BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I10

Length=593
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             272   7e-85   Solanum tuberosum [potatoes]
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             272   1e-84   Solanum lycopersicum
gb|KGN64509.1|  hypothetical protein Csa_1G062350                       261   6e-82   Cucumis sativus [cucumbers]
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             262   5e-81   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             257   4e-79   Tarenaya hassleriana [spider flower]
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         255   2e-78   Jatropha curcas
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             255   2e-78   Sesamum indicum [beniseed]
ref|XP_009782819.1|  PREDICTED: L-ascorbate oxidase homolog             255   4e-78   Nicotiana sylvestris
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog             254   7e-78   Tarenaya hassleriana [spider flower]
ref|XP_009629876.1|  PREDICTED: L-ascorbate oxidase homolog             253   1e-77   Nicotiana tomentosiformis
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             253   2e-77   Cucumis melo [Oriental melon]
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           251   9e-77   
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           251   9e-77   
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             251   2e-76   
gb|KJB67220.1|  hypothetical protein B456_010G181000                    248   4e-76   Gossypium raimondii
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             249   6e-76   Fragaria vesca subsp. vesca
gb|KJB67219.1|  hypothetical protein B456_010G181000                    248   6e-76   Gossypium raimondii
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433             248   1e-75   Arabidopsis lyrata subsp. lyrata
gb|KJB67218.1|  hypothetical protein B456_010G181000                    248   2e-75   Gossypium raimondii
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             248   2e-75   
gb|KHG02352.1|  L-ascorbate oxidase                                     248   2e-75   Gossypium arboreum [tree cotton]
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog             248   2e-75   Vitis vinifera
ref|XP_007213899.1|  hypothetical protein PRUPE_ppa003872mg             245   3e-75   
ref|NP_193932.1|  protein SKU5 similar 4                                247   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             246   5e-75   Citrus clementina [clementine]
ref|XP_002524823.1|  multicopper oxidase, putative                      246   6e-75   Ricinus communis
ref|XP_006282576.1|  hypothetical protein CARUB_v10004445mg             247   7e-75   
emb|CDP04415.1|  unnamed protein product                                246   9e-75   Coffea canephora [robusta coffee]
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         245   2e-74   Jatropha curcas
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             245   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             245   2e-74   Prunus persica
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             245   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             244   3e-74   
ref|XP_010434093.1|  PREDICTED: L-ascorbate oxidase homolog             244   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010439384.1|  PREDICTED: L-ascorbate oxidase homolog             244   3e-74   
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             244   3e-74   Prunus mume [ume]
ref|XP_010448953.1|  PREDICTED: L-ascorbate oxidase homolog             244   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             244   4e-74   Prunus persica
gb|AGJ03718.1|  multicopper oxidase                                     244   6e-74   Citrus maxima [buntan]
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         244   6e-74   
ref|XP_006413696.1|  hypothetical protein EUTSA_v10024862mg             243   1e-73   Eutrema salsugineum [saltwater cress]
ref|XP_003549771.1|  PREDICTED: L-ascorbate oxidase homolog             243   1e-73   Glycine max [soybeans]
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             243   1e-73   Prunus mume [ume]
gb|EPS74059.1|  hypothetical protein M569_00695                         242   2e-73   Genlisea aurea
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             242   2e-73   Citrus clementina [clementine]
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             242   3e-73   Glycine max [soybeans]
gb|AFK33407.1|  unknown                                                 238   3e-73   Lotus japonicus
ref|XP_007046384.1|  SKU5 similar 5 isoform 2                           239   4e-73   
ref|XP_009135529.1|  PREDICTED: L-ascorbate oxidase homolog             241   5e-73   Brassica rapa
emb|CDX79120.1|  BnaA01g11870D                                          241   6e-73   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             241   8e-73   Citrus sinensis [apfelsine]
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             241   9e-73   Eucalyptus grandis [rose gum]
gb|KHN03487.1|  L-ascorbate oxidase like                                241   1e-72   Glycine soja [wild soybean]
emb|CDP19581.1|  unnamed protein product                                240   1e-72   Coffea canephora [robusta coffee]
emb|CDP10787.1|  unnamed protein product                                240   1e-72   Coffea canephora [robusta coffee]
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             240   2e-72   Cucumis melo [Oriental melon]
emb|CDX82897.1|  BnaC01g13470D                                          240   2e-72   
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             240   2e-72   Oryza brachyantha
gb|EAZ38022.1|  hypothetical protein OsJ_22366                          239   2e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             240   2e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ02087.1|  hypothetical protein OsI_24168                          239   2e-72   Oryza sativa Indica Group [Indian rice]
ref|NP_001058365.1|  Os06g0678800                                       239   2e-72   
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg                239   4e-72   Erythranthe guttata [common monkey flower]
gb|KJB15896.1|  hypothetical protein B456_002G202300                    236   4e-72   Gossypium raimondii
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             239   5e-72   Nelumbo nucifera [Indian lotus]
gb|KJB57755.1|  hypothetical protein B456_009G179300                    238   9e-72   Gossypium raimondii
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             238   1e-71   
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             238   1e-71   Nicotiana sylvestris
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           238   1e-71   
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    238   1e-71   Populus euphratica
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             238   1e-71   
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             238   1e-71   Solanum lycopersicum
gb|KCW70295.1|  hypothetical protein EUGRSUZ_F03538                     236   1e-71   Eucalyptus grandis [rose gum]
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             237   1e-71   
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             237   2e-71   Cicer arietinum [garbanzo]
gb|KJB47732.1|  hypothetical protein B456_008G038600                    231   2e-71   Gossypium raimondii
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             238   2e-71   Brachypodium distachyon [annual false brome]
gb|KHG03845.1|  L-ascorbate oxidase                                     237   2e-71   Gossypium arboreum [tree cotton]
gb|KEH30610.1|  multi-copper oxidase-like protein                       234   4e-71   Medicago truncatula
ref|XP_007017957.1|  SKU5 similar 5 isoform 3                           234   5e-71   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             236   5e-71   
gb|KHG11003.1|  L-ascorbate oxidase                                     236   6e-71   Gossypium arboreum [tree cotton]
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             236   7e-71   Tarenaya hassleriana [spider flower]
gb|KHN05478.1|  L-ascorbate oxidase like                                236   8e-71   Glycine soja [wild soybean]
gb|KJB15897.1|  hypothetical protein B456_002G202300                    236   9e-71   Gossypium raimondii
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             236   9e-71   Glycine max [soybeans]
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             235   1e-70   Glycine max [soybeans]
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             235   1e-70   Phoenix dactylifera
ref|XP_010063104.1|  PREDICTED: L-ascorbate oxidase homolog             235   1e-70   Eucalyptus grandis [rose gum]
ref|XP_007017956.1|  SKU5 similar 5 isoform 2                           233   1e-70   
gb|ACN50176.1|  pectinesterase                                          235   1e-70   Annona cherimola [cherimoya]
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             235   1e-70   Nelumbo nucifera [Indian lotus]
gb|KGN43515.1|  hypothetical protein Csa_7G043570                       233   1e-70   Cucumis sativus [cucumbers]
ref|XP_007041705.1|  SKU5 similar 5                                     235   2e-70   
gb|KDP36848.1|  hypothetical protein JCGZ_08139                         235   2e-70   Jatropha curcas
ref|XP_008365718.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    230   2e-70   
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog             234   2e-70   Cucumis melo [Oriental melon]
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             234   2e-70   Cucumis sativus [cucumbers]
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                    234   2e-70   Arabis alpina [alpine rockcress]
ref|XP_010686816.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    234   3e-70   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB58003.1|  hypothetical protein B456_009G189900                    232   3e-70   Gossypium raimondii
ref|NP_001053555.1|  Os04g0561900                                       234   3e-70   
ref|XP_002528421.1|  multicopper oxidase, putative                      234   3e-70   
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         234   3e-70   Jatropha curcas
emb|CAH67167.1|  H0211B05.4                                             234   3e-70   Oryza sativa [red rice]
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   234   3e-70   Medicago truncatula
ref|NP_001147597.1|  LOC100281206 precursor                             234   3e-70   Zea mays [maize]
gb|KJB47729.1|  hypothetical protein B456_008G038600                    232   3e-70   Gossypium raimondii
ref|XP_006390228.1|  hypothetical protein EUTSA_v10018373mg             233   3e-70   
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             234   4e-70   Elaeis guineensis
ref|XP_004145593.1|  PREDICTED: L-ascorbate oxidase homolog             234   4e-70   
gb|KGN55480.1|  hypothetical protein Csa_4G653410                       231   4e-70   Cucumis sativus [cucumbers]
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog             234   4e-70   
gb|KJB58004.1|  hypothetical protein B456_009G189900                    232   5e-70   Gossypium raimondii
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             233   6e-70   Glycine max [soybeans]
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             233   6e-70   Nicotiana sylvestris
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             233   6e-70   Solanum tuberosum [potatoes]
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog             233   6e-70   Pyrus x bretschneideri [bai li]
gb|KEH30611.1|  multi-copper oxidase-like protein                       233   7e-70   Medicago truncatula
emb|CDX73238.1|  BnaC06g36860D                                          233   8e-70   
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             233   8e-70   Populus euphratica
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    233   8e-70   Nicotiana tomentosiformis
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g             233   8e-70   
ref|XP_006435292.1|  hypothetical protein CICLE_v10000783mg             230   9e-70   
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             233   9e-70   Malus domestica [apple tree]
ref|XP_007017955.1|  SKU5 similar 5 isoform 1                           233   9e-70   
gb|KHG21048.1|  L-ascorbate oxidase                                     233   1e-69   Gossypium arboreum [tree cotton]
gb|EMS67789.1|  L-ascorbate oxidase-like protein                        234   1e-69   Triticum urartu
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             233   1e-69   Vitis vinifera
gb|KJB59710.1|  hypothetical protein B456_009G268100                    231   1e-69   Gossypium raimondii
emb|CAN83942.1|  hypothetical protein VITISV_013559                     233   1e-69   Vitis vinifera
ref|XP_010278638.1|  PREDICTED: L-ascorbate oxidase homolog             232   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             233   1e-69   Citrus sinensis [apfelsine]
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog             232   1e-69   Brassica rapa
gb|KHN33820.1|  L-ascorbate oxidase like                                232   2e-69   Glycine soja [wild soybean]
gb|KEH40258.1|  multi-copper oxidase-like protein                       232   2e-69   Medicago truncatula
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    232   2e-69   Nicotiana tomentosiformis
ref|XP_002510630.1|  multicopper oxidase, putative                      232   2e-69   Ricinus communis
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             232   2e-69   Solanum lycopersicum
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             232   2e-69   Citrus clementina [clementine]
ref|XP_002518462.1|  multicopper oxidase, putative                      232   2e-69   Ricinus communis
ref|XP_009630899.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    232   2e-69   
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             232   2e-69   Glycine max [soybeans]
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             232   2e-69   Phaseolus vulgaris [French bean]
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             232   2e-69   Eutrema salsugineum [saltwater cress]
gb|KJB14335.1|  hypothetical protein B456_002G120000                    232   2e-69   Gossypium raimondii
gb|KHG21949.1|  L-ascorbate oxidase                                     232   2e-69   Gossypium arboreum [tree cotton]
gb|KHF99506.1|  L-ascorbate oxidase                                     232   3e-69   Gossypium arboreum [tree cotton]
gb|KJB47731.1|  hypothetical protein B456_008G038600                    231   3e-69   Gossypium raimondii
ref|XP_004505676.1|  PREDICTED: L-ascorbate oxidase homolog             231   3e-69   Cicer arietinum [garbanzo]
ref|XP_007221787.1|  hypothetical protein PRUPE_ppa003860mg             231   3e-69   Prunus persica
gb|KCW55614.1|  hypothetical protein EUGRSUZ_I01478                     229   3e-69   Eucalyptus grandis [rose gum]
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             231   4e-69   Tarenaya hassleriana [spider flower]
dbj|BAK00459.1|  predicted protein                                      231   4e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             231   4e-69   Phoenix dactylifera
gb|KHF99853.1|  L-ascorbate oxidase                                     231   5e-69   Gossypium arboreum [tree cotton]
ref|XP_002438855.1|  hypothetical protein SORBIDRAFT_10g027270          231   5e-69   Sorghum bicolor [broomcorn]
gb|KJB47727.1|  hypothetical protein B456_008G038600                    231   5e-69   Gossypium raimondii
ref|XP_004291312.1|  PREDICTED: L-ascorbate oxidase homolog             231   5e-69   Fragaria vesca subsp. vesca
gb|KJB58002.1|  hypothetical protein B456_009G189900                    231   5e-69   Gossypium raimondii
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog             231   6e-69   Cicer arietinum [garbanzo]
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             231   6e-69   Capsella rubella
gb|KJB59711.1|  hypothetical protein B456_009G268100                    231   6e-69   Gossypium raimondii
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             231   7e-69   Nicotiana sylvestris
emb|CDX87633.1|  BnaA07g32400D                                          230   7e-69   
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             230   8e-69   Camelina sativa [gold-of-pleasure]
gb|KGN43295.1|  hypothetical protein Csa_7G018770                       228   8e-69   Cucumis sativus [cucumbers]
ref|XP_006435293.1|  hypothetical protein CICLE_v10000783mg             230   8e-69   Citrus clementina [clementine]
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             230   9e-69   Fragaria vesca subsp. vesca
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             230   9e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_004966212.1|  PREDICTED: L-ascorbate oxidase homolog             230   9e-69   Setaria italica
dbj|BAJ91397.1|  predicted protein                                      230   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008221175.1|  PREDICTED: L-ascorbate oxidase homolog             230   1e-68   Prunus mume [ume]
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             230   1e-68   Vitis vinifera
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             229   2e-68   
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             229   2e-68   Prunus mume [ume]
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    229   2e-68   
gb|KFK34651.1|  hypothetical protein AALP_AA5G173600                    229   2e-68   Arabis alpina [alpine rockcress]
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             229   3e-68   Cucumis sativus [cucumbers]
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             229   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             229   3e-68   Glycine max [soybeans]
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             229   3e-68   Cucumis melo [Oriental melon]
emb|CDY35790.1|  BnaA08g04510D                                          229   4e-68   Brassica napus [oilseed rape]
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             229   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009107631.1|  PREDICTED: L-ascorbate oxidase homolog             229   4e-68   Brassica rapa
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             229   4e-68   Glycine max [soybeans]
emb|CDY67479.1|  BnaCnng55180D                                          228   4e-68   Brassica napus [oilseed rape]
gb|AAL24296.1|  Unknown protein                                         228   4e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAF99833.1|AC008046_5  Putative pectinesterase                       228   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             228   5e-68   Tarenaya hassleriana [spider flower]
ref|NP_564479.1|  SKU5 similar 6                                        228   5e-68   Arabidopsis thaliana [mouse-ear cress]
gb|KEH36280.1|  multi-copper oxidase-like protein                       228   5e-68   Medicago truncatula
gb|ACJ85585.1|  unknown                                                 228   5e-68   Medicago truncatula
ref|XP_009128157.1|  PREDICTED: L-ascorbate oxidase homolog             228   5e-68   Brassica rapa
gb|AFK35121.1|  unknown                                                 228   5e-68   Medicago truncatula
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             228   5e-68   Glycine max [soybeans]
gb|ABK95805.1|  unknown                                                 228   5e-68   Populus trichocarpa [western balsam poplar]
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             228   5e-68   Phaseolus vulgaris [French bean]
ref|NP_177743.1|  SKU5-like 5 protein                                   228   6e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AGT57427.1|  ascorbate oxidase                                       228   6e-68   Prunus persica
emb|CDY55201.1|  BnaCnng28410D                                          228   6e-68   Brassica napus [oilseed rape]
gb|AAL09733.1|  At1g76160/T23E18_10                                     228   6e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDY68834.1|  BnaCnng60730D                                          228   7e-68   Brassica napus [oilseed rape]
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             228   7e-68   Eucalyptus grandis [rose gum]
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein         228   8e-68   Populus trichocarpa [western balsam poplar]
gb|KFK28784.1|  hypothetical protein AALP_AA7G047600                    228   8e-68   Arabis alpina [alpine rockcress]
gb|AAM97070.1|  pectinesterase, putative                                228   8e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136137.1|  hypothetical protein PHAVU_009G021000g             228   9e-68   Phaseolus vulgaris [French bean]
ref|XP_008789824.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    224   9e-68   
ref|XP_011041276.1|  PREDICTED: L-ascorbate oxidase homolog             228   9e-68   Populus euphratica
ref|XP_010089487.1|  L-ascorbate oxidase-like protein                   221   9e-68   
ref|XP_011034917.1|  PREDICTED: L-ascorbate oxidase homolog             228   1e-67   Populus euphratica
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             227   1e-67   Prunus persica
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             227   1e-67   Populus euphratica
ref|XP_002888337.1|  hypothetical protein ARALYDRAFT_475543             227   1e-67   
gb|KEH29685.1|  multi-copper oxidase-like protein                       227   1e-67   Medicago truncatula
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog             227   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010500092.1|  PREDICTED: L-ascorbate oxidase homolog             227   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010101299.1|  L-ascorbate oxidase-like protein                   227   1e-67   Morus notabilis
ref|XP_003529638.1|  PREDICTED: L-ascorbate oxidase homolog             227   2e-67   Glycine max [soybeans]
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog             227   2e-67   Cicer arietinum [garbanzo]
ref|XP_002300669.1|  multi-copper oxidase type 1 family protein         227   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             226   3e-67   Sesamum indicum [beniseed]
ref|XP_003610452.1|  L-ascorbate oxidase-like protein                   226   3e-67   Medicago truncatula
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             226   4e-67   Nicotiana sylvestris
ref|XP_010461374.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    226   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460          226   4e-67   Amborella trichopoda
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             226   4e-67   Cucumis sativus [cucumbers]
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             226   5e-67   Sesamum indicum [beniseed]
ref|XP_006307199.1|  hypothetical protein CARUB_v10008790mg             226   5e-67   Capsella rubella
ref|XP_006411628.1|  hypothetical protein EUTSA_v10024832mg             226   5e-67   Eutrema salsugineum [saltwater cress]
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             226   5e-67   Cucumis melo [Oriental melon]
ref|XP_010103298.1|  L-ascorbate oxidase-like protein                   227   6e-67   
ref|XP_010667351.1|  PREDICTED: L-ascorbate oxidase homolog             225   9e-67   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA62868.1|  TPA: hypothetical protein ZEAMMB73_701617              216   1e-66   
gb|KFK44289.1|  hypothetical protein AALP_AA1G238900                    213   2e-66   Arabis alpina [alpine rockcress]
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007153964.1|  hypothetical protein PHAVU_003G080100g             224   2e-66   Phaseolus vulgaris [French bean]
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-66   
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   224   2e-66   Morus notabilis
ref|XP_004487420.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-66   Cicer arietinum [garbanzo]
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-66   
emb|CAA65634.1|  PS60                                                   224   2e-66   Nicotiana tabacum [American tobacco]
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-66   Nicotiana tomentosiformis
tpg|DAA62867.1|  TPA: hypothetical protein ZEAMMB73_701617              214   3e-66   
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             224   3e-66   Fragaria vesca subsp. vesca
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    224   3e-66   Phoenix dactylifera
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   223   3e-66   Medicago truncatula
ref|XP_010052867.1|  PREDICTED: L-ascorbate oxidase homolog             223   3e-66   Eucalyptus grandis [rose gum]
ref|XP_009101945.1|  PREDICTED: L-ascorbate oxidase homolog             224   4e-66   Brassica rapa
ref|XP_006366591.1|  PREDICTED: L-ascorbate oxidase homolog             224   4e-66   
emb|CDY54804.1|  BnaA06g40970D                                          225   5e-66   Brassica napus [oilseed rape]
ref|XP_010686815.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    223   5e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             223   6e-66   Brachypodium distachyon [annual false brome]
gb|ABK25092.1|  unknown                                                 223   6e-66   Picea sitchensis
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog             222   9e-66   Elaeis guineensis
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             222   1e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002866796.1|  hypothetical protein ARALYDRAFT_490604             222   1e-65   
gb|KHG04142.1|  L-ascorbate oxidase                                     222   2e-65   Gossypium arboreum [tree cotton]
ref|XP_010323833.1|  PREDICTED: L-ascorbate oxidase homolog             222   2e-65   Solanum lycopersicum
emb|CDY64276.1|  BnaCnng43630D                                          223   2e-65   Brassica napus [oilseed rape]
ref|XP_004507683.1|  PREDICTED: L-ascorbate oxidase homolog             221   2e-65   
ref|XP_010555198.1|  PREDICTED: L-ascorbate oxidase homolog             221   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_004238406.1|  PREDICTED: L-ascorbate oxidase homolog             221   2e-65   
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog             221   3e-65   Vitis vinifera
emb|CAB37498.1|  putative pectinesterase                                221   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195555.2|  protein SKU5 similar 9                                221   4e-65   Arabidopsis thaliana [mouse-ear cress]
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                221   4e-65   Erythranthe guttata [common monkey flower]
ref|XP_006342102.1|  PREDICTED: L-ascorbate oxidase homolog             221   4e-65   Solanum tuberosum [potatoes]
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             220   5e-65   
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             220   6e-65   Pyrus x bretschneideri [bai li]
ref|XP_009803721.1|  PREDICTED: L-ascorbate oxidase homolog             221   6e-65   Nicotiana sylvestris
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog             220   7e-65   Nicotiana tomentosiformis
ref|XP_009418785.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    220   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             220   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418784.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    220   8e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    220   9e-65   Nicotiana sylvestris
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog             219   1e-64   Elaeis guineensis
emb|CAB08077.1|  pectinesterase                                         219   1e-64   Solanum lycopersicum
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog             219   1e-64   
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             219   1e-64   
gb|KFK30447.1|  hypothetical protein AALP_AA7G262200                    219   3e-64   
gb|ABR18324.1|  unknown                                                 218   3e-64   
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        218   4e-64   
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             218   4e-64   
gb|KJB50840.1|  hypothetical protein B456_008G189200                    218   5e-64   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             218   6e-64   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                218   6e-64   
ref|XP_010431777.1|  PREDICTED: L-ascorbate oxidase homolog             218   6e-64   
emb|CDP07321.1|  unnamed protein product                                218   6e-64   
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420          218   7e-64   
dbj|BAK04971.1|  predicted protein                                      218   8e-64   
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             217   8e-64   
ref|XP_010436936.1|  PREDICTED: L-ascorbate oxidase homolog             217   1e-63   
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog             217   1e-63   
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             217   1e-63   
gb|AGE09595.1|  SKU5-like protein                                       215   3e-63   
ref|XP_007132533.1|  hypothetical protein PHAVU_011G102500g             216   4e-63   
ref|XP_003539859.1|  PREDICTED: L-ascorbate oxidase homolog             215   4e-63   
gb|EMS52588.1|  L-ascorbate oxidase-like protein                        220   4e-63   
emb|CDX81353.1|  BnaC09g07640D                                          216   4e-63   
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             215   4e-63   
gb|KHN21220.1|  L-ascorbate oxidase like                                215   4e-63   
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg             216   5e-63   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             215   5e-63   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             215   5e-63   
gb|ACL53812.1|  unknown                                                 215   5e-63   
emb|CDY18626.1|  BnaA09g07690D                                          215   5e-63   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             215   5e-63   
ref|XP_004253133.1|  PREDICTED: L-ascorbate oxidase homolog             215   6e-63   
ref|NP_001152000.1|  L-ascorbate oxidase precursor                      215   6e-63   
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     216   7e-63   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             215   7e-63   
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          215   7e-63   
ref|XP_006342555.1|  PREDICTED: L-ascorbate oxidase homolog             215   7e-63   
ref|NP_173604.1|  SKU5 similar 7 protein                                214   9e-63   
ref|NP_173603.1|  SKU5 similar 8 protein                                214   1e-62   
gb|EEE67250.1|  hypothetical protein OsJ_24405                          214   1e-62   
gb|EEC82126.1|  hypothetical protein OsI_26158                          214   1e-62   
ref|XP_006657409.1|  PREDICTED: L-ascorbate oxidase homolog             214   1e-62   
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             214   1e-62   
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               214   1e-62   
dbj|BAC83966.1|  putative PS60                                          214   2e-62   
ref|XP_002893186.1|  hypothetical protein ARALYDRAFT_313077             214   2e-62   
ref|XP_010459724.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    214   2e-62   
ref|XP_010459725.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    213   2e-62   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             213   2e-62   
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    213   3e-62   
gb|EPS65321.1|  hypothetical protein M569_09457                         203   3e-62   
ref|XP_010480557.1|  PREDICTED: L-ascorbate oxidase homolog             213   3e-62   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             213   5e-62   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             212   6e-62   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             212   1e-61   
gb|KDO79340.1|  hypothetical protein CISIN_1g0092422mg                  209   2e-61   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             211   2e-61   
emb|CDY01453.1|  BnaA07g12260D                                          211   2e-61   
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             211   2e-61   
emb|CDY12788.1|  BnaC07g16450D                                          211   2e-61   
emb|CDY43557.1|  BnaC02g16540D                                          211   3e-61   
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             211   3e-61   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             210   3e-61   
emb|CBI18560.3|  unnamed protein product                                210   3e-61   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             210   3e-61   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          210   3e-61   
gb|EYU17541.1|  hypothetical protein MIMGU_mgv1a004531mg                210   4e-61   
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    210   4e-61   
ref|XP_008338225.1|  PREDICTED: L-ascorbate oxidase homolog             209   6e-61   
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             209   8e-61   
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             209   8e-61   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             209   8e-61   
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             209   9e-61   
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             209   9e-61   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             209   9e-61   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         209   9e-61   
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             209   1e-60   
ref|XP_002866726.1|  predicted protein                                  209   1e-60   
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             209   1e-60   
ref|XP_004253203.1|  PREDICTED: L-ascorbate oxidase homolog             209   1e-60   
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             209   1e-60   
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             209   1e-60   
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   208   2e-60   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         208   2e-60   
gb|KFK44156.1|  hypothetical protein AALP_AA1G222300                    208   2e-60   
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    208   2e-60   
ref|XP_010498473.1|  PREDICTED: L-ascorbate oxidase homolog             208   2e-60   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             208   3e-60   
ref|XP_004511976.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    208   4e-60   
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       206   5e-60   
ref|XP_002522337.1|  multicopper oxidase, putative                      207   6e-60   
ref|NP_569041.1|  protein SKU5 similar 17                               207   7e-60   
dbj|BAB08634.1|  pectinesterase like protein                            207   7e-60   
ref|XP_002459273.1|  hypothetical protein SORBIDRAFT_02g001610          200   8e-60   
gb|AAM61328.1|  pectinesterase-like protein                             207   8e-60   
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             207   8e-60   
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    206   9e-60   
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    206   1e-59   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             206   2e-59   
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             206   2e-59   
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             206   2e-59   
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             206   2e-59   
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    206   2e-59   
ref|XP_010680456.1|  PREDICTED: L-ascorbate oxidase homolog             205   2e-59   
gb|KHN44868.1|  L-ascorbate oxidase like                                204   2e-59   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             205   3e-59   
gb|KGN48499.1|  hypothetical protein Csa_6G490140                       203   3e-59   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    205   3e-59   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             205   3e-59   
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             205   4e-59   
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             205   4e-59   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             204   5e-59   
ref|XP_004955371.1|  PREDICTED: L-ascorbate oxidase homolog             204   6e-59   
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             204   7e-59   
gb|KHN36198.1|  L-ascorbate oxidase like                                204   8e-59   
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             204   8e-59   
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             204   1e-58   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             204   1e-58   
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950          203   1e-58   
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             203   2e-58   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             203   2e-58   
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             203   2e-58   
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             203   2e-58   
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog             202   3e-58   
ref|XP_006402152.1|  hypothetical protein EUTSA_v10013200mg             202   3e-58   
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             202   4e-58   
ref|XP_010433262.1|  PREDICTED: L-ascorbate oxidase homolog             202   5e-58   
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             202   5e-58   
ref|XP_003524640.1|  PREDICTED: L-ascorbate oxidase homolog             201   5e-58   
gb|KHN42054.1|  L-ascorbate oxidase like                                202   5e-58   
gb|ABK25324.1|  unknown                                                 201   6e-58   
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             201   7e-58   
gb|EMT24760.1|  L-ascorbate oxidase-like protein                        201   1e-57   
ref|XP_006342554.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    203   1e-57   
ref|XP_010438504.1|  PREDICTED: L-ascorbate oxidase homolog             201   1e-57   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             201   2e-57   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             201   2e-57   
gb|KEH20500.1|  multi-copper oxidase-like protein                       201   2e-57   
ref|XP_008663511.1|  PREDICTED: L-ascorbate oxidase homolog             201   2e-57   
gb|EEE61490.1|  hypothetical protein OsJ_15776                          200   3e-57   
ref|XP_002522339.1|  multicopper oxidase, putative                      200   3e-57   
ref|XP_002867467.1|  hypothetical protein ARALYDRAFT_328883             200   4e-57   
ref|XP_002448327.1|  hypothetical protein SORBIDRAFT_06g025300          200   4e-57   
ref|NP_001058771.1|  Os07g0119400                                       199   4e-57   
gb|EEC77800.1|  hypothetical protein OsI_16980                          199   6e-57   
emb|CDP02462.1|  unnamed protein product                                199   6e-57   
gb|KHN44494.1|  L-ascorbate oxidase like                                199   8e-57   
gb|EMS54595.1|  L-ascorbate oxidase-like protein                        199   9e-57   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             198   1e-56   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             198   1e-56   
emb|CAN72539.1|  hypothetical protein VITISV_028750                     197   1e-56   
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             198   1e-56   
ref|XP_010227225.1|  PREDICTED: L-ascorbate oxidase homolog             198   1e-56   
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             198   2e-56   
ref|NP_194538.1|  SKU5 similar 10 protein                               197   2e-56   
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             197   3e-56   
gb|KDP31875.1|  hypothetical protein JCGZ_12336                         197   3e-56   
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             197   3e-56   
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                197   4e-56   
emb|CBI18561.3|  unnamed protein product                                197   5e-56   
emb|CDP02461.1|  unnamed protein product                                196   6e-56   
ref|XP_006416260.1|  hypothetical protein EUTSA_v10007292mg             196   8e-56   
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             195   2e-55   
emb|CDY31468.1|  BnaC05g15770D                                          195   2e-55   
ref|XP_009368021.1|  PREDICTED: L-ascorbate oxidase homolog             195   2e-55   
ref|XP_002310164.1|  multi-copper oxidase type 1 family protein         195   2e-55   
ref|XP_003557661.2|  PREDICTED: L-ascorbate oxidase homolog             195   3e-55   
ref|XP_010464737.1|  PREDICTED: L-ascorbate oxidase homolog             194   3e-55   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             194   4e-55   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             194   4e-55   
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             194   4e-55   
ref|XP_006345828.1|  PREDICTED: L-ascorbate oxidase homolog             194   4e-55   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             194   5e-55   
emb|CAN72538.1|  hypothetical protein VITISV_028749                     194   6e-55   
ref|XP_011013815.1|  PREDICTED: L-ascorbate oxidase homolog             194   6e-55   
gb|KHM99211.1|  L-ascorbate oxidase like                                192   1e-54   
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             193   1e-54   
ref|XP_011099223.1|  PREDICTED: L-ascorbate oxidase homolog             193   1e-54   
ref|XP_002969915.1|  hypothetical protein SELMODRAFT_410532             193   1e-54   
ref|XP_002981392.1|  hypothetical protein SELMODRAFT_178788             192   2e-54   
ref|XP_009348089.1|  PREDICTED: L-ascorbate oxidase homolog             192   2e-54   
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             192   2e-54   
ref|XP_009594575.1|  PREDICTED: L-ascorbate oxidase homolog             192   3e-54   
ref|XP_010931432.1|  PREDICTED: L-ascorbate oxidase homolog             192   3e-54   
gb|KDO79346.1|  hypothetical protein CISIN_1g009171mg                   191   5e-54   
ref|XP_006466655.1|  PREDICTED: L-ascorbate oxidase homolog             191   6e-54   
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             191   8e-54   
ref|XP_006285663.1|  hypothetical protein CARUB_v10007118mg             191   8e-54   
ref|XP_009149524.1|  PREDICTED: L-ascorbate oxidase homolog             191   8e-54   
ref|XP_006425822.1|  hypothetical protein CICLE_v10027285mg             191   9e-54   
ref|XP_006304367.1|  hypothetical protein CARUB_v10010844mg             191   1e-53   
ref|XP_010680452.1|  PREDICTED: L-ascorbate oxidase homolog             190   1e-53   
ref|XP_006416404.1|  hypothetical protein EUTSA_v10007361mg             190   1e-53   
ref|XP_003550084.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    190   1e-53   
ref|XP_009765874.1|  PREDICTED: L-ascorbate oxidase homolog             190   1e-53   
gb|KJB48510.1|  hypothetical protein B456_008G073000                    190   1e-53   
ref|XP_010922850.1|  PREDICTED: L-ascorbate oxidase homolog             190   2e-53   
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             190   2e-53   
ref|XP_011039229.1|  PREDICTED: L-ascorbate oxidase homolog             189   2e-53   
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog             190   2e-53   
ref|XP_009347247.1|  PREDICTED: L-ascorbate oxidase homolog             189   2e-53   
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog             189   2e-53   
ref|XP_004301852.1|  PREDICTED: L-ascorbate oxidase homolog             189   3e-53   
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             189   3e-53   
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog             189   3e-53   
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             189   3e-53   
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             189   3e-53   
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    189   4e-53   
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             189   4e-53   
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             189   5e-53   
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             189   5e-53   
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    189   6e-53   
emb|CDX89588.1|  BnaC04g36070D                                          182   8e-53   
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    187   8e-53   
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog             188   8e-53   
gb|KJB40235.1|  hypothetical protein B456_007G052900                    183   9e-53   
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   188   9e-53   
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             188   1e-52   
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         187   1e-52   
gb|KEH20499.1|  multi-copper oxidase-like protein                       187   2e-52   
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    187   2e-52   
ref|XP_002960418.1|  hypothetical protein SELMODRAFT_229918             187   2e-52   



