BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I09

Length=588
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011081060.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     259   2e-82   Sesamum indicum [beniseed]
ref|XP_009615125.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     257   2e-81   Nicotiana tomentosiformis
ref|XP_011071315.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     253   6e-80   Sesamum indicum [beniseed]
ref|XP_009776121.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     251   3e-79   Nicotiana sylvestris
ref|XP_009776165.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     251   3e-79   Nicotiana sylvestris
ref|XP_004245668.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     248   3e-78   Solanum lycopersicum
ref|XP_006358846.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    248   5e-78   Solanum tuberosum [potatoes]
gb|EYU23230.1|  hypothetical protein MIMGU_mgv1a010060mg                248   5e-78   Erythranthe guttata [common monkey flower]
gb|EYU28953.1|  hypothetical protein MIMGU_mgv1a010076mg                248   6e-78   Erythranthe guttata [common monkey flower]
ref|XP_004244596.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     246   2e-77   Solanum lycopersicum
emb|CDP09836.1|  unnamed protein product                                244   1e-76   Coffea canephora [robusta coffee]
ref|XP_006358383.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    242   7e-76   Solanum tuberosum [potatoes]
ref|XP_009614163.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     240   7e-75   Nicotiana tomentosiformis
ref|XP_007040070.1|  Pgr5-like a, a isoform 1                           237   9e-74   
emb|CBI34776.3|  unnamed protein product                                235   5e-73   Vitis vinifera
ref|XP_002282120.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     235   5e-73   Vitis vinifera
gb|EPS59985.1|  hypothetical protein M569_14818                         234   9e-73   Genlisea aurea
ref|XP_010540318.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     233   3e-72   Tarenaya hassleriana [spider flower]
gb|EYU39022.1|  hypothetical protein MIMGU_mgv1a010322mg                228   1e-70   Erythranthe guttata [common monkey flower]
ref|XP_010108065.1|  hypothetical protein L484_023150                   228   2e-70   Morus notabilis
ref|XP_010255673.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     228   2e-70   
ref|XP_006440489.1|  hypothetical protein CICLE_v10021127mg             225   3e-70   
emb|CDY51552.1|  BnaC03g72980D                                          227   6e-70   Brassica napus [oilseed rape]
gb|KJB52016.1|  hypothetical protein B456_008G242200                    227   1e-69   Gossypium raimondii
ref|XP_010529516.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     226   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_011029133.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     225   4e-69   Populus euphratica
gb|KDO63650.1|  hypothetical protein CISIN_1g019981mg                   222   5e-69   Citrus sinensis [apfelsine]
gb|KJB52014.1|  hypothetical protein B456_008G242200                    226   5e-69   Gossypium raimondii
ref|XP_006440488.1|  hypothetical protein CICLE_v10021127mg             225   6e-69   Citrus clementina [clementine]
gb|KDP25533.1|  hypothetical protein JCGZ_20689                         224   8e-69   Jatropha curcas
ref|XP_006413604.1|  hypothetical protein EUTSA_v10025739mg             224   9e-69   
emb|CDY68977.1|  BnaAnng29010D                                          224   1e-68   Brassica napus [oilseed rape]
gb|KDO63649.1|  hypothetical protein CISIN_1g019981mg                   222   1e-68   Citrus sinensis [apfelsine]
gb|KHG15187.1|  PGR5-like protein 1B, chloroplastic                     224   2e-68   Gossypium arboreum [tree cotton]
ref|XP_009137295.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    223   2e-68   Brassica rapa
ref|XP_009137291.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    223   3e-68   Brassica rapa
emb|CDX94134.1|  BnaC07g37680D                                          222   4e-68   
gb|KDO63648.1|  hypothetical protein CISIN_1g019981mg                   222   5e-68   Citrus sinensis [apfelsine]
ref|XP_003525746.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    222   7e-68   Glycine max [soybeans]
gb|ACU23217.1|  unknown                                                 222   7e-68   Glycine max [soybeans]
emb|CDY10819.1|  BnaC01g14340D                                          221   8e-68   Brassica napus [oilseed rape]
ref|XP_006385747.1|  hypothetical protein POPTR_0003s11910g             218   8e-68   
gb|KDO63643.1|  hypothetical protein CISIN_1g019981mg                   222   9e-68   Citrus sinensis [apfelsine]
gb|KJB25726.1|  hypothetical protein B456_004G206000                    222   1e-67   Gossypium raimondii
gb|KDO63646.1|  hypothetical protein CISIN_1g019981mg                   222   1e-67   Citrus sinensis [apfelsine]
ref|XP_009137294.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    220   2e-67   Brassica rapa
ref|NP_567672.1|  PGR5-like protein 1A                                  220   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004147962.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    219   9e-67   Cucumis sativus [cucumbers]
ref|XP_011033840.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     218   2e-66   Populus euphratica
ref|XP_008364795.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     217   5e-66   
ref|XP_002303553.1|  hypothetical protein POPTR_0003s11910g             217   7e-66   
ref|XP_009136287.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    216   8e-66   Brassica rapa
ref|XP_002509675.1|  conserved hypothetical protein                     216   8e-66   Ricinus communis
ref|XP_006413605.1|  hypothetical protein EUTSA_v10025739mg             215   2e-65   
ref|XP_008448945.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     215   3e-65   Cucumis melo [Oriental melon]
ref|NP_001078431.1|  PGR5-like protein 1A                               215   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396828.1|  hypothetical protein EUTSA_v10028695mg             217   3e-65   
gb|KJB52017.1|  hypothetical protein B456_008G242200                    216   3e-65   Gossypium raimondii
ref|XP_006396829.1|  hypothetical protein EUTSA_v10028695mg             218   4e-65   
ref|XP_004298721.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     214   4e-65   Fragaria vesca subsp. vesca
ref|XP_006284133.1|  hypothetical protein CARUB_v10005263mg             214   6e-65   Capsella rubella
ref|NP_001078432.1|  PGR5-like protein 1A                               214   8e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517448.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    213   3e-64   Glycine max [soybeans]
ref|XP_002869800.1|  hypothetical protein ARALYDRAFT_492575             212   3e-64   
ref|XP_010439270.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     212   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010448812.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     212   5e-64   Camelina sativa [gold-of-pleasure]
gb|ABK95508.1|  unknown                                                 211   7e-64   Populus trichocarpa [western balsam poplar]
gb|AES94146.2|  PGR5-like protein 1A                                    211   9e-64   Medicago truncatula
ref|XP_003611188.1|  PGR5-like protein 1A                               211   1e-63   
ref|XP_009136301.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    211   1e-63   Brassica rapa
ref|XP_007155578.1|  hypothetical protein PHAVU_003G213900g             210   2e-63   Phaseolus vulgaris [French bean]
ref|XP_007158444.1|  hypothetical protein PHAVU_002G152800g             210   3e-63   Phaseolus vulgaris [French bean]
ref|XP_009134250.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     210   3e-63   Brassica rapa
ref|XP_002874736.1|  hypothetical protein ARALYDRAFT_490014             208   1e-62   
ref|XP_010433975.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     208   2e-62   Camelina sativa [gold-of-pleasure]
gb|AFK47748.1|  unknown                                                 208   2e-62   Lotus japonicus
ref|XP_004511624.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    207   3e-62   Cicer arietinum [garbanzo]
ref|NP_192933.2|  PGR5-like protein 1B                                  207   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010676600.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     207   6e-62   Beta vulgaris subsp. vulgaris [field beet]
emb|CAB40937.1|  putative protein                                       207   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004515785.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    206   2e-61   Cicer arietinum [garbanzo]
ref|XP_002299573.1|  hypothetical protein POPTR_0001s08420g             206   2e-61   
gb|AFK41277.1|  unknown                                                 205   3e-61   Medicago truncatula
ref|XP_003549873.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    205   3e-61   Glycine max [soybeans]
gb|KHN09744.1|  PGR5-like protein 1A, chloroplastic                     205   4e-61   Glycine soja [wild soybean]
ref|XP_010433977.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     202   2e-60   Camelina sativa [gold-of-pleasure]
emb|CAA19804.1|  putative protein                                       203   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008238748.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     202   3e-60   
gb|KCW77643.1|  hypothetical protein EUGRSUZ_D01944                     200   6e-60   Eucalyptus grandis [rose gum]
ref|XP_010455613.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     201   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010422149.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     201   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010053364.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     201   1e-59   Eucalyptus grandis [rose gum]
ref|XP_007211199.1|  hypothetical protein PRUPE_ppa008744mg             200   2e-59   Prunus persica
ref|XP_009362831.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     200   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_006290008.1|  hypothetical protein CARUB_v10003639mg             198   7e-59   
ref|XP_008381938.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     197   4e-58   
ref|XP_003559404.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     196   1e-57   Brachypodium distachyon [annual false brome]
gb|KEH31685.1|  PGR5-like protein 1A                                    193   1e-56   Medicago truncatula
ref|XP_006477587.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    192   2e-56   
ref|XP_008652279.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     191   5e-56   Zea mays [maize]
ref|XP_009389075.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     190   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001190702.1|  PGR5-like protein 1B                               189   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001141772.2|  hypothetical protein                               189   4e-55   Zea mays [maize]
gb|KHG00657.1|  PGR5-like protein 1A, chloroplastic                     187   1e-54   Gossypium arboreum [tree cotton]
ref|XP_003557298.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     187   2e-54   Brachypodium distachyon [annual false brome]
ref|XP_008776921.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     186   8e-54   Phoenix dactylifera
gb|EEC83915.1|  hypothetical protein OsI_29970                          184   3e-53   Oryza sativa Indica Group [Indian rice]
gb|EEE69030.1|  hypothetical protein OsJ_28011                          184   4e-53   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062297.1|  Os08g0526300                                       184   4e-53   
ref|XP_009398865.1|  PREDICTED: PGR5-like protein 1B, chloroplastic     182   4e-53   
ref|XP_004980979.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    182   9e-53   Setaria italica
gb|EMT22967.1|  hypothetical protein F775_30979                         182   2e-52   
ref|XP_010934076.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     182   2e-52   Elaeis guineensis
ref|XP_010918997.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     181   3e-52   Elaeis guineensis
gb|AFK39966.1|  unknown                                                 180   9e-52   Lotus japonicus
ref|XP_006828898.1|  hypothetical protein AMTR_s00001p00191890          180   2e-51   Amborella trichopoda
ref|XP_006660041.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    179   3e-51   
ref|XP_008783584.1|  PREDICTED: PGR5-like protein 1A, chloroplastic     179   4e-51   Phoenix dactylifera
gb|EEC76574.1|  hypothetical protein OsI_14406                          178   4e-51   Oryza sativa Indica Group [Indian rice]
ref|NP_001051955.1|  Os03g0857400                                       178   5e-51   
ref|XP_006652042.1|  PREDICTED: PGR5-like protein 1A, chloroplast...    164   1e-45   Oryza brachyantha
ref|XP_001772047.1|  predicted protein                                  161   9e-45   
gb|ABK25031.1|  unknown                                                 159   2e-43   Picea sitchensis
ref|XP_004956010.1|  PREDICTED: PGR5-like protein 1B, chloroplast...    144   1e-38   
gb|EMS46577.1|  hypothetical protein TRIUR3_31517                       147   1e-38   Triticum urartu
ref|XP_002964064.1|  hypothetical protein SELMODRAFT_66389              138   3e-36   
ref|XP_005650025.1|  hypothetical protein COCSUDRAFT_28046              134   9e-34   Coccomyxa subellipsoidea C-169
tpg|DAA52585.1|  TPA: hypothetical protein ZEAMMB73_384055              128   6e-33   
ref|XP_002975457.1|  hypothetical protein SELMODRAFT_232511             128   5e-32   Selaginella moellendorffii
ref|XP_002951714.1|  hypothetical protein VOLCADRAFT_109811             125   6e-31   Volvox carteri f. nagariensis
ref|XP_001692513.1|  predicted protein                                  125   1e-30   Chlamydomonas reinhardtii
ref|XP_005850458.1|  hypothetical protein CHLNCDRAFT_34513              121   2e-29   Chlorella variabilis
ref|XP_005707770.1|  hypothetical protein Gasu_14910                    120   8e-29   Galdieria sulphuraria
gb|KDO63647.1|  hypothetical protein CISIN_1g019981mg                   115   6e-28   Citrus sinensis [apfelsine]
ref|XP_011398911.1|  PGR5-like protein 1B, chloroplastic                114   4e-26   Auxenochlorella protothecoides
gb|KIY98308.1|  PGR5-like protein 1B                                    115   4e-26   Monoraphidium neglectum
ref|NP_001061513.2|  Os08g0310500                                       108   2e-25   
gb|AAQ56392.1|  hypothetical protein OSJNBa0003M24.11                   107   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005844699.1|  hypothetical protein CHLNCDRAFT_59756              106   5e-24   Chlorella variabilis
ref|XP_005719217.1|  unnamed protein product                            103   1e-22   Chondrus crispus [carageen]
gb|EAY97101.1|  hypothetical protein OsI_19024                        99.4    3e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_005539297.1|  hypothetical protein, conserved                    101   3e-22   Cyanidioschyzon merolae strain 10D
ref|XP_002289386.1|  hypothetical protein THAPSDRAFT_268713           92.4    5e-19   Thalassiosira pseudonana CCMP1335
ref|XP_002177079.1|  predicted protein                                88.2    2e-17   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007508174.1|  predicted protein                                86.7    7e-17   Bathycoccus prasinos
ref|XP_003061604.1|  predicted protein                                85.1    2e-16   Micromonas pusilla CCMP1545
gb|EJK45793.1|  hypothetical protein THAOC_35578                      85.9    7e-16   Thalassiosira oceanica
ref|XP_002509148.1|  predicted protein                                81.6    3e-15   Micromonas commoda
gb|EJK57224.1|  hypothetical protein THAOC_22761                      80.1    1e-14   Thalassiosira oceanica
ref|XP_005823018.1|  hypothetical protein GUITHDRAFT_90093            77.4    7e-14   Guillardia theta CCMP2712
emb|CBJ29877.1|  conserved unknown protein                            74.3    1e-12   Ectocarpus siliculosus
ref|XP_005785885.1|  hypothetical protein EMIHUDRAFT_441626           72.8    2e-12   Emiliania huxleyi CCMP1516
ref|XP_005787281.1|  hypothetical protein EMIHUDRAFT_441130           72.8    2e-12   Emiliania huxleyi CCMP1516
ref|XP_005833759.1|  hypothetical protein GUITHDRAFT_107552           70.9    6e-12   Guillardia theta CCMP2712
ref|XP_001420406.1|  predicted protein                                70.9    1e-11   Ostreococcus lucimarinus CCE9901
emb|CEF99527.1|  unnamed product                                      69.7    6e-11   Ostreococcus tauri
ref|XP_003081836.1|  putative heme activated protein (ISS)            70.5    8e-11   
ref|XP_002293951.1|  predicted protein                                68.6    1e-10   Thalassiosira pseudonana CCMP1335
ref|XP_008347100.1|  PREDICTED: PGR5-like protein 1A, chloroplastic   65.1    1e-09   
ref|XP_008665769.1|  PREDICTED: uncharacterized protein LOC103644336  60.1    1e-07   
ref|XP_002185714.1|  predicted protein                                54.3    8e-06   Phaeodactylum tricornutum CCAP 1055/1
dbj|BAG91915.1|  unnamed protein product                              48.9    4e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_011081060.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Sesamum indicum]
 ref|XP_011081062.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Sesamum indicum]
Length=320

