP GCENL +  + E    F  A +  + P+E L  ED PDC+VA   + 
Sbjct  69   TVDFPSVEAGLPPGCENLDSVASQEMLLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A + G+PR+ F G  FF +C    +  H+PH
Sbjct  129  WATDVAQRLGVPRMVFHGMSFFALCATACVMLHEPH  164



>ref|XP_010066692.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=505

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 98/156 (63%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            L ++F P +A GH++P +D+A+ FA  G+KAT +TTPLNA   ++ I R ++ G++I ++
Sbjct  16   LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVK  75

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             ++FP  E+GLP GCENL +  + E    F  A +  + P+E L  ED PDC+VA   + 
Sbjct  76   TVDFPSVEAGLPPGCENLDSVASQEMLLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  135

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A + G+PR+ F G  FF +C    +  H+PH
Sbjct  136  WATDVAQRLGVPRMVFHGMSFFALCATACVMLHEPH  171



>ref|XP_009354713.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Pyrus x bretschneideri]
Length=475

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 103/164 (63%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+S   LH++F P +  GH IP++++A+ FA  GVK+T +TTPLNA   SK I   ++
Sbjct  1    METKSHEQLHIFFFPYMIQGHFIPLINMAKLFASRGVKSTLITTPLNAPLFSKEIQSSKK  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  + I +++FP +E GLP+GCEN +  TT E    F  A    Q  IE++  + RP C
Sbjct  61   LGFDVEILVIKFPTEEVGLPQGCENGNLATTSEMNEKFIKATFLLQPQIEQILDKHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D AAKFGIPR+ F G GFF +C   S+  ++PH
Sbjct  121  LVADVFFPWATDVAAKFGIPRIIFHGIGFFALCASLSVALYEPH  164



>ref|XP_008236556.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Prunus mume]
Length=481

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 103/164 (63%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+S   LH++F P +A GH IP++D+A+ FA  GVK+T +TT LNA  +SKAI   + 
Sbjct  1    METKSHEQLHIFFFPYMAQGHSIPLIDIAKLFASRGVKSTLITTTLNAPLLSKAIQSSKN  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G +I I +++FP  E GLP+G E  S  TT E    FF A    +  IE++  + RP C
Sbjct  61   LGFEIEILVIQFPAIEVGLPQGFEITSMATTHEMKEKFFQATFLLEPQIEQILDQHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D A KFGIPRL F+G GF P+C   S+  ++PH
Sbjct  121  LVADSFFPWATDVAGKFGIPRLIFYGPGFLPMCASLSVILYEPH  164



>dbj|BAG80550.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=475

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISI-  239
            LH +  P++A GHMIP +D+A+  A  GVKAT +TTPLN +  SKAI R ++ G +I I 
Sbjct  4    LHFFLFPMMAQGHMIPTLDMAKLIASRGVKATIITTPLNESVFSKAIQRNKQLGIEIEIE  63

Query  240  -RLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPL  416
             RL++FP  E+ LPE CE L    T     +FF A    Q P+E+L  E RPDC+V+   
Sbjct  64   IRLIKFPALENDLPEDCERLDLIPTEAHLPNFFKAAAMMQEPLEQLIQECRPDCLVSDMF  123

Query  417  YTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
              W+ D AAKF IPR+ F G+ +F +CV +S+RR+KP
Sbjct  124  LPWTTDTAAKFNIPRIVFHGTNYFALCVGDSMRRNKP  160



>dbj|BAG80536.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=477

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISI-  239
            LH +  P++A GHMIP +D+A+  A  GVKAT +TTPLN +  SKAI R ++ G +I I 
Sbjct  4    LHFFLFPMMAQGHMIPTLDMAKLIASRGVKATIITTPLNESVFSKAIQRNKQLGIEIEIE  63

Query  240  -RLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPL  416
             RL++FP  E+ LPE CE L    T     +FF A    Q P+E+L  E RPDC+V+   
Sbjct  64   IRLIKFPALENDLPEDCERLDLIPTEAHLPNFFKAAAMMQEPLEQLIQECRPDCLVSDMF  123

Query  417  YTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
              W+ D AAKF IPR+ F G+ +F +CV +S+RR+KP
Sbjct  124  LPWTTDTAAKFNIPRIVFHGTNYFALCVGDSMRRNKP  160



>gb|KCW63754.1| hypothetical protein EUGRSUZ_G01414 [Eucalyptus grandis]
Length=498

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 99/156 (63%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            L ++F P +A GH++P +D+A+ FA  G+KAT +TTPLNA   ++ + R ++ G++I ++
Sbjct  9    LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTVQRIQKLGAKIDVK  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             + FP  E+GLP GCE+L +  + E    F  A +  + P+E L  ED PDC+VA   + 
Sbjct  69   TVNFPSVEAGLPPGCESLDSVASQEMFLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A + G+PR+ F G+ FF +C    +R H+PH
Sbjct  129  WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPH  164



>gb|ACJ72160.1| UGT3 [Pueraria montana var. lobata]
Length=475

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  ++  LHV+F P  A GH+IP +DLAR FA  G++ T +TTPLN   IS+ I +    
Sbjct  1    MGNENRELHVFFFPFPANGHIIPSIDLARVFASRGIRTTVVTTPLNEPLISRTIGK----  56

Query  222  GSQISIRLLEFPYKE-SGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             + + IR ++FP  E +GLPEGCEN  +  + +   +F  A    + P+E L  +++PDC
Sbjct  57   -ANVKIRTIKFPSPEQTGLPEGCENSDSALSPDMIMAFLKATVLLRDPLEHLMEQEKPDC  115

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            I+A   + W+ D AAKFGIPR+ F G GFFP CV   +R++KP 
Sbjct  116  IIADMFFPWATDSAAKFGIPRIVFHGMGFFPTCVSACVRQYKPQ  159



>ref|XP_010066838.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=505

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 97/156 (62%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            L ++F P +A GH++P +D+A+ FA  G+KAT +TTPLNA   ++ I R ++ G++I ++
Sbjct  16   LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVQ  75

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             + FP  E+GL  GCENL    + E    F  A +  + P+E L  ED PDC+VA   + 
Sbjct  76   TVNFPSVEAGLSPGCENLDLVASQEMFLKFIKATEMLKQPLEELLSEDPPDCLVADMFFP  135

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A + G+PR+ F G+ FF +C    +R H+PH
Sbjct  136  WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPH  171



>gb|KCW64874.1| hypothetical protein EUGRSUZ_G02440 [Eucalyptus grandis]
Length=498

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 97/156 (62%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            L ++F P +A GH++P +D+A+ FA  G+KAT +TTPLNA   ++ I R ++ G++I ++
Sbjct  9    LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTIQRTQKLGAKIDVQ  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             + FP  E+GL  GCENL    + E    F  A +  + P+E L  ED PDC+VA   + 
Sbjct  69   TVNFPSVEAGLSPGCENLDLVASQEMFLKFIKATEMLKQPLEELLSEDPPDCLVADMFFP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A + G+PR+ F G+ FF +C    +R H+PH
Sbjct  129  WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPH  164



>ref|XP_006369755.1| hypothetical protein POPTR_0001s31040g [Populus trichocarpa]
 gb|ERP66324.1| hypothetical protein POPTR_0001s31040g [Populus trichocarpa]
Length=485

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 97/167 (58%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +    LH++FLP  A GHMIP VD+A+ FA  G+K T +TTPLNA   SK I + +E 
Sbjct  1    MGSLGHQLHIFFLPFFAHGHMIPSVDMAKLFASRGIKTTIITTPLNAPFFSKTIQKTKEL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSA----TTTLEQTFSFFNALDHFQGPIERLAVEDR  389
            G  I+I  ++FP  E+GLPEG EN  A        E T  F  A    Q P E++  E  
Sbjct  61   GFDINILTIKFPAAEAGLPEGYENTDAFIFSENAREMTIKFIKATTFLQAPFEKVLQECH  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDCIVA   + W+ D AAKFGIPRL F G+  F +     +R ++PH
Sbjct  121  PDCIVADVFFPWATDAAAKFGIPRLVFHGTSNFALSASECVRLYEPH  167



>gb|AFJ52945.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=492

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 98/159 (62%), Gaps = 0/159 (0%)
 Frame = +3

Query  51   QSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQ  230
            +S  L V F P +A GHMIP+VD+AR FAR GVK+T +TTPLNA   S  I R+ + G Q
Sbjct  2    ESKQLQVVFFPFMAQGHMIPLVDMARLFARRGVKSTIITTPLNAPLFSDKIKRDADQGLQ  61

Query  231  ISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAG  410
            I   +++FP+ E+GLPEGCEN++   + +    FF ++  F+ P+E L    +PDC VA 
Sbjct  62   IQTHIIDFPFLEAGLPEGCENVNTIKSADMLLPFFMSMHAFKKPVEELLELWKPDCFVAD  121

Query  411  PLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
              + W  + A   GIPRL F G+  F +C+ +   R +P
Sbjct  122  LFFHWGTESAHSLGIPRLFFNGTSSFAICLMHCFTRQEP  160



>ref|XP_008375157.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Malus domestica]
Length=477

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 101/164 (62%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+S   LH++F P +  GH +P++++AR FA  GVK+T + TPLN    SKAI   ++
Sbjct  1    METKSHKQLHIFFFPYMVQGHFVPLINIARLFASRGVKSTLIATPLNEPLFSKAIQSSKK  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  + I +++FP +E GLP+GCEN S  TT E    F  A    Q  IE++  + RP C
Sbjct  61   LGFDVDILVIKFPAEEVGLPQGCENASLVTTTEMNEKFIKATFLLQPQIEQILDKHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ + AAKF IPR+ F G GFF +C   S+  ++PH
Sbjct  121  LVADTFFPWATEVAAKFDIPRIIFHGMGFFALCASRSVALYEPH  164



>ref|XP_004304024.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=483

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 107/165 (65%), Gaps = 2/165 (1%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFA-RHGVKATFLTTPLNAAKISKAIDRER  215
            M+T++   LH++FLP +  GH +P++D+A+ FA R GVK+T +TTP+NA   S +I+  +
Sbjct  1    METKTHRQLHIFFLPYMVQGHTLPLLDIAKLFASRSGVKSTIITTPVNAPLFSNSIETSK  60

Query  216  EFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPD  395
              G +I + +++FP  E GLP+G EN+    T E    F+ A+   +  +E+L  + RP 
Sbjct  61   SSGFEIELVIIKFPSTEVGLPDGIENMKLVKTQETKEKFYKAITALEHQVEQLLDQHRPH  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            C+VA  L+ W+ + AAKFGIPRL F G GFFP+C   S+  ++PH
Sbjct  121  CLVASTLFHWATNVAAKFGIPRLIFHGPGFFPLCAARSVTLYQPH  165



>ref|XP_010066005.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=495

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 99/156 (63%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            L ++F P +A GH++P +D+A+ FA  G+KAT +TTPLNA   ++ + R ++ G++I ++
Sbjct  16   LRIFFFPFMAYGHILPTIDMAKLFASRGLKATIITTPLNAPIFAQTVQRIQKLGAKIDVK  75

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             + FP  E+GLP GCE+L +  + E    F  A +  + P+E L  ED PDC+VA   + 
Sbjct  76   TVNFPSVEAGLPPGCESLDSVASQEMFLKFIKATEMLKQPLEDLLSEDPPDCLVADMFFP  135

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A + G+PR+ F G+ FF +C    +R H+PH
Sbjct  136  WATDVAQRLGVPRMVFHGTSFFALCATECVRLHEPH  171



>ref|XP_006422965.1| hypothetical protein CICLE_v10030025mg [Citrus clementina]
 gb|ESR36205.1| hypothetical protein CICLE_v10030025mg [Citrus clementina]
Length=218

 Score =   141 bits (355),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 1/157 (1%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F PL+A GHMIP+VD+A+ F   GVK T +TTP NA   SKAI R  E G +I I+
Sbjct  8    LHIFFFPLMAHGHMIPLVDMAKLFGSRGVKTTVITTPANATLFSKAIPRANELGIEIDIK  67

Query  243  LLEFPYKESGLPEGCENLSATTTL-EQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLY  419
             ++FP  E GLPEG ENL+  T+  +    F   +   Q P+E L  E +P+C+VA  L+
Sbjct  68   TIKFPSVEVGLPEGSENLNEMTSQPDMPVKFLKGVTMLQEPLELLLQEHKPNCLVADMLF  127

Query  420  TWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             W+ D AAKFGIPRL F G+ F  +C    L  ++PH
Sbjct  128  PWATDAAAKFGIPRLVFHGTSFLSLCATACLMLYEPH  164



>gb|KDP24997.1| hypothetical protein JCGZ_23980 [Jatropha curcas]
Length=483

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 103/165 (62%), Gaps = 2/165 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD++S  LH++  PLLAPGHM+PM+D+AR FA  GVK T +TTP+NA + +K+I +  + 
Sbjct  1    MDSESNQLHIFLFPLLAPGHMLPMLDIARLFAARGVKTTIITTPVNAPRFTKSIQKIPDL  60

Query  222  GSQ--ISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPD  395
             +   I+++ + FP +++GLPEG ENL   +  E    FF+AL   Q P+E    E  P 
Sbjct  61   ATTQLINLKAINFPSEKAGLPEGLENLDLVSNQETHSRFFDALSLLQEPLEEAIKELHPQ  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             IVA   + W+ D A K+ IPRL F G+ F  +C   S+  ++PH
Sbjct  121  AIVADLFFPWTTDLALKYAIPRLIFHGTSFISMCCMASIAINQPH  165



>emb|CAA59450.1| twi1 [Solanum lycopersicum]
Length=466

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 97/154 (63%), Gaps = 0/154 (0%)
 Frame = +3

Query  66   HVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIRL  245
            H +F P  A GHMIP +D+A   A  GVKAT +TTPLN +  SKAI+R +  G +I IRL
Sbjct  1    HFFFFPDDAQGHMIPTLDMANVVACRGVKATIITTPLNESVFSKAIERNKHLGIEIDIRL  60

Query  246  LEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYTW  425
            L+FP KE+ LPE CE L    + ++  +F  A    +   E L  E RPDC+V+     W
Sbjct  61   LKFPAKENDLPEDCERLDLVPSDDKLPNFLKAAAMMKDEFEELIGECRPDCLVSDMFLPW  120

Query  426  SNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            + D AAKF IPR+ F G+ +F +CV +++RR+KP
Sbjct  121  TTDSAAKFSIPRIVFHGTSYFALCVGDTIRRNKP  154



>ref|XP_002518719.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43644.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=480

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 101/163 (62%), Gaps = 1/163 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M T+S  LH++  PL+A GH +P +DLAR FA+ G K T +TTP NA +I+  I   ++ 
Sbjct  1    MVTESDQLHIFLFPLMASGHTLPFLDLARLFAQRGAKITIITTPANAPRIT-TIQTTKDS  59

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
             +QIS++++ FP KE+GLPEG E+L   +  +    FF AL   Q P+E+   E  P  I
Sbjct  60   AAQISLKIINFPSKEAGLPEGIESLDMLSDYQLRGKFFAALTLLQEPLEQAIQELNPHAI  119