>ref|XP_006348131.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=548

 Score =   272 bits (696),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            VY GNPYRYYTWKITYG+IYPLGVKQ+ ILINGQFPGPQIDCVTNDNLII+VYNYL+EPF
Sbjct  27   VYAGNPYRYYTWKITYGNIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLSEPF  86

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNSWQDGVYG+TCPI P KNFTY LQAKDQIGSYFYFPSL MHKAAGGYG
Sbjct  87   LISWNGIQQRRNSWQDGVYGSTCPILPGKNFTYTLQAKDQIGSYFYFPSLAMHKAAGGYG  146

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            AIR+YSRP IPVPFAPPA DFTV
Sbjct  147  AIRVYSRPRIPVPFAPPAHDFTV  169



>ref|XP_004232701.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=548

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            +Y  NPYRYYTWKITYGDIYPLGVKQ+ ILINGQFPGPQIDCVTNDNLII+VYNYL+EPF
Sbjct  27   IYADNPYRYYTWKITYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLSEPF  86

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNSWQDGVYGTTCPI P KNFTY LQAKDQIGSYFYFPSL MHKAAGGYG
Sbjct  87   LISWNGIQQRRNSWQDGVYGTTCPILPGKNFTYTLQAKDQIGSYFYFPSLAMHKAAGGYG  146

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            AIR+YSRP IPVPFAPPA DFTV
Sbjct  147  AIRVYSRPRIPVPFAPPAHDFTV  169



>gb|KGN64509.1| hypothetical protein Csa_1G062350 [Cucumis sativus]
Length=420

 Score =   261 bits (667),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 140/166 (84%), Gaps = 3/166 (2%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            MREY  +CSLI+ VL      N V   NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1    MREYRVLCSLIILVLFAV---NEVNADNPYRFFTWKVTYGDIYPLGVKQQGILINGQFPG  57

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQID VTNDNLIINVYNYL EPFL+SWNGLQQRRNSWQDGVYGTTC IPP +NFTY LQA
Sbjct  58   PQIDAVTNDNLIINVYNYLKEPFLISWNGLQQRRNSWQDGVYGTTCAIPPMRNFTYTLQA  117

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPS   HKAAG +G IRI+SRP IPVPFAPPA DFTV
Sbjct  118  KDQIGSYFYFPSTAFHKAAGAFGGIRIWSRPGIPVPFAPPAGDFTV  163



>ref|XP_004145114.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004153223.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004158002.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=542

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 140/166 (84%), Gaps = 3/166 (2%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            MREY  +CSLI+ VL      N V   NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1    MREYRVLCSLIILVLFAV---NEVNADNPYRFFTWKVTYGDIYPLGVKQQGILINGQFPG  57

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQID VTNDNLIINVYNYL EPFL+SWNGLQQRRNSWQDGVYGTTC IPP +NFTY LQA
Sbjct  58   PQIDAVTNDNLIINVYNYLKEPFLISWNGLQQRRNSWQDGVYGTTCAIPPMRNFTYTLQA  117

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPS   HKAAG +G IRI+SRP IPVPFAPPA DFTV
Sbjct  118  KDQIGSYFYFPSTAFHKAAGAFGGIRIWSRPGIPVPFAPPAGDFTV  163



>ref|XP_010529443.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV+G NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYLNE
Sbjct  17   NGVFGENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLNE  76

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNGLQQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGSYFYFPSL  HKAAG 
Sbjct  77   PFLISWNGLQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSYFYFPSLAFHKAAGA  136

Query  519  YGAIRIYSRPLIPVPFAPPARDF  587
            +GAIR++SRP IPVPF+PP  DF
Sbjct  137  FGAIRVWSRPQIPVPFSPPDGDF  159



>gb|KDP20733.1| hypothetical protein JCGZ_21204 [Jatropha curcas]
Length=541

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            +GV G NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINV+NYL E
Sbjct  18   HGVNGENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVFNYLRE  77

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQRRNSWQDGVYGT CPI P +NFTY+LQ KDQIGS+FYFPSL MHKAAGG
Sbjct  78   PFLISWNGIQQRRNSWQDGVYGTNCPILPGRNFTYILQVKDQIGSFFYFPSLGMHKAAGG  137

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G+IRI+SRPLIPVPF  PA DFTV
Sbjct  138  FGSIRIWSRPLIPVPFPTPAGDFTV  162



>ref|XP_011096053.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=541

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 145/166 (87%), Gaps = 4/166 (2%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            MR+++S+ +++  +L+L    + V G NPYR+YTWK+TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1    MRDFTSLITVLSLLLVL----HAVNGDNPYRFYTWKVTYGDIYPLGVKQQGILINGQFPG  56

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            P IDCVTNDNLII+VYNYLNEPFL+SWNGLQQRRNSWQDG++GT+CPIPP KNFTY LQA
Sbjct  57   PTIDCVTNDNLIISVYNYLNEPFLISWNGLQQRRNSWQDGMFGTSCPIPPGKNFTYALQA  116

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIG+YFYFPSL +HKAAGGYG+I++YSRP IPVP+  PA D  V
Sbjct  117  KDQIGTYFYFPSLALHKAAGGYGSIKVYSRPRIPVPYPTPAGDHVV  162



>ref|XP_009782819.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=544

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            VY  NPYRYYTWKITYGDIYPLGVKQ+ ILINGQFPGPQIDCVTNDNLII+VYNYLNEPF
Sbjct  23   VYCDNPYRYYTWKITYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLNEPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNGLQQRRNSWQDGVYGTTCPIPP KNFTY LQAKDQIGSYFYFPSL MHKAAGGYG
Sbjct  83   LISWNGLQQRRNSWQDGVYGTTCPIPPGKNFTYTLQAKDQIGSYFYFPSLAMHKAAGGYG  142