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 147/178 (83%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA++L  ++T PRF    F+ PF S       +      + F  +K+S RRR LVL PKA
Sbjct  1    MASRLGLTVTKPRFFTVQFRNPFFSVSLLPSSAPG----VQFGPKKLSFRRRLLVLSPKA  56

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TTDQPGQVQEDEV VDSNVLPYCSID+K+KKSLGEMEQ+FLQALQAFYYEGKAIMSNEEF
Sbjct  57   TTDQPGQVQEDEV-VDSNVLPYCSIDKKQKKSLGEMEQEFLQALQAFYYEGKAIMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLSADEQRFLEASMAYV+G PIM+D+EFDKLK KLK+DGS+IV
Sbjct  116  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVSGNPIMTDEEFDKLKQKLKIDGSEIV  173



>ref|XP_009615125.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Nicotiana tomentosiformis]
Length=322

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 150/178 (84%), Gaps = 3/178 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MATKL +S+T+ R  HA FKRP  SA S+S  S     + + A RK+S+R+R LVL PKA
Sbjct  1    MATKLGFSMTSSRLFHAPFKRPIFSASSSSSSSPRLPLIPFGASRKLSIRKRLLVLSPKA  60

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TTDQPGQVQEDE   DS +L YCSID K KKS+GEMEQ+FLQALQ+FYYEGKAIMSNEEF
Sbjct  61   TTDQPGQVQEDE---DSKILQYCSIDGKGKKSMGEMEQEFLQALQSFYYEGKAIMSNEEF  117

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLSADEQRFLEASMAYV+G PIM+D+EFDKLK+KLKMDGSDIV
Sbjct  118  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVSGNPIMTDQEFDKLKLKLKMDGSDIV  175



>ref|XP_011071315.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Sesamum indicum]
Length=323

 Score =   253 bits (645),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MATK   +L    FL A  K+PFIS  S    ++  L   +F   K+S RRR +V+ PKA
Sbjct  1    MATKAWLTLARSSFLTAQLKKPFISISSLPSAASGVLST-HFGAGKLSFRRRLVVVSPKA  59

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TTDQPGQVQEDEV VDSNVLPYCS+D+K+KKSLGEMEQDFLQALQAFYYEGK+IMSNEEF
Sbjct  60   TTDQPGQVQEDEV-VDSNVLPYCSLDKKQKKSLGEMEQDFLQALQAFYYEGKSIMSNEEF  118

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLSADEQRFLEASMAYV+G PI+SD+EFD+LK KLK DGS+IV
Sbjct  119  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVSGNPILSDEEFDELKQKLKADGSEIV  176



>ref|XP_009776121.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Nicotiana sylvestris]
Length=328

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 149/184 (81%), Gaps = 9/184 (5%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplI------YFAGRKISVRRRFL  216
            MATKL +S+T+ R  HA FKRP  SA   +  S+S           + A RK+S+R+R L
Sbjct  1    MATKLGFSMTSSRLFHAPFKRPIFSASLPAASSSSSSSSPRLPLIPFGASRKLSIRKRLL  60

Query  217  VLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAI  396
            VL PKATTDQPGQVQEDE   DS +L YCSID K KKS+GEMEQ+FLQALQ+FYYEGKAI
Sbjct  61   VLSPKATTDQPGQVQEDE---DSKILQYCSIDGKGKKSMGEMEQEFLQALQSFYYEGKAI  117

Query  397  MSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDG  576
            MSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYV+G PIM+D+EFDKLK+KLKMDG
Sbjct  118  MSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVSGNPIMTDQEFDKLKLKLKMDG  177

Query  577  SDIV  588
            SDIV
Sbjct  178  SDIV  181



>ref|XP_009776165.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Nicotiana sylvestris]
 ref|XP_009776166.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Nicotiana sylvestris]
Length=329

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 151/183 (83%), Gaps = 6/183 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASF-KRPFIsapsaslpsasrlpl----IYFAGRKISVRRRFLV  219
            MATK  +++T+PR  HA F K+P  S+ SASL  AS        I F GRK+++RRR LV
Sbjct  1    MATKFGFTITSPRLFHAPFRKKPIFSSSSASLQGASFSCSKLRLINFGGRKLAIRRRLLV  60

Query  220  LCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIM  399
            L PKATTDQPGQ+ E+EVE DS +L YCSID K KKSLGEMEQ+FLQALQ+FYYEGKAIM
Sbjct  61   LSPKATTDQPGQLNENEVE-DSKILQYCSIDGKGKKSLGEMEQEFLQALQSFYYEGKAIM  119

Query  400  SNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGS  579
            SNEEFDNLKEELMWEGSSVVMLS DEQ+FLEASMAYV+G PIM+DKE+DKLKMKLK DGS
Sbjct  120  SNEEFDNLKEELMWEGSSVVMLSTDEQKFLEASMAYVSGNPIMTDKEYDKLKMKLKRDGS  179

Query  580  DIV  588
            DIV
Sbjct  180  DIV  182



>ref|XP_004245668.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Solanum lycopersicum]
Length=320

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 148/178 (83%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MATKL +S+T+ +  HA FKRP  SA S+  P        +   RK+S+RR+ LVL PKA
Sbjct  1    MATKLGFSITSSKLFHAPFKRPIFSASSSPRPPLIP----FGVSRKLSIRRKLLVLSPKA  56

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
              DQPGQV+E+E E D+ +L YCS+DRK+KKS+GEMEQ+FLQALQAFYYEGKAIMSNEEF
Sbjct  57   AADQPGQVKEEEEE-DTKILQYCSLDRKQKKSMGEMEQEFLQALQAFYYEGKAIMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLSADEQRFLEASMAYV+G PI++DKEFDKLK+KLKMDGSDIV
Sbjct  116  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVSGNPILTDKEFDKLKLKLKMDGSDIV  173



>ref|XP_006358846.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Solanum 
tuberosum]
Length=320

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 147/178 (83%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MATKL +S+T+ +  HA FKRP  S+ S+           + A RK+S+RR+ L+L PKA
Sbjct  1    MATKLGFSITSSKLFHAPFKRPIFSSSSSPRLPLIP----FVASRKLSIRRKLLILSPKA  56

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
              DQPGQV+E E E D+ +L YCS+DRKEKKS+GEMEQ+FLQALQ+FYYEGKAIMSNEEF
Sbjct  57   AADQPGQVKE-EAEEDTKILQYCSLDRKEKKSMGEMEQEFLQALQSFYYEGKAIMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLSADEQRFLEASMAYV+G PI++D+EFDKLK+KLKMDGSDIV
Sbjct  116  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVSGNPILTDQEFDKLKLKLKMDGSDIV  173