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   + W+ D AAK+GIPRL F  S FF +C   +L  H+PH
Sbjct  120  VADVFFPWATDLAAKYGIPRLIFQISSFFSLCCFANLEEHQPH  162



>dbj|BAO51837.1| UDP-glycosyltransferase 73A17 [Camellia sinensis]
Length=473

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH +F P++A GHMIP +D+A+ FA HGVKAT +TTPLNA   +++I R       IS+ 
Sbjct  4    LHFFFFPVMAQGHMIPTLDMAKLFASHGVKATIITTPLNAPYFTRSIQRTHH---SISVL  60

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             L+FP  E+GL EGCE++    + +   +F  A    Q P+ERL  + RPDC+VA   + 
Sbjct  61   TLKFPAVEAGLVEGCESVDQIPSPDMLPNFLKATTMLQDPLERLLQDSRPDCLVADMFFP  120

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+   AAKF IPRL F G+GFF +C   +LR + P 
Sbjct  121  WATHVAAKFNIPRLVFHGTGFFTLCASENLRLYMPQ  156



>gb|KHN40682.1| UDP-glycosyltransferase 73B4 [Glycine soja]
Length=498

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 99/165 (60%), Gaps = 2/165 (1%)
 Frame = +3

Query  42   MDTQSPP--LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRER  215
            M T+S P  L+V FLP  APGHM PMVD AR FA+HGV  T +TTP N     KAI  + 
Sbjct  1    MKTESQPQQLNVIFLPYPAPGHMNPMVDTARLFAKHGVGVTIITTPANDLTFQKAIYSDF  60

Query  216  EFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPD  395
              G+ I  R+++FP  + GLP+G EN+   T+ E        L   + PIE L  E +PD
Sbjct  61   SCGNCIKTRVIQFPASQVGLPDGVENVKNVTSREMLDKISLGLLILKDPIELLFQEMQPD  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            CIV   LY W+ + AAK GIPRL F+ S +F  C  + +R+HKPH
Sbjct  121  CIVTDMLYPWTVESAAKLGIPRLYFYSSSYFTSCAGHFVRKHKPH  165



>ref|XP_003551588.1| PREDICTED: soyasapogenol B glucuronide galactosyltransferase-like 
[Glycine max]
Length=498

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 99/165 (60%), Gaps = 2/165 (1%)
 Frame = +3

Query  42   MDTQSPP--LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRER  215
            M T+S P  L+V FLP  APGHM PMVD AR FA+HGV  T +TTP N     KAI  + 
Sbjct  1    MKTESQPQQLNVIFLPYPAPGHMNPMVDTARLFAKHGVGVTIITTPANDLTFQKAIYSDF  60

Query  216  EFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPD  395
              G+ I  R+++FP  + GLP+G EN+   T+ E        L   + PIE L  E +PD
Sbjct  61   SCGNCIKTRVIQFPASQVGLPDGVENVKNVTSREMLDKISLGLLILKDPIELLFQEMQPD  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            CIV   LY W+ + AAK GIPRL F+ S +F  C  + +R+HKPH
Sbjct  121  CIVTDMLYPWTVESAAKLGIPRLYFYSSSYFTSCAGHFVRKHKPH  165



>ref|XP_007011136.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
 gb|EOY19946.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
Length=482

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 95/163 (58%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  Q+  L ++FLP +A GHMIP +DLA  FA  GVK T +TT LN   ISK  +R +  
Sbjct  1    MSCQNRQLQIFFLPFMAQGHMIPFIDLAMLFAAKGVKTTIITTTLNVPHISKVTERAKNL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I+I +  FP  E+GLPEGCE+    ++ +  F FF A    + P+  L    RPDC+
Sbjct  61   GYEINILVTYFPSVEAGLPEGCESYDQASSPDMQFKFFTATTMLREPLAHLLQAHRPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   + W  D AA FGIPR+ F G+  F +     +R ++PH
Sbjct  121  VADTFFPWVTDVAAAFGIPRIVFHGTCVFSLSATEHIRLYEPH  163



>ref|XP_004252755.1| PREDICTED: scopoletin glucosyltransferase-like isoform X1 [Solanum 
lycopersicum]
Length=489

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 92/156 (59%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LHV F+P   P HMIP+VD+AR FA HGVK + +TTP NA     +ID   E G +IS+ 
Sbjct  9    LHVVFIPYFTPSHMIPLVDIARLFASHGVKVSIITTPYNALLFESSIDHATELGHEISVH  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             L+FP  E GL EG EN SA T+ E   S F  +   Q P+E L  E RP CIV+  L  
Sbjct  69   KLKFPSDEVGLAEGIENFSAATSQEMAISVFMGIPLLQKPMESLIFELRPHCIVSDLLLP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A +  IPRL+F+ +     CV + L+ + PH
Sbjct  129  WTVDVAEQLKIPRLAFYPTNVMYHCVEHCLKLYTPH  164



>ref|XP_004252827.2| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Solanum lycopersicum]
Length=395

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 91/156 (58%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LHV F+P L P HMIP+VD +R FA HGVK + +TTP NA     +ID   E G +I + 
Sbjct  9    LHVVFIPYLTPSHMIPLVDTSRLFASHGVKVSIITTPYNALLFESSIDHATELGHEIFVH  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             L+FP  E GL EG EN S TT+ E     F  +D  Q P+E L  E RP CIV+  L  
Sbjct  69   KLKFPSDEVGLAEGIENFSVTTSQEMAIGVFMGIDLLQKPMESLIFELRPHCIVSDLLLP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A +  IPRL+F+ +     CV + L+ + PH
Sbjct  129  WTVDVAEQLKIPRLAFYPTNVMYHCVEHCLKMYTPH  164



>ref|XP_002518721.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43646.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=475

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH+   PL+A GHM+P++D+AR F+  GVK TF+TTP NA ++ ++        +QIS +
Sbjct  10   LHILLFPLMAQGHMLPLLDIARLFSSRGVKITFITTPGNAPRLKRSSQT-----TQISFK  64

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            +++FP KE+GLPEG ENL   + L+    FFNAL  FQ P+E++  E  P  IV+   + 
Sbjct  65   IIKFPSKEAGLPEGLENLDLISDLQTHIKFFNALSLFQEPLEQVLQELHPHGIVSDVFFP  124

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A K+GIPRL F G+ FF +C   +L  H+PH
Sbjct  125  WTADAALKYGIPRLIFNGASFFYMCCLANLEEHQPH  160



>ref|XP_007201142.1| hypothetical protein PRUPE_ppa016033mg [Prunus persica]
 gb|EMJ02341.1| hypothetical protein PRUPE_ppa016033mg [Prunus persica]
Length=474

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 93/157 (59%), Gaps = 0/157 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD ++   H++  P +APGHMIP + +A+ FA  G+K T ++TP N A  SK I+R +  
Sbjct  1    MDIKAKQSHIFLFPYMAPGHMIPTIAMAKLFASRGIKTTIISTPKNVAAFSKTIERSKAL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I + LL+FP  E GLPEGCE      TLE+   F  A       +E+L  E +P+C+
Sbjct  61   GFEIGVLLLKFPSVEVGLPEGCECGHMVETLEELQKFLKATSLLDQQLEKLLEEHQPNCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSL  512
            VA   + W+ D AAKFGIPRL F G  F  +C+   L
Sbjct  121  VADNCFPWTTDLAAKFGIPRLVFHGINFISLCISQHL  157



>gb|AFK37676.1| unknown [Lotus japonicus]
Length=491

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 97/160 (61%), Gaps = 4/160 (3%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFA-RHGVKATFLTTPLNAAKISKAIDRERE---FGSQ  230
            LH+ F P L  GHMIPM D+A  FA R GV+AT +TTPLNA  IS+ I    E     + 
Sbjct  5    LHILFFPFLGHGHMIPMSDMATLFATRRGVRATIVTTPLNAPTISRTIQEGGEDEGTHAN  64

Query  231  ISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAG  410
            I IR ++FP  E+GLPEGCEN     +     +F  A    QGP+E L +++ PDC++A 
Sbjct  65   IQIRTIKFPCAEAGLPEGCENPDLVPSSAMIPNFLKATTMLQGPLEHLLLQEHPDCLIAS  124

Query  411  PLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
              + W+ D AAKF IPR+ F G+G F +C    +R ++PH
Sbjct  125  AFFPWATDSAAKFNIPRIVFHGTGVFSLCAAECIRLYEPH  164



>dbj|BAI63589.1| UDP-glucose glucosyltransferase [Lotus japonicus]
Length=491

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 97/160 (61%), Gaps = 4/160 (3%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFA-RHGVKATFLTTPLNAAKISKAIDRERE---FGSQ  230
            LH+ F P L  GHMIPM D+A  FA R GV+AT +TTPLNA  IS+ I    E     + 
Sbjct  5    LHILFFPFLGHGHMIPMSDMATLFATRRGVRATIVTTPLNAPTISRTIQEGGEDEGTHAN  64

Query  231  ISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAG  410
            I IR ++FP  E+GLPEGCEN     +     +F  A    QGP+E L +++ PDC++A 
Sbjct  65   IQIRTIKFPCAEAGLPEGCENPDLVPSSAMIPNFLKATTMLQGPLEHLLLQEHPDCLIAS  124

Query  411  PLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
              + W+ D AAKF IPR+ F G+G F +C    +R ++PH
Sbjct  125  AFFPWATDSAAKFNIPRIVFHGTGVFSLCAAECIRLYEPH  164



>gb|KHN40683.1| UDP-glycosyltransferase 73B3 [Glycine soja]
Length=499

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 100/164 (61%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQSP-PLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+ QS   L+V FLP   PGHMIPMVD AR FA+HGV  T +TTP NA    KAIDR+  
Sbjct  1    MEAQSHHQLNVLFLPYPTPGHMIPMVDTARVFAKHGVSVTIITTPANALTFQKAIDRDLS  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G +I  +++ FP  + GLP+G EN+  +TT E      + +   +  IE L  + +PDC
Sbjct  61   CGYRIRTQVVPFPSAQVGLPDGLENIKDSTTPEMLGQISHGISMLKDQIELLFRDLQPDC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            IV    Y W+ + A K  IPR+ F+ S +F  CV +S+R+H+PH
Sbjct  121  IVTDFCYPWTVESAQKLSIPRICFYSSSYFSNCVSHSIRKHRPH  164



>ref|XP_003622870.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES79088.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=497

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 95/156 (61%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LHV FLP   PGHMIPM+D AR FA+HGV  T + T  NA+   K+ID +   G  I  +
Sbjct  10   LHVTFLPYPTPGHMIPMIDTARLFAKHGVNVTIIATHANASTFQKSIDSDFNSGYSIKTQ  69

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L+ FP  + GLP+G EN+   T+LE      + +   Q PIE L  + RPDCIV   +Y 
Sbjct  70   LIPFPSAQVGLPDGVENIKDGTSLEMLGKISSGILMLQDPIENLFHDLRPDCIVTDQMYA  129

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ + AAK GIPR+ ++ S +F  CV + + +++PH
Sbjct  130  WTVEAAAKLGIPRIHYYSSSYFSNCVFHFIMKYRPH  165



>ref|XP_011000136.1| PREDICTED: scopoletin glucosyltransferase-like [Populus euphratica]
Length=485

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 95/167 (57%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +    LH++F P  A GHMIP VD+A+ FA  G+K T +TTPLNA   SK I + +E 
Sbjct  1    MGSLGHQLHIFFFPFFAHGHMIPFVDMAKLFASRGIKTTIITTPLNAPLFSKTIHKNKEL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSA----TTTLEQTFSFFNALDHFQGPIERLAVEDR  389
            G  I+I  ++FP  E+G PEG EN  A        E T  F  A    Q P E++  E  
Sbjct  61   GFDINILTIKFPAAEAGFPEGYENTDAFIFSENAREMTIKFIKATTLLQAPFEKVLQECH  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDCIVA   + W+ D AAKFGIPRL F G+  F +     +R ++PH
Sbjct  121  PDCIVADMFFPWATDAAAKFGIPRLVFHGTSNFALSASECVRLYEPH  167



>ref|XP_003520067.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
Length=483

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 102/164 (62%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +   PLH++F P +A GHMIP+VD+A+ FA  GV+ T +TTPLNA  ISK I++ +  
Sbjct  1    MGSNYGPLHIFFFPFMAHGHMIPLVDMAKLFAAKGVRTTIITTPLNAPIISKTIEQTKTH  60

Query  222  GS-QISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             S +I+I+ ++FP    GLPEGCE+  +  + +    F  A    Q P E+L +  RP+C
Sbjct  61   QSKEINIQTIKFPNVGVGLPEGCEHSDSVLSTDLFPIFLKATTLMQEPFEQLLLHQRPNC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D AAKFGIPRL F G  FF +C    +  +KP+
Sbjct  121  VVADWFFPWTTDSAAKFGIPRLVFHGISFFSLCATKIMSLYKPY  164



>gb|KHN12234.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Glycine soja]
Length=482

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 102/164 (62%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +   PLH++F P +A GHMIP+VD+A+ FA  GV+ T +TTPLNA  ISK I++ +  
Sbjct  1    MGSNYGPLHIFFFPFMAHGHMIPLVDMAKLFAAKGVRTTIITTPLNAPIISKTIEQTKTH  60

Query  222  GS-QISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             S +I+I+ ++FP    GLPEGCE+  +  + +    F  A    Q P E+L +  RP+C
Sbjct  61   QSKEINIQTIKFPNVGVGLPEGCEHSDSVLSTDLFPIFLKATTLMQEPFEQLLLHQRPNC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D AAKFGIPRL F G  FF +C    +  +KP+
Sbjct  121  VVADWFFPWTTDSAAKFGIPRLVFHGISFFSLCATKIMSLYKPY  164



>ref|XP_009600997.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana tomentosiformis]
Length=539

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 97/154 (63%), Gaps = 0/154 (0%)
 Frame = +3

Query  66   HVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIRL  245
            H +F PL+A GHMIP +D+A+  A  GVKAT +TTPLN +  S +I R ++ G +I IRL
Sbjct  5    HFFFFPLMAHGHMIPTLDMAKLVASRGVKATIITTPLNESVFSNSIQRSKQVGIEIDIRL  64

Query  246  LEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYTW  425
            ++F   E+GLPEGCE L    + +   +F  A    Q P E+L  E RP+C+V+     W
Sbjct  65   IKFQAVENGLPEGCERLDLIPSDDLLNNFSTATTMMQEPFEQLLQECRPNCLVSDMFLPW  124

Query  426  SNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            + D A KF IPRL F G+ +F +CV +S+R + P
Sbjct  125  TADSADKFNIPRLVFHGTSYFALCVADSIRHYTP  158



>ref|XP_003623458.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES79676.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=504

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 96/169 (57%), Gaps = 0/169 (0%)
 Frame = +3

Query  24   SQPTNKMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAI  203
            +Q T +    +  LHV FLP  + GHM PM+D AR FA+HGV  T +TT  NA++  K+I
Sbjct  3    NQATMESQQSNNKLHVVFLPYPSAGHMNPMIDTARLFAKHGVDVTIITTHANASRFQKSI  62