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            AIR+YSRP IPVPF PPA DFTV
Sbjct  143  AIRVYSRPRIPVPFPPPAHDFTV  165



>ref|XP_010539014.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=543

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV+G NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYL E
Sbjct  18   NGVFGDNPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLKE  77

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFLLSWNGLQQR+NSW DGV GTTCPIPP KNFTY++Q KDQIGSYFYFPSL  HKAAG 
Sbjct  78   PFLLSWNGLQQRKNSWHDGVIGTTCPIPPGKNFTYIIQVKDQIGSYFYFPSLAFHKAAGA  137

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +GAIR++SRP IPVPF+PP  DF +
Sbjct  138  FGAIRVWSRPRIPVPFSPPDGDFWI  162



>ref|XP_009629876.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            MRE S+V S IL +L+L      VY  NPYRYYTWKITYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1    MREKSNVHSAILTILVLLTLQR-VYCDNPYRYYTWKITYGDIYPLGVKQQGILINGQFPG  59

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQIDCVTNDNLII+VYNYLNEPFL+SWNGLQQRRNSWQ+GVYGTTCPIPP KNFTY LQA
Sbjct  60   PQIDCVTNDNLIISVYNYLNEPFLISWNGLQQRRNSWQNGVYGTTCPIPPGKNFTYTLQA  119

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPSL MHKAAGGYGAIR+YSRP IPVPF PPA DFTV
Sbjct  120  KDQIGSYFYFPSLAMHKAAGGYGAIRVYSRPRIPVPFPPPAHDFTV  165



>ref|XP_008440923.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34061.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=542

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            MREY  +CSLI+ VL      N     NPYR++TWK+TYG+IYPLGV+Q+ ILINGQFPG
Sbjct  1    MREYRVLCSLIILVLFAVNEANA---DNPYRFFTWKVTYGNIYPLGVRQQGILINGQFPG  57

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQID VTNDNLIINVYNYL EPFL+SWNGLQQRRNSWQDGVYGTTC IPP +NFTY LQA
Sbjct  58   PQIDAVTNDNLIINVYNYLKEPFLISWNGLQQRRNSWQDGVYGTTCAIPPMRNFTYTLQA  117

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPS   HKAAG +G IRI+SRP IPVPF  PA DFTV
Sbjct  118  KDQIGSYFYFPSTAFHKAAGAFGGIRIWSRPGIPVPFPSPAGDFTV  163



>ref|XP_007026108.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 ref|XP_007026109.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 gb|EOY28730.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 gb|EOY28731.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
Length=542

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
            GV G NPYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLII+VYNYLNEP
Sbjct  19   GVNGENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLNEP  78

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+QQRRNSWQDGV+GT CPI P KNFTY+LQ KDQIGS+FYFPSL  HKAAGGY
Sbjct  79   FLISWNGVQQRRNSWQDGVFGTNCPIRPGKNFTYVLQVKDQIGSFFYFPSLLFHKAAGGY  138

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI+SRP IPVPF  PA DFTV
Sbjct  139  GGIRIWSRPKIPVPFPTPAGDFTV  162



>ref|XP_007026110.1| SKU5 similar 4 isoform 3 [Theobroma cacao]
 gb|EOY28732.1| SKU5 similar 4 isoform 3 [Theobroma cacao]
Length=543

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
            GV G NPYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLII+VYNYLNEP
Sbjct  19   GVNGENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLNEP  78

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+QQRRNSWQDGV+GT CPI P KNFTY+LQ KDQIGS+FYFPSL  HKAAGGY
Sbjct  79   FLISWNGVQQRRNSWQDGVFGTNCPIRPGKNFTYVLQVKDQIGSFFYFPSLLFHKAAGGY  138

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI+SRP IPVPF  PA DFTV
Sbjct  139  GGIRIWSRPKIPVPFPTPAGDFTV  162



>ref|XP_008384084.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=543

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV G +PYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNL+I+V+NYL E
Sbjct  19   NGVNGEDPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLRE  78

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SW+G+QQRRNSWQDGV+GTTCPIPP +NFTY +Q KDQIGS+FYFPSL+ HKAAGG
Sbjct  79   PFLISWDGIQQRRNSWQDGVFGTTCPIPPGRNFTYNIQVKDQIGSFFYFPSLQFHKAAGG  138

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF  PA DFTV
Sbjct  139  FGGIRIWSRPKIPVPFPTPAGDFTV  163



>gb|KJB67220.1| hypothetical protein B456_010G181000 [Gossypium raimondii]
Length=484

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
            GV G NPYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYLNEP
Sbjct  19   GVNGENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLNEP  78

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+QQRRNSWQDGV GT CPI P KNFTY+LQ KDQIGS++YFPSL  HKAAGGY
Sbjct  79   FLISWNGVQQRRNSWQDGVSGTNCPIRPGKNFTYVLQVKDQIGSFYYFPSLLFHKAAGGY  138

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            GAIRI+SRP IPVPF  PA DFTV
Sbjct  139  GAIRIWSRPKIPVPFPSPAGDFTV  162



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 138/166 (83%), Gaps = 3/166 (2%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            M  Y+SVC ++L  L+     NG    +PYR+Y W +TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1    MGLYTSVCCVLLVALLTVSFTNGE---DPYRFYNWNVTYGDIYPLGVKQQGILINGQFPG  57

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQIDCVTNDNLII+V+N L+EPFL+SWNG+QQRRNSWQDGV+GT CPIPP +NFTY+LQ 
Sbjct  58   PQIDCVTNDNLIISVFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQV  117

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSY+YFPSL  HKAAGGYG I+I SRP IPVPF PPA DFT+
Sbjct  118  KDQIGSYYYFPSLAFHKAAGGYGGIKISSRPRIPVPFDPPAGDFTI  163



>gb|KJB67219.1| hypothetical protein B456_010G181000 [Gossypium raimondii]
Length=516

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
            GV G NPYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYLNEP
Sbjct  19   GVNGENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLNEP  78

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+QQRRNSWQDGV GT CPI P KNFTY+LQ KDQIGS++YFPSL  HKAAGGY
Sbjct  79   FLISWNGVQQRRNSWQDGVSGTNCPIRPGKNFTYVLQVKDQIGSFYYFPSLLFHKAAGGY  138

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            GAIRI+SRP IPVPF  PA DFTV
Sbjct  139  GAIRIWSRPKIPVPFPSPAGDFTV  162



>ref|XP_002869849.1| hypothetical protein ARALYDRAFT_914433 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46108.1| hypothetical protein ARALYDRAFT_914433 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV+G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID +TNDN+II+V+NYL E
Sbjct  17   NGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKE  76

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77   PFLISWNGVQQRKNSWQDGVVGTTCPIPPGKNFTYVIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  519  YGAIRIYSRPLIPVPFAPPARDF  587
            +GAIR++SRP IPVPF+PP  DF
Sbjct  137  FGAIRVWSRPRIPVPFSPPDGDF  159



>gb|KJB67218.1| hypothetical protein B456_010G181000 [Gossypium raimondii]
Length=542

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
            GV G NPYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYLNEP
Sbjct  19   GVNGENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLNEP  78

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+QQRRNSWQDGV GT CPI P KNFTY+LQ KDQIGS++YFPSL  HKAAGGY
Sbjct  79   FLISWNGVQQRRNSWQDGVSGTNCPIRPGKNFTYVLQVKDQIGSFYYFPSLLFHKAAGGY  138

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            GAIRI+SRP IPVPF  PA DFTV
Sbjct  139  GAIRIWSRPKIPVPFPSPAGDFTV  162



>ref|XP_008371076.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
 ref|XP_008365611.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=543

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV G +PYR++TWK+TYGDIYPLGVKQR ILINGQFPGPQID VTNDNL+I+V+NYL E
Sbjct  19   NGVIGEDPYRFFTWKVTYGDIYPLGVKQRGILINGQFPGPQIDAVTNDNLVISVFNYLRE  78

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SW+G+QQRRNSWQDG +GT CPIPP +NFTY +Q KDQIGS+FYFPSL+ HKAAGG
Sbjct  79   PFLISWDGIQQRRNSWQDGNFGTNCPIPPGRNFTYNIQVKDQIGSFFYFPSLKFHKAAGG  138

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF  PA DFTV
Sbjct  139  FGGIRIWSRPKIPVPFPNPAGDFTV  163



>gb|KHG02352.1| L-ascorbate oxidase [Gossypium arboreum]
Length=542

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
            GV G NPYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYLNEP
Sbjct  19   GVNGENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLNEP  78

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+QQRRNSWQDGV GT CPI P KNFTY+LQ KDQIGS++YFPSL  HKAAGGY
Sbjct  79   FLISWNGVQQRRNSWQDGVSGTNCPIRPGKNFTYVLQVKDQIGSFYYFPSLLFHKAAGGY  138

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            GAIRI+SRP IPVPF  PA DFTV
Sbjct  139  GAIRIWSRPKIPVPFPSPAGDFTV  162



>ref|XP_002272880.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI23230.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
            GV+G +PYR+YTWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLII+VYNYL EP
Sbjct  18   GVHGEDPYRFYTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLREP  77

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SW+GLQQRRNSWQDG+YGT CPIPP +N TY LQ KDQIGS+FYFPSL  HKAAGG+
Sbjct  78   FLISWSGLQQRRNSWQDGMYGTNCPIPPGRNMTYALQVKDQIGSFFYFPSLAFHKAAGGF  137

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  P+ DFTV
Sbjct  138  GGIRILSRPRIPVPFPAPSGDFTV  161



>ref|XP_007213899.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
 gb|EMJ15098.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
Length=447

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV G +PYR++TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNL+I+V+NYL E
Sbjct  19   NGVNGEDPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLRE  78

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SW+G+QQRRNSWQDGVYGT CPI P KNFTY +Q KDQIGS+FYFPS   HKAAGG
Sbjct  79   PFLISWDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFLFHKAAGG  138

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF  PA DFTV
Sbjct  139  FGGIRIWSRPKIPVPFPNPAGDFTV  163



>ref|NP_193932.1| protein SKU5 similar 4 [Arabidopsis thaliana]
 emb|CAA18104.1| pectinesterase like protein [Arabidopsis thaliana]
 emb|CAB79156.1| pectinesterase like protein [Arabidopsis thaliana]
 gb|AAL91224.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AAP68338.1| At4g22010 [Arabidopsis thaliana]
 gb|AEE84542.1| protein SKU5 similar 4 [Arabidopsis thaliana]
Length=541

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID +TNDN+II+V+NYL E
Sbjct  17   NGVLGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKE  76

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77   PFLISWNGVQQRKNSWQDGVVGTTCPIPPGKNFTYVIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  519  YGAIRIYSRPLIPVPFAPPARDF  587
            +GAIR++SRP IPVPF+PP  DF
Sbjct  137  FGAIRVWSRPRIPVPFSPPDGDF  159



>ref|XP_006447580.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 ref|XP_006469673.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Citrus sinensis]
 gb|ESR60820.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 gb|KDO54689.1| hypothetical protein CISIN_1g009283mg [Citrus sinensis]
Length=538

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 137/166 (83%), Gaps = 4/166 (2%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            M  YSS+C L+L  +++        G +PYR++ W +TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1    MASYSSICCLLLVFMLVSC----TRGESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPG  56

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            P I+ VTNDNLII+V+N L+EPFL+SWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ 
Sbjct  57   PSIEAVTNDNLIISVFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQV  116

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPSL  HKAAGGYG I+I SRPLIPVPF PPA DFT+
Sbjct  117  KDQIGSYFYFPSLAFHKAAGGYGGIKIASRPLIPVPFDPPAGDFTI  162



>ref|XP_002524823.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF37543.1| multicopper oxidase, putative [Ricinus communis]
Length=538

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            + G +PYR+Y+W I+YGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L+EPF
Sbjct  22   INGEDPYRFYSWNISYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDEPF  81

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGSYFYFPSL MHKAAGGYG
Sbjct  82   LISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLGMHKAAGGYG  141

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
              +I SR +IPVPF PPA DFTV
Sbjct  142  GFKIASRSVIPVPFPPPAGDFTV  164



>ref|XP_006282576.1| hypothetical protein CARUB_v10004445mg, partial [Capsella rubella]
 gb|EOA15474.1| hypothetical protein CARUB_v10004445mg, partial [Capsella rubella]
Length=582

 Score =   247 bits (631),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV+G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID +TNDN+II+V+NYL E
Sbjct  58   NGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKE  117

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS+FYFPSL  HKAAG 
Sbjct  118  PFLMSWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFFYFPSLAFHKAAGA  177

Query  519  YGAIRIYSRPLIPVPFAPPARDF  587
            +GAIR++SRP IPVPF  P  DF
Sbjct  178  FGAIRVWSRPRIPVPFPSPDGDF  200



>emb|CDP04415.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   246 bits (628),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            MR+   +CSLI + ++L   LNG Y  NPYR+YTWKITYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1    MRDCKILCSLITSCILLVSVLNGAYADNPYRFYTWKITYGDIYPLGVKQQGILINGQFPG  60

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            P IDCVTNDNLII+VYNYLNEPFL+SWNG+Q R+NSWQDGV GTTCPIPP KNFTY+LQA
Sbjct  61   PHIDCVTNDNLIISVYNYLNEPFLISWNGIQHRKNSWQDGVQGTTCPIPPGKNFTYILQA  120

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIG+YFYFPSL +HKAAGG+G+I+IYSRP IPVPF PPA DF V
Sbjct  121  KDQIGTYFYFPSLGLHKAAGGFGSIKIYSRPQIPVPFPPPAGDFIV  166



>gb|KDP22727.1| hypothetical protein JCGZ_01829 [Jatropha curcas]
Length=541

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V G +PYR+Y+W +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTN+NLIIN++N L+EPF
Sbjct  20   VSGEDPYRFYSWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINIFNSLDEPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNSWQDGVYGT CPIPP +NFTYMLQ KDQIGSYFYFPSL MHKAAGG G
Sbjct  80   LLSWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYMLQVKDQIGSYFYFPSLGMHKAAGGIG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
              +I SR +IPVPF PPA DFTV
Sbjct  140  GFKIASRSVIPVPFPPPAGDFTV  162



>ref|XP_002301616.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
 gb|EEE80889.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
Length=545

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+YTW +TYGDIYPLGVKQ+ ILING+FPGPQI+ VTNDNLII+V+N L+EPFLL
Sbjct  26   GEDPYRFYTWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIISVFNSLDEPFLL  85

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGSYFYFPSL MHKAAGG+G  
Sbjct  86   SWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLGMHKAAGGFGGF  145

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            +I SR +IPVPF PPA DFT+
Sbjct  146  KIASRSVIPVPFPPPAGDFTI  166



>ref|XP_007215641.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
 gb|EMJ16840.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
Length=542

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            M  Y+S+C +IL  L+     NG    +PYR+Y W +TYGDIYPLG+KQR ILINGQFPG
Sbjct  1    MGLYTSLCCVILVALLTVTCTNGE---DPYRFYNWNVTYGDIYPLGLKQRGILINGQFPG  57

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQI+ VTNDNLIINV+N L+EPFLLSWNG+QQRRNSWQDGV+GT CPIPP +NFTY+LQ 
Sbjct  58   PQIESVTNDNLIINVFNSLDEPFLLSWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQV  117

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPSL  HKAAGG+G I+I SR +IPVPF PPA DFT+
Sbjct  118  KDQIGSYFYFPSLGFHKAAGGFGGIKIASRSVIPVPFPPPAGDFTI  163



>ref|XP_009359037.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=543

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV G +PYR++TWK+TYGDIYPLGVKQR ILINGQFPGPQID VTNDNL+I+V+NYL E
Sbjct  19   NGVIGEDPYRFFTWKVTYGDIYPLGVKQRGILINGQFPGPQIDAVTNDNLVISVFNYLRE  78

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SW+G+QQRRNSWQDGV GT CPIPP ++FTY +Q KDQIGS+FYFPSL+ HKAAGG
Sbjct  79   PFLISWDGIQQRRNSWQDGVLGTNCPIPPGRSFTYNIQVKDQIGSFFYFPSLQFHKAAGG  138

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI SRP IPVPF  PA DFTV
Sbjct  139  FGGIRIRSRPKIPVPFPNPAGDFTV  163



>ref|XP_009413373.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413374.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR++TW +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLI+NV+N L EPFL 
Sbjct  23   GDSPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLIVNVFNSLPEPFLF  82

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQRR+SWQDGVYGT CPIPP  NFTY +Q KDQIGSYFYFPSL  HKAAGGYG I
Sbjct  83   SWNGIQQRRSSWQDGVYGTNCPIPPGGNFTYTMQVKDQIGSYFYFPSLAFHKAAGGYGGI  142

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            R+ SRPLIPVPFAPPA D+TV
Sbjct  143  RVLSRPLIPVPFAPPAADYTV  163



>ref|XP_010434093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV+G NPYR++TWKITYGDIYPLGVKQ+ I+INGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17   NGVFGDNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIIISVFNYLKE  76

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77   PFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  519  YGAIRIYSRPLIPVPFAPPARDF  587
            +GAIR++SRP IPVPF  P  DF
Sbjct  137  FGAIRVWSRPRIPVPFPSPDGDF  159



>ref|XP_010439384.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV+G NPYR++TWKITYGDIYPLGVKQ+ I+INGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17   NGVFGDNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIIISVFNYLKE  76

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77   PFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  519  YGAIRIYSRPLIPVPFAPPARDF  587
            +GAIR++SRP IPVPF  P  DF
Sbjct  137  FGAIRVWSRPRIPVPFPSPDGDF  159



>ref|XP_008229964.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=542

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            M  Y+SVC +IL  L+     +G    +PYR+Y W +TYGDIYPLG+KQR ILINGQFPG
Sbjct  1    MGLYTSVCCVILVALLTVTCTSGE---DPYRFYNWNVTYGDIYPLGLKQRGILINGQFPG  57

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQI+ VTNDNLIINV+N L+EPFLLSWNG+QQRRNSWQDGV+GT CPIPP +NFTY+LQ 
Sbjct  58   PQIESVTNDNLIINVFNSLDEPFLLSWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQV  117

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPSL  HKAAGG+G I+I SR +IPVPF PPA DFT+
Sbjct  118  KDQIGSYFYFPSLGFHKAAGGFGGIKIASRSVIPVPFPPPAGDFTI  163



>ref|XP_010448953.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV+G NPYR++TWKITYGDIYPLGVKQ+ I+INGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17   NGVFGDNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIIISVFNYLKE  76

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77   PFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  519  YGAIRIYSRPLIPVPFAPPARDF  587
            +GAIR++SRP IPVPF  P  DF
Sbjct  137  FGAIRVWSRPRIPVPFPSPDGDF  159



>ref|XP_007213900.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
 gb|EMJ15099.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
Length=543

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV G +PYR++TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNL+I+V+NYL E
Sbjct  19   NGVNGEDPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLRE  78

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SW+G+QQRRNSWQDGVYGT CPI P KNFTY +Q KDQIGS+FYFPS   HKAAGG
Sbjct  79   PFLISWDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFLFHKAAGG  138

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF  PA DFTV
Sbjct  139  FGGIRIWSRPKIPVPFPNPAGDFTV  163



>gb|AGJ03718.1| multicopper oxidase [Citrus maxima]
Length=538

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 136/166 (82%), Gaps = 4/166 (2%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            M  YSS+C L+L  +++        G +PYR++ W +TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1    MASYSSICCLLLVFMLVSC----TRGESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPG  56

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            P I+ VTNDNLII+V+N L+EPFL+SWNG+QQRRNSWQDGVYGT CPI P KNFTY+LQ 
Sbjct  57   PSIEAVTNDNLIISVFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPISPGKNFTYVLQV  116

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPSL  HKAAGGYG I+I SRPLIPVPF PPA DFT+
Sbjct  117  KDQIGSYFYFPSLAFHKAAGGYGGIKIASRPLIPVPFDPPAGDFTI  162



>ref|XP_006383902.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|ERP61699.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=544

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            N V   +PYR+ TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTN+NLII+VYNYL E
Sbjct  20   NDVNCEDPYRFITWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNENLIISVYNYLRE  79

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQRRNSWQDGVYGT+CPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAG 
Sbjct  80   PFLISWNGIQQRRNSWQDGVYGTSCPIPPGKNFTYALQVKDQIGSFFYFPSLGFHKAAGA  139

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF  PA DFTV
Sbjct  140  FGGIRIWSRPRIPVPFPAPAGDFTV  164



>ref|XP_006413696.1| hypothetical protein EUTSA_v10024862mg [Eutrema salsugineum]
 gb|ESQ55149.1| hypothetical protein EUTSA_v10024862mg [Eutrema salsugineum]
Length=541

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV+G NPYR++TWKITYG+IYPLGVKQ+ ILINGQFPGP ID +TNDN+II+V+NYL E
Sbjct  17   NGVFGDNPYRFFTWKITYGNIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKE  76

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77   PFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  519  YGAIRIYSRPLIPVPFAPPARDF  587
            +GAIRI+SRP IPVPF  P  DF
Sbjct  137  FGAIRIWSRPRIPVPFPSPDGDF  159



>ref|XP_003549771.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=549

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            + V+  +PYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINVYNYL E
Sbjct  25   SSVHCEDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLRE  84

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNGLQ RRNSWQDGVYGT CPIPP +N TY +Q KDQIGSYFYFPSL MHKAAG 
Sbjct  85   PFLISWNGLQHRRNSWQDGVYGTNCPIPPGRNLTYAIQVKDQIGSYFYFPSLGMHKAAGA  144

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF  PA D T+
Sbjct  145  FGGIRIWSRPQIPVPFPSPAGDITI  169



>ref|XP_008224692.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=543

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV G +PYR +TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNL+I+V+NYL E
Sbjct  19   NGVNGEDPYRLFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLRE  78

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SW+G+QQRRNSWQDGVYGT CPI P KNFTY +Q KDQIGS+FYFPS   HKAAGG
Sbjct  79   PFLISWDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFLFHKAAGG  138

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF  PA DFTV
Sbjct  139  FGGIRIWSRPKIPVPFPNPAGDFTV  163



>gb|EPS74059.1| hypothetical protein M569_00695 [Genlisea aurea]
Length=541

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
             +G NPYR++ W ++YGDIYPLGVKQ+ ILINGQFPGP I CVTNDNLIINV+N LNEPF
Sbjct  20   AFGDNPYRFFYWNVSYGDIYPLGVKQQGILINGQFPGPSISCVTNDNLIINVFNSLNEPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNGLQQRRNSWQDGV+GTTCPIPP KNFTY LQAKDQIG+YFYFPSL +HK+AGGYG
Sbjct  80   LISWNGLQQRRNSWQDGVFGTTCPIPPGKNFTYALQAKDQIGTYFYFPSLGLHKSAGGYG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            +I+IYSRP IPVP+  P  D  V
Sbjct  140  SIKIYSRPKIPVPYPTPDGDHVV  162



>ref|XP_006449754.1| hypothetical protein CICLE_v10014825mg [Citrus clementina]
 gb|ESR62994.1| hypothetical protein CICLE_v10014825mg [Citrus clementina]
Length=543

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGVYG +PYR++TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLII+VYNYL E
Sbjct  20   NGVYGDSPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLRE  79

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNGLQQRRNSWQDGVYGTTCPIPP KNFTY+LQAKDQIGSYFYFPS   HKAAG 
Sbjct  80   PFLISWNGLQQRRNSWQDGVYGTTCPIPPGKNFTYVLQAKDQIGSYFYFPSFLFHKAAGA  139

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF PPA DFTV
Sbjct  140  FGGIRIWSRPRIPVPFPPPAGDFTV  164



>ref|XP_003540295.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=536

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+YTW +TYGDIYPLG+KQ+ ILINGQFPGPQI+ VTNDNLI++V+N L+EPFL+
Sbjct  22   GEDPYRFYTWNVTYGDIYPLGMKQQGILINGQFPGPQIESVTNDNLILHVFNSLDEPFLI  81

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGSYFYFPSL  HKAAGGYG  
Sbjct  82   SWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGGF  141

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            +I SR +IPVPF PPA DFT+
Sbjct  142  KIASRSVIPVPFPPPAGDFTI  162



>gb|AFK33407.1| unknown [Lotus japonicus]
Length=385

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNL+INV+N+L EPF
Sbjct  28   VSAEDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLVINVHNHLPEPF  87

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  88   LLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYNLQVKDQIGSFFYFPSLAFHKAAGGFG  147

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            AI+I SRP IPVPF  PA DF++
Sbjct  148  AIKILSRPRIPVPFPEPAADFSL  170



>ref|XP_007046384.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
 gb|EOY02216.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
Length=447

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G + YR++TW +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTN+NLIINV+N L++PFL+
Sbjct  24   GEDAYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINVFNSLDQPFLI  83

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQRRNSWQDGVYGT CPIPP  NFTY LQ KDQIGSYFYFPSL +HKAAGGYG  
Sbjct  84   SWNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYFPSLALHKAAGGYGGF  143

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            RI SR +IPVPF PPA D+T+
Sbjct  144  RILSRSVIPVPFPPPAADYTI  164



>ref|XP_009135529.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV+G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17   NGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNIIISVFNYLRE  76

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQR+NS+QDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77   PFLISWNGVQQRKNSYQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  519  YGAIRIYSRPLIPVPFAPPARDF  587
            +GAIR++SRP IPVPF  P  DF
Sbjct  137  FGAIRVWSRPRIPVPFPSPDGDF  159



>emb|CDX79120.1| BnaA01g11870D [Brassica napus]
Length=541

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV+G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17   NGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNIIISVFNYLRE  76

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQR+NS+QDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77   PFLISWNGVQQRKNSYQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  519  YGAIRIYSRPLIPVPFAPPARDF  587
            +GAIR++SRP IPVPF  P  DF
Sbjct  137  FGAIRVWSRPRIPVPFPSPDGDF  159



>ref|XP_006467415.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|KDO78277.1| hypothetical protein CISIN_1g009127mg [Citrus sinensis]
Length=543

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            +GVYG +PYR++TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLII+VYNYL E
Sbjct  20   HGVYGDSPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLRE  79

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNGLQQRRNSWQDGVYGTTCPIPP KNFTY+LQAKDQIGSYFYFPS   HKAAG 
Sbjct  80   PFLISWNGLQQRRNSWQDGVYGTTCPIPPGKNFTYVLQAKDQIGSYFYFPSFLFHKAAGA  139

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF PPA DFTV
Sbjct  140  FGGIRIWSRPRIPVPFPPPAGDFTV  164



>ref|XP_010046372.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW88773.1| hypothetical protein EUGRSUZ_A01118 [Eucalyptus grandis]
Length=542

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PY +Y W +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L+EPFLL
Sbjct  26   GEDPYSFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNALDEPFLL  85

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQ+RNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSYFYFPSL  HKAAGG+G  
Sbjct  86   SWNGVQQKRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGSYFYFPSLAFHKAAGGFGGF  145

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            +I SR +IPVPF PPA DFT+
Sbjct  146  KILSRSVIPVPFPPPANDFTI  166



>gb|KHN03487.1| L-ascorbate oxidase like [Glycine soja]
Length=556

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            + V+  +PYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINVYNYL E
Sbjct  25   SSVHCEDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLRE  84

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNGLQ RRNSWQDGVYGT CPIPP +N TY +Q KDQIGSYFYFP L MHKAAG 
Sbjct  85   PFLISWNGLQHRRNSWQDGVYGTNCPIPPGRNLTYAIQVKDQIGSYFYFPFLGMHKAAGA  144

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF  PA D T+
Sbjct  145  FGGIRIWSRPQIPVPFPSPAGDITI  169



>emb|CDP19581.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++TW +TYGDIYPLGVKQ+ ILINGQFPGP I+ VTNDNLIINV+N L+EPFL+SW
Sbjct  27   DPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPAIESVTNDNLIINVFNNLDEPFLISW  86

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NGL+QRRNSWQDGV+GT CPIPP KN+TY LQ KDQIGSYFYFPSL  HKAAGGYG I+I
Sbjct  87   NGLEQRRNSWQDGVWGTNCPIPPGKNYTYALQVKDQIGSYFYFPSLAFHKAAGGYGGIKI  146

Query  537  YSRPLIPVPFAPPARDFTV  593
             SR +IPVPFAPPA D+T+
Sbjct  147  ASRSVIPVPFAPPAGDYTI  165



>emb|CDP10787.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            + G +PY+++TW +TYGDIYPLGVKQ+ ILINGQFPGPQI  VTN+NLI++V+N LNEPF
Sbjct  20   INGEDPYQFFTWNVTYGDIYPLGVKQQGILINGQFPGPQITSVTNENLIVSVFNSLNEPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS+FYFPSL   KAAGGYG
Sbjct  80   LLSWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFQKAAGGYG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            +IRIYSR +IPVPF PPA ++T+
Sbjct  140  SIRIYSRSVIPVPFPPPAAEYTI  162



>ref|XP_008455444.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=543

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            +YG +PYR++TW ITYGDI+PLGVKQ+ ILINGQFPGPQI+ VTN+NLIINV+N L+EPF
Sbjct  22   IYGEDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPF  81

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSYFYFPSL +HKAAGG+G
Sbjct  82   LISWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGFG  141

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
              +I SR +IP+PF  PA +FTV
Sbjct  142  GFKIQSRSIIPIPFPTPAGEFTV  164



>emb|CDX82897.1| BnaC01g13470D [Brassica napus]
Length=541

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17   NGVLGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNIIISVFNYLRE  76

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQR+NS+QDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77   PFLISWNGVQQRKNSYQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  519  YGAIRIYSRPLIPVPFAPPARDF  587
            +GAIR++SRP IPVPF  P  DF
Sbjct  137  FGAIRVWSRPRIPVPFPSPDGDF  159



>ref|XP_006656379.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=546

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+YTW +T+GDIYPLGVKQ+ ILINGQFPGPQID VTNDN++INVYN L  PFLL
Sbjct  26   GDDPYRFYTWNVTFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIVINVYNSLPSPFLL  85

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SW G+QQRR+SWQDGVYGT CPIPP  NFTY++Q KDQIGSY+YFPSL  HKAAGGYG I
Sbjct  86   SWQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGI  145

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            R+ SRP IPVPFAPPA DFT+
Sbjct  146  RVLSRPGIPVPFAPPAGDFTI  166



>gb|EAZ38022.1| hypothetical protein OsJ_22366 [Oryza sativa Japonica Group]
Length=532

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+YTW IT+GDIYPLGVKQ+ ILINGQFPGPQID VTNDN+IINV+N L  PFLL
Sbjct  12   GDDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLL  71

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SW G+QQRR+SWQDGVYGT CPIPP  NFTY++Q KDQIGSY+YFPSL  HKAAGGYG I
Sbjct  72   SWQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGI  131

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            R+ SRP IPVPFAPPA DFT+
Sbjct  132  RVLSRPGIPVPFAPPAGDFTI  152



>ref|XP_010676489.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=549

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR+YTW +TYGDIYPLGVKQ+ ILINGQFPGP I+ VTNDNLI++V+N L+EPFLLSW
Sbjct  26   SPYRFYTWNVTYGDIYPLGVKQQGILINGQFPGPPIEAVTNDNLIVSVFNSLDEPFLLSW  85

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSY+YFPSL  HKAAGGYG IRI
Sbjct  86   NGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYYYFPSLAFHKAAGGYGGIRI  145

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRPLIPVP+  PA DFTV
Sbjct  146  DSRPLIPVPYPTPAGDFTV  164



>gb|EAZ02087.1| hypothetical protein OsI_24168 [Oryza sativa Indica Group]
Length=542

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+YTW IT+GDIYPLGVKQ+ ILINGQFPGPQID VTNDN+IINV+N L  PFLL
Sbjct  22   GDDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLL  81

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SW G+QQRR+SWQDGVYGT CPIPP  NFTY++Q KDQIGSY+YFPSL  HKAAGGYG I
Sbjct  82   SWQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGI  141

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            R+ SRP IPVPFAPPA DFT+
Sbjct  142  RVLSRPGIPVPFAPPAGDFTI  162



>ref|NP_001058365.1| Os06g0678800 [Oryza sativa Japonica Group]
 dbj|BAD45475.1| putative PS60 [Oryza sativa Japonica Group]
 dbj|BAD45542.1| putative PS60 [Oryza sativa Japonica Group]
 dbj|BAF20279.1| Os06g0678800 [Oryza sativa Japonica Group]
 dbj|BAG92507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=542

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+YTW IT+GDIYPLGVKQ+ ILINGQFPGPQID VTNDN+IINV+N L  PFLL
Sbjct  22   GDDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLL  81

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SW G+QQRR+SWQDGVYGT CPIPP  NFTY++Q KDQIGSY+YFPSL  HKAAGGYG I
Sbjct  82   SWQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGI  141

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            R+ SRP IPVPFAPPA DFT+
Sbjct  142  RVLSRPGIPVPFAPPAGDFTI  162



>gb|EYU27771.1| hypothetical protein MIMGU_mgv1a003982mg [Erythranthe guttata]
Length=551

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G NPYRYYTW+ITYGDIYPLGVKQ+ ILINGQFPGP IDCVTNDNLII+VYNYLNEPFLL
Sbjct  32   GDNPYRYYTWRITYGDIYPLGVKQQGILINGQFPGPTIDCVTNDNLIISVYNYLNEPFLL  91

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQRRNSWQDGVYGT CPIPP KNFTY +QAKDQIG+YFYFPSL +HKAAGGYG+I
Sbjct  92   SWNGIQQRRNSWQDGVYGTNCPIPPGKNFTYAIQAKDQIGTYFYFPSLALHKAAGGYGSI  151

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            ++YSRP IPVPF PPA D+ V
Sbjct  152  KVYSRPQIPVPFPPPAGDYVV  172



>gb|KJB15896.1| hypothetical protein B456_002G202300 [Gossypium raimondii]
Length=449

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP +  VTNDNLIINVYN L+EPF
Sbjct  24   VQAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPF  83

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS++DGVYGTTCPIPP KNFTY+LQAKDQIG+++YFPSL  HKAAGG+G
Sbjct  84   LLSWNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYYFPSLAFHKAAGGFG  143

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA DFTV
Sbjct  144  GIRILSRPRIPVPFPDPAGDFTV  166



>ref|XP_010266098.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=547

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L EPFLLSW
Sbjct  30   DPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLPEPFLLSW  89

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IRI
Sbjct  90   NGIQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFGGIRI  149

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA DFTV
Sbjct  150  LSRPRIPVPFPDPAGDFTV  168



>gb|KJB57755.1| hypothetical protein B456_009G179300 [Gossypium raimondii]
Length=542

 Score =   238 bits (607),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
            GV G +PYR++T K+T+GDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYLN P
Sbjct  19   GVNGESPYRFFTLKVTHGDIYPLGVKQKGILINGQFPGPTIDAVTNDNLIIHVYNYLNVP  78

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+QQRRNSWQDGV GT CPI P KNFTY+LQ KDQIG++FYFPSL  HKAAGGY
Sbjct  79   FLISWNGVQQRRNSWQDGVLGTNCPIRPGKNFTYVLQVKDQIGTFFYFPSLLFHKAAGGY  138

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G+IRI+SRP IPVPF  PA DFTV
Sbjct  139  GSIRIWSRPKIPVPFPTPAGDFTV  162



>ref|XP_009596487.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            N + G +PYR+YTW +TYGDIYPLG+KQ+ ILINGQFPGP I+CVTNDNLIINV+N L+E
Sbjct  22   NLISGEDPYRFYTWNVTYGDIYPLGLKQQGILINGQFPGPPIECVTNDNLIINVFNNLDE  81

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG++QRRNSWQDGVYGT CPIPP  NFTY+LQ KDQIGS++YFPSL  HKAAGG
Sbjct  82   PFLISWNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGSFYYFPSLAFHKAAGG  141

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G+I I SR +IPVPF PPA +F++
Sbjct  142  FGSINIASRSVIPVPFPPPAGEFSI  166



>ref|XP_009794442.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=541

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            N + G +PYR+YTW ITYGD+YPLGVKQ+ ILINGQFPGP I+CVTNDNLIINV+N L+E
Sbjct  19   NLICGEDPYRFYTWNITYGDVYPLGVKQQGILINGQFPGPTIECVTNDNLIINVFNNLDE  78

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG++QRRNSWQDGVYGT CPIPP  NFTY+LQ KDQIGS++YFPSL  HKAAGG
Sbjct  79   PFLISWNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGSFYYFPSLAFHKAAGG  138

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G+I I S  +IPVPF PPA +F++
Sbjct  139  FGSINIASSSVIPVPFPPPAGEFSI  163



>ref|XP_007046383.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY02215.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=540

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G + YR++TW +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTN+NLIINV+N L++PFL+
Sbjct  24   GEDAYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINVFNSLDQPFLI  83

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQRRNSWQDGVYGT CPIPP  NFTY LQ KDQIGSYFYFPSL +HKAAGGYG  
Sbjct  84   SWNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYFPSLALHKAAGGYGGF  143

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            RI SR +IPVPF PPA D+T+
Sbjct  144  RILSRSVIPVPFPPPAADYTI  164



>ref|XP_011047251.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
 ref|XP_011047252.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=547

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR++TW +TYGDIYPLGVKQ+ ILING FPGPQI+ VTNDNLII+V+N L+EPFL+
Sbjct  28   GEDPYRFHTWNVTYGDIYPLGVKQQGILINGLFPGPQIESVTNDNLIISVFNSLDEPFLI  87

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSYFYFPSL MHKAAGG+G  
Sbjct  88   SWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLGMHKAAGGFGGF  147

Query  531  RIYSRPLIPVPFAPPARDFT  590
            +I SR +IPVPF PP+ DFT
Sbjct  148  KIASRSVIPVPFPPPSGDFT  167



>ref|XP_004506275.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V G +PYR+YTW +TYGDIYP G++Q+ ILINGQFPGPQI+ VTNDN+IINV+N L+EPF
Sbjct  20   VSGEDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNVIINVFNSLDEPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+ QRRNSWQDGVYGT CPIPP +NFTY LQ K+QIGSYFYFPSL +HKAAGGYG
Sbjct  80   LISWNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGSYFYFPSLALHKAAGGYG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             + + SRP+IPVPF PP+ DFT+
Sbjct  140  GLSVASRPMIPVPFDPPSGDFTI  162



>ref|XP_004243477.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=537

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            N ++G +PYR+Y W +TYGDIYPLGVKQ+ ILINGQFPGP I CVTNDNLIINV+N L+E
Sbjct  22   NFIHGEDPYRFYAWNVTYGDIYPLGVKQQGILINGQFPGPPIQCVTNDNLIINVFNNLDE  81

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG++QRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG
Sbjct  82   PFLISWNGVEQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFYYFPSLAFHKAAGG  141

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G+I I SR +IPVPF  PA +F++
Sbjct  142  FGSINIASRSVIPVPFPSPAGEFSI  166



>gb|KCW70295.1| hypothetical protein EUGRSUZ_F03538 [Eucalyptus grandis]
Length=487

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            NPYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+ PFL+SW
Sbjct  23   NPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLISW  82

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            +G+QQRRNS++DGVYGTTCPIPP +NFTY+ Q KDQIGS+FYFPSL+ HKAAGG+G IRI
Sbjct  83   SGIQQRRNSYEDGVYGTTCPIPPGRNFTYIFQVKDQIGSFFYFPSLKFHKAAGGFGGIRI  142