>gb|EYU23230.1| hypothetical protein MIMGU_mgv1a010060mg [Erythranthe guttata]
Length=323

 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA KL ++   PR L A F+ PF+S  S    +      I F  RK+S+RRR +V+ PKA
Sbjct  1    MAAKLGFTAAKPRLLTAQFRNPFVSVSSLPSSAPRVHS-IQFGPRKLSLRRRLVVISPKA  59

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQPGQ+QEDEV VDSNVL YCS+D+K+K+++GEMEQ+FLQALQ+FYYEGK+IMSNEEF
Sbjct  60   TADQPGQIQEDEV-VDSNVLQYCSLDKKQKRTMGEMEQEFLQALQSFYYEGKSIMSNEEF  118

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLSADEQRFLEASMAYV+G PI+SDK+FD+LK KLK DGSDIV
Sbjct  119  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVSGNPILSDKDFDELKQKLKRDGSDIV  176



>gb|EYU28953.1| hypothetical protein MIMGU_mgv1a010076mg [Erythranthe guttata]
Length=323

 Score =   248 bits (632),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA KL ++   PR L A F+ PF+S  S    +      I F  RK+S+RRR +V+ PKA
Sbjct  1    MAAKLGFAAAKPRLLTAQFRNPFVSVSSLPTSAPRVHS-IQFGPRKLSLRRRLVVISPKA  59

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQPGQ+QEDEV VDSNVL YCS+D+K+K+++GEMEQ+FLQALQ+FYYEGK+IMSNEEF
Sbjct  60   TADQPGQIQEDEV-VDSNVLQYCSLDKKQKRTMGEMEQEFLQALQSFYYEGKSIMSNEEF  118

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLSADEQRFLEASMAYV+G PI+SDK+FD+LK KLK DGSDIV
Sbjct  119  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVSGNPILSDKDFDELKQKLKRDGSDIV  176



>ref|XP_004244596.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Solanum lycopersicum]
Length=319

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 148/179 (83%), Gaps = 8/179 (4%)
 Frame = +1

Query  55   MATKLVYSLTTP-RFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPK  231
            MATK  +++TT  R  HA+F++  I +P++  P       I F GRK+S+RRR LVL PK
Sbjct  1    MATKFGFTITTSSRLFHATFRKKTIFSPNSVSPL------INFGGRKLSIRRRLLVLSPK  54

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            AT DQPGQ++EDE+E DS +L YCSID K KKSLGEMEQ+FLQALQ+FYYEGKA+MSNEE
Sbjct  55   ATADQPGQLREDEIE-DSKILQYCSIDGKGKKSLGEMEQEFLQALQSFYYEGKAMMSNEE  113

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS DEQRFLEASMAYV+G PIM+DKE+DKLKMKLK DGSDIV
Sbjct  114  FDNLKEELMWEGSSVVMLSPDEQRFLEASMAYVSGNPIMTDKEYDKLKMKLKRDGSDIV  172



>emb|CDP09836.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 145/182 (80%), Gaps = 5/182 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPF----IsapsaslpsasrlplIYFAGRKISVRRRFLVL  222
            MATKL +++T PRF  A F++PF     S  S  L S S     Y     ++  RR LVL
Sbjct  1    MATKLAFTITIPRFYSAPFRKPFSCVPSSPSSPFLHSCSSSASRYQQPFNLNGGRRQLVL  60

Query  223  CPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMS  402
             PK TTDQPG VQEDEV VD  +L YCSID+KEKKSLGEMEQDFLQALQAFYYEGKAIMS
Sbjct  61   SPKTTTDQPGPVQEDEV-VDGKILQYCSIDKKEKKSLGEMEQDFLQALQAFYYEGKAIMS  119

Query  403  NEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSD  582
            NEEFDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PIMSDKE+DKLKMKLK+DGS+
Sbjct  120  NEEFDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPIMSDKEYDKLKMKLKIDGSE  179

Query  583  IV  588
            IV
Sbjct  180  IV  181



>ref|XP_006358383.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Solanum 
tuberosum]
Length=319

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 147/179 (82%), Gaps = 8/179 (4%)
 Frame = +1

Query  55   MATKLVYSLTTP-RFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPK  231
            MATK  +++TT  R  HA F++  I +P++  P       I F GRK+S+RRR L L PK
Sbjct  1    MATKFGFTITTSSRLFHAPFRKKPIFSPNSVSPL------INFGGRKLSIRRRLLFLSPK  54

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            ATTDQPGQV+EDE+E DS +L YCSID K KKSLGEMEQ+FLQALQ+FYYEGKA+MSNEE
Sbjct  55   ATTDQPGQVKEDEIE-DSKILQYCSIDGKGKKSLGEMEQEFLQALQSFYYEGKAMMSNEE  113

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS DEQRFLEASMAYV+G PIM+D+E+DKLKMKLK DGS+IV
Sbjct  114  FDNLKEELMWEGSSVVMLSPDEQRFLEASMAYVSGNPIMTDEEYDKLKMKLKRDGSNIV  172



>ref|XP_009614163.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009614164.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Nicotiana tomentosiformis]
Length=329

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 149/183 (81%), Gaps = 6/183 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsa-----slpsasrlplIYFAGRKISVRRRFLV  219
            MATK  +++T+PR  H  F++  I + S+     +   +S+L LI FAG+K+ ++ R LV
Sbjct  1    MATKFGFTITSPRLFHGPFRKKSIFSSSSASLGDASFCSSKLKLINFAGKKLVIKHRVLV  60

Query  220  LCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIM  399
            L PKATTDQPGQ+ E+EVE DS +L YCSID K KKSLGEMEQ+FLQALQ+FYYEGKA M
Sbjct  61   LSPKATTDQPGQLNENEVE-DSKILQYCSIDGKGKKSLGEMEQEFLQALQSFYYEGKATM  119

Query  400  SNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGS  579
            SNEEFDNLKEELMWEGSSVVMLS DEQ+FLEASMAYV+G PIM+DKE+DKLKMKLK DGS
Sbjct  120  SNEEFDNLKEELMWEGSSVVMLSTDEQKFLEASMAYVSGNPIMTDKEYDKLKMKLKRDGS  179

Query  580  DIV  588
            DIV
Sbjct  180  DIV  182



>ref|XP_007040070.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
 ref|XP_007040071.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
 ref|XP_007040072.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
 ref|XP_007040073.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
 ref|XP_007040074.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
 ref|XP_007040075.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
 gb|EOY24571.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
 gb|EOY24572.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
 gb|EOY24573.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
 gb|EOY24574.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
 gb|EOY24575.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
 gb|EOY24576.1| Pgr5-like a, a isoform 1 [Theobroma cacao]
Length=318

 Score =   237 bits (604),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 143/178 (80%), Gaps = 7/178 (4%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA KL +SLT PR   A F++P +   S+S         +   G+++ VRRR  +L  KA
Sbjct  1    MAGKLTFSLTPPRLFTAPFQKPLVPFSSSSSTR------VQSNGKQLCVRRRLFLLPTKA  54

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQ GQ+ EDEV VDS +LPYCSID+KEKKSLGEMEQ+FLQALQAFYYEGKAIMSNEEF
Sbjct  55   TADQQGQLGEDEV-VDSKILPYCSIDKKEKKSLGEMEQEFLQALQAFYYEGKAIMSNEEF  113

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI+SD+EFDKLK +LKM+GS+IV
Sbjct  114  DNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPILSDEEFDKLKQRLKMEGSEIV  171



>emb|CBI34776.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 147/180 (82%), Gaps = 3/180 (2%)
 Frame = +1

Query  55   MATKLVYSLTT-PRFLHASFKRPFIsapsaslpsasrlplIY-FAGRKISVRRRFLVLCP  228
            MATKL ++LTT PR   +S ++P IS  S S  S+      +   GR++ + RR  ++ P
Sbjct  1    MATKLGFALTTAPRLFASSSRKPLISPASLSSASSCSRVESFQLVGRQLRLSRRLFIISP  60

Query  229  KATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            KAT DQ GQVQ D+V VDS +LPYCSID+KEK+S+GEMEQDFLQALQ+FYYEGKAIMSNE
Sbjct  61   KATADQQGQVQGDDV-VDSKILPYCSIDKKEKRSIGEMEQDFLQALQSFYYEGKAIMSNE  119

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYVAG PIMSD+EFD LK+KLK++GS+IV
Sbjct  120  EFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVAGNPIMSDEEFDDLKIKLKIEGSEIV  179



>ref|XP_002282120.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Vitis vinifera]
 ref|XP_010661470.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Vitis vinifera]
Length=331

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 147/180 (82%), Gaps = 3/180 (2%)
 Frame = +1

Query  55   MATKLVYSLTT-PRFLHASFKRPFIsapsaslpsasrlplIY-FAGRKISVRRRFLVLCP  228
            MATKL ++LTT PR   +S ++P IS  S S  S+      +   GR++ + RR  ++ P
Sbjct  6    MATKLGFALTTAPRLFASSSRKPLISPASLSSASSCSRVESFQLVGRQLRLSRRLFIISP  65

Query  229  KATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            KAT DQ GQVQ D+V VDS +LPYCSID+KEK+S+GEMEQDFLQALQ+FYYEGKAIMSNE
Sbjct  66   KATADQQGQVQGDDV-VDSKILPYCSIDKKEKRSIGEMEQDFLQALQSFYYEGKAIMSNE  124

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYVAG PIMSD+EFD LK+KLK++GS+IV
Sbjct  125  EFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVAGNPIMSDEEFDDLKIKLKIEGSEIV  184



>gb|EPS59985.1| hypothetical protein M569_14818 [Genlisea aurea]
Length=324

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA+K  + +  P F    F++P  S  S    +     + + A R + +RRR LV+ PKA
Sbjct  1    MASKFGFLVAKPGFFSGHFRKPLFSVASLPSSALGVDAVQFDAKRSLFLRRRILVVAPKA  60

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TTDQPGQV+ DE  VD NVLPYC++D K+K+S+GEMEQ+FLQALQ+FYYEGK+IMSNEEF
Sbjct  61   TTDQPGQVRGDEA-VDDNVLPYCNVDEKKKRSIGEMEQEFLQALQSFYYEGKSIMSNEEF  119

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLSADEQRFLEASMAY +GTPI+SD+EFDKLK KLK+DGS IV
Sbjct  120  DNLKEELMWEGSSVVMLSADEQRFLEASMAYASGTPILSDEEFDKLKQKLKIDGSSIV  177



>ref|XP_010540318.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Tarenaya hassleriana]
Length=324

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 143/178 (80%), Gaps = 1/178 (1%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+ ++LT+PRF  A  ++P      +S  ++     ++  GR + +RRR  +L  KA
Sbjct  1    MGSKMAFTLTSPRFFSAISRKPTTRFSPSSPTTSKAQWNLFSHGRSVPLRRRLFLLPTKA  60

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TTDQ GQV  +EV+ DS +LPYCSI++ EKK++GEMEQ+FLQA+QAFYYEGKA+MSNEEF
Sbjct  61   TTDQSGQVGGEEVD-DSKILPYCSINKNEKKTIGEMEQEFLQAMQAFYYEGKAVMSNEEF  119