Query  204  DREREFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVE  383
            D +   G  I  +LL+FP  E GLPEG EN    T+LE        +   Q  IE L  E
Sbjct  63   DSDISLGYSIKTKLLQFPANEVGLPEGIENTIDATSLEMLVKITIGVRMLQQSIEVLFKE  122

Query  384  DRPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             +PDCIV    Y W+ + AAK  IPR+ F+ S +F  C    +R++KPH
Sbjct  123  LQPDCIVTDMKYPWTVESAAKLNIPRIDFYSSSYFSYCAIYFVRKYKPH  171



>ref|XP_002518717.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43642.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=480

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 105/160 (66%), Gaps = 0/160 (0%)
 Frame = +3

Query  45   DTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFG  224
            D+ +  LH+   PL+A GHM+P++D+AR FA  GVK T +TTP NA +++++    ++  
Sbjct  4    DSNNHQLHILLFPLMAQGHMLPLLDIARLFASRGVKITIVTTPGNAPRLNRSFQTTQDSS  63

Query  225  SQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIV  404
            +QIS ++++FP KE+GLPEG ENL + +  E    FF+AL   + P+E++  E  P  +V
Sbjct  64   TQISFKIIKFPAKEAGLPEGLENLDSVSDKETHSKFFDALSLLREPLEQVLQELHPQGLV  123

Query  405  AGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHK  524
            +   + W+ + A+K+GIPRL F+G+ FF +C   +L  H+
Sbjct  124  SDIFFPWTAEVASKYGIPRLIFYGTSFFSMCCLENLEEHQ  163



>gb|KCW64674.1| hypothetical protein EUGRSUZ_G02260, partial [Eucalyptus grandis]
Length=424

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 98/156 (63%), Gaps = 2/156 (1%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            +HV F PL+A GHM+P +D+AR F   G +AT +TTP NA     ++  + + GS+I +R
Sbjct  9    VHVLFFPLMAHGHMLPTLDMARLFTARGARATIITTPHNAPVFQNSL--QIDAGSRIDLR  66

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             +EFP +E GLPEG ENL   TT +    FF A+     P+E L  E  PD +VA   + 
Sbjct  67   TIEFPTREVGLPEGLENLDMVTTQDIQLKFFRAISMLSRPLEALVEELAPDALVADIFFP  126

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            ++ND AA  GIPRL+F G+ FF +C   S++RH+PH
Sbjct  127  FANDIAAGHGIPRLAFHGTSFFSMCAAESVQRHRPH  162



>gb|KDO59784.1| hypothetical protein CISIN_1g042879mg, partial [Citrus sinensis]
Length=189

 Score =   137 bits (344),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 92/156 (59%), Gaps = 14/156 (9%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH+ F PL+A GHMIP+VD+A+ F   GVK T +TTP NA   SKAI R  E G +I I+
Sbjct  8    LHIIFFPLMAHGHMIPLVDMAKLFGSRGVKTTVITTPANATLFSKAIPRANELGIEIDIK  67

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             ++FP  E GLPEG ENL+  T+              Q  +     E +P+C+VA  L+ 
Sbjct  68   TIKFPSVEVGLPEGSENLNEMTS--------------QPDMPVNLQEHKPNCLVADMLFP  113

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D AAKFGIPRL F G+ F  +C    L  ++PH
Sbjct  114  WATDAAAKFGIPRLVFHGTSFLSLCATACLMLYEPH  149



>ref|XP_010068736.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=499

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 98/156 (63%), Gaps = 2/156 (1%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            +HV F PL+A GHM+P +D+AR F   G +AT +TTP NA     ++  + + GS+I +R
Sbjct  9    VHVLFFPLMAHGHMLPTLDMARLFTARGARATIITTPHNAPVFQNSL--QIDAGSRIDLR  66

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             +EFP +E GLPEG ENL   TT +    FF A+     P+E L  E  PD +VA   + 
Sbjct  67   TIEFPTREVGLPEGLENLDMVTTQDIQLKFFRAISMLSRPLEALVEELAPDALVADIFFP  126

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            ++ND AA  GIPRL+F G+ FF +C   S++RH+PH
Sbjct  127  FANDIAAGHGIPRLAFHGTSFFSMCAAESVQRHRPH  162



>gb|KJB36979.1| hypothetical protein B456_006G185400 [Gossypium raimondii]
Length=364

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 101/165 (61%), Gaps = 2/165 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +QS  LH  F+PL+ PGH+IPMVD+ R  A+HGV  T +TTPLNA++I   IDR+   
Sbjct  1    MSSQSSKLHFVFIPLMCPGHLIPMVDMGRLLAQHGVTVTIVTTPLNASRIKTIIDRDIAS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERL--AVEDRPD  395
            G Q+ +  L FP  E+GLP+GCEN+ A  + + + +F +A+   Q P+ER     E +P 
Sbjct  61   GIQLQLLQLRFPCIEAGLPKGCENIDALPSRQLSKNFMDAVGMLQQPLERFLEETEPKPS  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            CI++   + W+   A KF IPRL+F G+  F V   + +   K H
Sbjct  121  CIISDRHHPWTFGVAQKFKIPRLAFDGTSCFTVTCSHFINLSKIH  165



>ref|XP_010547999.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Tarenaya hassleriana]
Length=496

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 106/173 (61%), Gaps = 12/173 (7%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M T+   LH++F P +APGHMIP +D+A+ FA  G K+T LTTPLN+    K I+  +  
Sbjct  1    MGTKFDQLHIFFFPYMAPGHMIPTLDMAKLFASRGAKSTILTTPLNSQTFQKPIEAFKNM  60

Query  222  G--SQISIRLLEFPYKESGLPEGCENL--------SATTTLEQTFSFFNALDHFQGPIER  371
               ++I + +L+FP +E GLPEGCEN         S +  L Q F F  A +  +  +E+
Sbjct  61   NPDAEIGVEILDFPCRELGLPEGCENTDFIISNYKSNSGDLTQKFMF--ATEFLKEQMEQ  118

Query  372  LAVEDRPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            L    +PDC++A   + W+++ A K G+PR++F GSG+FP+C  + +  HKPH
Sbjct  119  LMETMKPDCLIADIFFPWASESADKLGVPRVAFHGSGYFPICAAHCIDVHKPH  171



>ref|XP_010057243.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW74287.1| hypothetical protein EUGRSUZ_E02950 [Eucalyptus grandis]
Length=485

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 96/163 (59%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M+T+S  LH+ FLPL A GHMIPM+D+A+ FA  G K T +T+P  AA  SK I+R  + 
Sbjct  1    METESNRLHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPAFAAIFSKQIERANQL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +  ++ ++FP  E G+PEG EN  AT   +    F  AL   + P+  +  + RPDC+
Sbjct  61   GLEFHVQTVKFPSTEVGMPEGWENTDATAYSQNLPKFAEALSLLREPVLHILEKHRPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            V    + W+ D AA+  IPRL F G+    VC    + RH+PH
Sbjct  121  VTDFFFAWATDVAARLKIPRLVFGGTSIIAVCAEEVIARHQPH  163



>ref|XP_010690618.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=486

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 97/156 (62%), Gaps = 1/156 (1%)
 Frame = +3

Query  66   HVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAID-REREFGSQISIR  242
            H++F P +APGHMIP +D+AR FA  G+K+T +TTP N    ++ I    ++ G QI + 
Sbjct  10   HIFFFPFMAPGHMIPTLDMARLFASRGIKSTIVTTPANLHYFTETIKVHTQKSGIQIDLL  69

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             + FP +E GLPEGCEN    T+ E    F  A+D  Q P   L  +  P+C+VA P ++
Sbjct  70   TINFPSEEVGLPEGCENFEFVTSSEMFHKFCKAVDLLQHPFANLMEKYNPNCLVADPFFS  129

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+N  A+KF +PRL+F GS +F  C+ +SL   +PH
Sbjct  130  WANSVASKFRVPRLAFHGSSYFSRCIVSSLLHFEPH  165



>ref|XP_010066837.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW64873.1| hypothetical protein EUGRSUZ_G02439 [Eucalyptus grandis]
Length=487

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 98/156 (63%), Gaps = 2/156 (1%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            +HV F PL+A GHM+P +D+AR F   G +AT +TTP NA     ++  + + GS+I +R
Sbjct  9    VHVLFFPLMAHGHMLPTLDMARLFTARGARATIITTPHNAPVFQNSL--QIDAGSRIDLR  66

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             +EFP +E GLPEG ENL   TT +    FF A+     P+E L  E  PD +VA   + 
Sbjct  67   TIEFPTQEVGLPEGLENLDMVTTQDIQLKFFRAISMLSRPLEALVEELAPDALVADIFFP  126

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            ++ND AA  GIPRL+F G+ FF +C   S++RH+PH
Sbjct  127  FANDIAAGHGIPRLAFHGTSFFSMCAAESVQRHRPH  162



>ref|XP_004305937.1| PREDICTED: abscisate beta-glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=501

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 97/167 (58%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQS--PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRER  215
            MD+Q+  P L ++F P +  GH+IPM+DLAR F+ HGVKAT +TTP N       I R++
Sbjct  1    MDSQADHPKLEIFFFPYILGGHLIPMIDLARLFSSHGVKATIVTTPHNVLLFQNPILRDQ  60

Query  216  EFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVED--R  389
            + G  IS   L FP +E GLP GCEN   TT  +     F A    Q P+ +L  E   +
Sbjct  61   QLGHAISFVTLNFPAEEFGLPNGCENELTTTNGDMFTKLFMAAMKLQDPLRKLLSETKPK  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDC+V+  LY W+ +     GIPR+ F GSG F  CV  SLR + PH
Sbjct  121  PDCLVSDRLYPWTANVTDGLGIPRIVFDGSGCFSHCVEESLRVYAPH  167



>ref|XP_010028421.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW55164.1| hypothetical protein EUGRSUZ_I01120 [Eucalyptus grandis]
Length=485

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 96/163 (59%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M+T+S  LH+ FLPL A GHMIPM+D+A+ FA  G K T +T+P  AA  SK I+R  + 
Sbjct  1    METESNRLHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPAFAAIFSKQIERANQL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +  ++ ++FP  E G+PEG EN  AT   +    F  AL   + P+ R+  + R DC+
Sbjct  61   GLEFHVQTVKFPSTEVGMPEGWENTDATAYSQNQPKFGEALSLLREPVLRILEKHRTDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            V    + W+ D AA+  IPRL F G+    VC    + RH+PH
Sbjct  121  VTDFFFAWATDVAARLKIPRLVFGGTSIIAVCAEEVIARHQPH  163



>gb|ACO44747.1| UDP glycosyltransferase [Withania somnifera]
Length=470

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 99/155 (64%), Gaps = 4/155 (3%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P++A GHMIP +D+A+  A  GVKAT +TTPLN +  SK I R +  G    IR
Sbjct  4    LHIFFFPMMAQGHMIPTLDMAKLVASRGVKATIITTPLNESVFSKVIQRNKNLG----IR  59

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L++FP  E+ LPE CE L    + ++  +FF A    Q  +E+L  E RP+C+V+   + 
Sbjct  60   LIKFPAVENDLPEDCERLDLIPSDDKLPNFFKAAATMQESLEQLIQECRPNCLVSDMFFP  119

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W+ D AAKF IPR+ F G+G+F +   +SLR +KP
Sbjct  120  WTTDTAAKFNIPRIVFHGTGYFALSAVDSLRLNKP  154



>ref|XP_007011132.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
 gb|EOY19942.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
Length=482

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 95/163 (58%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  ++  L ++FLP +A GHMIP +DLA  FA  GVK T +TT LN   ISK  +R +  
Sbjct  1    MSCKNRQLQIFFLPFMAHGHMIPFIDLAMLFAAKGVKTTIITTTLNVPHISKVTERAKNL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I+I +  FP  E+GLPEGCE+    ++ +  F FF A    + P+  L    RPDC+
Sbjct  61   GYEINILVTYFPSVEAGLPEGCESYDQASSPDMQFKFFTATTMLREPLAHLLQAHRPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   + W  D AA FGIPR+ F G+  F +     +R ++PH
Sbjct  121  VADMFFPWVTDVAAAFGIPRIVFHGTCVFSLSATEHIRLYEPH  163



>gb|KGN43910.1| hypothetical protein Csa_7G073460 [Cucumis sativus]
Length=219

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 99/163 (61%), Gaps = 1/163 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M T+   LH++  P +A GHMIP+V++A  FA  G+K T +TTPLN+  ISK++  +   
Sbjct  1    MATEGRQLHIFMFPFMAHGHMIPVVNMANLFASRGIKITIVTTPLNSISISKSLHNDSS-  59

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
               I + +L+FP  E GLP+ CEN+ +  T++    F+ A+   Q  +E    ++RP C+
Sbjct  60   SLHIHLLILKFPSAEVGLPDDCENVDSLPTMDLLPLFYQAISLLQSSLEEALHQNRPHCL  119

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   + W+ND A + GIPRL F G+G F +C    +R H+P+
Sbjct  120  VADMFFPWTNDVADRIGIPRLIFHGTGSFSLCASEFVRIHQPY  162



>ref|XP_007042484.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
 gb|EOX98315.1| UDP-glucosyl transferase 73B3 [Theobroma cacao]
Length=483

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 94/163 (58%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +Q+  L ++FLP +A GHMIP  DL   FA  GVK T +TT LN   ISK  +R +  
Sbjct  1    MSSQNRQLQIFFLPFMAHGHMIPFTDLVMLFAAKGVKTTIITTTLNVPHISKVTERAKSL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I+I +  FP  E+GLPEGCE+    ++ +  F FF A    + P+  L    RPDC+
Sbjct  61   GYEINILVTYFPSVEAGLPEGCESFDQASSPDMQFKFFTATTMLREPLAHLLQAHRPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   + W  D AA FGIPR+ F G+  F +     +R ++PH
Sbjct  121  VADMFFPWVTDVAAAFGIPRIVFHGTCVFSLSATEHIRLYEPH  163



>gb|KDP25001.1| hypothetical protein JCGZ_23984 [Jatropha curcas]
Length=471

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 96/153 (63%), Gaps = 5/153 (3%)
 Frame = +3

Query  87   LAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIRLLEFPYKE  266
            +A GHMIP VD+A+ FA  G KAT +TTP N   ISK I R ++ G  I+I++L+FP  E
Sbjct  1    MAHGHMIPTVDMAKLFAFRGHKATIITTPSNEPLISKTIQRTKDMGFDINIQILKFPSVE  60

Query  267  SGLPEGCENLSATTTL-----EQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYTWSN  431
             GLPEGC+N+    +L     E    F+ A    Q P+E+L  E  P+C+VA   + W+ 
Sbjct  61   VGLPEGCDNIDFVLSLVENGMEMIIKFWLATGKLQEPLEKLLQECNPNCLVADMFFPWTT  120

Query  432  DFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            D AAKFGIPRL F G+ FF +C   S+R ++PH
Sbjct  121  DAAAKFGIPRLVFHGTSFFSLCAGESIRLYQPH  153