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRPLIPVPFA PA D+TV
Sbjct  143  LSRPLIPVPFAEPAGDYTV  161



>ref|XP_002320467.1| hypothetical protein POPTR_0014s15260g [Populus trichocarpa]
 gb|EEE98782.1| hypothetical protein POPTR_0014s15260g [Populus trichocarpa]
Length=532

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G + YR++TW +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLII+V+N L+EPFL+
Sbjct  18   GEDAYRFHTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIISVFNSLDEPFLI  77

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQRRNSWQDGVYGT C IPP +NFTY+LQ KDQIGSYFYFPSL MHKAAGG+G  
Sbjct  78   SWNGVQQRRNSWQDGVYGTNCAIPPGQNFTYVLQVKDQIGSYFYFPSLGMHKAAGGFGGF  137

Query  531  RIYSRPLIPVPFAPPARDFT  590
            +I SR +IPVPF+PP+ DFT
Sbjct  138  KIASRSVIPVPFSPPSGDFT  157



>ref|XP_004506310.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V G +PYR+YTW +TYGDIYP G++Q+ ILINGQFPGPQI+ VTNDN+IINV+N L+EPF
Sbjct  20   VSGEDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNVIINVFNSLDEPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+ QRRNSWQDGVYGT CPIPP +NFTY LQ K+QIGSYFYFPSL +HKAAGGYG
Sbjct  80   LISWNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGSYFYFPSLALHKAAGGYG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             + + SRP+IPVPF PP+ DFT+
Sbjct  140  GLSVASRPMIPVPFDPPSGDFTI  162



>gb|KJB47732.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=325

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDI+PLGV+Q+ ILINGQFPGP I  VTNDNLIINV N L+EPFLLSW
Sbjct  26   SPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLSW  85

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NGLQQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IR+
Sbjct  86   NGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIRV  145

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA DFT+
Sbjct  146  LSRPRIPVPFPDPAGDFTL  164



>ref|XP_003563398.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=549

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+YTW IT+GDIYPLGVKQ  ILINGQFPGPQID VTNDN++INV+N L  PFLL
Sbjct  29   GEDPYRFYTWNITFGDIYPLGVKQEGILINGQFPGPQIDAVTNDNIVINVFNNLPAPFLL  88

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SW G+QQRR+SWQDGVYGT CPIPP  NFTY +Q KDQIGSY+YFPSL +HKAAGGYG I
Sbjct  89   SWQGIQQRRSSWQDGVYGTNCPIPPGGNFTYNMQFKDQIGSYYYFPSLELHKAAGGYGGI  148

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            R+ SRP IPVPF PPA DFT+
Sbjct  149  RVLSRPRIPVPFDPPAGDFTI  169



>gb|KHG03845.1| L-ascorbate oxidase [Gossypium arboreum]
Length=542

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
            GV G +PYR++T K+T+GDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYLN P
Sbjct  19   GVNGESPYRFFTLKVTHGDIYPLGVKQKGILINGQFPGPTIDAVTNDNLIIHVYNYLNVP  78

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+QQRRNSWQDGV GT CPI P KNFTY+LQ KDQIG++FYFPSL  HKAAGGY
Sbjct  79   FLISWNGVQQRRNSWQDGVLGTNCPIRPGKNFTYVLQVKDQIGTFFYFPSLFFHKAAGGY  138

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G+IRI+SRP IPVPF  PA DFTV
Sbjct  139  GSIRIWSRPKIPVPFPTPAGDFTV  162



>gb|KEH30610.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=447

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  23   VASEDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLPEPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  83   LLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  142

Query  525  AIRIYSRPLIPVPFAPPARDFT  590
            +I+I SRP IPVPF  PA D+T
Sbjct  143  SIKILSRPRIPVPFPEPANDYT  164



>ref|XP_007017957.1| SKU5 similar 5 isoform 3 [Theobroma cacao]
 gb|EOY15182.1| SKU5 similar 5 isoform 3 [Theobroma cacao]
Length=445

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  24   DPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  84   NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>ref|XP_004166771.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            MRE S +CSL    L+L    + + G +PYR+  W ITYGDI+PLGVKQ+ ILINGQFPG
Sbjct  1    MRENSFLCSLTFLFLVLSF--SCINGEDPYRFLNWNITYGDIWPLGVKQQGILINGQFPG  58

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQI+ VTN+NLIINV+N L+EPFL+SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ 
Sbjct  59   PQIEAVTNENLIINVFNSLDEPFLISWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQV  118

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPSL +HKAAGG+G  +I SR +IP+PF  PA +FTV
Sbjct  119  KDQIGSYFYFPSLALHKAAGGFGGFKIQSRSIIPIPFPTPAGEFTV  164



>gb|KHG11003.1| L-ascorbate oxidase [Gossypium arboreum]
Length=545

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP +  VTNDNLIINVYN L+EPF
Sbjct  24   VQSEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPF  83

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS++DGVYGTTCPIPP KNFTY+LQAKDQIG+++YFPSL  HKAAGG+G
Sbjct  84   LLSWNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYYFPSLAFHKAAGGFG  143

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA DFTV
Sbjct  144  GIRILSRPRIPVPFPDPASDFTV  166



>ref|XP_010536445.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N L+EPFL+SW
Sbjct  25   DPYRFFDWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLISW  84

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS+QDGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  85   NGIQQRRNSFQDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  144

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  145  LSRPRIPVPFPDPAGDYTV  163



>gb|KHN05478.1| L-ascorbate oxidase like [Glycine soja]
Length=544

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  26   VAAEDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLTEPF  85

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  86   LLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  145

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            AI+I SRP IPVPF  PA DF++
Sbjct  146  AIKILSRPRIPVPFPDPAGDFSL  168



>gb|KJB15897.1| hypothetical protein B456_002G202300 [Gossypium raimondii]
Length=545

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP +  VTNDNLIINVYN L+EPF
Sbjct  24   VQAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPF  83

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS++DGVYGTTCPIPP KNFTY+LQAKDQIG+++YFPSL  HKAAGG+G
Sbjct  84   LLSWNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYYFPSLAFHKAAGGFG  143

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA DFTV
Sbjct  144  GIRILSRPRIPVPFPDPAGDFTV  166



>ref|XP_003537754.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  29   VAAEDPYRFFDWTITYGDIYPLGVKQQVILINGQFPGPEIYSVTNDNLIINVHNNLTEPF  88

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  89   LLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  148

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            AI+I SRP IPVPF  PA DF++
Sbjct  149  AIKILSRPRIPVPFPDPAGDFSL  171



>ref|XP_006592035.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=544

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  26   VAAEDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLTEPF  85

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  86   LLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  145

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            AI+I SRP IPVPF  PA DF++
Sbjct  146  AIKILSRPRIPVPFPDPAGDFSL  168



>ref|XP_008791980.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=541

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   NPYR++TW +T+GDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EPF
Sbjct  20   VGADNPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLTEPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNSW+DGV GT CPIPP KNFTY+LQ KDQIGSYFYFPSL  HKAAGG+G
Sbjct  80   LISWNGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQVKDQIGSYFYFPSLYFHKAAGGFG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
              RI SRPLIPVPF+ PA D+TV
Sbjct  140  GFRILSRPLIPVPFSEPAGDYTV  162



>ref|XP_010063104.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW70294.1| hypothetical protein EUGRSUZ_F03538 [Eucalyptus grandis]
Length=540

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            NPYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+ PFL+SW
Sbjct  23   NPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLISW  82

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            +G+QQRRNS++DGVYGTTCPIPP +NFTY+ Q KDQIGS+FYFPSL+ HKAAGG+G IRI
Sbjct  83   SGIQQRRNSYEDGVYGTTCPIPPGRNFTYIFQVKDQIGSFFYFPSLKFHKAAGGFGGIRI  142

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRPLIPVPFA PA D+TV
Sbjct  143  LSRPLIPVPFAEPAGDYTV  161



>ref|XP_007017956.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
 gb|EOY15181.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
Length=475

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  24   DPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  84   NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>gb|ACN50176.1| pectinesterase [Annona cherimola]
Length=540

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +3

Query  168  YGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFL  347
            +G +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EPFL
Sbjct  20   FGEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIFSVTNDNLIINVHNSLPEPFL  79

Query  348  LSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGA  527
            +SWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G 
Sbjct  80   ISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGG  139

Query  528  IRIYSRPLIPVPFAPPARDFTV  593
            I+I SRP IPVPF  PA D+T 
Sbjct  140  IKILSRPRIPVPFPDPAADYTA  161



>ref|XP_010266952.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=546

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L EPF
Sbjct  25   VRAEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLPEPF  84

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+ QRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  85   LISWNGVLQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFG  144

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA DFTV
Sbjct  145  GIRILSRPRIPVPFPDPAGDFTV  167



>gb|KGN43515.1| hypothetical protein Csa_7G043570 [Cucumis sativus]
Length=453

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            MR+ S +CSL    L+L      + G +PYR+  W ITYGDI+PLGVKQ+ ILINGQFPG
Sbjct  1    MRKNSFLCSLTFLFLVLSFSC--INGEDPYRFLNWNITYGDIWPLGVKQQGILINGQFPG  58

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQI+ VTN+NLIINV+N L+EPFL+SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ 
Sbjct  59   PQIEAVTNENLIINVFNSLDEPFLISWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQV  118

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPSL +HKAAGG+G  +I SR +IP+PF  PA +FTV
Sbjct  119  KDQIGSYFYFPSLALHKAAGGFGGFKIQSRSIIPIPFPTPAGEFTV  164



>ref|XP_007041705.1| SKU5 similar 5 [Theobroma cacao]
 gb|EOX97536.1| SKU5 similar 5 [Theobroma cacao]
Length=547

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP++  VTNDNLIINVYN L+EPFLLSW
Sbjct  30   DPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPELYSVTNDNLIINVYNNLDEPFLLSW  89

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G I+I
Sbjct  90   NGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIKI  149

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA DFTV
Sbjct  150  LSRPRIPVPFPDPAGDFTV  168



>gb|KDP36848.1| hypothetical protein JCGZ_08139 [Jatropha curcas]
Length=542

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  26   DPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  85

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  86   NGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  145

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPFA P  D+TV
Sbjct  146  LSRPRIPVPFADPDGDYTV  164



>ref|XP_008365718.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=373

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  16   VSAEDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPEIFSVTNDNLIINVHNSLPEPF  75

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNS+QDGVYGTTC IPP +NFTY LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  76   LISWNGVQQRRNSYQDGVYGTTCAIPPGQNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFG  135

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            AI+I SRPLIPVPF  PA D+++
Sbjct  136  AIKILSRPLIPVPFPEPAGDYSI  158



>ref|XP_008452926.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34135.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=541

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            NPYR++TW ++Y +IYPLGV+Q+ ILINGQFPGP I CVTNDNLIINV+N L+EPFL+SW
Sbjct  25   NPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDIHCVTNDNLIINVFNSLDEPFLISW  84

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  85   NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  144

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  145  LSRPRIPVPFPDPAGDYTV  163



>ref|XP_004144498.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            MR+ S +CSL    L+L    + + G +PYR+  W ITYGDI+PLGVKQ+ ILINGQFPG
Sbjct  1    MRKNSFLCSLTFLFLVLSF--SCINGEDPYRFLNWNITYGDIWPLGVKQQGILINGQFPG  58

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQI+ VTN+NLIINV+N L+EPFL+SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ 
Sbjct  59   PQIEAVTNENLIINVFNSLDEPFLISWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQV  118

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPSL +HKAAGG+G  +I SR +IP+PF  PA +FTV
Sbjct  119  KDQIGSYFYFPSLALHKAAGGFGGFKIQSRSIIPIPFPTPAGEFTV  164



>gb|KFK34458.1| hypothetical protein AALP_AA5G148000 [Arabis alpina]
Length=541

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EP
Sbjct  20   AVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPFA PA D+TV
Sbjct  140  GGIRILSRPRIPVPFADPAGDYTV  163



>ref|XP_010686816.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NG+ G NPYR+Y WK+TYG IYPLG+KQ+ I+INGQFPGPQIDCVTNDNL+I+V+NYLNE
Sbjct  20   NGINGENPYRFYDWKVTYGYIYPLGIKQQVIMINGQFPGPQIDCVTNDNLVISVHNYLNE  79

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFLLSWNGLQ RRNS+QDG+ GTTCPIPPR+N+TY+LQAKDQIGS+FYFPS+ +HKA+GG
Sbjct  80   PFLLSWNGLQNRRNSYQDGMPGTTCPIPPRRNYTYVLQAKDQIGSFFYFPSINLHKASGG  139

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            YGAIRIYSRP IPVPF PPA DFTV
Sbjct  140  YGAIRIYSRPRIPVPFPPPAGDFTV  164



>gb|KJB58003.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=445

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDI+PLGV+Q  ILINGQFPGP I  VTNDNLIINV+N LNEPFLLSW
Sbjct  24   DPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  84   NGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>ref|NP_001053555.1| Os04g0561900 [Oryza sativa Japonica Group]
 emb|CAE01850.2| OSJNBa0084K11.18 [Oryza sativa Japonica Group]
 dbj|BAF15469.1| Os04g0561900 [Oryza sativa Japonica Group]
 dbj|BAG92144.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92535.1| unnamed protein product [Oryza sativa Japonica Group]
Length=554

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W++T G+I PLGV+Q+ ILINGQFPGP+IDC TNDNLI+NV+N L+EPFLLSW
Sbjct  28   DPYRFFDWEVTTGNINPLGVQQQGILINGQFPGPEIDCQTNDNLIVNVHNRLSEPFLLSW  87

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NGLQ R+NSWQDGV GT CPIPP +NFTY +QAKDQIGS+FYFPSL  HKAAGG+GAIRI
Sbjct  88   NGLQHRKNSWQDGVSGTNCPIPPGQNFTYQMQAKDQIGSFFYFPSLAFHKAAGGFGAIRI  147

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRPLIPVPF PPA ++T+
Sbjct  148  RSRPLIPVPFDPPAGEYTM  166



>ref|XP_002528421.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF33963.1| multicopper oxidase, putative [Ricinus communis]
Length=544

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGVKQ+ ILINGQFPGP I  VTN+NLIINV+N L EPF
Sbjct  23   VNAEDPYRFFDWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVHNSLPEPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  83   LISWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  142

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRPLIPVPF  PA DFTV
Sbjct  143  GIRILSRPLIPVPFPDPAGDFTV  165



>gb|KDP47151.1| hypothetical protein JCGZ_00042 [Jatropha curcas]
Length=540

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGVKQ+ ILINGQFPGP I  VTN+NLIINV+N L EPFL+SW
Sbjct  23   DPYRFFDWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVHNSLPEPFLISW  82

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G IRI
Sbjct  83   NGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGGIRI  142

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRPLIPVPF  PA DFTV
Sbjct  143  LSRPLIPVPFPEPADDFTV  161



>emb|CAH67167.1| H0211B05.4 [Oryza sativa Indica Group]
Length=554

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W++T G+I PLGV+Q+ ILINGQFPGP+IDC TNDNLI+NV+N L+EPFLLSW
Sbjct  28   DPYRFFDWEVTTGNINPLGVQQQGILINGQFPGPEIDCQTNDNLIVNVHNRLSEPFLLSW  87

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NGLQ R+NSWQDGV GT CPIPP +NFTY +QAKDQIGS+FYFPSL  HKAAGG+GAIRI
Sbjct  88   NGLQHRKNSWQDGVSGTNCPIPPGQNFTYQMQAKDQIGSFFYFPSLAFHKAAGGFGAIRI  147

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRPLIPVPF PPA ++T+
Sbjct  148  RSRPLIPVPFDPPAGEYTM  166



>ref|XP_003605947.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES88144.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=538

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+Y W +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L+EPFL+
Sbjct  22   GEDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLI  81

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+ QRRNSWQDGVYGT CPI P +NFTY+LQ KDQIGSYFYFPSL  HKAAGGYG  
Sbjct  82   SWNGVLQRRNSWQDGVYGTNCPISPGQNFTYILQVKDQIGSYFYFPSLAFHKAAGGYGGF  141

Query  531  RIYSRPLIPVPFAPPARDFTV  593
             I SR +IPVPF PP+ D+T+
Sbjct  142  TIASRSVIPVPFDPPSGDYTI  162



>ref|NP_001147597.1| LOC100281206 precursor [Zea mays]
 gb|ACG28039.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACL54459.1| unknown [Zea mays]
 gb|AFW68979.1| L-ascorbate oxidase [Zea mays]
Length=548

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR+YTW +T+GDIYPLGVKQ  ILINGQFPGPQID VTNDN+I+NV+N L  PFLLSW
Sbjct  31   DPYRFYTWNVTFGDIYPLGVKQEGILINGQFPGPQIDAVTNDNIIVNVFNNLPVPFLLSW  90

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
             G+QQRR+SWQDGVYGT CPIPP  NFTY +Q KDQIGSY+YFPSL  HKAAGGYGAIR+
Sbjct  91   QGIQQRRSSWQDGVYGTNCPIPPGGNFTYNMQFKDQIGSYYYFPSLLFHKAAGGYGAIRV  150

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF PPA DFT+
Sbjct  151  LSRPRIPVPFDPPAGDFTI  169



>gb|KJB47729.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
 gb|KJB47730.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=447

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDI+PLGV+Q+ ILINGQFPGP I  VTNDNLIINV N L+EPFLLSW
Sbjct  26   SPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLSW  85

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NGLQQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IR+
Sbjct  86   NGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIRV  145

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA DFT+
Sbjct  146  LSRPRIPVPFPDPAGDFTL  164



>ref|XP_006390228.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27514.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=515

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EP
Sbjct  20   AVTAEDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D+TV
Sbjct  140  GGIRILSRPRIPVPFPDPAGDYTV  163



>ref|XP_010918208.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=541

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   NPYR++TW +++GDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  20   VGADNPYRFFTWNVSFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLSEPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNSW+DGV GT CPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  80   LISWNGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQVKDQIGSFFYFPSLYFHKAAGGFG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
              RI SRPLIPVPF+ PA D+TV
Sbjct  140  GFRILSRPLIPVPFSEPAGDYTV  162



>ref|XP_004145593.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            NPYR++TW ++Y +IYPLGV+Q+ ILINGQFPGP + CVTNDNLIINV+N L+EPFL+SW
Sbjct  25   NPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLISW  84

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  85   NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  144

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  145  LSRPRIPVPFPDPAGDYTV  163



>gb|KGN55480.1| hypothetical protein Csa_4G653410 [Cucumis sativus]
Length=447

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            NPYR++TW ++Y +IYPLGV+Q+ ILINGQFPGP + CVTNDNLIINV+N L+EPFL+SW
Sbjct  25   NPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLISW  84

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  85   NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  144

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  145  LSRPRIPVPFPDPAGDYTV  163



>ref|XP_004157080.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            NPYR++TW ++Y +IYPLGV+Q+ ILINGQFPGP + CVTNDNLIINV+N L+EPFL+SW
Sbjct  25   NPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLISW  84

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  85   NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  144

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  145  LSRPRIPVPFPDPAGDYTV  163



>gb|KJB58004.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=474

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDI+PLGV+Q  ILINGQFPGP I  VTNDNLIINV+N LNEPFLLSW
Sbjct  24   DPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  84   NGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>ref|XP_003527501.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN41233.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V G +PYR+YTW +TYGDIYPLGVKQ+ ILIN QFPGPQI+ VTNDNLIINVYN L+EPF
Sbjct  20   VRGEDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVYNSLDEPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+ QRRNSWQDGVYGT CPI P  NFTY+LQ KDQIGSYFY+PSL  HKAAGGYG
Sbjct  80   LLSWNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGSYFYYPSLAFHKAAGGYG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
              +I SRP IPVPF  PA DFT+
Sbjct  140  GFKIASRPGIPVPFPTPAGDFTI  162