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PIM+D+E+D LK+KLKMDGS+IV
Sbjct  120  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPIMNDEEYDNLKLKLKMDGSEIV  177



>gb|EYU39022.1| hypothetical protein MIMGU_mgv1a010322mg [Erythranthe guttata]
 gb|EYU39023.1| hypothetical protein MIMGU_mgv1a010322mg [Erythranthe guttata]
Length=316

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 139/178 (78%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA++L +++  PR     F++P     ++     +    + F   K+S  RR LV+  KA
Sbjct  1    MASRLGFTVAKPRSFTGRFRKPL----TSVPSLLTSASGVQFGATKLSFTRRLLVVSTKA  56

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQPGQV+E+E  +DSNVLPYC+I++ +KKSLGEMEQ+FLQALQAFYYEGK+IMSNEEF
Sbjct  57   TGDQPGQVRENET-IDSNVLPYCNIEKDQKKSLGEMEQEFLQALQAFYYEGKSIMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLSADEQRFLEASMAYV+G  IM+D E+DKLK KLKMDGS+IV
Sbjct  116  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVSGNQIMTDDEYDKLKQKLKMDGSEIV  173



>ref|XP_010108065.1| hypothetical protein L484_023150 [Morus notabilis]
 gb|EXC17797.1| hypothetical protein L484_023150 [Morus notabilis]
Length=323

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 6/180 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASF-KRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCP-  228
            MA+KL ++LT+PR   +S  +RPF      S  S++R+    F GR++ +RRR  VL P 
Sbjct  1    MASKLAFTLTSPRRPFSSLIQRPF---NPLSSSSSARVQSFNFNGRQLCLRRRLSVLVPT  57

Query  229  KATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            KAT DQ G+V+EDE  VDS +LPYC+ID+KEKKSLGE+EQ+FLQALQAFYYEGKAIMSNE
Sbjct  58   KATADQEGKVEEDEF-VDSKILPYCNIDKKEKKSLGELEQEFLQALQAFYYEGKAIMSNE  116

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYV+G  IMSD+EFDKLK +LK +GS+IV
Sbjct  117  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVSGNKIMSDEEFDKLKQRLKSEGSEIV  176



>ref|XP_010255673.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Nelumbo nucifera]
Length=309

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 141/180 (78%), Gaps = 4/180 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsap--saslpsasrlplIYFAGRKISVRRRFLVLCP  228
            M T L ++LT+PR      +RPF+S+P    S  +A     I F   ++S R R  +L P
Sbjct  1    MVTALGFTLTSPRLFFTQLRRPFVSSPRDHFSQFTAHHRSSIPFTSFRLSPRHRLFILPP  60

Query  229  KATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            KA  DQ GQ  EDEV VDS +LPYCSID+KEKK+LGEMEQDFLQALQ+FYYEGKA MSNE
Sbjct  61   KAA-DQQGQATEDEV-VDSKILPYCSIDKKEKKTLGEMEQDFLQALQSFYYEGKATMSNE  118

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PIM+D+EFDKLK+KLK++GS IV
Sbjct  119  EFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPIMTDEEFDKLKLKLKIEGSQIV  178



>ref|XP_006440489.1| hypothetical protein CICLE_v10021127mg [Citrus clementina]
 gb|ESR53729.1| hypothetical protein CICLE_v10021127mg [Citrus clementina]
Length=238

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  178  FAGRKISVRRRFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFL  357
            F+GR+ SVRRR  VL  KATTDQ GQV+ DEV VDS +L YCSID+KEKKSLGE+EQ+FL
Sbjct  45   FSGRQFSVRRRSFVLPSKATTDQQGQVEGDEV-VDSKILQYCSIDKKEKKSLGELEQEFL  103

Query  358  QALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDK  537
            QALQAFYYEGKA+MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEASMAYVAG PIMSD+
Sbjct  104  QALQAFYYEGKAVMSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDE  163

Query  538  EFDKLKMKLKMDGSDIV  588
            E+DKLK KLKMDGS+IV
Sbjct  164  EYDKLKQKLKMDGSEIV  180



>emb|CDY51552.1| BnaC03g72980D [Brassica napus]
Length=320

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 141/178 (79%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+ ++LT PRF     ++P     + S P +      +  GR IS+RRR  +L  KA
Sbjct  1    MCSKMAFALTIPRFHSPISRKP---TTTCSSPPSKTQSAHFSHGRSISLRRRLFLLPVKA  57

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TTDQ GQV  +EV  DS +LPYCSI++ EK+S+GEMEQ+FLQA+Q+FYYEGKA+MSNEEF
Sbjct  58   TTDQSGQVGGEEV--DSKILPYCSINKNEKRSIGEMEQEFLQAMQSFYYEGKAVMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI+SD+E+DKLKMKLKMDGS+IV
Sbjct  116  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSEIV  173



>gb|KJB52016.1| hypothetical protein B456_008G242200 [Gossypium raimondii]
Length=328

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 139/178 (78%), Gaps = 9/178 (5%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA+KL  +LT  RFL+   ++P +S  S++         +   G+++  R R  VL  KA
Sbjct  50   MASKLALTLTPHRFLNGHIQKPLVSFSSSTR--------VLSNGKQLCCRHRLFVLPIKA  101

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
              DQ GQV+ED V VDS +LPYCSID+KEKKSLGEMEQ+FLQALQAFYYEGKAIMSNEEF
Sbjct  102  AADQQGQVEEDNV-VDSKILPYCSIDKKEKKSLGEMEQEFLQALQAFYYEGKAIMSNEEF  160

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEEL WEGSSVVMLS+DEQ+FLEASMAYV+G PI+SD+EFD LK+ LKM+GS+IV
Sbjct  161  DNLKEELTWEGSSVVMLSSDEQKFLEASMAYVSGKPILSDEEFDDLKLGLKMEGSEIV  218



>ref|XP_010529516.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Tarenaya hassleriana]
Length=324

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 143/179 (80%), Gaps = 3/179 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFA-GRKISVRRRFLVLCPK  231
            M +K+ ++LT+PRF  +  ++P      +S PS+      +F+ GR  SV RR  +L  K
Sbjct  1    MGSKMAFTLTSPRFFSSISRKPTTCVSPSSPPSSRAQCSNHFSHGRSGSVSRRLFLLPTK  60

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            ATTDQ GQV  +EV  D  +LPYCSI++ EKK++GEMEQ+FLQA+QAFYYEGKAIMSNEE
Sbjct  61   ATTDQSGQVGGEEV--DGKILPYCSINKNEKKTIGEMEQEFLQAMQAFYYEGKAIMSNEE  118

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G P+M+D+E+DKLK+KLKMDGS+IV
Sbjct  119  FDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPLMNDEEYDKLKLKLKMDGSEIV  177



>ref|XP_011029133.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Populus euphratica]
Length=326

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 145/180 (81%), Gaps = 3/180 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlpl-IYFAGRKISVRRRFLVLCPK  231
            MA KL ++LT+PR L A  ++PFIS+ S+    +      ++F  R+ S+RRR L+   K
Sbjct  1    MAGKLAFTLTSPRLLIAPIRKPFISSSSSLPSPSCSSSTRVHFNVRQFSLRRRMLLPPTK  60

Query  232  ATTDQPG-QVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            AT DQ   Q QEDE+ VD  +L YCSID+++KKS+GEMEQ+FLQALQAFYYEGKAIMSNE
Sbjct  61   ATADQQADQAQEDEM-VDGKILQYCSIDKRDKKSIGEMEQEFLQALQAFYYEGKAIMSNE  119

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PIMSDKE+D+LKMKLK +GS+IV
Sbjct  120  EFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGNPIMSDKEYDELKMKLKSEGSEIV  179



>gb|KDO63650.1| hypothetical protein CISIN_1g019981mg [Citrus sinensis]
Length=238

 Score =   222 bits (566),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  178  FAGRKISVRRRFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFL  357
            F GR+ +VRRR  VL  KATTDQ GQV+ DEV VDS +L YCSID+KEKKSLGE+EQ+FL
Sbjct  45   FNGRQFTVRRRSFVLPSKATTDQQGQVEGDEV-VDSKILQYCSIDKKEKKSLGELEQEFL  103

Query  358  QALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDK  537
            QALQAFYYEGKA+MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEASMAYVAG PIMSD+
Sbjct  104  QALQAFYYEGKAVMSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDE  163

Query  538  EFDKLKMKLKMDGSDIV  588
            E+DKLK KLKM+GS+IV
Sbjct  164  EYDKLKQKLKMEGSEIV  180



>gb|KJB52014.1| hypothetical protein B456_008G242200 [Gossypium raimondii]
 gb|KJB52015.1| hypothetical protein B456_008G242200 [Gossypium raimondii]
Length=365

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 139/178 (78%), Gaps = 9/178 (5%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA+KL  +LT  RFL+   ++P +S  S++         +   G+++  R R  VL  KA
Sbjct  50   MASKLALTLTPHRFLNGHIQKPLVSFSSSTR--------VLSNGKQLCCRHRLFVLPIKA  101

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
              DQ GQV+ED V VDS +LPYCSID+KEKKSLGEMEQ+FLQALQAFYYEGKAIMSNEEF
Sbjct  102  AADQQGQVEEDNV-VDSKILPYCSIDKKEKKSLGEMEQEFLQALQAFYYEGKAIMSNEEF  160

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEEL WEGSSVVMLS+DEQ+FLEASMAYV+G PI+SD+EFD LK+ LKM+GS+IV
Sbjct  161  DNLKEELTWEGSSVVMLSSDEQKFLEASMAYVSGKPILSDEEFDDLKLGLKMEGSEIV  218



>ref|XP_006440488.1| hypothetical protein CICLE_v10021127mg [Citrus clementina]
 gb|ESR53728.1| hypothetical protein CICLE_v10021127mg [Citrus clementina]
Length=327

 Score =   225 bits (573),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = +1

Query  178  FAGRKISVRRRFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFL  357
            F+GR+ SVRRR  VL  KATTDQ GQV+ DEV VDS +L YCSID+KEKKSLGE+EQ+FL
Sbjct  45   FSGRQFSVRRRSFVLPSKATTDQQGQVEGDEV-VDSKILQYCSIDKKEKKSLGELEQEFL  103

Query  358  QALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDK  537
            QALQAFYYEGKA+MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEASMAYVAG PIMSD+
Sbjct  104  QALQAFYYEGKAVMSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDE  163

Query  538  EFDKLKMKLKMDGSDIV  588
            E+DKLK KLKMDGS+IV
Sbjct  164  EYDKLKQKLKMDGSEIV  180



>gb|KDP25533.1| hypothetical protein JCGZ_20689 [Jatropha curcas]
Length=323

 Score =   224 bits (571),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 141/178 (79%), Gaps = 2/178 (1%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA+KL  SLT+     A  ++P IS  S+S  S      I F GR   VRRR  +L  KA
Sbjct  1    MASKLAISLTSSGLSSAPIRKPVISLSSSSSSSTRSQS-IQFNGRHFCVRRRIFMLPIKA  59