>ref|XP_006342641.1| PREDICTED: soyasapogenol B glucuronide galactosyltransferase-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342642.1| PREDICTED: soyasapogenol B glucuronide galactosyltransferase-like 
isoform X2 [Solanum tuberosum]
Length=492

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 90/156 (58%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LHV F+P   P HMIP+VD+AR FA HGVK + +TTP NA     +ID   E G +I + 
Sbjct  9    LHVVFIPYFTPSHMIPLVDIARLFASHGVKVSIITTPYNALLFESSIDHATELGHEIFVH  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             L+FP  E G+PEG EN SA T+ E     F  +   Q P+E L  E RP CIV+   + 
Sbjct  69   KLKFPSAEVGIPEGIENFSAVTSKEMAIGVFMGIPLLQKPMESLIFELRPHCIVSDMFFP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A +  IPRL F+ +     CV + L+ + PH
Sbjct  129  WTVDVAEQLKIPRLMFYPTNVMYHCVEHCLKLYAPH  164



>ref|XP_008236571.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Prunus mume]
Length=471

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 93/153 (61%), Gaps = 0/153 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MDT++   H++  P +APGHMIP + +A+ FA  G+K T ++TP N A   K I+R ++ 
Sbjct  1    MDTKAKQSHIFLFPYMAPGHMIPTIAMAKLFASRGIKTTLISTPQNIAFFFKTIERSKDS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I + LL+FP  E GLPEGCE      TLE+   F  A       +E+L  E +P+C+
Sbjct  61   GFEIGVLLLKFPSVEVGLPEGCECGHMVETLEELQKFLKATSLLDQQLEKLLEEHQPNCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCV  500
            VA   + W+ D AAKFGIPRL F G  F  +C+
Sbjct  121  VADNCFPWTTDLAAKFGIPRLVFHGINFISLCI  153



>ref|XP_004305940.2| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=485

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 99/166 (60%), Gaps = 3/166 (2%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRER-  215
            M T+S   L + F P +A GH+IP   +A+ F+  G  +T LTTPLNA   +K+I R + 
Sbjct  1    MATKSHEQLDIMFFPYMAAGHIIPFTHVAKLFSSRGANSTILTTPLNAPLCTKSIQRSKC  60

Query  216  -EFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRP  392
             EF  +I + L++FPY E GLPEGCE     TT E    FF A    +  +E++  E RP
Sbjct  61   LEFDKKIELILIKFPYAEVGLPEGCEMADLITTPEMDGKFFLATTLLETQLEQILDEHRP  120

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             C+VA   + W+ D AAKFGIPRL F  +G FP+C   S+  H+PH
Sbjct  121  HCLVADAFFPWATDVAAKFGIPRLYFHATGSFPLCASLSMMIHRPH  166



>gb|KGN43914.1| hypothetical protein Csa_7G073500 [Cucumis sativus]
Length=471

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = +3

Query  87   LAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGS---QISIRLLEFP  257
            +APGHMIPMVD+A+  +  GVK T +TTPLN+  IS +I    +  S   +I + +L+FP
Sbjct  1    MAPGHMIPMVDMAKLLSSRGVKITIVTTPLNSISISNSIHNNSKSISPPPKIHLLILKFP  60

Query  258  YKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYTWSNDF  437
              E GLP+GCENL + T       F +  +  Q P E   +E RP CI+A   + W+ND 
Sbjct  61   SAEVGLPDGCENLDSVTGNAMIPKFISVCNLLQTPFEEAVMEHRPHCILADIFFPWANDV  120

Query  438  AAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            AAKFGIPRL+F G+GFF  C    +R H+P+
Sbjct  121  AAKFGIPRLTFHGTGFFSTCASEFIRIHEPY  151



>ref|XP_008454970.1| PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]
Length=478

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 100/163 (61%), Gaps = 1/163 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++   LH++  P +A GHMIPMVD+A+ FA  G+K T +TTPLN+   SK++      
Sbjct  1    MGSEDRQLHIFMFPFMAHGHMIPMVDMAKLFASRGIKITIVTTPLNSISFSKSL-HNYSA  59

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
             S I + +L+FP  E+GLPEGCEN  +  +++   +FF A+   Q P E     +RPDC+
Sbjct  60   DSLIQLLILKFPSAEAGLPEGCENADSIPSMDFLPNFFRAVSLLQPPFEEALQNNRPDCL  119

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            ++   + W+ND A + GIPRL F G+  F +C    +R H+P+
Sbjct  120  ISDMFFPWTNDVADRIGIPRLIFHGTSCFSLCASEFMRLHEPY  162



>gb|KDO41467.1| hypothetical protein CISIN_1g046582mg, partial [Citrus sinensis]
Length=381

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 100/168 (60%), Gaps = 2/168 (1%)
 Frame = +3

Query  33   TNKMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRE  212
            T+ M +++   H   LP LA GH+IPM+D+AR  A+HG   T +TTP+NAA+    + R 
Sbjct  11   TSAMISEASQFHFLLLPFLAQGHLIPMIDIARLLAQHGAIVTIVTTPVNAARFKTVLARA  70

Query  213  REFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVED--  386
             + G QI +  ++FP+KE+GLPEGCEN+    +++    FFN+L   Q P E L  E   
Sbjct  71   TQSGLQIRLTEIQFPWKEAGLPEGCENIDMLPSIDLASKFFNSLSMLQLPFENLFKEQTP  130

Query  387  RPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +P CI++   + W+ D AAKF +PR+ F G   F +   N LR  K H
Sbjct  131  KPCCIISDMGHPWTVDTAAKFNVPRIIFHGFSCFCLLCMNLLRDSKVH  178



>ref|XP_006423816.1| hypothetical protein CICLE_v10028297mg [Citrus clementina]
 gb|ESR37056.1| hypothetical protein CICLE_v10028297mg [Citrus clementina]
Length=492

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 97/159 (61%), Gaps = 2/159 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MDTQ+  LH    P LA GHMIPM+D+AR  A+ GV  T +TTP+NAA+ +  + R  E 
Sbjct  1    MDTQANQLHFVLFPFLAQGHMIPMIDIARLLAQRGVIITIVTTPVNAARFNGILSRAIES  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERL--AVEDRPD  395
            G QI I   + P +E+GLPEGCENL    +L   F FF A D  Q P+E +   ++ RP+
Sbjct  61   GLQIKIVQFQLPCEEAGLPEGCENLDMVASLGLAFDFFTAADMLQEPVENVFAQLKPRPN  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSL  512
            CI++     ++   A KF IPR++F G+  F +  +N+L
Sbjct  121  CIISDMCLPYTAHIAGKFNIPRITFHGTCCFCLVCYNNL  159



>ref|XP_002518718.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43643.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=480

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH+   PL+A GHM+P++D+AR FA  GVK T +TTP NAA  +K     ++   QI+++
Sbjct  10   LHILLFPLMAQGHMLPLLDIARLFASRGVKTTIITTPGNAASFTKIT---QDLSIQINLK  66

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            +++FP KE+GLPEG ENL   +  +    FF AL   Q P+E++  E  P  +V+   + 
Sbjct  67   IIKFPSKEAGLPEGLENLDLVSDKQTHSKFFKALSLLQDPLEKVVQELLPHGLVSDIFFP  126

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ + A K GIPRL F G+GFFP+C   ++   +PH
Sbjct  127  WTTEVATKCGIPRLIFLGTGFFPMCCFANIEEQQPH  162



>gb|KDP24999.1| hypothetical protein JCGZ_23982 [Jatropha curcas]
Length=469

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 95/151 (63%), Gaps = 3/151 (2%)
 Frame = +3

Query  87   LAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIRLLEFPYKE  266
            ++ GHMIP VD+A+ FA  G K T +TTP NA  ISK I R ++ G   +IR+LEFP  E
Sbjct  1    MSHGHMIPAVDMAKLFAFRGHKTTVVTTPSNAPLISKTIQRTKDLGFDTNIRILEFPSVE  60

Query  267  SGLPEGCENLSATTTLEQTF---SFFNALDHFQGPIERLAVEDRPDCIVAGPLYTWSNDF  437
            +GLPEGCEN+ +  + +       F  A    Q P+E+L  E RP+C+VA   + W+ D 
Sbjct  61   AGLPEGCENMDSINSYDNDNMMDKFLLATAKLQEPLEKLLQECRPNCLVADMFFPWATDA  120

Query  438  AAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            A+KF IPRL F G+ FF +C   S+R ++PH
Sbjct  121  ASKFAIPRLVFHGTSFFSLCAGESIRLYQPH  151



>ref|XP_007140179.1| hypothetical protein PHAVU_008G090600g [Phaseolus vulgaris]
 gb|ESW12173.1| hypothetical protein PHAVU_008G090600g [Phaseolus vulgaris]
Length=493

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 94/156 (60%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            L+V FLP   PGHMIPMV  AR FA+HGV  T + T  NA    KAIDR+   G  I  +
Sbjct  9    LNVLFLPYPTPGHMIPMVVTARLFAKHGVSVTIIATQANALTFQKAIDRDFSCGYHIRTQ  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            ++ FP  + GLP+G EN+  +TT E      + +   +  IE L  + +PDCIV    Y 
Sbjct  69   VIPFPADQVGLPDGVENIKDSTTPEMLGQISHGISMLKDQIELLFQDLQPDCIVTDVCYP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ + AAK GIPRL F+ S +F  CV +S+R+H+PH
Sbjct  129  WTVESAAKLGIPRLFFYSSSYFSNCVSHSIRKHRPH  164



>ref|XP_004305939.2| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=503

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 100/164 (61%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQ-SPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+  P LH++FLP +APGH +P++D+A+ FA  GVK T +TT  NA  IS+AI     
Sbjct  21   METKPRPQLHIFFLPFMAPGHTLPLIDIAKLFASRGVKCTIVTTHANAPIISQAIKTSIG  80

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
            FG +I + L++FP  E GL EG E++    T E       A    Q  +E++  +  P C
Sbjct  81   FGFEIKLVLIKFPSTEVGLHEGIESIKLEKTKEMRKGLVKATTLLQQQVEQVLDQHHPHC  140

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA  L+ W+ D AAKF IPRL F G+GFF +C   S+  ++PH
Sbjct  141  LVADFLFHWATDVAAKFEIPRLVFHGTGFFALCALKSIMLYQPH  184



>ref|XP_007140178.1| hypothetical protein PHAVU_008G090500g [Phaseolus vulgaris]
 gb|ESW12172.1| hypothetical protein PHAVU_008G090500g [Phaseolus vulgaris]
Length=502

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 96/164 (59%), Gaps = 0/164 (0%)
 Frame = +3

Query  39   KMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            K ++Q+  L+V FLP L+ GH+ PMVD AR FAR+G   T +TT  NA     AID +  
Sbjct  2    KTESQAHRLNVAFLPYLSSGHLNPMVDTARLFARYGASVTIITTHANALTFQNAIDSDFN  61

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  I  +L+ FP  + GLPEG ENL   T+ +     F  +   QGP ERL  + +PDC
Sbjct  62   GGYHIRTQLVAFPAAQLGLPEGAENLKDGTSPDMVGKIFYGVSMLQGPFERLFQDLQPDC  121

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +V   LY W+ + AAK GIPRL F+ +  F  C  + + +HKPH
Sbjct  122  LVTDQLYPWTVESAAKLGIPRLCFYSASQFASCATHFIIKHKPH  165



>ref|XP_003518712.1| PREDICTED: scopoletin glucosyltransferase-like [Glycine max]
Length=476

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 101/164 (62%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +    LH++F P LA GHMIP+VD+A+ FA  GV+AT LTTPLNA  ISKAI++ +  
Sbjct  1    MASNDDSLHMFFFPFLAHGHMIPLVDMAKLFAAKGVRATILTTPLNAPIISKAIEKTKTH  60

Query  222  -GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G +I I+ L+F   E GLPEGCE+  +  +     +F  A    Q P E+L  + RP+C
Sbjct  61   QGKEIQIQTLKFLGTEFGLPEGCEHCDSLPSPNLFPAFIMATALLQEPFEQLLHQQRPNC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D A KFGIPRL F G  FF +C    +  ++P+
Sbjct  121  VVADMFFPWTTDSADKFGIPRLVFHGISFFSLCASQIMSLYQPY  164



>ref|XP_004505252.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Cicer arietinum]
 gb|AGU14084.1| UDP-glycosyltransferase [Cicer arietinum]
Length=488

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 105/162 (65%), Gaps = 0/162 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +Q+ PLH++F P +  GHMIP +D+A+ FA  GVKAT +TTPLN   ++KAI++ +  
Sbjct  1    MASQNNPLHIFFFPFMGHGHMIPSIDMAKLFASKGVKATIVTTPLNKPLVTKAIEQFKTH  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
             + I I++++FP  E GLPEGCEN+ +  +     +FF A    Q P+E+L  + +P+CI
Sbjct  61   SNNIDIQIIKFPCVEGGLPEGCENVDSIPSPHLIPAFFKATWLLQEPLEQLLQQQKPNCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            VA   + WS   AAKFGIPR+ F G+ FF +C    L  ++P
Sbjct  121  VADMFFPWSTASAAKFGIPRIVFHGTSFFSLCASQCLNLYEP  162



>ref|XP_010681315.1| PREDICTED: scopoletin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 100/163 (61%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  +   LHV F PL+A GH+IP +D+A+ FA H VK T +TTPLNA   +K ++  +  
Sbjct  1    MGAEPQRLHVVFFPLMAAGHLIPTLDIAKLFAAHHVKTTIITTPLNAPCFTKPLESYKNL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I I ++ FP KE+GLPEG EN    T+ +    F  A +  Q   E+   + +P+CI
Sbjct  61   GHRIDIEIIPFPSKEAGLPEGLENFDQFTSDQMAVKFLKATELLQESFEKFLEKHKPNCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            V   L  ++N+ AAKF IPR+ F G  +F +C+ ++L +++PH
Sbjct  121  VTDMLMPFTNNVAAKFNIPRIVFHGCSYFALCMMHTLLKYQPH  163



>ref|XP_009606596.1| PREDICTED: scopoletin glucosyltransferase-like [Nicotiana tomentosiformis]
Length=492

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 93/163 (57%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  ++  LHV F+P L P HMIP+VD AR FA HGVK + +TTP NA     +ID   + 
Sbjct  1    MGQENGELHVVFIPYLTPSHMIPLVDTARLFASHGVKVSIITTPYNALLFESSIDYVIDL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +I +  L+FP  E G+PEG EN SA TT E     F  +   Q P+E L  E RP CI
Sbjct  61   GHKIFVHKLKFPSAEVGIPEGIENFSAATTTEMATGVFMGIALLQKPMEDLIFELRPHCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            V+   + W+ D A +  IPRL F+ +     CV + L+ + PH
Sbjct  121  VSDLFFPWTVDVAEQLKIPRLMFYPTNVMFHCVEHCLKLYTPH  163