>ref|XP_009758923.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=549

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYRY+ W+I+YGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EPF
Sbjct  29   VVAEDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIISVTNDNLIINVHNDLPEPF  88

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LL+WNGLQQR+NS++DGVYGTTCPIPP KNFTY++Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  89   LLTWNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFG  148

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA DFT+
Sbjct  149  GIRILSRPRIPVPFPEPAGDFTI  171



>ref|XP_006364519.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=541

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYRY+ W+ITYGDIYPLG++Q+ ILINGQFPGP I  VTNDNLIINV+N L++PF
Sbjct  26   VVAEDPYRYFDWRITYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVHNDLHDPF  85

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LL+WNGLQQR+NS++DGVYGTTCPIPP +NFTY++Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  86   LLTWNGLQQRKNSFEDGVYGTTCPIPPGQNFTYIMQVKDQIGSFFYFPSLQFHKAAGGFG  145

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA DFT+
Sbjct  146  GIRILSRPRIPVPFPEPAGDFTI  168



>ref|XP_009334388.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=544

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  27   DPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  86

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  87   NGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  146

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  147  LSRPRIPVPFPDPAGDYTV  165



>gb|KEH30611.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   233 bits (594),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  23   VASEDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLPEPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  83   LLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  142

Query  525  AIRIYSRPLIPVPFAPPARDFT  590
            +I+I SRP IPVPF  PA D+T
Sbjct  143  SIKILSRPRIPVPFPEPANDYT  164



>emb|CDX73238.1| BnaC06g36860D [Brassica napus]
Length=541

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EP
Sbjct  20   AVTAESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G +RI SRP IPVPFA PA D+TV
Sbjct  140  GGLRILSRPGIPVPFADPAGDYTV  163



>ref|XP_011046313.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=544

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++TW +TYGDIYPLGVKQ+ ILINGQFPGP I  VTN+NLIINVYN L EPF
Sbjct  23   VNAEDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVYNSLPEPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++Y+PSL  HKAAGG+G
Sbjct  83   LISWNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYYPSLAFHKAAGGFG  142

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRPLIPVPF  PA DFTV
Sbjct  143  GIRILSRPLIPVPFPEPADDFTV  165



>ref|XP_009630901.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYRY+ W+I+YGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIIN++N L EPF
Sbjct  26   VVAEDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIISVTNDNLIINIHNDLPEPF  85

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LL+WNGLQQR+NS++DGVYGTTCPIPP KNFTY++Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  86   LLTWNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFG  145

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA DFT+
Sbjct  146  GIRILSRPRIPVPFLEPAGDFTI  168



>ref|XP_002306213.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
 gb|EEE86724.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
Length=543

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++TW +TYGDIYPLGVKQ+ ILINGQFPGP I  VTN+NLIINVYN L EPF
Sbjct  23   VNAEDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVYNSLPEPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++Y+PSL  HKAAGG+G
Sbjct  83   LISWNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYYPSLAFHKAAGGFG  142

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRPLIPVPF  PA DFTV
Sbjct  143  GIRILSRPLIPVPFPEPADDFTV  165



>ref|XP_006435292.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 gb|ESR48532.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
Length=446

 Score =   230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+QR ILIN QFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22   VSAEDPYRFFNWNVTYGDIYPLGVRQRGILINWQFPGPDIHSVTNDNLIINVFNSLDEPF  81

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82   LLSWNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+TV
Sbjct  142  GIRILSRPRIPVPFPDPAGDYTV  164



>ref|XP_008387887.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=544

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  27   DPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  86

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  87   NGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  146

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  147  LSRPRIPVPFPDPAGDYTV  165



>ref|XP_007017955.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY15180.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=541

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  24   DPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  84   NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>gb|KHG21048.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR+Y+W +TYGDIYPLGV+Q  +LINGQFPGP I  VTNDNLIINVYN LNE FLLSW
Sbjct  24   DPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTYMLQ KDQIGS++Y+PSL  HKAAGG+G IRI
Sbjct  84   NGVQQRRNSYEDGVYGTTCPIPPGKNFTYMLQVKDQIGSFYYYPSLGFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>gb|EMS67789.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=610

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR+YTW +T+GDIYPLGVKQ+ ILINGQFPGPQID VTNDN+IINV+N L  PFLLSW
Sbjct  156  DPYRFYTWNVTFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPAPFLLSW  215

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
             G+QQRR+SWQDGVYGT CPIPP  NFTY +Q KDQIGSY+YFPSL  HKAAGGYG IR+
Sbjct  216  QGIQQRRSSWQDGVYGTNCPIPPGGNFTYNMQFKDQIGSYYYFPSLAFHKAAGGYGGIRV  275

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF PPA DFT+
Sbjct  276  LSRPRIPVPFNPPAGDFTI  294



>ref|XP_002285913.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18890.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++TW +T+GDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L EPF
Sbjct  20   VAAEDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLTEPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSW+G+QQRRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  80   LLSWSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGSFFYFPSLDFHKAAGGFG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D TV
Sbjct  140  GIRILSRPRIPVPFPDPAGDITV  162



>gb|KJB59710.1| hypothetical protein B456_009G268100 [Gossypium raimondii]
Length=491

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR+Y+W +TYGDIYPLGV+Q  +LINGQFPGP I  VTNDNLIINVYN LNE FLLSW
Sbjct  24   DPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV+GTTCPIPP KNFTYMLQ KDQIG+++Y+PSL  HKAAGG+G IRI
Sbjct  84   NGVQQRRNSYEDGVFGTTCPIPPGKNFTYMLQVKDQIGTFYYYPSLGFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>emb|CAN83942.1| hypothetical protein VITISV_013559 [Vitis vinifera]
Length=541

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++TW +T+GDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L EPF
Sbjct  20   VAAEDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLTEPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSW+G+QQRRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  80   LLSWSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGSFFYFPSLDFHKAAGGFG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D TV
Sbjct  140  GIRILSRPRIPVPFPDPAGDITV  162



>ref|XP_010278638.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=541

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++TWK+TYGDIYPLGVKQR ILINGQFPGPQIDCVTNDNLI++VYNYL+EPFL+SW
Sbjct  24   DPYRFFTWKVTYGDIYPLGVKQRGILINGQFPGPQIDCVTNDNLIVSVYNYLDEPFLISW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G I+I
Sbjct  84   NGIQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLGFHKAAGGFGGIKI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP+IPVPF PPA DFTV
Sbjct  144  NSRPMIPVPFPPPAGDFTV  162



>ref|XP_006486657.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|KDO68240.1| hypothetical protein CISIN_1g009054mg [Citrus sinensis]
Length=545

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EPFL+SW
Sbjct  28   SPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLISW  87

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGSYFYFPS+   KAAGG+G IRI
Sbjct  88   NGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYFPSVGFQKAAGGFGGIRI  147

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRPLIPVPF  PA DFTV
Sbjct  148  LSRPLIPVPFPEPAGDFTV  166



>ref|XP_009106271.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EP
Sbjct  20   AVTAESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G +RI SRP IPVPFA PA D+TV
Sbjct  140  GGLRILSRPGIPVPFADPAGDYTV  163



>gb|KHN33820.1| L-ascorbate oxidase like [Glycine soja]
Length=540

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  23   DPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  82

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  83   NGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  142

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  143  LSRPRIPVPFPDPAGDYTV  161



>gb|KEH40258.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            +   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22   IVAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPF  81

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82   LISWNGVQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+TV
Sbjct  142  GIRILSRPRIPVPFDDPAGDYTV  164



>ref|XP_009630902.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nicotiana 
tomentosiformis]
Length=543

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            +   +PYRY+ W+I+YGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L +PF
Sbjct  22   IVAEDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPF  81

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LL+WNGLQQR+NS++DGVYGTTCPIPP KNFTY++Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  82   LLTWNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFG  141

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA DFT+
Sbjct  142  GIRILSRPRIPVPFLEPAGDFTI  164



>ref|XP_002510630.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF52817.1| multicopper oxidase, putative [Ricinus communis]
Length=546

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLG++Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  29   DPYRFFNWNVTYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  88

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  89   NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  148

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPFA P  D+T+
Sbjct  149  LSRPRIPVPFADPDGDYTI  167



>ref|XP_004231076.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=536

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYRY+ W+ITYGDI+PLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N+L  PF
Sbjct  23   VVAEDPYRYFDWRITYGDIHPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNHLPHPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LL+WNGLQQR+NS+QDGVYGTTCPIPP KNFTY +Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  83   LLTWNGLQQRKNSFQDGVYGTTCPIPPGKNFTYTMQVKDQIGSFFYFPSLQFHKAAGGFG  142

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA DFT+
Sbjct  143  GIRILSRPKIPVPFPEPAGDFTI  165



>ref|XP_006422489.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
 gb|ESR35729.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
Length=545

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EPFL+SW
Sbjct  28   SPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLISW  87

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGSYFYFPS+   KAAGG+G IRI
Sbjct  88   NGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYFPSVGFQKAAGGFGGIRI  147

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRPLIPVPF  PA DFTV
Sbjct  148  LSRPLIPVPFPEPAGDFTV  166



>ref|XP_002518462.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF43849.1| multicopper oxidase, putative [Ricinus communis]
Length=541

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V G NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINV+NYL EPF
Sbjct  20   VNGENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDVVTNDNLIINVFNYLREPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNSWQDGVYGT CPI P +NFTY+LQ KDQIGSYFYFPSL MHKAAGG+G
Sbjct  80   LISWNGIQQRRNSWQDGVYGTNCPILPGRNFTYILQVKDQIGSYFYFPSLGMHKAAGGFG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IR++SRP IPVPF PP+ DFTV
Sbjct  140  GIRVWSRPRIPVPFPPPSGDFTV  162



>ref|XP_009630899.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=547

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYRY+ W+I+YGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L +PF
Sbjct  26   VVAEDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPF  85

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LL+WNGLQQR+NS++DGVYGTTCPIPP KNFTY++Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  86   LLTWNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFG  145

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA DFT+
Sbjct  146  GIRILSRPRIPVPFLEPAGDFTI  168



>ref|XP_003523207.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  30   DPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  89

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  90   NGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  149

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  150  LSRPRIPVPFPDPAGDYTV  168



>ref|XP_007131584.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
 gb|ESW03578.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
Length=545

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV N L EPFLLSW
Sbjct  31   DPYRFFDWTVTYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVRNNLTEPFLLSW  90

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS+QDGVYGTTCPIPP +NFTY LQ KDQIGS+FYFPSL  HKAAGG+GAI+I
Sbjct  91   NGVQQRRNSYQDGVYGTTCPIPPGQNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGAIKI  150

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA DF++
Sbjct  151  LSRPRIPVPFPDPAGDFSL  169



>ref|XP_006390229.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27515.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=541

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EP
Sbjct  20   AVTAEDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D+TV
Sbjct  140  GGIRILSRPRIPVPFPDPAGDYTV  163



>gb|KJB14335.1| hypothetical protein B456_002G120000 [Gossypium raimondii]
Length=541

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +T+GDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N LNEPFL+SW
Sbjct  24   DPYRFFDWNVTFGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVHNSLNEPFLISW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            +G+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IRI
Sbjct  84   SGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>gb|KHG21949.1| L-ascorbate oxidase [Gossypium arboreum]
Length=543

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDI+PLGV+Q+ ILINGQFPGP I  VTNDNLIINV N L+EPFLLSW
Sbjct  26   SPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLSW  85

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NGLQQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IR+
Sbjct  86   NGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIRV  145

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA DFT+
Sbjct  146  LSRPRIPVPFTDPAGDFTL  164



>gb|KHF99506.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +T+GDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N LNEPFL+SW
Sbjct  24   DPYRFFDWNVTFGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVHNSLNEPFLISW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            +G+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IRI
Sbjct  84   SGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>gb|KJB47731.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=522

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDI+PLGV+Q+ ILINGQFPGP I  VTNDNLIINV N L+EPFLLSW
Sbjct  26   SPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLSW  85

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NGLQQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IR+
Sbjct  86   NGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIRV  145

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA DFT+
Sbjct  146  LSRPRIPVPFPDPAGDFTL  164



>ref|XP_004505676.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=533

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V+  +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  18   VFAEDPYRFFDWNITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPF  77

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNS++DGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  78   LISWNGIQQRRNSYEDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  137

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            +I+I SRP IPVPF  P  D+T+
Sbjct  138  SIKILSRPRIPVPFPDPTDDYTL  160



>ref|XP_007221787.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
 gb|EMJ22986.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
Length=544

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  23   VAAEDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  83   LISWNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  142

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+TV
Sbjct  143  GIRILSRPRIPVPFPDPAGDYTV  165



>gb|KCW55614.1| hypothetical protein EUGRSUZ_I01478 [Eucalyptus grandis]
Length=449

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EP
Sbjct  23   AVTAEDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEP  82

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLL+WNG+QQRRNS++DGV GTTCPIPP KNFTY+LQ KDQIGS+FY PSL  HKAAGG+
Sbjct  83   FLLTWNGVQQRRNSYEDGVQGTTCPIPPGKNFTYILQVKDQIGSFFYSPSLAFHKAAGGF  142

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRPLIPVPF  PA D+TV
Sbjct  143  GGIRILSRPLIPVPFDNPADDYTV  166



>ref|XP_010530339.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=540

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V G +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EP
Sbjct  19   AVTGESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEP  78

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+Q RRNS+ DGVYGTTCPIPP +N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  79   FLISWNGVQNRRNSYVDGVYGTTCPIPPGRNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  138

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRPLIPVPF  PA D+TV
Sbjct  139  GGIRILSRPLIPVPFDQPAGDYTV  162



>dbj|BAK00459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR+YTW +T+GD+YPLGVKQ+ ILINGQFPGPQID VTNDN++INV+N L  PFLLSW
Sbjct  24   DPYRFYTWNVTFGDVYPLGVKQQGILINGQFPGPQIDAVTNDNIVINVFNNLPAPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
             G+QQRR+SWQDGVYGT CP PP  NFTY +Q KDQIGSY+YFPSL  HKAAGGYG IR+
Sbjct  84   QGIQQRRSSWQDGVYGTNCPTPPGGNFTYNMQFKDQIGSYYYFPSLAFHKAAGGYGGIRV  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF PPA DFT+
Sbjct  144  LSRPRIPVPFDPPAGDFTI  162



>ref|XP_008798222.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=541

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++TW +T+GDIYPLGV+Q+ ILINGQFPGP I  V+NDNLIINV+N L EPFL+SW
Sbjct  24   SPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVSNDNLIINVHNSLTEPFLISW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNSW+DGV GT CPIPP KNFTY+LQAKDQIGS+FYFPSL  HKAAGG+G  RI
Sbjct  84   NGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQAKDQIGSFFYFPSLYFHKAAGGFGGFRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRPLIPVPF  PA D+TV
Sbjct  144  LSRPLIPVPFPEPAGDYTV  162



>gb|KHF99853.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDI+PLGV+Q  ILINGQFPGP I  VTNDNLIINV+N LNEPFLLSW
Sbjct  24   DPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  84   NGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>ref|XP_002438855.1| hypothetical protein SORBIDRAFT_10g027270 [Sorghum bicolor]
 gb|EER90222.1| hypothetical protein SORBIDRAFT_10g027270 [Sorghum bicolor]
Length=546

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR+YTW +T+GDIYPLGVKQ  ILINGQFPGPQID VTNDN+I+NV+N L  PFLLSW
Sbjct  29   DPYRFYTWNVTFGDIYPLGVKQEGILINGQFPGPQIDAVTNDNIIVNVFNNLPVPFLLSW  88

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
             G+QQRR+SWQDGVYGT CPIPP  NFTY +Q KDQIG+Y+YFPSL  HKAAGGYG IR+
Sbjct  89   QGIQQRRSSWQDGVYGTNCPIPPGGNFTYNMQFKDQIGTYYYFPSLLFHKAAGGYGGIRV  148

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF PPA DFT+
Sbjct  149  LSRPRIPVPFDPPAGDFTI  167



>gb|KJB47727.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=543

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDI+PLGV+Q+ ILINGQFPGP I  VTNDNLIINV N L+EPFLLSW
Sbjct  26   SPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLSW  85

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NGLQQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IR+
Sbjct  86   NGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIRV  145

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA DFT+
Sbjct  146  LSRPRIPVPFPDPAGDFTL  164



>ref|XP_004291312.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=545

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+QR ILINGQFPGP I+ VTNDNLIINV+N L+EPF
Sbjct  24   VTAEDPYRFFQWNVTYGDIYPLGVRQRGILINGQFPGPDINSVTNDNLIINVFNSLDEPF  83

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQR NS+QDGVYGTTCPIPP +N TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  84   LLSWNGIQQRHNSFQDGVYGTTCPIPPGRNLTYILQVKDQIGSFYYFPSLAFHKAAGGFG  143

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  P+ D+TV
Sbjct  144  GIRILSRPRIPVPFPDPSGDYTV  166



>gb|KJB58002.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=541

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDI+PLGV+Q  ILINGQFPGP I  VTNDNLIINV+N LNEPFLLSW
Sbjct  24   DPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  84   NGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>ref|XP_004500896.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=548

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N L+EPFL+SW
Sbjct  31   DPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLISW  90

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV+GTTCPIPP +NFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  91   NGIQQRRNSFEDGVFGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLSFHKAAGGFGGIRI  150

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  P  D+TV
Sbjct  151  LSRPRIPVPFPDPDGDYTV  169



>ref|XP_006302110.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
 gb|EOA35008.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
Length=541

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINVYN L+EP
Sbjct  20   AVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TYMLQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGVQQRRNSFVDGVYGTTCPIPPGKNYTYMLQMKDQIGSFYYFPSLGFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D TV
Sbjct  140  GGIRILSRPRIPVPFPDPAGDTTV  163



>gb|KJB59711.1| hypothetical protein B456_009G268100 [Gossypium raimondii]
Length=541

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR+Y+W +TYGDIYPLGV+Q  +LINGQFPGP I  VTNDNLIINVYN LNE FLLSW
Sbjct  24   DPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV+GTTCPIPP KNFTYMLQ KDQIG+++Y+PSL  HKAAGG+G IRI
Sbjct  84   NGVQQRRNSYEDGVFGTTCPIPPGKNFTYMLQVKDQIGTFYYYPSLGFHKAAGGFGGIRI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPAGDYTV  162



>ref|XP_009758924.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=548

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYRY+ W+I+YGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L +PF
Sbjct  27   VVAEDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPF  86

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LL+WNGLQQR+NS++DGVYGTTCPIPP KNFTY++Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  87   LLTWNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFG  146

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA DFT+
Sbjct  147  GIRILSRPRIPVPFPEPAGDFTL  169



>emb|CDX87633.1| BnaA07g32400D [Brassica napus]
Length=541

 Score =   230 bits (587),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EP
Sbjct  20   AVTAESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G +RI SRP IPVPFA PA D TV
Sbjct  140  GGLRILSRPGIPVPFADPAGDNTV  163



>ref|XP_010471765.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR+Y W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINVYN L+EP
Sbjct  21   AVTAEDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEP  80

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP +N+TYMLQ KDQIGS++YFPSL  HKAAGG+
Sbjct  81   FLLSWNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGSFYYFPSLAFHKAAGGF  140

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D TV
Sbjct  141  GGIRILSRPRIPVPFPDPAGDTTV  164



>gb|KGN43295.1| hypothetical protein Csa_7G018770 [Cucumis sativus]
Length=444

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            N  +  +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+ INV+N L E
Sbjct  24   NIAFADSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPE  83

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFLLSWNG+QQR+NS+QDGVYGTTCPIPP +NFTY +Q KDQIGSYFYFPSL  HKAAGG
Sbjct  84   PFLLSWNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLAFHKAAGG  143

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G+IR+ SRPLIPVPF  PA D+T+
Sbjct  144  FGSIRVLSRPLIPVPFPEPAADYTL  168