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQ GQV ED+V VDS +L YCSIDRKEK+S+GEMEQ+FLQALQ+FYYEGKAIMSNEEF
Sbjct  60   TADQQGQVGEDQV-VDSKILQYCSIDRKEKRSIGEMEQEFLQALQSFYYEGKAIMSNEEF  118

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI+SD+EFD+LKM+LK +GS+IV
Sbjct  119  DNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPILSDQEFDELKMRLKQEGSEIV  176



>ref|XP_006413604.1| hypothetical protein EUTSA_v10025739mg [Eutrema salsugineum]
 ref|XP_006413606.1| hypothetical protein EUTSA_v10025739mg [Eutrema salsugineum]
 ref|XP_006413607.1| hypothetical protein EUTSA_v10025739mg [Eutrema salsugineum]
 ref|XP_006413608.1| hypothetical protein EUTSA_v10025739mg [Eutrema salsugineum]
 gb|ESQ55057.1| hypothetical protein EUTSA_v10025739mg [Eutrema salsugineum]
 gb|ESQ55059.1| hypothetical protein EUTSA_v10025739mg [Eutrema salsugineum]
 gb|ESQ55060.1| hypothetical protein EUTSA_v10025739mg [Eutrema salsugineum]
 gb|ESQ55061.1| hypothetical protein EUTSA_v10025739mg [Eutrema salsugineum]
Length=321

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 143/178 (80%), Gaps = 4/178 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K ++SLT+PR   A  ++P +S    S   +    L    GR IS+RRRF +L  KA
Sbjct  1    MGSKTLFSLTSPRLFSAVSRKPTVSFSPPSSSRSQWAQLS--PGRSISLRRRFFLLPAKA  58

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q GQV+ +EV  DSN+  YCSI++ +KKS+GEMEQ+FLQALQ+FYY+GKAIMSNEEF
Sbjct  59   TTEQSGQVEGEEV--DSNINAYCSINKAQKKSIGEMEQEFLQALQSFYYDGKAIMSNEEF  116

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLK+ELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+E+DKLK+KLKMDGSDIV
Sbjct  117  DNLKDELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKMDGSDIV  174



>emb|CDY68977.1| BnaAnng29010D [Brassica napus]
Length=320

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A  ++P  S  S S  +          GR IS+R+RF +L  KA
Sbjct  1    MGSKILFSLTSPRLFSAVSRKPTASLSSPSPRTQWAQLS---PGRSISLRKRFFLLPAKA  57

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q GQ   ++V  DSN++PYCSI++ EKKS+GEMEQ+FLQALQ+FYY+GKA MSNEEF
Sbjct  58   TTEQSGQAGGEDV--DSNIMPYCSINKAEKKSIGEMEQEFLQALQSFYYDGKATMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+EFDKLK+KLK+DGS+IV
Sbjct  116  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEFDKLKLKLKIDGSEIV  173



>gb|KDO63649.1| hypothetical protein CISIN_1g019981mg [Citrus sinensis]
Length=276

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  178  FAGRKISVRRRFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFL  357
            F GR+ +VRRR  VL  KATTDQ GQV+ DEV VDS +L YCSID+KEKKSLGE+EQ+FL
Sbjct  45   FNGRQFTVRRRSFVLPSKATTDQQGQVEGDEV-VDSKILQYCSIDKKEKKSLGELEQEFL  103

Query  358  QALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDK  537
            QALQAFYYEGKA+MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEASMAYVAG PIMSD+
Sbjct  104  QALQAFYYEGKAVMSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDE  163

Query  538  EFDKLKMKLKMDGSDIV  588
            E+DKLK KLKM+GS+IV
Sbjct  164  EYDKLKQKLKMEGSEIV  180



>gb|KHG15187.1| PGR5-like protein 1B, chloroplastic [Gossypium arboreum]
Length=330

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 147/178 (83%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA+KL ++L  PRF  A+ ++P +   S+S  S    P    +G+ +  RRR L+L  KA
Sbjct  11   MASKLAFTLMPPRFFTATIQKPVVCFSSSSSSSIRFQP----SGKHLCFRRRLLLLPLKA  66

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQ GQV+EDEV VDS +LPYCSID+KEKKSLGEMEQ+FLQALQAFYYEGKAIMSNEEF
Sbjct  67   TADQQGQVEEDEV-VDSKILPYCSIDKKEKKSLGEMEQEFLQALQAFYYEGKAIMSNEEF  125

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI+SD+EFD+LKM+LKM+GS+IV
Sbjct  126  DNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPILSDEEFDELKMRLKMEGSEIV  183



>ref|XP_009137295.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X3 [Brassica 
rapa]
 ref|XP_009137296.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X3 [Brassica 
rapa]
Length=308

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A  ++P  S  S S  +          GR IS+R+RF +L  KA
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPTASLSSPSPRTQWAQLS---PGRSISLRKRFFLLPAKA  57

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q GQ   ++V  DSN++PYCSI++ EKKS+GEMEQ+FLQALQ+FYY+GKA MSNEEF
Sbjct  58   TTEQSGQGGGEDV--DSNIMPYCSINKAEKKSIGEMEQEFLQALQSFYYDGKATMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+EFDKLK+KLK+DGS+IV
Sbjct  116  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEFDKLKLKLKIDGSEIV  173



>ref|XP_009137291.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X1 [Brassica 
rapa]
 ref|XP_009137293.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X1 [Brassica 
rapa]
Length=320

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A  ++P  S  S S  +          GR IS+R+RF +L  KA
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPTASLSSPSPRTQWAQLS---PGRSISLRKRFFLLPAKA  57

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q GQ   ++V  DSN++PYCSI++ EKKS+GEMEQ+FLQALQ+FYY+GKA MSNEEF
Sbjct  58   TTEQSGQGGGEDV--DSNIMPYCSINKAEKKSIGEMEQEFLQALQSFYYDGKATMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+EFDKLK+KLK+DGS+IV
Sbjct  116  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEFDKLKLKLKIDGSEIV  173



>emb|CDX94134.1| BnaC07g37680D [Brassica napus]
Length=320

 Score =   222 bits (566),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A  ++P  S  S S  +          GR IS+R++F +L  KA
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPTASLSSPSPRTQWAQLS---PGRSISLRKKFFLLPAKA  57

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q GQ   ++V  DSN++PYCSI++ EKKS+GEMEQ+FLQALQ+FYY+GKA MSNEEF
Sbjct  58   TTEQSGQAGGEDV--DSNIMPYCSINKAEKKSIGEMEQEFLQALQSFYYDGKATMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+EFDKLK+KLK+DGS+IV
Sbjct  116  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEFDKLKLKLKIDGSEIV  173



>gb|KDO63648.1| hypothetical protein CISIN_1g019981mg [Citrus sinensis]
Length=309

 Score =   222 bits (565),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  178  FAGRKISVRRRFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFL  357
            F GR+ +VRRR  VL  KATTDQ GQV+ DEV VDS +L YCSID+KEKKSLGE+EQ+FL
Sbjct  45   FNGRQFTVRRRSFVLPSKATTDQQGQVEGDEV-VDSKILQYCSIDKKEKKSLGELEQEFL  103

Query  358  QALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDK  537
            QALQAFYYEGKA+MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEASMAYVAG PIMSD+
Sbjct  104  QALQAFYYEGKAVMSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDE  163

Query  538  EFDKLKMKLKMDGSDIV  588
            E+DKLK KLKM+GS+IV
Sbjct  164  EYDKLKQKLKMEGSEIV  180



>ref|XP_003525746.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Glycine 
max]
 gb|KHN34448.1| PGR5-like protein 1A, chloroplastic [Glycine soja]
Length=321

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 141/180 (78%), Gaps = 12/180 (7%)
 Frame = +1

Query  58   ATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKAT  237
            A+KL ++LT PR   A             + SAS + LI F GR + +R+R  +L P AT
Sbjct  4    ASKLAFTLTPPRPCTAPLTP---------ISSASGVHLIQFNGRHLCLRQRLFLLSPMAT  54

Query  238  TDQPGQVQE---DEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
             DQ G+V+E   D   VDS +LPYCSID+KEKKS+GE+EQ+FLQALQAFYYEGKAIMSNE
Sbjct  55   ADQQGKVEEFEDDSNTVDSKILPYCSIDKKEKKSIGELEQEFLQALQAFYYEGKAIMSNE  114

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PIMSDKEFD+LK++LK++GS+IV
Sbjct  115  EFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPIMSDKEFDELKLRLKIEGSEIV  174



>gb|ACU23217.1| unknown [Glycine max]
Length=321

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 141/180 (78%), Gaps = 12/180 (7%)
 Frame = +1

Query  58   ATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKAT  237
            A+KL ++LT PR   A             + SAS + LI F GR + +R+R  +L P AT
Sbjct  4    ASKLAFTLTPPRPCTAPLTP---------ISSASGVHLIQFNGRHLCLRQRLFLLSPMAT  54

Query  238  TDQPGQVQE---DEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
             DQ G+V+E   D   VDS +LPYCSID+KEKKS+GE+EQ+FLQALQAFYYEGKAIMSNE
Sbjct  55   ADQQGKVEEFEDDSNTVDSKILPYCSIDKKEKKSIGELEQEFLQALQAFYYEGKAIMSNE  114

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PIMSDKEFD+LK++LK++GS+IV
Sbjct  115  EFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPIMSDKEFDELKLRLKIEGSEIV  174



>emb|CDY10819.1| BnaC01g14340D [Brassica napus]
Length=319

 Score =   221 bits (564),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 142/178 (80%), Gaps = 4/178 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A   +P  +   +S  S+         GR + +R+ F +L  KA
Sbjct  1    MGSKMLFSLTSPRLFSAVSSKP--TTCFSSPSSSRTQWAPLSPGRSVPLRKSFFLLPSKA  58

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+QPGQ   ++V  DSN++PYCSI++ EKK++GEMEQ+FLQA+Q+FYY+GKAIMSNEEF
Sbjct  59   TTEQPGQAGGEDV--DSNIMPYCSINKAEKKTIGEMEQEFLQAMQSFYYDGKAIMSNEEF  116

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+EFD+LK+KLKMDGS+IV
Sbjct  117  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDQEFDQLKLKLKMDGSEIV  174



>ref|XP_006385747.1| hypothetical protein POPTR_0003s11910g [Populus trichocarpa]
 gb|ERP63544.1| hypothetical protein POPTR_0003s11910g [Populus trichocarpa]
Length=218

 Score =   218 bits (556),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 143/181 (79%), Gaps = 4/181 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrl--plIYFAGRKISVRRRFLVLCP  228
            MA+KL ++LT+PR   A  ++P IS+ S+    +S      +   G++ S+R R L L  
Sbjct  1    MASKLAFNLTSPRVFTAPIQKPIISSSSSLPSLSSPSCSTRVQLNGKQFSLRGRMLFLPT  60

Query  229  KATTDQ-PGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSN  405
            KAT DQ   QVQED+++ D  +L YCSID+K KKSLGEMEQDFLQALQAFYYEGKAIMSN
Sbjct  61   KATADQQTDQVQEDDMD-DGKILQYCSIDKKGKKSLGEMEQDFLQALQAFYYEGKAIMSN  119