>ref|XP_002298734.2| hypothetical protein POPTR_0001s31120g [Populus trichocarpa]
 gb|EEE83539.2| hypothetical protein POPTR_0001s31120g [Populus trichocarpa]
Length=485

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 95/167 (57%), Gaps = 4/167 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +    LH++F P  A GHMIP VD+A+ FA  G+K T +TTPLNA   SK I + +E 
Sbjct  1    MGSLGHQLHIFFFPFFAHGHMIPSVDMAKLFASRGIKTTIITTPLNAPLFSKTIQKTKEL  60

Query  222  GSQISIRLLEFPYKESGLPEGCEN----LSATTTLEQTFSFFNALDHFQGPIERLAVEDR  389
            G  I+I  ++FP  E+G PEG EN    + +      T  FF A    Q P E+   E  
Sbjct  61   GFDINILTIKFPAAEAGFPEGYENTDTFIFSENARAMTTKFFKATTLLQAPFEKALQECH  120

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            PDCIVA   + W+ D AAKFGIPRL F G+  F +     +R ++PH
Sbjct  121  PDCIVADMFFPWATDAAAKFGIPRLVFHGTSNFALSAAECVRLYEPH  167



>ref|XP_004492515.1| PREDICTED: soyasapogenol B glucuronide galactosyltransferase-like 
[Cicer arietinum]
 gb|AGU14079.1| UDP-glycosyltransferase [Cicer arietinum]
Length=489

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 98/163 (60%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD+QS  L+V FLP   PGHMIPM+D AR FA+HG   T +TT  NA+   KAI  +   
Sbjct  1    MDSQSQQLNVIFLPYPTPGHMIPMIDTARLFAKHGANVTIITTHANASSFQKAIKSDFNS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G  I  +L+ FP  ++GLP+G EN+   T+ E      + ++  +  IE L  + +PDCI
Sbjct  61   GHPIKTQLIHFPSAQAGLPDGVENIKDATSSEILGKIIHGIEMLKDEIELLFQKLQPDCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            V+   Y W+ + AAK  IPRL ++ + +F  C  + +R++KPH
Sbjct  121  VSDMFYPWTVESAAKLSIPRLYYYSTSYFSNCSAHFIRKYKPH  163



>dbj|BAG71127.1| glucosyltransferase [Phytolacca americana]
 dbj|BAH05017.1| glucosyltransferase [Phytolacca americana]
Length=485

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 98/164 (60%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  +   LHV F P++A GHMIP +D+AR FA   V+AT +TTPLNA   +KAI+  ++ 
Sbjct  1    MGAEPQQLHVVFFPIMAHGHMIPTLDIARLFAARNVRATIITTPLNAHTFTKAIEMGKKN  60

Query  222  GS-QISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
            GS  I + L +FP ++ GLPEGCENL           FF  +   +  +E    + RP+C
Sbjct  61   GSPTIHLELFKFPAQDVGLPEGCENLEQALGSSLIEKFFKGVGLLREQLEAYLEKTRPNC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D AAKF IPRL F G+ FF +C    +R ++PH
Sbjct  121  LVADMFFPWATDSAAKFNIPRLVFHGTSFFSLCALEVVRLYEPH  164



>emb|CDP09466.1| unnamed protein product [Coffea canephora]
 emb|CDO97203.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LHV+F P  A GHM+P +D+A+ F+  G KAT +TTPL+A   +KAI++ ++ G  ISIR
Sbjct  5    LHVFFFPFFAHGHMLPTLDMAKVFSSRGAKATVITTPLHAPVFNKAIEKCKQLGFDISIR  64

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            +++FP  E+GLPEG E+     + +   +FF A    Q P+E+L  E RP C+VA   + 
Sbjct  65   VVKFPAVEAGLPEGTESADQLISDDMLPNFFLATRLLQEPVEQLLQECRPHCLVADFFFP  124

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D AAK+GIPRL F GS  F +    S+ R+KP+
Sbjct  125  WATDSAAKYGIPRLLFHGSSSFAMSASESVWRNKPY  160



>gb|AFO67243.1| putative UDP-glucose glucosyltransferase, partial [Aralia elata]
Length=166

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 92/163 (56%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M T+ P LHV  LP     H++P+V++ R  A  GV  T +TTP NA     ++D++   
Sbjct  1    MATEDPKLHVLILPYFTTSHIMPLVEIGRLIAARGVNITIITTPHNANLFRSSVDQDINS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G QISI  L+FP  E GLPEG EN SA T+ +     +  +   + P+E L     PDCI
Sbjct  61   GHQISIHELKFPSTEVGLPEGIENFSAITSSDMPAKVYEGIMRLRKPMEDLIRNLSPDCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             +   Y W+ + A +  IPRL F+ S FF  C+H+SL+ + PH
Sbjct  121  FSDMFYPWTVELAEELKIPRLMFYVSTFFYCCLHHSLKLYAPH  163



>ref|XP_006423821.1| hypothetical protein CICLE_v10028465mg [Citrus clementina]
 gb|ESR37061.1| hypothetical protein CICLE_v10028465mg [Citrus clementina]
Length=440

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 100/168 (60%), Gaps = 2/168 (1%)
 Frame = +3

Query  33   TNKMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRE  212
            T+ M +++   H   LP LA GH+IPM+D+AR  A+HG   T +TTP+NAA+    + R 
Sbjct  11   TSAMISEASQFHFLLLPFLAQGHLIPMIDIARLLAQHGAIVTIVTTPVNAARFKTVLARA  70

Query  213  REFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVED--  386
             + G QI +  ++FP+KE+GLPEGCEN+    +++    FFN+L   Q P E L  E   
Sbjct  71   TQSGLQIRLTEIQFPWKEAGLPEGCENIDMLPSIDLASKFFNSLSMLQLPFENLFKEQTP  130

Query  387  RPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +P CI++   + W+ D AAKF +PR+ F G   F +   N LR  K H
Sbjct  131  KPCCIISDMGHPWTVDTAAKFNVPRIIFHGFSCFCLLCMNLLRDSKVH  178



>ref|XP_004304025.2| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Fragaria vesca subsp. vesca]
Length=484

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 97/157 (62%), Gaps = 1/157 (1%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++FLP +  GH +P++D+A+ FA  G K++ +TTP NA   +KAI   R  G +I I 
Sbjct  9    LHIFFLPFMGQGHTLPLIDIAKLFASRGEKSSIITTPANAPLFTKAIQTSRSSGLEIEIL  68

Query  243  LLEFPYKESGLPEGCENLSA-TTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLY  419
            L++FP  E GLPEG E+ +    T E    FF AL   +  +E+L  +  P C+VA  L+
Sbjct  69   LIKFPSSEVGLPEGIESSNDWGKTAEIAEKFFKALTLLKHQVEQLLHQYHPHCLVASSLF  128

Query  420  TWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             WS D AAKFGIPRL F G GFF +C   S+  ++PH
Sbjct  129  HWSTDLAAKFGIPRLIFQGPGFFSLCAAMSVTLYQPH  165



>gb|KGN43909.1| hypothetical protein Csa_7G073450 [Cucumis sativus]
Length=480

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 100/163 (61%), Gaps = 1/163 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M ++   LH++  P +A GHMIP+VD+A+ FA  G+K T +TTPLN+  ISK++      
Sbjct  1    MGSEGRQLHIFMFPFMAHGHMIPIVDMAKLFASRGIKITIVTTPLNSISISKSLHNCSP-  59

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
             S I + +L+FP  E+GLP+GCEN  +  +++    FF A+   Q P E     +RPDC+
Sbjct  60   NSLIQLLILKFPAAEAGLPDGCENADSIPSMDLLPKFFEAVSLLQPPFEEALHNNRPDCL  119

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            ++   + W+ND A + GIPRL F G+  F +C    +R HKP+
Sbjct  120  ISDMFFPWTNDVADRVGIPRLIFHGTSCFSLCSSEFMRLHKPY  162



>ref|XP_007153575.1| hypothetical protein PHAVU_003G047100g [Phaseolus vulgaris]
 gb|ESW25569.1| hypothetical protein PHAVU_003G047100g [Phaseolus vulgaris]
Length=474

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 100/164 (61%), Gaps = 7/164 (4%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  Q   LHV+F P  A GH+IP ++LAR FA  GVK T +TTPLN   IS+ I +    
Sbjct  1    MGIQDRDLHVFFFPFFANGHIIPSIELARVFASRGVKTTVVTTPLNEPLISRTIGK----  56

Query  222  GSQISIRLLEFPYKE-SGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             + I+IR ++FP  E +GLPEG EN    T + Q   F  +    + P+E+L  ++ PD 
Sbjct  57   -ANIAIRTIKFPSPEKTGLPEGVENSDQLTGM-QIIPFLKSTVLLRDPLEQLMQQEHPDL  114

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            I+A   + W+ D AAKFGIPR+ F G GFFP+CV   +R++KP 
Sbjct  115  IIADMFFPWATDSAAKFGIPRIVFHGLGFFPLCVSACVRQYKPQ  158



>gb|KDO45022.1| hypothetical protein CISIN_1g011142mg [Citrus sinensis]
Length=492

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 96/159 (60%), Gaps = 2/159 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MDTQ+  LH    P LA GHMIPM+D+AR  A+ GV  T +TTP+NAA+ +  + R  E 
Sbjct  1    MDTQANQLHFVLFPFLAQGHMIPMIDIARLLAQRGVIITIVTTPVNAARFNGILARAIES  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERL--AVEDRPD  395
            G QI I   + P +E+GLPEGCENL    +L   F FF A D  Q P+E     ++ RP+
Sbjct  61   GLQIKIVQFQLPCEEAGLPEGCENLDMVASLGLAFDFFTAADMLQEPVENFFAQLKPRPN  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSL  512
            CI++     ++   A KF IPR++F G+  F +  +N+L
Sbjct  121  CIISDMCLPYTAHIAGKFNIPRITFHGTCCFCLVCYNNL  159



>ref|XP_006492619.1| PREDICTED: UDP-glycosyltransferase 73C1-like [Citrus sinensis]
Length=492

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 96/159 (60%), Gaps = 2/159 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MDTQ+  LH    P LA GHMIPM+D+AR  A+ GV  T +TTP+NAA+ +  + R  E 
Sbjct  1    MDTQANQLHFVLFPFLAQGHMIPMIDIARLLAQRGVIITIVTTPVNAARFNGILARAIES  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERL--AVEDRPD  395
            G QI I   + P +E+GLPEGCENL    +L   F FF A D  Q P+E     ++ RP+
Sbjct  61   GLQIKIVQFQLPCEEAGLPEGCENLDMVASLGLAFDFFTAADMLQEPVENFFAQLKPRPN  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSL  512
            CI++     ++   A KF IPR++F G+  F +  +N+L
Sbjct  121  CIISDMCLPYTAHIAGKFNIPRITFHGTCCFCLVCYNNL  159



>ref|XP_006342640.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like 
[Solanum tuberosum]
Length=488

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 90/156 (58%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LHV F+P   P HMIP+VD+AR FA HGVK + +TT  NA     +ID   E G +I + 
Sbjct  9    LHVVFIPYFTPSHMIPLVDIARLFASHGVKVSIITTTYNALLFESSIDHATELGHKIFVY  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             L+FP  E G+PEG EN SA T+ E   S F  +   Q P+E L  E RP CIV+   + 
Sbjct  69   KLKFPSAEVGIPEGIENFSAATSQEMAISVFMGIPLLQKPMESLIFELRPHCIVSDMFFP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A +  IPRL F+ +     CV + L+ + PH
Sbjct  129  WTVDVAEQLKIPRLMFYPTNVMYHCVEHCLKLYAPH  164



>ref|XP_006492609.1| PREDICTED: UDP-glycosyltransferase 73C6-like [Citrus sinensis]
Length=504

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 100/168 (60%), Gaps = 2/168 (1%)
 Frame = +3

Query  33   TNKMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRE  212
            T+ M +++   H   LP LA GH+IPM+D+AR  A+HG   T +TTP+NAA+    + R 
Sbjct  11   TSAMISEASQFHFLLLPFLAQGHLIPMIDIARLLAQHGAIVTIVTTPVNAARFKTVLARA  70

Query  213  REFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVED--  386
             + G QI +  ++FP+KE+GLPEGCEN+    +++    FFN+L   Q P E L  E   
Sbjct  71   TQSGLQIRLTEIQFPWKEAGLPEGCENIDMLPSIDLASKFFNSLSMLQLPFENLFKEQTP  130

Query  387  RPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +P CI++   + W+ D AAKF +PR+ F G   F +   N LR  K H
Sbjct  131  KPCCIISDMGHPWTVDTAAKFNVPRIIFHGFSCFCLLCMNLLRDSKVH  178



>ref|XP_007153574.1| hypothetical protein PHAVU_003G047000g [Phaseolus vulgaris]
 gb|ESW25568.1| hypothetical protein PHAVU_003G047000g [Phaseolus vulgaris]
Length=461

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 103/164 (63%), Gaps = 5/164 (3%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  +   LH++F P LA GH IP +D+A  FA  GV+ T +TTPLNA  ISKAI++ +E 
Sbjct  1    MANKDASLHIFFFPFLAHGHTIPCIDMAILFAAKGVRTTIITTPLNAPIISKAIEKTKE-  59

Query  222  GSQISIRLLEFPYKE-SGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
               I+I+ ++FP  + +GLP+GCE++S   +L    +F  A    Q P E+L  +  P+C
Sbjct  60   ---INIQTIKFPSTDHTGLPQGCEHVSTLPSLHLLPAFHKATTLLQEPFEQLLRDQHPNC  116

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + W+ D AAKFGIPRL F G  FF +C +  +R ++P+
Sbjct  117  VVADMFFPWTTDSAAKFGIPRLVFHGMSFFSLCAYEVMRLYEPY  160



>gb|KEH30902.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=478

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  ++  LH+ F P LA GH+IP VDLAR F+  G+K T +TT LN   IS+ I +    
Sbjct  1    MTNENQELHIIFFPFLANGHIIPCVDLARVFSSRGLKVTIVTTHLNVPLISRTIGK----  56

Query  222  GSQISIRLLEFPY-KESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             ++I+I+ ++FP  +E+GLPEGCEN  +    ++   F  +    + P+E +  +++PDC
Sbjct  57   -AKINIKTIKFPSPEETGLPEGCENSESALAPDKFIKFMKSTLLLREPLEHVLEQEKPDC  115

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   + WS D AAKF IPR+ F G GFFP+CV    R++KP 
Sbjct  116  LVADMFFPWSTDSAAKFNIPRIVFHGLGFFPLCVLACTRQYKPQ  159



>ref|XP_010260609.1| PREDICTED: scopoletin glucosyltransferase-like [Nelumbo nucifera]
Length=482

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 96/163 (59%), Gaps = 1/163 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M T    LHV+F P +APG ++PMVD+AR FA  GVKAT +TT LN ++    IDR+ + 
Sbjct  1    MGTDDKQLHVFFFPFMAPGRLLPMVDMARLFAARGVKATIITTALNLSRFQAIIDRDIQS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G QI +  +E P+ ++G+PEGCEN+  T       +F  A    Q   E+L     PD I
Sbjct  61   GLQIQVHTVELPFSDAGIPEGCENVD-TLPSRDLLNFSKAAALLQPQFEKLVEHHLPDAI  119