>ref|XP_006435293.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 ref|XP_006473746.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR48533.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 gb|KDO85016.1| hypothetical protein CISIN_1g009149mg [Citrus sinensis]
Length=542

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+QR ILIN QFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22   VSAEDPYRFFNWNVTYGDIYPLGVRQRGILINWQFPGPDIHSVTNDNLIINVFNSLDEPF  81

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82   LLSWNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+TV
Sbjct  142  GIRILSRPRIPVPFPDPAGDYTV  164



>ref|XP_004290036.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   230 bits (587),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR++ W +TYGDIYPLG+KQR ILINGQFPGP+I  VTNDNLIINV+N L EPFL+
Sbjct  22   GEDPYRFFEWNVTYGDIYPLGIKQRGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLI  81

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            +WNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS++YFPSL  HKAAGG+GAI
Sbjct  82   TWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAI  141

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            +I SRP IPVPF  PA D+++
Sbjct  142  KILSRPRIPVPFPEPAADYSL  162



>ref|XP_002889063.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65322.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   230 bits (587),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EP
Sbjct  20   AVVAEDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D TV
Sbjct  140  GGIRILSRPRIPVPFPDPAGDTTV  163



>ref|XP_004966212.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=550

 Score =   230 bits (587),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR+YTW IT+GDIYPLGVKQ  ILINGQFPGPQID VTNDN+I+NV+N L  PFLLSW
Sbjct  33   DPYRFYTWNITFGDIYPLGVKQEGILINGQFPGPQIDAVTNDNIIVNVFNNLPVPFLLSW  92

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
             G+QQRR+SWQDGV GT CPIPP  NFTY +Q KDQIGSY+YFPSL  HKAAGGYG IR+
Sbjct  93   QGIQQRRSSWQDGVSGTNCPIPPGGNFTYNMQFKDQIGSYYYFPSLLFHKAAGGYGGIRV  152

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF PPA DFT+
Sbjct  153  LSRPRIPVPFDPPAGDFTI  171



>dbj|BAJ91397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR+YTW +T+GD+YPLGV+Q+ ILINGQFPGPQID VTNDN++INV+N L  PFLLSW
Sbjct  24   DPYRFYTWNVTFGDVYPLGVRQQGILINGQFPGPQIDAVTNDNIVINVFNNLPAPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
             G+QQRR+SWQDGVYGT CP PP  NFTY +Q KDQIGSY+YFPSL  HKAAGGYG IR+
Sbjct  84   QGIQQRRSSWQDGVYGTNCPTPPGGNFTYNMQFKDQIGSYYYFPSLAFHKAAGGYGGIRV  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF PPA DFT+
Sbjct  144  LSRPRIPVPFDPPAGDFTI  162



>ref|XP_008221175.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=544

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PY+++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  23   VAAEDPYKFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  83   LISWNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  142

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+TV
Sbjct  143  GIRILSRPRIPVPFPDPAGDYTV  165



>ref|XP_002282214.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI37764.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EPFL+SW
Sbjct  25   DPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLISW  84

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IRI
Sbjct  85   NGVQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIRI  144

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+T+
Sbjct  145  LSRPRIPVPFPDPAGDYTI  163



>ref|XP_008382461.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=535

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYRY+ W +TYGDIYPLG +Q+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  16   VSAEDPYRYFDWNVTYGDIYPLGARQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPF  75

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  76   LISWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFG  135

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
            AI+I SRP IPVPF  PA D+++
Sbjct  136  AIKIJSRPRIPVPFPEPAGDYSI  158



>ref|XP_008236098.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=536

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP+I  VTNDNLIINV+N L EPFL+SW
Sbjct  20   DPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLISW  79

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS++YFPSL  HKAAGG+GAI+I
Sbjct  80   NGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIKI  139

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+++
Sbjct  140  LSRPRIPVPFPDPAGDYSI  158



>ref|XP_008377105.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=544

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  27   DPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  86

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS+ DGVYGTTCPIPP +NFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  87   NGIQQRRNSFVDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLDFHKAAGGFGGIRI  146

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  P  D+TV
Sbjct  147  LSRPRIPVPFPDPDGDYTV  165



>gb|KFK34651.1| hypothetical protein AALP_AA5G173600 [Arabis alpina]
Length=543

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V G +PYR+Y W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINV+N L+EPF
Sbjct  23   VTGESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNVIINVHNSLDEPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFP+L  HKAAGG+G
Sbjct  83   LISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQMKDQIGSFYYFPTLAFHKAAGGFG  142

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPFA PA D+TV
Sbjct  143  GIRILSRPGIPVPFADPAGDYTV  165



>ref|XP_004144874.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004152953.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            N  +  +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+ INV+N L E
Sbjct  24   NIAFADSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPE  83

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFLLSWNG+QQR+NS+QDGVYGTTCPIPP +NFTY +Q KDQIGSYFYFPSL  HKAAGG
Sbjct  84   PFLLSWNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLAFHKAAGG  143

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G+IR+ SRPLIPVPF  PA D+T+
Sbjct  144  FGSIRVLSRPLIPVPFPEPAADYTL  168



>ref|XP_010428667.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR+Y W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINV+N L+EP
Sbjct  21   AVTAEDPYRFYEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEP  80

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP +N+TYMLQ KDQIGS++YFPSL  HKAAGG+
Sbjct  81   FLLSWNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGSFYYFPSLAFHKAAGGF  140

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D TV
Sbjct  141  GGIRILSRPRIPVPFPDPAGDTTV  164



>ref|XP_003527461.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W ITYGDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  30   DPYRFFNWNITYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  89

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV+GTTCPIP  KNFTY+LQ KDQIG+++YFPSL  HKAAGG+G IRI
Sbjct  90   NGIQQRRNSFEDGVFGTTCPIPAGKNFTYILQVKDQIGTFYYFPSLAFHKAAGGFGGIRI  149

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  150  LSRPRIPVPFPDPAGDYTV  168



>ref|XP_008447902.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=546

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            N  +  +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+ INV+N L E
Sbjct  24   NIAFADSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPE  83

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFLLSWNG+QQR+NS+QDGVYGTTCPIPP +NFTY +Q KDQIGSYFYFPSL  HKAAGG
Sbjct  84   PFLLSWNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLAFHKAAGG  143

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G+IR+ SRPLIPVPF  PA D+T+
Sbjct  144  FGSIRVLSRPLIPVPFPEPAADYTL  168



>emb|CDY35790.1| BnaA08g04510D [Brassica napus]
Length=542

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22   VTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPF  81

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82   LISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPFA PA D+TV
Sbjct  142  GIRILSRPGIPVPFADPAGDYTV  164



>ref|XP_010416527.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR+Y W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINVYN L+EP
Sbjct  20   AVTAEDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP +N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGVQQRRNSFVDGVYGTTCPIPPGQNYTYVLQMKDQIGSFYYFPSLAFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D TV
Sbjct  140  GGIRILSRPRIPVPFPDPAGDTTV  163



>ref|XP_009107631.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22   VTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPF  81

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82   LISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPFA PA D+TV
Sbjct  142  GIRILSRPGIPVPFADPAGDYTV  164



>ref|XP_006596528.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L++PF
Sbjct  26   VVAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPF  85

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS++DGV GTTCPIPP  NFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  86   LLSWNGVQQRRNSFEDGVLGTTCPIPPGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  145

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+TV
Sbjct  146  GIRILSRPRIPVPFDDPAGDYTV  168



>emb|CDY67479.1| BnaCnng55180D [Brassica napus]
Length=541

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  21   VTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPF  80

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  81   LISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  140

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPFA PA D+TV
Sbjct  141  GIRILSRPGIPVPFADPAGDYTV  163



>gb|AAL24296.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91125.1| unknown protein [Arabidopsis thaliana]
Length=542

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EP
Sbjct  21   AVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEP  80

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  81   FLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  140

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPFA PA D+TV
Sbjct  141  GGIRILSRPGIPVPFADPAGDYTV  164



>gb|AAF99833.1|AC008046_5 Putative pectinesterase [Arabidopsis thaliana]
Length=541

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EP
Sbjct  20   AVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPFA PA D+TV
Sbjct  140  GGIRILSRPGIPVPFADPAGDYTV  163



>ref|XP_010539810.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=542

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP +  VTNDNLIINV+N L+EP
Sbjct  20   AVTAEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDVRSVTNDNLIINVFNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SW+G+QQRRNS+ DGVYGTTCPIPP KN+TY LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLISWSGIQQRRNSFVDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D+TV
Sbjct  140  GGIRILSRPKIPVPFPDPAGDYTV  163



>ref|NP_564479.1| SKU5 similar 6 [Arabidopsis thaliana]
 gb|AEE31910.1| SKU5 similar 6 [Arabidopsis thaliana]
Length=542

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EP
Sbjct  21   AVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEP  80

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  81   FLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  140

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPFA PA D+TV
Sbjct  141  GGIRILSRPGIPVPFADPAGDYTV  164



>gb|KEH36280.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=544

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PY+++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N LNEPFL+SW
Sbjct  27   DPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLISW  86

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV GTTCPIPP +NFTY+LQ KDQIGS++YFPSL   KAAGG+G IRI
Sbjct  87   NGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIRI  146

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  147  LSRPRIPVPFPEPAGDYTV  165



>gb|ACJ85585.1| unknown [Medicago truncatula]
Length=544

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PY+++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N LNEPFL+SW
Sbjct  27   DPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLISW  86

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV GTTCPIPP +NFTY+LQ KDQIGS++YFPSL   KAAGG+G IRI
Sbjct  87   NGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIRI  146

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  147  LSRPRIPVPFPEPAGDYTV  165



>ref|XP_009128157.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+Q+ ILI+G+FPGP I  VTNDNL+IN++N L+EPF
Sbjct  21   VTAEDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEPF  80

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TYMLQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  81   LLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGFG  140

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+TV
Sbjct  141  GIRILSRPRIPVPFPDPAGDYTV  163



>gb|AFK35121.1| unknown [Medicago truncatula]
Length=544

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PY+++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N LNEPFL+SW
Sbjct  27   DPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLISW  86

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV GTTCPIPP +NFTY+LQ KDQIGS++YFPSL   KAAGG+G IRI
Sbjct  87   NGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIRI  146

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  147  LSRPRIPVPFPEPAGDYTV  165



>ref|XP_003550444.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN48525.1| L-ascorbate oxidase like [Glycine soja]
Length=541

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L++P
Sbjct  19   AVVAEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQP  78

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS++DGV GTTCPIP   NFTY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  79   FLLSWNGVQQRRNSFEDGVLGTTCPIPAGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGF  138

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D+TV
Sbjct  139  GGIRILSRPRIPVPFDDPAGDYTV  162



>gb|ABK95805.1| unknown [Populus trichocarpa]
Length=544

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV   +PYR+ TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTN+NLII+VYNYL E
Sbjct  20   NGVNCEDPYRFITWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNENLIISVYNYLRE  79

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQRRNSWQDGVYGT+CPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAG 
Sbjct  80   PFLISWNGIQQRRNSWQDGVYGTSCPIPPGKNFTYALQVKDQIGSFFYFPSLGFHKAAGA  139

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF PPA DFTV
Sbjct  140  FGGIRIWSRPRIPVPFPPPAGDFTV  164



>ref|XP_007160607.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
 gb|ESW32601.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
Length=539

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L++PFLLSW
Sbjct  22   DPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLSW  81

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV+GTTCPIPP  NFTY+LQ KDQIGS++YFPSL  HKAAGG+G +RI
Sbjct  82   NGVQQRRNSFEDGVWGTTCPIPPGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGLRI  141

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  142  LSRPRIPVPFDDPAGDYTV  160



>ref|NP_177743.1| SKU5-like 5 protein [Arabidopsis thaliana]
 gb|AAF17645.1|AC009978_21 T23E18.10 [Arabidopsis thaliana]
 dbj|BAH19558.1| AT1G76160 [Arabidopsis thaliana]
 gb|AEE35804.1| SKU5-like 5 protein [Arabidopsis thaliana]
Length=541

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W ITYGDIYPLGV+Q+ ILING FPGP I  VTNDNLIINVYN L+EP
Sbjct  20   AVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D TV
Sbjct  140  GGIRILSRPRIPVPFPDPAGDTTV  163



>gb|AGT57427.1| ascorbate oxidase [Prunus persica]
Length=536

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP+I  VTNDNLIINV+N L EPFL+SW
Sbjct  20   DPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLISW  79

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+Q RRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS++YFPSL  HKAAGG+GAI+I
Sbjct  80   NGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIKI  139

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+++
Sbjct  140  LSRPRIPVPFPDPASDYSI  158



>emb|CDY55201.1| BnaCnng28410D, partial [Brassica napus]
Length=549

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILI+G+FPGP I  VTNDNL+IN++N L+EP
Sbjct  28   AVTAEDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEP  87

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TYMLQ KDQIGS++YFPSL  HKAAGG+
Sbjct  88   FLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGF  147

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D+TV
Sbjct  148  GGIRILSRPRIPVPFPDPAGDYTV  171



>gb|AAL09733.1| At1g76160/T23E18_10 [Arabidopsis thaliana]
Length=541

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W ITYGDIYPLGV+Q+ ILING FPGP I  VTNDNLIINVYN L+EP
Sbjct  20   AVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D TV
Sbjct  140  GGIRILSRPRIPVPFPDPAGDTTV  163



>emb|CDY68834.1| BnaCnng60730D, partial [Brassica napus]
Length=549

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILI+G+FPGP I  VTNDNL+IN++N L+EP
Sbjct  28   AVTAEDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEP  87

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TYMLQ KDQIGS++YFPSL  HKAAGG+
Sbjct  88   FLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGF  147

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D+TV
Sbjct  148  GGIRILSRPRIPVPFPDPAGDYTV  171



>ref|XP_010028797.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55613.1| hypothetical protein EUGRSUZ_I01478 [Eucalyptus grandis]
Length=545

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EP
Sbjct  23   AVTAEDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEP  82

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLL+WNG+QQRRNS++DGV GTTCPIPP KNFTY+LQ KDQIGS+FY PSL  HKAAGG+
Sbjct  83   FLLTWNGVQQRRNSYEDGVQGTTCPIPPGKNFTYILQVKDQIGSFFYSPSLAFHKAAGGF  142

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRPLIPVPF  PA D+TV
Sbjct  143  GGIRILSRPLIPVPFDNPADDYTV  166



>ref|XP_002307765.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE94761.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=548

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYG IYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  26   VKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  85

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  86   LLSWNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFG  145

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+T+
Sbjct  146  GIRILSRPRIPVPFDDPAGDYTI  168



>gb|KFK28784.1| hypothetical protein AALP_AA7G047600 [Arabis alpina]
Length=541

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV+G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID +TNDN+II+V+NYL E
Sbjct  17   NGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKE  76

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77   PFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  519  YGAIRIYSR  545
            +GAIR++SR
Sbjct  137  FGAIRVWSR  145



>gb|AAM97070.1| pectinesterase, putative [Arabidopsis thaliana]
 gb|AAN15546.1| pectinesterase, putative [Arabidopsis thaliana]
Length=541

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W ITYGDIYPLGV+Q+ ILING FPGP I  VTNDNLIINVYN L+EP
Sbjct  20   AVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80   FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGF  139

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPF  PA D TV
Sbjct  140  GGIRILSRPRIPVPFPDPAGDTTV  163



>ref|XP_007136137.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
 gb|ESW08131.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
Length=548

 Score =   228 bits (581),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYGDI+PLGV+QR ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  31   DPYRFFNWNVTYGDIFPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  90

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGV+GTTCPI P KNFTY+LQ KDQIGS++YFPSL  HKA GG+G IRI
Sbjct  91   NGIQQRRNSFEDGVFGTTCPIAPGKNFTYILQVKDQIGSFYYFPSLAFHKAGGGFGGIRI  150

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  P  D+TV
Sbjct  151  LSRPRIPVPFPDPDGDYTV  169



>ref|XP_008789824.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Phoenix dactylifera]
Length=427

 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V G +PYR++TW ITYGDI+PLGVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L EPF
Sbjct  28   VRGDDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPF  87

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNSWQDGVYGT CPIPPR+NFTY+LQ KDQIGSYFYFPSL  HKAAGG+G
Sbjct  88   LLSWNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFG  147

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
              RI SRPLIPVPF PPA D+T+
Sbjct  148  GFRILSRPLIPVPFPPPAGDYTL  170



>ref|XP_011041276.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=548

 Score =   228 bits (580),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYG IYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  26   VKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  85

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  86   LLSWNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFG  145

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+T+
Sbjct  146  GIRILSRPRIPVPFDDPAGDYTI  168



>ref|XP_010089487.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB37880.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=300

 Score =   221 bits (562),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+Y W +TYGDIYPLGVKQR ILINGQFPGPQI+ VTNDNLII+V+N L+EPFL+
Sbjct  22   GESPYRFYDWNVTYGDIYPLGVKQRGILINGQFPGPQIESVTNDNLIISVFNSLDEPFLI  81

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSYFY PSL  HKAAGG+G I
Sbjct  82   SWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYSPSLAFHKAAGGFGGI  141

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            +I SRP+IPVPF PPA DFT+
Sbjct  142  KILSRPVIPVPFPPPAGDFTI  162



>ref|XP_011034917.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=547

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYG IYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  26   VKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  85

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS++DGV GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  86   LLSWNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFG  145

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+TV
Sbjct  146  GIRILSRPRIPVPFDDPAGDYTV  168



>ref|XP_007200295.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
 gb|EMJ01494.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
Length=536

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP+I  VTNDNLIINV+N L EPFL+SW
Sbjct  20   DPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLISW  79

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+Q RRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS++YFPSL  HKAAGG+GAI+I
Sbjct  80   NGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIKI  139

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+++
Sbjct  140  LSRPRIPVPFPDPAGDYSI  158



>ref|XP_011046956.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=543

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            NGV   +PYR+ TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTN+NLII+VYNYL E
Sbjct  20   NGVNCEDPYRFITWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNENLIISVYNYLRE  79

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFL+SWNG+QQRRNSWQDGVYGT CPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAG 
Sbjct  80   PFLISWNGIQQRRNSWQDGVYGTNCPIPPGKNFTYALQVKDQIGSFFYFPSLGFHKAAGA  139

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF PPA DFTV
Sbjct  140  FGGIRIWSRPRIPVPFPPPAGDFTV  164



>ref|XP_002888337.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64596.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
             V   +PYR++ W +TYGDIYPLGV+Q+ ILING+FPGP I  VTNDNLIINV+N L+EP
Sbjct  22   AVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGKFPGPDIHSVTNDNLIINVHNSLDEP  81

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  82   FLISWNGIQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  141

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G IRI SRP IPVPFA PA D+TV
Sbjct  142  GGIRILSRPGIPVPFADPAGDYTV  165



>gb|KEH29685.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=537

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+Y W +TYGDIYPLGVKQ+ ILING+FPGPQI+ VTNDNLIINV+N L+EPFL+
Sbjct  22   GEDPYRFYNWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIINVFNSLDEPFLI  81

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+ QRRNSWQDGVYGT CPI P KN TY+LQ KDQIGSYFYFPSL  HKAAGGYG  
Sbjct  82   SWNGVLQRRNSWQDGVYGTNCPISPGKN-TYILQVKDQIGSYFYFPSLAFHKAAGGYGGF  140

Query  531  RIYSRPLIPVPFAPPARDFTV  593
             I +R +IPVPF PP+ DFT+
Sbjct  141  TIATRSVIPVPFDPPSGDFTI  161



>ref|XP_009400332.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=542

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +T+GDIYPLG++Q+ ILINGQFPGP I   TNDN+I+NVYN L EPFL+SW
Sbjct  25   DPYRFFDWNVTFGDIYPLGIRQQGILINGQFPGPDIHSQTNDNIIVNVYNSLTEPFLISW  84