Query  406  EEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDI  585
            EEFDNLKEELMW+GSSVVMLS+DEQ+FLEAS+AYV+G PIM+D+EFDKLK+KLK +GS+I
Sbjct  120  EEFDNLKEELMWQGSSVVMLSSDEQKFLEASLAYVSGNPIMNDEEFDKLKIKLKTEGSEI  179

Query  586  V  588
            V
Sbjct  180  V  180



>gb|KDO63643.1| hypothetical protein CISIN_1g019981mg [Citrus sinensis]
 gb|KDO63644.1| hypothetical protein CISIN_1g019981mg [Citrus sinensis]
 gb|KDO63645.1| hypothetical protein CISIN_1g019981mg [Citrus sinensis]
Length=327

 Score =   222 bits (565),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  178  FAGRKISVRRRFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFL  357
            F GR+ +VRRR  VL  KATTDQ GQV+ DEV VDS +L YCSID+KEKKSLGE+EQ+FL
Sbjct  45   FNGRQFTVRRRSFVLPSKATTDQQGQVEGDEV-VDSKILQYCSIDKKEKKSLGELEQEFL  103

Query  358  QALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDK  537
            QALQAFYYEGKA+MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEASMAYVAG PIMSD+
Sbjct  104  QALQAFYYEGKAVMSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDE  163

Query  538  EFDKLKMKLKMDGSDIV  588
            E+DKLK KLKM+GS+IV
Sbjct  164  EYDKLKQKLKMEGSEIV  180



>gb|KJB25726.1| hypothetical protein B456_004G206000 [Gossypium raimondii]
Length=336

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 150/181 (83%), Gaps = 4/181 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRP---FIsapsaslpsasrlplIYFAGRKISVRRRFLVLC  225
            MA+KL ++L  PRF  A+ ++P   F S+ S+S  S+S    +  +G+ +  RRR L+L 
Sbjct  10   MASKLAFTLMPPRFFTATIQKPVVCFSSSSSSSSSSSSSSTRVQPSGKHLCFRRRLLLLP  69

Query  226  PKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSN  405
             KAT DQ GQV+ DEV VDS +LPYCSID+KEKKSLGEMEQ+FLQALQAFYYEGKAIMSN
Sbjct  70   LKATADQQGQVEGDEV-VDSKILPYCSIDKKEKKSLGEMEQEFLQALQAFYYEGKAIMSN  128

Query  406  EEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDI  585
            EEFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI+SD+EFD+LKM+LKM+GS+I
Sbjct  129  EEFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPILSDEEFDELKMRLKMEGSEI  188

Query  586  V  588
            V
Sbjct  189  V  189



>gb|KDO63646.1| hypothetical protein CISIN_1g019981mg [Citrus sinensis]
Length=333

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +1

Query  178  FAGRKISVRRRFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFL  357
            F GR+ +VRRR  VL  KATTDQ GQV+ DEV VDS +L YCSID+KEKKSLGE+EQ+FL
Sbjct  45   FNGRQFTVRRRSFVLPSKATTDQQGQVEGDEV-VDSKILQYCSIDKKEKKSLGELEQEFL  103

Query  358  QALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDK  537
            QALQAFYYEGKA+MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEASMAYVAG PIMSD+
Sbjct  104  QALQAFYYEGKAVMSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDE  163

Query  538  EFDKLKMKLKMDGSDIV  588
            E+DKLK KLKM+GS+IV
Sbjct  164  EYDKLKQKLKMEGSEIV  180



>ref|XP_009137294.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X2 [Brassica 
rapa]
Length=318

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 141/178 (79%), Gaps = 7/178 (4%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A  ++P  S  S S  +          GR IS+R+RF +L  KA
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPTASLSSPSPRTQWAQLS---PGRSISLRKRFFLLPAKA  57

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q G  ++    VDSN++PYCSI++ EKKS+GEMEQ+FLQALQ+FYY+GKA MSNEEF
Sbjct  58   TTEQSGGGED----VDSNIMPYCSINKAEKKSIGEMEQEFLQALQSFYYDGKATMSNEEF  113

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+EFDKLK+KLK+DGS+IV
Sbjct  114  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEFDKLKLKLKIDGSEIV  171



>ref|NP_567672.1| PGR5-like protein 1A [Arabidopsis thaliana]
 ref|NP_849422.1| PGR5-like protein 1A [Arabidopsis thaliana]
 ref|NP_849423.1| PGR5-like protein 1A [Arabidopsis thaliana]
 sp|Q8H112.1|PGL1A_ARATH RecName: Full=PGR5-like protein 1A, chloroplastic; AltName: Full=Ferredoxin-plastoquinone 
reductase 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAN41305.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84674.1| PGR5-like protein 1A [Arabidopsis thaliana]
 gb|AEE84675.1| PGR5-like protein 1A [Arabidopsis thaliana]
 gb|AEE84676.1| PGR5-like protein 1A [Arabidopsis thaliana]
Length=324

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 143/179 (80%), Gaps = 3/179 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFA-GRKISVRRRFLVLCPK  231
            M +K+++SLT+PR   A  ++P  S   +    +SR      + G+ IS+RRR  +L  K
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPSSSFSPSPPSPSSRTQWTQLSPGKSISLRRRVFLLPAK  60

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            ATT+Q G V  D V  DSNVLPYCSI++ EKK++GEMEQ+FLQALQ+FYY+GKAIMSNEE
Sbjct  61   ATTEQSGPVGGDNV--DSNVLPYCSINKAEKKTIGEMEQEFLQALQSFYYDGKAIMSNEE  118

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+E+DKLK+KLK+DGSDIV
Sbjct  119  FDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKIDGSDIV  177



>ref|XP_004147962.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004159497.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Cucumis 
sativus]
 gb|KGN55940.1| hypothetical protein Csa_3G038140 [Cucumis sativus]
Length=321

 Score =   219 bits (558),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 126/139 (91%), Gaps = 1/139 (1%)
 Frame = +1

Query  172  IYFAGRKISVRRRFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQD  351
            I  + R++ +RR+ ++  P+ATTDQPGQV+ DEV VDSNVL YCSID+KEKK++GE+EQ+
Sbjct  40   IRVSSRRLFLRRKLVLPPPRATTDQPGQVEGDEV-VDSNVLQYCSIDKKEKKTIGELEQE  98

Query  352  FLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMS  531
            FLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI+S
Sbjct  99   FLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGNPILS  158

Query  532  DKEFDKLKMKLKMDGSDIV  588
            DKEFD LK++LK +GS+IV
Sbjct  159  DKEFDDLKLRLKTEGSEIV  177



>ref|XP_011033840.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Populus euphratica]
 ref|XP_011033841.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Populus euphratica]
Length=327

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 4/181 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrl--plIYFAGRKISVRRRFLVLCP  228
            MA+KL ++LT+PR   A  ++P IS+ S+    +S      +   G++ S+R R L L  
Sbjct  1    MASKLAFNLTSPRVFTAPIQKPIISSSSSLPSLSSPSCSTRVQLNGKQFSLRGRMLCLPT  60

Query  229  KATTDQ-PGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSN  405
            KAT DQ   QVQED+++ D  +L YCSID+K KKSLGEMEQDFLQALQAFYYEGKAIMSN
Sbjct  61   KATADQQTDQVQEDDMD-DDTILQYCSIDKKGKKSLGEMEQDFLQALQAFYYEGKAIMSN  119

Query  406  EEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDI  585
            EEFDNLKEELMW+GSSVVMLS+DEQ+FLEAS+AYV+G PIMSD+EFDKLK+KLK +GS+I
Sbjct  120  EEFDNLKEELMWQGSSVVMLSSDEQKFLEASLAYVSGNPIMSDEEFDKLKIKLKTEGSEI  179

Query  586  V  588
            V
Sbjct  180  V  180



>ref|XP_008364795.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Malus domestica]
Length=321

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 144/178 (81%), Gaps = 4/178 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA KL ++LT+P   + S +R      S S PS++R+     +GR++ +RRR  VL  KA
Sbjct  1    MAIKLGFNLTSPTPFNPSIQR---PFVSVSSPSSTRVESFQISGRQLCLRRRLFVLPAKA  57

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQ G+V+ D+V VDS +LPYCSID+K KKS GE+EQDFLQALQ+FYY+GKAIMSNEEF
Sbjct  58   TADQQGKVENDDV-VDSKILPYCSIDKKAKKSXGELEQDFLQALQSFYYDGKAIMSNEEF  116

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI++D+E+D+LK++LK +GSDIV
Sbjct  117  DNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPILTDQEYDELKLRLKTEGSDIV  174



>ref|XP_002303553.1| hypothetical protein POPTR_0003s11910g [Populus trichocarpa]
 gb|EEE78532.1| hypothetical protein POPTR_0003s11910g [Populus trichocarpa]
Length=327

 Score =   217 bits (552),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 143/181 (79%), Gaps = 4/181 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrl--plIYFAGRKISVRRRFLVLCP  228
            MA+KL ++LT+PR   A  ++P IS+ S+    +S      +   G++ S+R R L L  
Sbjct  1    MASKLAFNLTSPRVFTAPIQKPIISSSSSLPSLSSPSCSTRVQLNGKQFSLRGRMLFLPT  60

Query  229  KATTDQ-PGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSN  405
            KAT DQ   QVQED+++ D  +L YCSID+K KKSLGEMEQDFLQALQAFYYEGKAIMSN
Sbjct  61   KATADQQTDQVQEDDMD-DGKILQYCSIDKKGKKSLGEMEQDFLQALQAFYYEGKAIMSN  119

Query  406  EEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDI  585
            EEFDNLKEELMW+GSSVVMLS+DEQ+FLEAS+AYV+G PIM+D+EFDKLK+KLK +GS+I
Sbjct  120  EEFDNLKEELMWQGSSVVMLSSDEQKFLEASLAYVSGNPIMNDEEFDKLKIKLKTEGSEI  179

Query  586  V  588
            V
Sbjct  180  V  180



>ref|XP_009136287.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X1 [Brassica 
rapa]
 ref|XP_009136294.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X1 [Brassica 
rapa]
 emb|CDY41285.1| BnaA01g12540D [Brassica napus]
Length=319

 Score =   216 bits (551),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 142/178 (80%), Gaps = 4/178 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A  ++   +   +S  S+         GR + +R+RF +L  KA
Sbjct  1    MGSKMLFSLTSPRLFSAVSRK--PTTSFSSPSSSRTQWAPLSPGRSVPLRKRFFLLPSKA  58

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q GQ   ++V  DSN++PYCSI++ EKK++GEMEQ+FLQA+Q+FYY+GKAIMSNEEF
Sbjct  59   TTEQSGQAGGEDV--DSNIMPYCSINKAEKKTIGEMEQEFLQAMQSFYYDGKAIMSNEEF  116

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+EFD+LK+KLKMDGS+IV
Sbjct  117  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDQEFDQLKLKLKMDGSEIV  174