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            ++   +TW+ D A K  IPRL F G   F +CV +S+ R+ PH
Sbjct  120  ISDMNFTWTVDIAHKHHIPRLEFNGFSCFSLCVTDSINRYTPH  162



>gb|AIS39471.1| flavonoid UDP-glucosyltransferase 2 [Citrus x paradisi]
Length=491

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 96/159 (60%), Gaps = 2/159 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MDTQ+  LH    P LA GHMIPM+D+AR  A+ GV  T +TTP+NAA+ +  + R  E 
Sbjct  1    MDTQANQLHFVLFPFLAQGHMIPMIDIARLLAQRGVIITIVTTPVNAARFNGILSRAIES  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERL--AVEDRPD  395
            G QI I   + P +E+GLPEGCENL    +L   F FF A D  Q P+E +   ++ RP+
Sbjct  61   GLQIKIVQFQLPCEEAGLPEGCENLDMVASLGLAFDFFTAADMLQEPVENVFAQLKPRPN  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSL  512
            CI++     ++   A KF IPR++  G+  F +  +N+L
Sbjct  121  CIISDMCLPYTAHIAGKFNIPRITLHGTCCFCLVCYNNL  159



>sp|Q2V6J9.1|UFOG7_FRAAN RecName: Full=UDP-glucose flavonoid 3-O-glucosyltransferase 7; 
AltName: Full=Flavonol 3-O-glucosyltransferase 7; Short=FaGT7 
[Fragaria x ananassa]
 gb|ABB92749.1| UDP-glucose glucosyltransferase [Fragaria x ananassa]
Length=487

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 100/164 (61%), Gaps = 6/164 (4%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+S   LH++FLP +A GH IP+ D+A+ F+ HG + T +TTPLNA   SKA  R   
Sbjct  3    METKSCQQLHIFFLPFMARGHSIPLTDIAKLFSSHGARCTIVTTPLNAPLFSKATQR---  59

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
               +I + L++FP  E+GLP+ CE+    TT +    F  A    +   E++  E RP C
Sbjct  60   --GEIELVLIKFPSAEAGLPQDCESADLITTQDMLGKFVKATFLIEPHFEKILDEHRPHC  117

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   +TW+ D AAKF IPRL F G+GFF +C   S+  ++PH
Sbjct  118  LVADAFFTWATDVAAKFRIPRLYFHGTGFFALCASLSVMMYQPH  161



>ref|XP_004304021.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 100/164 (61%), Gaps = 6/164 (4%)
 Frame = +3

Query  42   MDTQS-PPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M+T+S   LH++FLP +A GH IP+ D+A+ F+ HG + T +TTPLNA   SKA  R   
Sbjct  3    METKSCQQLHIFFLPFMARGHSIPLTDIAKLFSSHGARCTIVTTPLNAPLFSKATQR---  59

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
               +I + L++FP  E+GLP+ CE+    TT +    F  A    +   E++  E RP C
Sbjct  60   --GEIELVLIKFPSAEAGLPQDCESADLITTQDMLGKFVKATFLIEPHFEKILDEHRPHC  117

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +VA   +TW+ D AAKF IPRL F G+GFF +C   S+  ++PH
Sbjct  118  LVADAFFTWATDVAAKFRIPRLYFHGTGFFALCASLSVMMYQPH  161



>gb|AIS71990.1| UDP-glycosyl transferase 1, partial [Haloxylon ammodendron]
Length=490

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 96/158 (61%), Gaps = 2/158 (1%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF-GSQISI  239
            LHV F PL+A GHMIP +D AR FA  GVKAT +TTP N    ++AI++ +E  G  I I
Sbjct  4    LHVVFFPLMAHGHMIPTLDTARLFAARGVKATIITTPCNMPIFTQAIEKSKESEGPMIDI  63

Query  240  RLLEFPYKESGLPEGCENL-SATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPL  416
             + +F   E GLP+GCENL  A ++L+    FF A    Q  +E      RP  +VA   
Sbjct  64   EVFKFSLVEDGLPKGCENLKQAMSSLDMAQKFFRAASMLQQQLEVYLERVRPHVLVADMF  123

Query  417  YTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +TW+ + AAKF IPRL F+G+ FF  CV + +  H+P+
Sbjct  124  FTWATECAAKFNIPRLVFYGTSFFADCVRDMIMVHQPY  161



>ref|XP_004492513.1| PREDICTED: soyasapogenol B glucuronide galactosyltransferase-like 
[Cicer arietinum]
 gb|AGU14078.1| UDP-glycosyltransferase [Cicer arietinum]
Length=496

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 92/160 (58%), Gaps = 0/160 (0%)
 Frame = +3

Query  51   QSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQ  230
            +S  L++ FLP   PGHMIPM+D AR FA+HG   T +TT  N +   KAID +   G  
Sbjct  2    ESQQLNIVFLPYPTPGHMIPMIDTARLFAKHGANVTIITTHANVSSFQKAIDSDFSAGHS  61

Query  231  ISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAG  410
            I  +L++FP  + GLP+G EN+   T+LE        +   Q  IE L  +  PDCIV  
Sbjct  62   IKTQLIQFPSAQVGLPDGVENIKDGTSLEMLGKITRGIWMLQDQIEILFQDLEPDCIVTD  121

Query  411  PLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             +Y W+   AAK GIPRL F+ S +F  C  + +R+ KPH
Sbjct  122  MMYPWTVQCAAKLGIPRLHFYSSSYFSNCACHFIRKCKPH  161



>gb|ACS87992.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis]
Length=504

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 99/168 (59%), Gaps = 2/168 (1%)
 Frame = +3

Query  33   TNKMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRE  212
            T+ M +++   H   LP LA GH+IPM+D+AR  A+HG   T +TTP+NA +    + R 
Sbjct  11   TSAMISEASQFHFLLLPFLAQGHLIPMIDIARLLAQHGAIVTIVTTPVNAGRFKTVLARA  70

Query  213  REFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVED--  386
             + G QI +  ++FP+KE+GLPEGCEN+    +++    FFN+L   Q P E L  E   
Sbjct  71   TQSGLQIRLTEIQFPWKEAGLPEGCENIDMLPSIDLASKFFNSLSMLQLPFENLFKEQTP  130

Query  387  RPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +P CI++   + W+ D AAKF +PR+ F G   F +   N LR  K H
Sbjct  131  KPCCIISDMGHPWTVDTAAKFNVPRIIFHGFSCFCLLCMNLLRDSKVH  178



>gb|KGN43915.1| hypothetical protein Csa_7G073510 [Cucumis sativus]
Length=484

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 99/164 (60%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE-  218
            M T    LH++  P LA GHMIP+VD+A+  +  G+K T +TTPLN+  IS +I   +  
Sbjct  1    MSTHDSVLHIFLFPFLAQGHMIPIVDMAKLLSSRGIKITIVTTPLNSISISNSIKSSKSL  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
            + S I + +L+FP  E GLP+GCENL    +      F +AL+  Q P E   +E RP C
Sbjct  61   YASNIHLLILKFPSAEVGLPDGCENLDFVISPAMIPKFISALNLLQTPFEEAVMEHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            I+A   + W+ND AAK GIPRL+F GS FF  C    +R H+P+
Sbjct  121  IIADMFFPWANDVAAKVGIPRLNFHGSCFFSFCASEFVRIHQPY  164



>ref|XP_010107898.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
 gb|EXC17298.1| UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Morus notabilis]
Length=464

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 91/148 (61%), Gaps = 0/148 (0%)
 Frame = +3

Query  87   LAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIRLLEFPYKE  266
            +A GHMIP VD+A+ FA  G KAT + TP NA   ++ I+R R  G +I I LL+FP  +
Sbjct  1    MAHGHMIPAVDMAKLFASRGCKATVILTPANALFFTQEIERSRNLGLEIEIVLLKFPVLD  60

Query  267  SGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYTWSNDFAAK  446
              LPEGCEN+   T+ +    FF A    + P+E L  E RP+C+VA   ++W+ + AA+
Sbjct  61   FELPEGCENVHMLTSDDMVEKFFKATTMLEQPLEELIKEHRPNCLVADITFSWATEVAAR  120

Query  447  FGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            FGIPRL F G  FF +C    L  H+P+
Sbjct  121  FGIPRLVFHGVSFFALCTSICLMEHEPY  148



>ref|XP_007201019.1| hypothetical protein PRUPE_ppa005572mg [Prunus persica]
 gb|EMJ02218.1| hypothetical protein PRUPE_ppa005572mg [Prunus persica]
Length=454

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 96/156 (62%), Gaps = 15/156 (10%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P +A GH IP +D+A+ FA HGVK+T +TTP+NA   SKAI   +  G +I + 
Sbjct  9    LHMFFFPFMAQGHNIPFIDIAKLFASHGVKSTLITTPVNAPLFSKAIQSSKNLGFEIELL  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            +++FP +E GLP+GCE  S T  LE               IE++  + RP C+VA   + 
Sbjct  69   VIKFPNEEVGLPQGCE--STTFLLEPQ-------------IEQILDQHRPHCLVADSFFP  113

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D AAKFGI RL F G+GFFP C   ++  H+PH
Sbjct  114  WATDVAAKFGISRLIFHGTGFFPSCASLTVILHQPH  149



>gb|KGN43913.1| hypothetical protein Csa_7G073490 [Cucumis sativus]
Length=477

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 95/156 (61%), Gaps = 3/156 (2%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++  P LA GHMIPMVD+A+ F+  G+K T +TTP+N+  I+K++         I++ 
Sbjct  5    LHIFLFPFLAHGHMIPMVDMAKLFSSRGIKVTIVTTPINSISIAKSLHDSNPL---INLL  61

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            +L+FP  E GLP+GCENL    +      F +A+   Q P+E    E RP CIVA   + 
Sbjct  62   ILKFPSAEVGLPDGCENLDFLISPSMIPKFISAVSLLQTPLEEAITEHRPHCIVADMFFP  121

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ND + K GIPRL+F G+ FF  C    +R ++P+
Sbjct  122  WANDASVKLGIPRLNFHGTSFFSTCALEFMRIYEPY  157



>ref|XP_004137109.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Cucumis sativus]
Length=477

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 95/156 (61%), Gaps = 3/156 (2%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++  P LA GHMIPMVD+A+ F+  G+K T +TTP+N+  I+K++         I++ 
Sbjct  5    LHIFLFPFLAHGHMIPMVDMAKLFSSRGIKVTIVTTPINSISIAKSLHDSNPL---INLL  61

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            +L+FP  E GLP+GCENL    +      F +A+   Q P+E    E RP CIVA   + 
Sbjct  62   ILKFPSAEVGLPDGCENLDFLISPSMIPKFISAVSLLQTPLEEAITEHRPHCIVADMFFP  121

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ND + K GIPRL+F G+ FF  C    +R ++P+
Sbjct  122  WANDASVKLGIPRLNFHGTSFFSTCALEFMRIYEPY  157



>gb|AFK79039.1| glycosyltransferase UGT7 [Bupleurum chinense]
Length=474

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 97/155 (63%), Gaps = 1/155 (1%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            L V+F P +APGHMIP++D+A+ FA  GV +T +TTPLNA   +K +++  + G  +SI+
Sbjct  4    LEVFFFPAMAPGHMIPILDMAKLFASRGVHSTIITTPLNAPAFAKGVEKSNDSGFHMSIK  63

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            ++EFP K SGLPE CEN    T+      F  A    +  +E+L  E RP+C+VA   + 
Sbjct  64   IVEFP-KVSGLPEDCENADQITSPAMLPLFIRATMMLEEQVEQLLGEYRPNCLVADMFFP  122

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W+ D AAKF IP L F G+ FF  C +  +R H+P
Sbjct  123  WAVDSAAKFDIPTLIFHGTSFFASCANEQVRLHEP  157



>ref|XP_002265409.1| PREDICTED: UDP-glycosyltransferase 73C3 [Vitis vinifera]
Length=495

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 95/165 (58%), Gaps = 2/165 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +Q   LH   +P +APGH+IPMVD+AR  A+HGV  T +TTPLNA +    IDR  E 
Sbjct  1    MASQLLQLHFVLIPFMAPGHLIPMVDMARLLAQHGVIVTVVTTPLNATRFKSMIDRAVES  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERL--AVEDRPD  395
            G QI +  L+FP  E+GLPEGCEN+    +     +FF A    Q P+E+L   ++ RP 
Sbjct  61   GLQIHLLELQFPAVEAGLPEGCENVDLLPSRSLIRNFFVAASMLQQPLEQLFQELQPRPS  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            CI++G    W+ D A KF IPRL F     F     ++L   K H
Sbjct  121  CIISGKNLAWTADTARKFQIPRLYFDAMSCFAFSCSHNLEASKVH  165



>ref|XP_010905295.1| PREDICTED: scopoletin glucosyltransferase-like [Elaeis guineensis]
Length=481

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 97/156 (62%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH+ F P +A GHMIPM+++AR FA  G+K + ++TP+N  + SK  +R +  G Q+ I 
Sbjct  9    LHICFFPFMAHGHMIPMMEIARLFATRGLKISIISTPVNVPQYSKFTERSKILGYQVDIL  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            +++FP  E+GLPEGCE+L    + +   +FF A       +E+L  + RPD +VA   + 
Sbjct  69   VIKFPCVEAGLPEGCEHLDMALSGDLNRNFFTAAGMLGPQLEQLLKKHRPDGLVADMFFP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ D A   GIPR+ F G+GFF +C    +R ++PH
Sbjct  129  WATDIAHSLGIPRIVFHGTGFFSLCAAECVRLYEPH  164



>gb|KDP25000.1| hypothetical protein JCGZ_23983 [Jatropha curcas]
Length=471

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 94/153 (61%), Gaps = 5/153 (3%)
 Frame = +3

Query  87   LAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIRLLEFPYKE  266
            +A GH IP VD+A+ FA  G K T +TTP N   ISK I R ++ G  I+I++L+FP  E
Sbjct  1    MAHGHTIPTVDMAKLFAFRGHKTTIITTPSNEPLISKTIQRTKDLGFVINIQILKFPSVE  60

Query  267  SGLPEGCENLSATTTL-----EQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYTWSN  431
             GLPEGCEN+    +L     E    F  A+   Q P+E+L  E  P+C+VA   + W+ 
Sbjct  61   VGLPEGCENIDFVLSLVENGTEMMNKFCLAIGKLQEPLEKLLQECNPNCLVADMFFPWAT  120

Query  432  DFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            D AAKFGIPRL F G+ FF +C   S+R ++PH
Sbjct  121  DAAAKFGIPRLVFQGTSFFSLCAGESIRLYQPH  153



>ref|XP_008454967.1| PREDICTED: scopoletin glucosyltransferase-like [Cucumis melo]
Length=494

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 100/174 (57%), Gaps = 11/174 (6%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +    LH++  P LA GHMIPMVD+A+  +  G+K T +TTP+N+  IS +I   + F
Sbjct  1    MSSNDSELHIFLFPYLARGHMIPMVDMAKLLSSRGIKITIVTTPINSISISNSIKISKSF  60