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQR NSWQDGV GT CPIPP KNFTY++  KDQIGS+FYFPSL  HKAAGG+G IRI
Sbjct  85   NGVQQRGNSWQDGVSGTNCPIPPGKNFTYVMHLKDQIGSFFYFPSLAFHKAAGGFGGIRI  144

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPFA PA DFT+
Sbjct  145  LSRPRIPVPFATPADDFTL  163



>ref|XP_010500092.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR+Y W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22   VTAESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPF  81

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+Q RRNS+ DG+ GTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82   LISWNGVQNRRNSYVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPFA PA D+TV
Sbjct  142  GIRILSRPGIPVPFADPAGDYTV  164



>ref|XP_010101299.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB88234.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=541

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYG IYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  19   VRAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  78

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  79   LLSWNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  138

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  P+ D+T+
Sbjct  139  GIRILSRPRIPVPFPDPSGDYTI  161



>ref|XP_003529638.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN35730.1| L-ascorbate oxidase like [Glycine soja]
Length=547

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V+  +PYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINVYNYL EPF
Sbjct  25   VHCEDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLREPF  84

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNGLQ RRNSWQDGVYGT CPIPP +N TY +Q KDQIGSYFYFPSL MHKAAG +G
Sbjct  85   LISWNGLQHRRNSWQDGVYGTNCPIPPGRNLTYAIQVKDQIGSYFYFPSLGMHKAAGAFG  144

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI+SRPLIPVPF PPA DFT+
Sbjct  145  GIRIWSRPLIPVPFPPPAGDFTI  167



>ref|XP_004499321.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=544

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W ITYGDIYPLG++Q+ ILINGQFPGP I  VTNDNLIINV+N L+ PF
Sbjct  23   VLAEDPYRFFDWNITYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+QQRRNS++DGV GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  83   LISWNGVQQRRNSYEDGVSGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  142

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+T+
Sbjct  143  GIRILSRPRIPVPFDDPAGDYTL  165



>ref|XP_002300669.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE79942.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=547

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYG IYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  26   VKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  85

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS++DGV GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  86   LLSWNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFG  145

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+T+
Sbjct  146  GIRILSRPRIPVPFDDPAGDYTI  168



>ref|XP_011099705.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR+YTW +TYG IYPLGV Q+ ILINGQFPGP I  VTNDN+I+NV+N L+EPFL+ W
Sbjct  21   SPYRFYTWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNIIVNVFNSLDEPFLIHW  80

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            +G+Q RRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGS+FYFPSL  HKAAGG+G I+I
Sbjct  81   SGVQNRRNSYEDGVYGTTCPIPPGQNFTYILQMKDQIGSFFYFPSLAFHKAAGGFGGIKI  140

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRPLIPVPF PPA D+TV
Sbjct  141  LSRPLIPVPFDPPADDYTV  159



>ref|XP_003610452.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES92649.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=545

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            M+ Y +V S +  V IL L    V   +PYR++TWKITYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1    MKSYYNVVSSLFLVTILLLFFTSVKCEDPYRFFTWKITYGDIYPLGVKQQGILINGQFPG  60

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQID VTN+NLII+VYNYL EPFL+SWNG+Q RRNSWQDGV GT CPIPP KNFTY LQ 
Sbjct  61   PQIDAVTNENLIISVYNYLTEPFLISWNGIQHRRNSWQDGVSGTNCPIPPGKNFTYTLQV  120

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIG+YFYFPSL MHKAAG +G IRI+SRP IPVPF PPA DFT+
Sbjct  121  KDQIGTYFYFPSLGMHKAAGAFGGIRIWSRPRIPVPFPPPAGDFTL  166



>ref|XP_009785141.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=540

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYG IYPLGV Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  24   DPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGSY+YFPSL  HKAAGG+G I+I
Sbjct  84   NGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIKI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  144  LSRPRIPVPFPDPADDYTV  162



>ref|XP_010461374.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010461375.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=542

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR+Y W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22   VTAESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPF  81

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+Q RRNS+ DG+ GTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82   LISWNGVQNRRNSYVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPFA PA D+T+
Sbjct  142  GIRILSRPGIPVPFADPAGDYTI  164



>ref|XP_006855939.1| hypothetical protein AMTR_s00037p00216460 [Amborella trichopoda]
 gb|ERN17406.1| hypothetical protein AMTR_s00037p00216460 [Amborella trichopoda]
Length=545

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V G +PYR++TW++T+GDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNL+INV+N L EPF
Sbjct  24   VNGDDPYRFFTWQVTWGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLVINVFNNLTEPF  83

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNSWQDGVYGT CPIPP  NFTY LQAKDQIGSYFYFPSL  HKAAGG+G
Sbjct  84   LLSWNGIQQRRNSWQDGVYGTNCPIPPGGNFTYNLQAKDQIGSYFYFPSLAFHKAAGGFG  143

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IR+ SRPLIPVPF PPA DFTV
Sbjct  144  GIRVLSRPLIPVPFPPPAGDFTV  166



>ref|XP_004142986.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 gb|KGN62282.1| Multicopper oxidase [Cucumis sativus]
Length=539

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYG IYPLG+ Q+ ILINGQFPGP I  VTNDN+IINV+N L+EPF
Sbjct  17   VRAEDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPF  76

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  77   LLSWNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYFPSLGFHKAAGGFG  136

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+TV
Sbjct  137  GIRILSRPRIPVPFPDPAGDYTV  159



>ref|XP_011088669.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++TW ITY DIYPLGV+Q+ ILINGQFPGP I  VTNDN+I+NVYN L EPF
Sbjct  19   VNAEDPYRFFTWNITYADIYPLGVRQQGILINGQFPGPDIYAVTNDNIIVNVYNNLPEPF  78

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQR+NS++DGVYGTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAGG+G
Sbjct  79   LLSWNGVQQRKNSFEDGVYGTTCPIPPGKNFTYVMQMKDQIGSFYYFPSLAFHKAAGGFG  138

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  P  DFT+
Sbjct  139  GIRILSRPRIPVPFPEPHGDFTL  161



>ref|XP_006307199.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
 gb|EOA40097.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
Length=541

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNL+INV+N L+EPF
Sbjct  21   VIAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLVINVHNSLDEPF  80

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNG+Q RRNS+ DG+ GTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  81   LISWNGVQNRRNSFVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  140

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPFA PA D+TV
Sbjct  141  GIRILSRPGIPVPFADPAGDYTV  163



>ref|XP_006411628.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
 gb|ESQ53081.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
Length=551

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V+  +PYR++ W++TYG+IYPLG+ QR ILINGQFPGP+I  VTN+NLIINV+N L+EPF
Sbjct  21   VHAEDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNNNLIINVHNDLDEPF  80

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+Q R+NS+QDGVYGTTCPIPP KN+TY +Q KDQIGS+FYFPSL +HKAAGG+G
Sbjct  81   LLSWNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLALHKAAGGFG  140

Query  525  AIRIYSRPLIPVPFAPPARDFT  590
              RI SRP IPVPF  PA DFT
Sbjct  141  GHRILSRPRIPVPFPDPAGDFT  162



>ref|XP_008445302.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYG IYPLG+ Q+ ILINGQFPGP I  VTNDN+IINV+N L+EPFLLSW
Sbjct  20   DPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLSW  79

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  80   NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIRI  139

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+TV
Sbjct  140  LSRPRIPVPFPDPAGDYTV  158



>ref|XP_010103298.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB95365.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=632

 Score =   227 bits (579),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W ITYGDIYPLGV+QR ILINGQFPGP+I  VTNDNLIINV+N L EPFL+SW
Sbjct  206  DPYRFFNWNITYGDIYPLGVRQRGILINGQFPGPEIYSVTNDNLIINVFNSLPEPFLISW  265

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+Q R+NS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FY+PSL  HKAAGG+G IRI
Sbjct  266  NGVQNRKNSYQDGVYGTTCPIPPGKNFTYKLQMKDQIGSFFYYPSLAFHKAAGGFGGIRI  325

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+T+
Sbjct  326  LSRPRIPVPFPDPAGDYTI  344


 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 114/143 (80%), Gaps = 5/143 (3%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR+  W +TYG+IYPLGV+QR ILINGQFPGP I  VTNDNLI+NV+N L EPF
Sbjct  25   VIAEDPYRFMEWNVTYGNIYPLGVRQRGILINGQFPGPGIYAVTNDNLIVNVHNNLPEPF  84

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SW+GLQ R+NS++DGVYGTTCPIPP KNFTY LQAKDQIGS++YFPSL  HKAAGG+ 
Sbjct  85   LISWSGLQNRKNSFEDGVYGTTCPIPPGKNFTYRLQAKDQIGSFYYFPSLGFHKAAGGF-  143

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
                 SRP IPVPF  PA D  +
Sbjct  144  ----LSRPQIPVPFPQPAADHRI  162



>ref|XP_010667351.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR+++W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+ PF
Sbjct  18   VVAEDPYRFFSWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNNLDVPF  77

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+Q RRNS++DGVYGTTCPIPP +NFTYMLQ KDQIGS++Y+PSL  HKAAG +G
Sbjct  78   LLSWNGVQNRRNSFEDGVYGTTCPIPPGRNFTYMLQVKDQIGSFYYYPSLAFHKAAGAFG  137

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  P+ D+TV
Sbjct  138  GIRILSRPRIPVPFPDPSGDYTV  160



>tpg|DAA62868.1| TPA: hypothetical protein ZEAMMB73_701617, partial [Zea mays]
Length=237

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++TW +TYGDIYPLGVKQ+ ILIN QFPGPQI+ VTNDNLIINV+N LNEPFLLSW
Sbjct  31   DPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLSW  90

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            +GLQQRRNS++DGV GTTCPIPP  NFTY++QAKDQIG+Y+YFPSL  HKAAGG+G IR+
Sbjct  91   SGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIRV  150

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF PPA D+TV
Sbjct  151  LSRPQIPVPFPPPAADYTV  169



>gb|KFK44289.1| hypothetical protein AALP_AA1G238900 [Arabis alpina]
Length=176

 Score =   213 bits (543),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PY+++ W +TYG+I PLGV+Q+ ILING+FPGP I  VTNDNLIINV+N+L+EPF
Sbjct  20   VAAEDPYKFFEWHVTYGNISPLGVQQQGILINGKFPGPDIYSVTNDNLIINVFNHLDEPF  79

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SW+G+Q  RNS+QDGVYGTTCPIPP KN+TY LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  80   LISWSGIQNWRNSYQDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFG  139

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI +R LIPVPF  PA D+TV
Sbjct  140  GIRISNRALIPVPFPAPADDYTV  162



>ref|XP_010667350.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYRY+ W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINV+N LN PF
Sbjct  18   VVAEDPYRYFNWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVFNNLNVPF  77

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSW+G+Q RRNS+QDGVYGTTCPIPP +NFTY LQ KDQIGS++YFPSL  HKAAG +G
Sbjct  78   LLSWSGVQNRRNSYQDGVYGTTCPIPPGRNFTYKLQFKDQIGSFYYFPSLAFHKAAGAFG  137

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI SRP IPVPF  PA D+TV
Sbjct  138  GIRILSRPRIPVPFPDPAGDYTV  160



>ref|XP_007153964.1| hypothetical protein PHAVU_003G080100g [Phaseolus vulgaris]
 gb|ESW25958.1| hypothetical protein PHAVU_003G080100g [Phaseolus vulgaris]
Length=545

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V+  +PYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINVYNYL EPF
Sbjct  23   VHCEDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLREPF  82

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            L+SWNGLQ RRNSWQDGV GT CPIPP +N TY +Q KDQIGSYFYFPSL MHKAAG +G
Sbjct  83   LISWNGLQHRRNSWQDGVAGTNCPIPPGRNLTYAIQVKDQIGSYFYFPSLGMHKAAGAFG  142

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             IRI+SRPLIPVPF PPA DFT+
Sbjct  143  GIRIWSRPLIPVPFPPPAGDFTI  165



>ref|XP_004987010.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=553

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            N      PYR++ W ITYG+I PLGV Q+ ILINGQFPGP I+  TN+NLIINV+N L +
Sbjct  18   NSASAEAPYRFFGWNITYGEIRPLGVSQQGILINGQFPGPTIESQTNENLIINVHNNLPD  77

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFLLSWNGLQQR++SWQDGV GT CPIPP +NFTY LQAKDQIGS+FYFPSL  HKAAGG
Sbjct  78   PFLLSWNGLQQRKDSWQDGVSGTNCPIPPGQNFTYHLQAKDQIGSFFYFPSLAFHKAAGG  137

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +GAIRI+SRPLIPVPF  P  ++TV
Sbjct  138  FGAIRIHSRPLIPVPFPSPDDEYTV  162



>ref|XP_010103300.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB95367.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=548

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ WKITYGDIYPLGV+QR ILINGQFPGP I  VTNDN+IINV N L EPF
Sbjct  24   VSAEDPYRFFDWKITYGDIYPLGVRQRGILINGQFPGPDIFSVTNDNIIINVQNNLPEPF  83

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSW+G+Q R+NS++DGVYGTTCPIPP KNFTY LQ KDQIG++FYFPSL  HKAAGG+G
Sbjct  84   LLSWSGVQNRKNSFEDGVYGTTCPIPPGKNFTYKLQMKDQIGTFFYFPSLAFHKAAGGFG  143

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
             I+I SRP IPVPF  PA D+T+
Sbjct  144  GIKILSRPRIPVPFPDPAGDYTI  166



>ref|XP_004487420.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+YTW +TYGDIYPLG+KQ+ ILINGQFPGPQI+ VTNDNLII+V+N LNEPFL+
Sbjct  22   GEDPYRFYTWNVTYGDIYPLGIKQQGILINGQFPGPQIESVTNDNLIISVFNSLNEPFLI  81

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQRRNSWQDGVYGT CPIP  KNFTY+LQ KDQIGSYFYFPSL  HKAAGGYGA 
Sbjct  82   SWNGVQQRRNSWQDGVYGTNCPIPAGKNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGAF  141

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            +I SRPLIPVPF PPA DF++
Sbjct  142  KINSRPLIPVPFPPPAADFSI  162



>ref|XP_008362259.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=542

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 134/166 (81%), Gaps = 3/166 (2%)
 Frame = +3

Query  96   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  275
            M  Y S C ++L  L+     NG    +PYR+Y W +TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1    MGVYKSACCVVLVALLTVTCTNGE---DPYRFYNWNVTYGDIYPLGVKQQGILINGQFPG  57

Query  276  PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  455
            PQID VTNDNLIINV+N L+EPFL+SWNG+QQRRNSWQDGV+GT CPIPP +NFTY LQ 
Sbjct  58   PQIDSVTNDNLIINVFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYALQV  117

Query  456  KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  593
            KDQIGSYFYFPSL  HKAAGG+G I+I SRP IPVPF PPA DFT+
Sbjct  118  KDQIGSYFYFPSLGFHKAAGGFGGIKIDSRPRIPVPFPPPAGDFTI  163



>emb|CAA65634.1| PS60 [Nicotiana tabacum]
Length=540

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYG IYPLGV Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  24   DPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+Q RRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGSY+YFPSL  HKAAGG+G I+I
Sbjct  84   NGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIKI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+T+
Sbjct  144  LSRPRIPVPFPDPADDYTL  162



>ref|XP_009623446.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=540

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++ W +TYG IYPLGV Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  24   DPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLSW  83

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            NG+Q RRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGSY+YFPSL  HKAAGG+G I+I
Sbjct  84   NGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIKI  143

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF  PA D+T+
Sbjct  144  LSRPRIPVPFPDPADDYTL  162



>tpg|DAA62867.1| TPA: hypothetical protein ZEAMMB73_701617 [Zea mays]
Length=217

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  177  NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  356
            +PYR++TW +TYGDIYPLGVKQ+ ILIN QFPGPQI+ VTNDNLIINV+N LNEPFLLSW
Sbjct  31   DPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLSW  90

Query  357  NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  536
            +GLQQRRNS++DGV GTTCPIPP  NFTY++QAKDQIG+Y+YFPSL  HKAAGG+G IR+
Sbjct  91   SGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIRV  150

Query  537  YSRPLIPVPFAPPARDFTV  593
             SRP IPVPF PPA D+TV
Sbjct  151  LSRPQIPVPFPPPAADYTV  169



>ref|XP_004293304.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=544

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  159  NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  338
            +G  G +PY+  TWKITYGDIYPLGVKQ+ ILIN QFPGPQID VTN NL+I+V+NYL+E
Sbjct  19   HGANGEDPYKLLTWKITYGDIYPLGVKQQGILINNQFPGPQIDAVTNMNLVISVFNYLSE  78

Query  339  PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  518
            PFLLSW+G+QQRRNSWQDG+ GT CPI P +NFTY +Q KDQIGS+FYFPS   HKAAGG
Sbjct  79   PFLLSWDGIQQRRNSWQDGMPGTNCPILPGRNFTYNIQVKDQIGSFFYFPSFLFHKAAGG  138

Query  519  YGAIRIYSRPLIPVPFAPPARDFTV  593
            +G IRI+SRP IPVPF  PA D TV
Sbjct  139  FGGIRIWSRPKIPVPFPNPAGDHTV  163



>ref|XP_008789823.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Phoenix dactylifera]
Length=549

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V G +PYR++TW ITYGDI+PLGVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L EPF
Sbjct  28   VRGDDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPF  87

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+QQRRNSWQDGVYGT CPIPPR+NFTY+LQ KDQIGSYFYFPSL  HKAAGG+G
Sbjct  88   LLSWNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFG  147

Query  525  AIRIYSRPLIPVPFAPPARDFTV  593
              RI SRPLIPVPF PPA D+T+
Sbjct  148  GFRILSRPLIPVPFPPPAGDYTL  170



>ref|XP_003596958.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|ABN08527.1| Multicopper oxidase, type 1 [Medicago truncatula]
 gb|AES67209.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=539

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  171  GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  350
            G +PYR+YTW +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLI++V+N L++PFL+
Sbjct  25   GEDPYRFYTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIVSVFNSLDQPFLI  84

Query  351  SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  530
            SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSYFYFPSL +HKAAGGYG I
Sbjct  85   SWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGYGGI  144

Query  531  RIYSRPLIPVPFAPPARDFTV  593
            +I SRP+IPVPF PP+ DFT+
Sbjct  145  KINSRPMIPVPFPPPSNDFTI  165



>ref|XP_010052867.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW76996.1| hypothetical protein EUGRSUZ_D01344 [Eucalyptus grandis]
Length=544

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  162  GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  341
            G  G NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGP ID +TNDN+II+VYNYL EP
Sbjct  22   GANGDNPYRFFTWKVTYGDIYPLGVKQKGILINGQFPGPHIDAITNDNVIISVYNYLKEP  81

Query  342  FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  521
            FL+SWNG+QQRRNSWQDGVYGT CPI P +NFTY++Q KDQIGSYFYFPS+ + KAAGG+
Sbjct  82   FLISWNGIQQRRNSWQDGVYGTNCPILPGRNFTYVMQVKDQIGSYFYFPSIGLQKAAGGF  141

Query  522  GAIRIYSRPLIPVPFAPPARDFTV  593
            G+IRI+SRPLIPVPF PPA DF V
Sbjct  142  GSIRIWSRPLIPVPFPPPAGDFMV  165



>ref|XP_009101945.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  165  VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  344
            V   +PYR++ W++TYG+IYPLG+ QR ILINGQFPGP+I  VTNDNLIINV+N L+EPF
Sbjct  21   VQAEDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPF  80

Query  345  LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  524
            LLSWNG+Q R+NS+QDGVYGTTCPIPP KN+TY +Q KDQIGS+FYFPSL  HKAAG +G
Sbjct  81   LLSWNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAFHKAAGAFG  140

Query  525  AIRIYSRPLIPVPFAPPARDFT  590
             +R+ SRP IPVPF  PA DFT
Sbjct  141  GLRVLSRPRIPVPFPEPAGDFT  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160