>ref|XP_002509675.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51062.1| conserved hypothetical protein [Ricinus communis]
Length=320

 Score =   216 bits (551),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 143/179 (80%), Gaps = 7/179 (4%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA+KL +SLT PR   A   +P IS  S+S   +S L      G+ +SVRRR L+L  KA
Sbjct  1    MASKLAFSLTFPRVYSAPILKPLISLSSSSRIHSSHL-----HGKHLSVRRRILLLPIKA  55

Query  235  TTDQP-GQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            T DQ  G+V+ DEV VD  +L YCSID+K+KKS+GEMEQ+FLQALQAFYYEGKAIMSNEE
Sbjct  56   TADQQQGKVEGDEV-VDGKILQYCSIDKKDKKSIGEMEQEFLQALQAFYYEGKAIMSNEE  114

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS DEQ+FLEASMAYV+G PIMSD+EFD+LK++LK +GS+IV
Sbjct  115  FDNLKEELMWEGSSVVMLSCDEQKFLEASMAYVSGNPIMSDEEFDQLKLRLKQEGSEIV  173



>ref|XP_006413605.1| hypothetical protein EUTSA_v10025739mg [Eutrema salsugineum]
 gb|ESQ55058.1| hypothetical protein EUTSA_v10025739mg [Eutrema salsugineum]
Length=319

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 140/178 (79%), Gaps = 6/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K ++SLT+PR   A  ++P +S    S   +    L    GR IS+RRRF +L  KA
Sbjct  1    MGSKTLFSLTSPRLFSAVSRKPTVSFSPPSSSRSQWAQLS--PGRSISLRRRFFLLPAKA  58

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q  + +E    VDSN+  YCSI++ +KKS+GEMEQ+FLQALQ+FYY+GKAIMSNEEF
Sbjct  59   TTEQSVEGEE----VDSNINAYCSINKAQKKSIGEMEQEFLQALQSFYYDGKAIMSNEEF  114

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLK+ELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+E+DKLK+KLKMDGSDIV
Sbjct  115  DNLKDELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKMDGSDIV  172



>ref|XP_008448945.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Cucumis melo]
Length=323

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 126/139 (91%), Gaps = 2/139 (1%)
 Frame = +1

Query  172  IYFAGRKISVRRRFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQD  351
            I  + R++ +RR+ ++  P+ATTDQPGQV+ DEV VDSNVL YCSID KEKK++GE+EQ+
Sbjct  40   IRVSSRRLFLRRKVVLPPPRATTDQPGQVEGDEV-VDSNVLRYCSID-KEKKTIGELEQE  97

Query  352  FLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMS  531
            FLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PIM+
Sbjct  98   FLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGNPIMT  157

Query  532  DKEFDKLKMKLKMDGSDIV  588
            DKEFD LK++LKM+GS+IV
Sbjct  158  DKEFDDLKLRLKMEGSEIV  176



>ref|NP_001078431.1| PGR5-like protein 1A [Arabidopsis thaliana]
 gb|AEE84677.1| PGR5-like protein 1A [Arabidopsis thaliana]
Length=321

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 141/179 (79%), Gaps = 6/179 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFA-GRKISVRRRFLVLCPK  231
            M +K+++SLT+PR   A  ++P  S   +    +SR      + G+ IS+RRR  +L  K
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPSSSFSPSPPSPSSRTQWTQLSPGKSISLRRRVFLLPAK  60

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            ATT+Q G        VDSNVLPYCSI++ EKK++GEMEQ+FLQALQ+FYY+GKAIMSNEE
Sbjct  61   ATTEQSGGDN-----VDSNVLPYCSINKAEKKTIGEMEQEFLQALQSFYYDGKAIMSNEE  115

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+E+DKLK+KLK+DGSDIV
Sbjct  116  FDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKIDGSDIV  174



>ref|XP_006396828.1| hypothetical protein EUTSA_v10028695mg [Eutrema salsugineum]
 gb|ESQ38281.1| hypothetical protein EUTSA_v10028695mg [Eutrema salsugineum]
Length=394

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 142/180 (79%), Gaps = 3/180 (2%)
 Frame = +1

Query  52   QMATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCP-  228
             M +K+ ++LT PRF  A  ++P   + S+   S SR    YF+ R+    RR L L P 
Sbjct  92   SMCSKMAFTLTIPRFYSAISRKPTTCSSSSFSSSPSRPQCAYFSYRRSISLRRRLFLLPV  151

Query  229  KATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            KATTDQ G V  +EV  DS +LPYCSI++ EK+SLGEMEQ+FLQA+Q+FYYEGKAIMSNE
Sbjct  152  KATTDQSGPVGGEEV--DSKILPYCSINKNEKRSLGEMEQEFLQAMQSFYYEGKAIMSNE  209

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI+SD+E+DKLKMKLKMDGSDIV
Sbjct  210  EFDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSDIV  269



>gb|KJB52017.1| hypothetical protein B456_008G242200 [Gossypium raimondii]
Length=346

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 133/172 (77%), Gaps = 9/172 (5%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA+KL  +LT  RFL+   ++P +S  S++         +   G+++  R R  VL  KA
Sbjct  50   MASKLALTLTPHRFLNGHIQKPLVSFSSSTR--------VLSNGKQLCCRHRLFVLPIKA  101

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
              DQ GQV+ED V VDS +LPYCSID+KEKKSLGEMEQ+FLQALQAFYYEGKAIMSNEEF
Sbjct  102  AADQQGQVEEDNV-VDSKILPYCSIDKKEKKSLGEMEQEFLQALQAFYYEGKAIMSNEEF  160

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKM  570
            DNLKEEL WEGSSVVMLS+DEQ+FLEASMAYV+G PI+SD+EFD LK+ LK+
Sbjct  161  DNLKEELTWEGSSVVMLSSDEQKFLEASMAYVSGKPILSDEEFDDLKLGLKV  212



>ref|XP_006396829.1| hypothetical protein EUTSA_v10028695mg [Eutrema salsugineum]
 gb|ESQ38282.1| hypothetical protein EUTSA_v10028695mg [Eutrema salsugineum]
Length=416

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 142/180 (79%), Gaps = 3/180 (2%)
 Frame = +1

Query  52   QMATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCP-  228
             M +K+ ++LT PRF  A  ++P   + S+   S SR    YF+ R+    RR L L P 
Sbjct  92   SMCSKMAFTLTIPRFYSAISRKPTTCSSSSFSSSPSRPQCAYFSYRRSISLRRRLFLLPV  151

Query  229  KATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            KATTDQ G V  +EV  DS +LPYCSI++ EK+SLGEMEQ+FLQA+Q+FYYEGKAIMSNE
Sbjct  152  KATTDQSGPVGGEEV--DSKILPYCSINKNEKRSLGEMEQEFLQAMQSFYYEGKAIMSNE  209

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI+SD+E+DKLKMKLKMDGSDIV
Sbjct  210  EFDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSDIV  269



>ref|XP_004298721.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=323

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 139/183 (76%), Gaps = 12/183 (7%)
 Frame = +1

Query  55   MATKLVYSLTTPR-----FLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLV  219
            MA+KL ++L  P        + S +RPF     +   S++R+    F GR++ VRRR LV
Sbjct  1    MASKLAFTLVAPTRSTTTTTNPSIQRPF----VSVSSSSTRVQSFQFGGRQLCVRRRLLV  56

Query  220  LCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIM  399
            +  KA  D+    Q +E  VD NVLPYCSID+K+KKSLGEMEQDFLQALQ+FYY+GKAIM
Sbjct  57   IPSKAAADKQ---QGNEDVVDGNVLPYCSIDKKQKKSLGEMEQDFLQALQSFYYDGKAIM  113

Query  400  SNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGS  579
            SNEEFD LKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI+SDKEFD+LKM+LK  GS
Sbjct  114  SNEEFDILKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPILSDKEFDELKMRLKEQGS  173

Query  580  DIV  588
            DIV
Sbjct  174  DIV  176



>ref|XP_006284133.1| hypothetical protein CARUB_v10005263mg [Capsella rubella]
 gb|EOA17031.1| hypothetical protein CARUB_v10005263mg [Capsella rubella]
Length=320

 Score =   214 bits (545),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 143/178 (80%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A  ++P  ++ S S     +L  +  A + +S+RRR L+L P+A
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPTTTSFSPSSSRTQQLAQLTPA-KSVSLRRRVLLLPPRA  59

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T +Q G        VDSNVLPYCSI++ EKK++GEMEQ+FLQA+Q+FYY+GKAIMSNEEF
Sbjct  60   TAEQSGGGDN----VDSNVLPYCSINKAEKKTIGEMEQEFLQAMQSFYYDGKAIMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+E+DKLK+KLKMDGS+IV
Sbjct  116  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKMDGSEIV  173



>ref|NP_001078432.1| PGR5-like protein 1A [Arabidopsis thaliana]
 gb|AEE84678.1| PGR5-like protein 1A [Arabidopsis thaliana]
Length=322

 Score =   214 bits (545),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 142/179 (79%), Gaps = 5/179 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFA-GRKISVRRRFLVLCPK  231
            M +K+++SLT+PR   A  ++P  S   +    +SR      + G+ IS+RRR  +L  K
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPSSSFSPSPPSPSSRTQWTQLSPGKSISLRRRVFLLPAK  60

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            ATT+Q   V  D V  DSNVLPYCSI++ EKK++GEMEQ+FLQALQ+FYY+GKAIMSNEE
Sbjct  61   ATTEQ--SVGGDNV--DSNVLPYCSINKAEKKTIGEMEQEFLQALQSFYYDGKAIMSNEE  116

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+E+DKLK+KLK+DGSDIV
Sbjct  117  FDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKIDGSDIV  175



>ref|XP_003517448.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like isoform X1 
[Glycine max]
 gb|KHN25744.1| PGR5-like protein 1A, chloroplastic [Glycine soja]
Length=316

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 139/178 (78%), Gaps = 9/178 (5%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA+KL ++LT P         P     S S  SASRL L+ F GR I +R R  +  P A
Sbjct  1    MASKLAFTLTYPL--------PLTPISSLSSSSASRLHLLQFNGRHICLRPRLFLFSPMA  52

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQ  +V+ED   VDS +L YCSID+KEKKS+GEMEQ+FLQALQAFYYEGKAIMSNEEF
Sbjct  53   TADQ-DKVEEDAAVVDSKILQYCSIDKKEKKSVGEMEQEFLQALQAFYYEGKAIMSNEEF  111

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGS+VVMLS+DEQ+FLEASMAYV+G PI+SDKEFD+LK++LKM+GS+IV
Sbjct  112  DNLKEELMWEGSTVVMLSSDEQKFLEASMAYVSGKPILSDKEFDELKLRLKMEGSEIV  169



>ref|XP_002869800.1| hypothetical protein ARALYDRAFT_492575 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46059.1| hypothetical protein ARALYDRAFT_492575 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 138/178 (78%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A   +P  S   +S  +           + IS+RRR  +L  KA
Sbjct  1    MGSKMLFSLTSPRLFSAVSLKPTSSFSPSSSRTQWAQLT---PAKSISLRRRVFLLPAKA  57