Query  222  -GSQISIRLLEFPYKESGLPEGCENLSAT----------TTLEQTFSFFNALDHFQGPIE  368
              S+I + +L+FP  E GLP+GCENL             T       F +A D FQ P E
Sbjct  61   SASKIHLLILKFPSAEVGLPDGCENLDFVINGCENLDFVTNTAMIPKFISAFDLFQTPFE  120

Query  369  RLAVEDRPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
                E RP CIV    + W+ND AAKFGIPRL+F G+GFF  C    +R H+P+
Sbjct  121  EAVREHRPHCIVVDMFFPWANDVAAKFGIPRLNFHGTGFFSTCASEFIRIHEPY  174



>ref|XP_008241364.1| PREDICTED: UDP-glycosyltransferase 73C3-like [Prunus mume]
Length=496

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 95/155 (61%), Gaps = 3/155 (2%)
 Frame = +3

Query  51   QSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQ  230
            Q   LH  F PL+A GHMIP++D+AR FA+ G+  T  TTP NAA+    + R+ E G Q
Sbjct  5    QDHQLHFVFFPLMASGHMIPLIDIARLFAQQGIIVTIFTTPHNAARFQTVLTRDIESGLQ  64

Query  231  ISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVE--DRPDCIV  404
            I I  ++FP +E+GLPEGCEN     + E  F+ F A      P+E+L  E   +P+CI+
Sbjct  65   IRIIQVKFPAEEAGLPEGCENFDMLASPELVFNCFAATALLHKPVEKLFEELTPKPNCII  124

Query  405  AGPLYTWSNDFAAKFGIPRLSFWGSG-FFPVCVHN  506
            +    TW+   A+K+ IPR+SF G G F  +CVHN
Sbjct  125  SDVCLTWTTCIASKYHIPRISFTGRGCFCDLCVHN  159



>ref|XP_004249831.1| PREDICTED: UDP-glycosyltransferase 73D1 [Solanum lycopersicum]
Length=494

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +3

Query  42   MDTQSP-PLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            M T  P  LH  F+PLLA GHMIPM+D+A+ FA HGVK + +TTP NA++ +  I+R +E
Sbjct  1    MATNIPQKLHFVFIPLLAQGHMIPMIDMAKLFAEHGVKVSLVTTPHNASRFATIINRAKE  60

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDR--P  392
             G  I +  + FP ++ GLP GCENL +  + +   +F+ AL+  Q P+E + ++    P
Sbjct  61   IGLDIELIQIPFPSEQVGLPIGCENLDSVPSRDLIRNFYRALNMLQNPLENILLDQNTPP  120

Query  393  DCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             CI++    +W++  A KF +PRL F G   F +   ++L  H+P+
Sbjct  121  SCIISDKCLSWTSQTARKFNVPRLVFHGMCCFSLLSSHNLMLHRPY  166



>ref|XP_004505253.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Cicer arietinum]
Length=475

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 93/155 (60%), Gaps = 0/155 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P    GH+ P VD+A+ FA  GVKAT +TTP N   ISK I + +  G  I I+
Sbjct  9    LHIFFFPYFGHGHIKPTVDMAKLFASKGVKATIITTPSNETLISKFIQKSKISGHNIHIQ  68

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             +EF   ++ LP G E + +  + E  FSF  A +  Q P+E+L VE  PDC+VA   + 
Sbjct  69   TIEFTSPKTCLPNGSEIIDSIPSPESFFSFLKATESLQEPLEKLLVEQNPDCVVADMFFP  128

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            W  D A+KFGIPR+ F G+ FF +C    ++R +P
Sbjct  129  WVTDSASKFGIPRIVFHGTSFFSLCATYCIKRFEP  163



>dbj|BAF49309.1| putative glycosyltransferase [Eustoma grandiflorum]
Length=481

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 100/156 (64%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            LH++F P LA GHM+P +D+A+ F+  GVKAT +TTP +    +KAI+  R  G  IS+R
Sbjct  4    LHIFFFPFLAQGHMLPTIDMAKLFSSRGVKATLITTPYHNPMFTKAIESTRNLGFDISVR  63

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L++FPY E+GLPEG E+    T+ +    F    +  Q P+E+L  E  P  +VA   + 
Sbjct  64   LIKFPYAEAGLPEGIESTDQITSDDLRPXFLKGCNLLQXPLEQLLQEFHPHALVADVFFY  123

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ND AAKFGIPRL F GS  F +   +S+RRHKP+
Sbjct  124  WANDSAAKFGIPRLLFHGSSSFAMSATDSVRRHKPY  159



>ref|XP_004306178.1| PREDICTED: UDP-glycosyltransferase 73C1-like [Fragaria vesca 
subsp. vesca]
Length=489

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 96/165 (58%), Gaps = 2/165 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +Q   LH    P +A GHMIPMVD+AR  A+HGV  T +TTPLNAA+    + R +E 
Sbjct  1    MASQEYQLHFVLFPFMAQGHMIPMVDIARMLAQHGVTITIVTTPLNAARFETVLARAKES  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVE--DRPD  395
            G QI +  L+FP++ +GLP GCENL    +     +FFNA    Q P+E+L  E   +P 
Sbjct  61   GYQIRLMQLKFPFEGAGLPHGCENLDMVPSFNLASNFFNATKGLQEPVEKLFEELTPKPS  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            CI++     W+ + +  F IPR+SF G+  F +   ++ R  K H
Sbjct  121  CIISDMCLPWTINISRMFNIPRISFSGTCCFTLLCFSNARLSKVH  165



>ref|XP_010030443.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=239

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 95/160 (59%), Gaps = 0/160 (0%)
 Frame = +3

Query  51   QSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQ  230
            +S  +H++F P +A GHMIPM+D+A+ FA  G K+T + TP +     K+I + ++ G  
Sbjct  3    ESHQVHIFFFPFVASGHMIPMIDMAKLFAIRGCKSTLIATPHDKPTFLKSIAKTKDDGFD  62

Query  231  ISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAG  410
            I +  +  P KE GLPE C+N++  TT+E    FF A+      +ERL  +  PDC+V+ 
Sbjct  63   IDVITVTLPLKEVGLPEDCDNMNKVTTVEVRKQFFRAIKMLDQQLERLIEKLAPDCLVSD  122

Query  411  PLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             L  W+ + AAK+GIPRL F G+  F +     +R ++P 
Sbjct  123  MLLPWTTEIAAKWGIPRLVFHGTSAFSIASMECVRLYEPQ  162



>ref|XP_010447140.1| PREDICTED: UDP-glucosyl transferase 73B2 isoform X1 [Camelina 
sativa]
Length=483

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 99/174 (57%), Gaps = 11/174 (6%)
 Frame = +3

Query  42   MDTQSPP--LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRER  215
            M +  PP  LHV F P +A GHMIP VD+A+ F+  G K+T LTTPLNA  + K ID  +
Sbjct  1    MGSDHPPRKLHVIFFPFMADGHMIPTVDMAKLFSSRGAKSTILTTPLNAKFLQKPIDAFK  60

Query  216  EF--GSQISIRLLEFPYKESGLPEGCENL-------SATTTLEQTFSFFNALDHFQGPIE  368
                G +I I + +FP  + GLPEGCEN+       +A      T  FF++   F+  +E
Sbjct  61   NLNPGLEIDIMIFDFPCVQLGLPEGCENIDFFTGDNNADRQDHMTLKFFSSTRFFKDQLE  120

Query  369  RLAVEDRPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +L    RPDC++A   + W+ + A KF +PRL F G G+F +C    +R H P 
Sbjct  121  KLLQTTRPDCLIADMFFPWATEAAEKFNVPRLVFHGVGYFSLCSIYCMRVHNPQ  174



>ref|XP_009108750.1| PREDICTED: UDP-glucosyl transferase 73B2-like [Brassica rapa]
Length=513

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 99/177 (56%), Gaps = 9/177 (5%)
 Frame = +3

Query  27   QPTNKMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAID  206
            Q  + M + S  LHV F P++A GHMIP +D+A+ F+  G K+T LTTPLNA  + K ID
Sbjct  26   QSKSNMTSNSHKLHVMFFPIMAHGHMIPTLDMAKLFSSRGAKSTILTTPLNAKILQKPID  85

Query  207  REREFG--SQISIRLLEFPYKESGLPEGCENLSATTTLEQT-------FSFFNALDHFQG  359
              +      QI I++L+FP  + GLPEGCEN    T    +         FF A   F+ 
Sbjct  86   TFKNLNPSLQIEIQILDFPCVQLGLPEGCENADFFTLTNNSDDRRAMISKFFLATRFFKD  145

Query  360  PIERLAVEDRPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             +E L    RPDC++A   + W+ + A KF +PRL F G+G+F +C    +R H P 
Sbjct  146  QLENLLETRRPDCLIADMFFPWATEAAEKFHVPRLVFHGTGYFSLCASYCIRVHNPQ  202



>ref|XP_010028420.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=516

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 96/163 (59%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M+T+S  LH+ FLPL A GHMIPM+D+A+ FA  G K T +T+P  A   SK I+R  + 
Sbjct  32   METESNRLHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPAFAVIFSKQIERANQL  91

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +  ++ ++FP  E G+PEG EN  AT   +    F  A+   + P+  +  + RP+C+
Sbjct  92   GLEFHVQTVKFPSTEVGMPEGWENTDATAYSQNLPKFAEAVSLLREPVLHILEKHRPNCL  151

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   + W+ D AA+  IPRL F G+    +C    + RH+PH
Sbjct  152  VADFSFPWATDVAARLKIPRLVFGGTSIIAMCAEEVIARHQPH  194



>ref|XP_007027510.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY08012.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=493

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 96/165 (58%), Gaps = 2/165 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  Q P LH   +PL+ PGH+IPMVD+ R  A+HGV  T +TTPLNA +    IDR+   
Sbjct  1    MSPQFPELHFVLIPLMCPGHLIPMVDIGRLLAQHGVTVTIVTTPLNATRFKSIIDRDIAS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVED--RPD  395
            G QI +  L FP  E+GLPEGCEN+ A  +   + +F +A+   Q PIE+   E   +P 
Sbjct  61   GIQIQLLQLRFPCIEAGLPEGCENVDALPSRHLSKNFMDAVGKLQHPIEQFLEETQPKPS  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            CI++     W+ D A KF IPRL+F G+  F +   + +   K H
Sbjct  121  CIISDGHIPWTFDVAQKFKIPRLAFDGTSCFTLTCSHFIGMSKIH  165



>gb|KCW55162.1| hypothetical protein EUGRSUZ_I01117 [Eucalyptus grandis]
Length=485

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 96/163 (59%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M+T+S  LH+ FLPL A GHMIPM+D+A+ FA  G K T +T+P  A   SK I+R  + 
Sbjct  1    METESNRLHISFLPLPAQGHMIPMIDIAKAFATRGAKITVITSPAFAVIFSKQIERANQL  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G +  ++ ++FP  E G+PEG EN  AT   +    F  A+   + P+  +  + RP+C+
Sbjct  61   GLEFHVQTVKFPSTEVGMPEGWENTDATAYSQNLPKFAEAVSLLREPVLHILEKHRPNCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            VA   + W+ D AA+  IPRL F G+    +C    + RH+PH
Sbjct  121  VADFSFPWATDVAARLKIPRLVFGGTSIIAMCAEEVIARHQPH  163



>ref|XP_002518722.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF43647.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=461

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 91/147 (62%), Gaps = 0/147 (0%)
 Frame = +3

Query  87   LAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIRLLEFPYKE  266
            +A GH IP++D+A+ FA  G K + +TTP+NA  ISK+I R R  G +I I +++FP  E
Sbjct  1    MAQGHSIPLIDMAKLFASRGQKVSIITTPVNAPDISKSIQRSRVLGHKIDIVIIKFPCVE  60

Query  267  SGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYTWSNDFAAK  446
            +GLPEGCE+L   T+ E    FF A      P+E L  +  PDC+V+   + WSN  A+K
Sbjct  61   AGLPEGCEHLELVTSPEMVSVFFQATTILAQPLEHLLKKYCPDCLVSDTFFPWSNKVASK  120

Query  447  FGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            FGIPR+ F G+ FF  C    +  ++P
Sbjct  121  FGIPRIVFSGTCFFSSCASQCMYLYQP  147



>ref|XP_004159929.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucose flavonoid 3-O-glucosyltransferase 
7-like [Cucumis sativus]
Length=484

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 98/164 (60%), Gaps = 1/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M T    LH++  P LA GHMIP+VD+A+  +  G+K T +TTP N+  IS +I   + F
Sbjct  1    MSTHDSVLHIFLFPFLAQGHMIPIVDMAKLLSSRGIKITIVTTPRNSISISNSIKSSKSF  60

Query  222  -GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
              S I + +L+FP  E GLP+GCENL    +      F +AL+  Q P E   +E RP C
Sbjct  61   YASNIHLLILKFPSAEVGLPDGCENLDFVISPAMIPKFISALNLLQTPFEEAVMEHRPHC  120

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            I+A   + W+ND AAK GIPRL+F GS FF  C    +R H+P+
Sbjct  121  IIADMFFPWANDVAAKVGIPRLNFHGSCFFSFCASEFVRIHQPY  164



>ref|XP_008340172.1| PREDICTED: scopoletin glucosyltransferase-like [Malus domestica]
Length=481

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 102/164 (62%), Gaps = 2/164 (1%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRER--  215
            M +++   H+ F P +A GHMIP+ D+A+ FA  GVK T +TTPLNA  +SKA    +  
Sbjct  1    MGSENRDFHICFFPFMAHGHMIPISDMAKLFASQGVKTTIVTTPLNAPTLSKATQSSKTC  60

Query  216  EFGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPD  395
              G ++ I+ ++FP  E+GLPEGCE++ +  + E   +F+ A    Q P+E L + + P 
Sbjct  61   SGGVEVRIKTIKFPSVEAGLPEGCEHVDSLPSPEFRSNFYKATSLLQEPLEHLLLHENPS  120

Query  396  CIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKP  527
            C+VA  L+ W+ D AAKF IPRL F G+ FF +   + + +++P
Sbjct  121  CLVADFLFHWATDAAAKFDIPRLIFHGTSFFAMAASDIVTKYEP  164



>gb|KCW54504.1| hypothetical protein EUGRSUZ_I004473, partial [Eucalyptus grandis]
Length=278

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 98/164 (60%), Gaps = 0/164 (0%)
 Frame = +3

Query  39   KMDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRERE  218
            +M +++  LH++F PL+APGHMIPM+D+A+ FA  G K+T +TTP +     K+I + ++
Sbjct  32   QMGSENDQLHIFFFPLMAPGHMIPMIDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKTKD  91

Query  219  FGSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDC  398
             G  I +  +  P KE GLPE C+NLS  TT+E    F  A       +E L  +  P+C
Sbjct  92   SGFDIDVVTVTLPLKEVGLPEDCDNLSKVTTVEIRKQFMRATMMLDRQLELLIEKLAPNC  151

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            +++     W+ + AAK+ IPRL+F G+G F       +R ++PH
Sbjct  152  LISDMFLPWTTEIAAKYEIPRLTFHGTGAFSFAGTVCVRLYEPH  195



>ref|XP_009386835.1| PREDICTED: scopoletin glucosyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=483

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 98/163 (60%), Gaps = 2/163 (1%)
 Frame = +3

Query  45   DTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFG  224
            D  S PL V+F PL++PGHMIPM+D+A+ FARHG   T +TTP N   +  AIDR  +  
Sbjct  3    DDASQPLRVFFFPLMSPGHMIPMIDIAKLFARHGAAVTVVTTPGNEPLVRPAIDRRHDGT  62

Query  225  SQISIRLLEFPYKESGL-PEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
              + + LL FP   + L P   E+L A TT E    F NA+    GP++ L  + RPDC+
Sbjct  63   PVVDLLLLPFPDSVAHLVPSTGEHLGAITTAEHA-DFMNAVFALAGPLDDLLRQHRPDCL  121

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            V+  ++ W++  AA+ GIPRL F+G G F +CVH S+     H
Sbjct  122  VSDAMFPWTSATAAQLGIPRLVFYGPGAFLLCVHRSIEFRGHH  164



>ref|XP_006342639.1| PREDICTED: scopoletin glucosyltransferase-like [Solanum tuberosum]
Length=487

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 92/163 (56%), Gaps = 4/163 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M  ++  LHV F+P   P HMIP+VD+AR FA HGVK T +TT  NA     +I   ++ 
Sbjct  1    MAQENSELHVVFVPYFTPSHMIPLVDIARLFASHGVKVTIITTHYNALLFESSI---KDS  57

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G+QI I  L+FP  E GLPEG EN +A T  E     F  +   Q PIE L VE RP CI
Sbjct  58   GNQIFIHKLKFPSDEVGLPEGIENFTAVTASEMAM-LFMGIALLQKPIEDLIVELRPHCI  116

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            ++    TW+ D A +  IPR++F+       CV + L  H PH
Sbjct  117  ISDVCLTWTVDVAEQLKIPRVTFYPHNLMYHCVEHCLNVHTPH  159



>ref|XP_010246109.1| PREDICTED: scopoletin glucosyltransferase-like [Nelumbo nucifera]
Length=514

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 100/165 (61%), Gaps = 4/165 (2%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +++  LH+ FLP  A GH+IPMVD+AR  A  GVK T +TTPLNA     +IDR+   
Sbjct  24   MGSEADELHIAFLPFTALGHLIPMVDMARGLAARGVKVTIITTPLNALLFQNSIDRDITS  83

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTT-LEQTFS-FFNALDHFQGPIERL--AVEDR  389
            G  I +  L  P  +S LP+GCEN+S T+    +TF+  F AL   Q P+ +L   +  R
Sbjct  84   GHPIQLLTLPLPPMDSPLPDGCENISTTSAPFPETFNKLFQALSLLQQPLAQLFQHLRFR  143

Query  390  PDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHK  524
            P CIV+ PL  W+ DFA + GIPR+ F  + FF  CV  SL R++
Sbjct  144  PHCIVSDPLLPWTTDFANQLGIPRIIFHATNFFYHCVSESLVRYQ  188



>ref|XP_010030422.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
Length=304

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 97/163 (60%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +++  LH++F PL+APGHMIPM+D+A+ FA  G K+T +TTP +     K+I + ++ 
Sbjct  1    MGSENDQLHIFFFPLMAPGHMIPMIDMAKLFAIRGCKSTLITTPHDEPTFLKSIAKTKDS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G  I +  +  P KE GLPE C+NLS  TT+E    F  A       +E L  +  P+C+
Sbjct  61   GFDIDVVTVTLPLKEVGLPEDCDNLSKVTTVEIRKQFMRATMMLDRQLELLIEKLAPNCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            ++     W+ + AAK+ IPRL+F G+G F       +R ++PH
Sbjct  121  ISDMFLPWTTEIAAKYEIPRLTFHGTGAFSFAGTVCVRLYEPH  163



>ref|XP_009801094.1| PREDICTED: UDP-glycosyltransferase 73D1 [Nicotiana sylvestris]
Length=490

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 100/164 (61%), Gaps = 3/164 (2%)
 Frame = +3

Query  48   TQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF-G  224
            T S  LH   +PLLA GHMIPM+D+AR FA +GVK + +TTP NA++ +  I+R RE  G
Sbjct  4    TNSQKLHFVLIPLLAQGHMIPMIDMARLFAENGVKVSLVTTPHNASRFATIINRSRESEG  63

Query  225  SQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDR--PDC  398
             +I +  + FP +E GLP GCENL +  + +   +F+ AL+  Q P+E    E    P C
Sbjct  64   KEIELIQIPFPSEEVGLPPGCENLDSVPSRDLIRNFYTALNTLQKPVEIFLTEHDFPPSC  123

Query  399  IVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            I++    +W++  A KF +PRL F G   F +   ++L+ H+P+
Sbjct  124  IISDKCLSWTSQIARKFNVPRLVFHGMCCFSLLSSHNLKIHRPY  167



>ref|XP_010447141.1| PREDICTED: UDP-glycosyltransferase 73B3 isoform X2 [Camelina 
sativa]
Length=482

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 98/173 (57%), Gaps = 10/173 (6%)
 Frame = +3

Query  42   MDTQSPP--LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDRER  215
            M +  PP  LHV F P +A GHMIP VD+A+ F+  G K+T LTTPLNA  + K ID  +
Sbjct  1    MGSDHPPRKLHVMFFPFMAHGHMIPTVDMAKLFSSRGAKSTILTTPLNAKILQKPIDAFK  60

Query  216  EF--GSQISIRLLEFPYKESGLPEGCENLSATTT------LEQTFSFFNALDHFQGPIER  371
                G +I I++ +FP  + GLPEGCEN    T+       + T  FF +    +  +E+
Sbjct  61   NLNPGLEIDIQIFDFPCVQLGLPEGCENADFFTSDNNVDRQDMTLKFFMSTRFLKDQLEK  120

Query  372  LAVEDRPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            L    RPDC++A   + W+   A KF +PRL F G+G+F +C    +R H P 
Sbjct  121  LLQTTRPDCLIADMFFPWATKAAEKFNVPRLVFHGTGYFSLCSDYCIRVHNPQ  173



>ref|XP_004492514.1| PREDICTED: soyasapogenol B glucuronide galactosyltransferase-like 
[Cicer arietinum]
 gb|AGU14085.1| UDP-glycosyltransferase [Cicer arietinum]
Length=496

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 89/156 (57%), Gaps = 0/156 (0%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            L+V FLP   PGHMIPM+D AR FA+HG   T +TT  NA+   K+ID +   G  I  +
Sbjct  10   LNVIFLPFPTPGHMIPMIDTARLFAKHGANVTIITTHANASTFQKSIDNDFNSGHPIKTQ  69

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
            L++FP  + GLP+G ENL   T+ E        +   Q  IE L  +  PDCIV    Y 
Sbjct  70   LIQFPSAQVGLPDGVENLKDATSPEIISKISRGISMLQDHIENLFQDLEPDCIVTDMCYP  129

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ + AAK GIPRL F+ S +F  C    +R ++PH
Sbjct  130  WTVESAAKLGIPRLYFYSSSYFSNCASYFVRNYRPH  165



>ref|XP_009129082.1| PREDICTED: UDP-glycosyltransferase 73B3-like [Brassica rapa]
Length=294

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 96/171 (56%), Gaps = 8/171 (5%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M +    LHV F P +A GHMIP +D+A+ F+  G K+T LTTPLN+  + K ID  +  
Sbjct  1    MGSNPKRLHVMFFPFMAHGHMIPTLDMAKLFSSRGAKSTILTTPLNSKILQKHIDTFKNL  60

Query  222  GS--QISIRLLEFPYKESGLPEGCENLSATTT------LEQTFSFFNALDHFQGPIERLA  377
                +I I++L+FP  + GLPEGCEN    T        +    FF +   F+G +E L 
Sbjct  61   NPSLEIEIQVLDFPCVQLGLPEGCENADFLTLNNNDDRQDMITKFFLSTRFFKGQLENLL  120

Query  378  VEDRPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
               RPDC++A   + W+   A KF +PRL F G G+FP+C    ++ HKP 
Sbjct  121  ETMRPDCLIADMFFPWATQAAEKFNVPRLVFHGFGYFPLCFAYRIKLHKPQ  171



>ref|XP_004492516.1| PREDICTED: soyasapogenol B glucuronide galactosyltransferase-like 
[Cicer arietinum]
Length=488

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 99/163 (61%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M+++S PL+V FLP L PGHM PM+D AR FA+HGV  T +TT  NA    KAID +   
Sbjct  1    MESKSLPLNVIFLPHLTPGHMNPMIDTARLFAKHGVSVTIITTQANALIFQKAIDNDLHS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G  I   ++++P  + GLP+G EN+   T+ E        +   Q  IE L  + +PDC+
Sbjct  61   GYFIKTCVIQYPTAQVGLPDGVENIKDATSHEMLGKIILGISMLQDQIENLLQDLQPDCL  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            V+  LY W+ + AAK GIPRL ++ S +F  C  + +++HKPH
Sbjct  121  VSDMLYPWTVESAAKLGIPRLYYYSSSYFSSCAAHFIKKHKPH  163



>ref|XP_009407035.1| PREDICTED: anthocyanin 3'-O-beta-glucosyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=475

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 93/159 (58%), Gaps = 3/159 (2%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQ---I  233
            LHV+FLP LAPGHMIPMVDLAR FA  GV++T +TT  N   I   +D      S    I
Sbjct  3    LHVFFLPFLAPGHMIPMVDLARVFAGRGVRSTIVTTAANVPLIQPTLDLANADASLRHPI  62

Query  234  SIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGP  413
             I +L FP  ESG+ +G ENL A    E T  F  A++  + P ++L    RPD IVA  
Sbjct  63   QILVLSFPCLESGISQGYENLFAFNNSEITPEFATAINMLEAPFKQLLRAHRPDSIVADI  122

Query  414  LYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             Y W++D A +FGIPRL F GS  F   V  +LRR K H
Sbjct  123  FYAWASDVAKEFGIPRLVFHGSNTFFTVVSGALRRLKLH  161



>ref|XP_010048320.1| PREDICTED: scopoletin glucosyltransferase-like [Eucalyptus grandis]
 gb|KCW80575.1| hypothetical protein EUGRSUZ_C01938 [Eucalyptus grandis]
Length=495

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 97/169 (57%), Gaps = 6/169 (4%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            MD++   LH++FLP +A GHMIP +++AR FA  G+KAT +TT LN A   K I+R +  
Sbjct  1    MDSELHRLHIFFLPFMAHGHMIPTIEMARLFATRGIKATIVTTHLNLAVYLKHIERTKHS  60

Query  222  GSQISIRLLEFPYKESGLPEGCENL------SATTTLEQTFSFFNALDHFQGPIERLAVE  383
            G  I I  ++ P  E GLPEGCEN+      S   + E    F  AL   + P+ RL  E
Sbjct  61   GLDIDILTVKLPSVELGLPEGCENIEAIISSSGANSRELVVKFVKALSMLREPLLRLLQE  120

Query  384  DRPDCIVAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
             RPDC++A   + W+ D AA+  IPR+       F +  + ++ R++PH
Sbjct  121  HRPDCLIADMFFPWATDVAAECNIPRIVVNALCLFSMSAYETISRYEPH  169



>ref|XP_003623451.1| UDP-glucuronosyltransferase 2B4 [Medicago truncatula]
 gb|AES79669.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=487

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 99/163 (61%), Gaps = 0/163 (0%)
 Frame = +3

Query  42   MDTQSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREF  221
            M++QS  L+V FLP L PGHM PM+D AR FA+HG+  T +TT  NA    KAID +   
Sbjct  1    MESQSQKLNVIFLPYLTPGHMNPMIDTARLFAKHGINVTIITTHANALLFKKAIDNDTCC  60

Query  222  GSQISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCI  401
            G  I   +++FP  + GLPEG EN+   T+LE      + +   Q  IE L  + +PDCI
Sbjct  61   GYSIRTCVIQFPSAQVGLPEGVENIKDGTSLEMLGKIGHGISLLQDQIEILFQDLQPDCI  120

Query  402  VAGPLYTWSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            V+   Y W+ + AAK G+PR+ ++ S +F  C  + +R++KPH
Sbjct  121  VSDMFYPWTVESAAKLGVPRIYYYSSSYFSSCCAHFIRKYKPH  163



>ref|XP_008241359.1| PREDICTED: UDP-glycosyltransferase 73C1-like [Prunus mume]
Length=490

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 95/155 (61%), Gaps = 3/155 (2%)
 Frame = +3

Query  51   QSPPLHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQ  230
            Q   LH  F PL+A GHMIP++D+AR FA+ G+  T  TTP NAA+    + R+ E G Q
Sbjct  5    QDHQLHFVFFPLMASGHMIPLIDIARLFAQQGIIVTIFTTPHNAARFQTVLTRDIESGLQ  64

Query  231  ISIRLLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVE--DRPDCIV  404
            I I  ++FP +E+GLPEGCEN     + E  F+FF A      P+E+L  E   +P+CI+
Sbjct  65   IRIIQVKFPAEEAGLPEGCENFDMLPSPELVFNFFAATALLHKPVEKLFEELTPKPNCII  124

Query  405  AGPLYTWSNDFAAKFGIPRLSFWGSGFFP-VCVHN  506
            +   + W+   A+K  IPR+SF G+G F  +C HN
Sbjct  125  SDVTFPWTYSIASKHHIPRISFGGTGCFSFLCAHN  159



>ref|XP_004304714.1| PREDICTED: scopoletin glucosyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=477

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 95/156 (61%), Gaps = 3/156 (2%)
 Frame = +3

Query  63   LHVYFLPLLAPGHMIPMVDLARQFARHGVKATFLTTPLNAAKISKAIDREREFGSQISIR  242
            +H++  P +A GHMIP+ D+A+ FA HGVK T +TTPLNA + ++     +     I I+
Sbjct  9    VHIFLFPFMAHGHMIPVSDMAKLFASHGVKITIVTTPLNAIRFAQTTQSSK---FNIQIK  65

Query  243  LLEFPYKESGLPEGCENLSATTTLEQTFSFFNALDHFQGPIERLAVEDRPDCIVAGPLYT  422
             +EFP +E+GLP+GCEN+    +      FF A    Q   E L  E +P CIVA   + 
Sbjct  66   AIEFPSEEAGLPKGCENVDTLPSPNLVNPFFKATRLLQPQFEELLKEVKPTCIVADMFFP  125

Query  423  WSNDFAAKFGIPRLSFWGSGFFPVCVHNSLRRHKPH  530
            W+ + AAKFGIPRL F G+ FF +C  + ++ ++P+
Sbjct  126  WATEAAAKFGIPRLVFHGTSFFAMCASDCVKVYEPY  161



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200