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q G    D V  DSNVLPYCSI++ EKK++GEMEQ+FLQA+Q+FYY+GKAIMSNEEF
Sbjct  58   TTEQSGPGGGDNV--DSNVLPYCSINKAEKKTIGEMEQEFLQAMQSFYYDGKAIMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLK+ELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+E+DKLK+KLK+DGS+IV
Sbjct  116  DNLKDELMWEGSSVVMLSSDEQRFLEASMAYVSGKPILNDEEYDKLKLKLKIDGSEIV  173



>ref|XP_010439270.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Camelina sativa]
Length=319

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 140/178 (79%), Gaps = 6/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A  ++P  S+ S S        L     + +S+R+R  +L  KA
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPTTSSFSPSSSKTQLDQLC--PAKSVSLRKRVSLLPAKA  58

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+QPG        VDSNVLPYCSI++ EKK++GE+EQ+FLQA+Q+FYY+GKAIMSNEEF
Sbjct  59   TTEQPGGGDN----VDSNVLPYCSINKAEKKTIGELEQEFLQAMQSFYYDGKAIMSNEEF  114

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+E+DKLK+KLKMDGSDIV
Sbjct  115  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKMDGSDIV  172



>ref|XP_010448812.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Camelina sativa]
Length=320

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 141/178 (79%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A  ++P  S+ S S        L     + +S+RRR  +L  KA
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPTTSSFSPSSSKTQLDQLC--PAKSVSLRRRVSLLPAKA  58

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q G   ++   VDSNVLPYCSI++ EKK++GE+EQ+FLQA+Q+FYY+GKAIMSNEEF
Sbjct  59   TTEQSGGGGDN---VDSNVLPYCSINKAEKKTIGELEQEFLQAMQSFYYDGKAIMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+E+DKLK+KLKMDGSDIV
Sbjct  116  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKMDGSDIV  173



>gb|ABK95508.1| unknown [Populus trichocarpa]
Length=323

 Score =   211 bits (538),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MA+KL ++LT+PR   A  ++      S+S   +     +   G++ S+R R L L  KA
Sbjct  1    MASKLAFNLTSPRVFTAPIQK--PIISSSSSLPSLSSTRVQLNGKQFSLRGRMLFLPTKA  58

Query  235  TTDQ-PGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            T DQ   QVQED+++ D  +L YCSID+K KKSLGEMEQDFLQALQAFYYEGKAIMSNEE
Sbjct  59   TADQQTDQVQEDDMD-DGKILQYCSIDKKGKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  117

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMW+GSSVVMLS+DEQ+FLEAS+AYV+G PIM+D+EFDKLK+KLK +GS+IV
Sbjct  118  FDNLKEELMWQGSSVVMLSSDEQKFLEASLAYVSGNPIMNDEEFDKLKIKLKTEGSEIV  176



>gb|AES94146.2| PGR5-like protein 1A [Medicago truncatula]
Length=315

 Score =   211 bits (537),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 4/142 (3%)
 Frame = +1

Query  172  IYF--AGRKISVRRRFLVLCPKATTDQ-PGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEM  342
            I+F   GR  S+RR   +L PKAT+DQ  G+V+ED V VDS +L YCSID+KEKKSLGE+
Sbjct  28   IHFNAGGRHSSLRRGLFLLSPKATSDQQAGKVEEDAV-VDSKILQYCSIDQKEKKSLGEL  86

Query  343  EQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTP  522
            EQDFLQALQAFYYEGKA MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEAS+AYV+G P
Sbjct  87   EQDFLQALQAFYYEGKATMSNEEFDNLKEELMWEGSSVVMLSSSEQKFLEASIAYVSGKP  146

Query  523  IMSDKEFDKLKMKLKMDGSDIV  588
            +MSDKEFD+LK+KLKM+GS+IV
Sbjct  147  LMSDKEFDELKLKLKMEGSEIV  168



>ref|XP_003611188.1| PGR5-like protein 1A [Medicago truncatula]
Length=326

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 4/142 (3%)
 Frame = +1

Query  172  IYF--AGRKISVRRRFLVLCPKATTDQ-PGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEM  342
            I+F   GR  S+RR   +L PKAT+DQ  G+V+ED V VDS +L YCSID+KEKKSLGE+
Sbjct  28   IHFNAGGRHSSLRRGLFLLSPKATSDQQAGKVEEDAV-VDSKILQYCSIDQKEKKSLGEL  86

Query  343  EQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTP  522
            EQDFLQALQAFYYEGKA MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEAS+AYV+G P
Sbjct  87   EQDFLQALQAFYYEGKATMSNEEFDNLKEELMWEGSSVVMLSSSEQKFLEASIAYVSGKP  146

Query  523  IMSDKEFDKLKMKLKMDGSDIV  588
            +MSDKEFD+LK+KLKM+GS+IV
Sbjct  147  LMSDKEFDELKLKLKMEGSEIV  168



>ref|XP_009136301.1| PREDICTED: PGR5-like protein 1A, chloroplastic isoform X2 [Brassica 
rapa]
Length=317

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 140/178 (79%), Gaps = 6/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A  ++   +   +S  S+         GR + +R+RF +L  KA
Sbjct  1    MGSKMLFSLTSPRLFSAVSRK--PTTSFSSPSSSRTQWAPLSPGRSVPLRKRFFLLPSKA  58

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q    ++    VDSN++PYCSI++ EKK++GEMEQ+FLQA+Q+FYY+GKAIMSNEEF
Sbjct  59   TTEQSAGGED----VDSNIMPYCSINKAEKKTIGEMEQEFLQAMQSFYYDGKAIMSNEEF  114

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+EFD+LK+KLKMDGS+IV
Sbjct  115  DNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDQEFDQLKLKLKMDGSEIV  172



>ref|XP_007155578.1| hypothetical protein PHAVU_003G213900g [Phaseolus vulgaris]
 gb|ESW27572.1| hypothetical protein PHAVU_003G213900g [Phaseolus vulgaris]
Length=326

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 143/180 (79%), Gaps = 7/180 (4%)
 Frame = +1

Query  58   ATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKAT  237
            A+KL + LT PR   A    P     S S  S S + LI+F GR + +RRR  +L PKAT
Sbjct  4    ASKLAFMLTLPRPCTA----PLTPISSLSSSSPSGIHLIHFNGRHLCLRRRLFLLSPKAT  59

Query  238  TDQPGQV---QEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
             DQ G+V   ++D   VDS +LPYCSID+KEKKS+GE+EQDFLQALQAFYYEGKAIMSNE
Sbjct  60   ADQQGRVGDFEDDANTVDSKILPYCSIDKKEKKSIGELEQDFLQALQAFYYEGKAIMSNE  119

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PIM+DKEFD+LK++LK++GS+IV
Sbjct  120  EFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPIMNDKEFDELKLRLKIEGSEIV  179



>ref|XP_007158444.1| hypothetical protein PHAVU_002G152800g [Phaseolus vulgaris]
 gb|ESW30438.1| hypothetical protein PHAVU_002G152800g [Phaseolus vulgaris]
Length=324

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 146/180 (81%), Gaps = 4/180 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVL--CP  228
            MATKL ++L+ P+   +    PFI   S S  S S L L+ F  R++ +RRR  +    P
Sbjct  1    MATKLTFTLSCPQPFTSHTPTPFIPVSSFSSTSVSPLHLLQFNARRLCLRRRRRLFLFSP  60

Query  229  KATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            +AT DQ G+V+ED+V VDS +LPYCSID+KEKKS+GE+EQDFLQALQAFYYEGKAIMSNE
Sbjct  61   RATADQ-GKVEEDDV-VDSKILPYCSIDKKEKKSVGELEQDFLQALQAFYYEGKAIMSNE  118

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGS+VVMLS++EQ+FLEASMAYV+G PI+SDKEFD LK+KLK++GSDIV
Sbjct  119  EFDNLKEELMWEGSTVVMLSSEEQKFLEASMAYVSGKPILSDKEFDDLKLKLKIEGSDIV  178



>ref|XP_009134250.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Brassica rapa]
 emb|CDX90812.1| BnaA03g24920D [Brassica napus]
Length=320

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 139/179 (78%), Gaps = 7/179 (4%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCP-K  231
            M +K+ ++LT PRF H+   R    + +      SR     F+ R+    RR L L P K
Sbjct  1    MCSKMAFTLTIPRF-HSPVSR---KSTTTCSSPPSRTHSAQFSPRRSISLRRRLFLLPVK  56

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            ATTDQ GQV  +EV  DS +LPYCSI++ EK+S+GEMEQ+FLQA+Q+FYYEGKA+MSNEE
Sbjct  57   ATTDQSGQVGGEEV--DSKILPYCSINKNEKRSIGEMEQEFLQAMQSFYYEGKAVMSNEE  114

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PIMSD+E+DKLKMKLKMDGS+IV
Sbjct  115  FDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPIMSDEEYDKLKMKLKMDGSEIV  173



>ref|XP_002874736.1| hypothetical protein ARALYDRAFT_490014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50995.1| hypothetical protein ARALYDRAFT_490014 [Arabidopsis lyrata subsp. 
lyrata]
Length=310

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 139/174 (80%), Gaps = 11/174 (6%)
 Frame = +1

Query  67   LVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKATTDQ  246
            + ++LT PRF   S ++P   + S +          +  GR IS+RRR L+L  KA+TDQ
Sbjct  1    MAFTLTIPRFSAIS-RKPITCSSSKTAH--------FTHGRSISLRRRLLLLPLKASTDQ  51

Query  247  PGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLK  426
             GQV  +EV  DS +LPYCSI++ EK+++GEMEQ+FLQA+Q+FYYEGKAIMSNEEFDNLK
Sbjct  52   SGQVGGEEV--DSKILPYCSINKSEKRTIGEMEQEFLQAMQSFYYEGKAIMSNEEFDNLK  109

Query  427  EELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EELMWEGSSVVMLS+DEQRFLEASMAYV+G PI+SD+E+DKLKMKLKMDGS+IV
Sbjct  110  EELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSEIV  163



>ref|XP_010433975.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Camelina sativa]
Length=320

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 140/178 (79%), Gaps = 5/178 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            M +K+++SLT+PR   A  ++P  S+ S S        L     + +S+RRR  +L  KA
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPTTSSFSPSSSKTQLDQLC--PAKSVSLRRRVSLLPAKA  58

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TT+Q G   ++   VDSNVLPYCSI++ EKK++GE+EQ+FLQA+Q+FYY+GKAIMSNEEF
Sbjct  59   TTEQSGGGGDN---VDSNVLPYCSINKAEKKTIGELEQEFLQAMQSFYYDGKAIMSNEEF  115

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLK+ELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+E+DKLK+KLKMDGS IV
Sbjct  116  DNLKDELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKMDGSGIV  173



>gb|AFK47748.1| unknown [Lotus japonicus]
Length=327

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = +1

Query  58   ATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKAT  237
            A+KL ++LT+PR        P I   S+S  S+     I F GR++ +RRR  +L PKAT
Sbjct  4    ASKLAFTLTSPRSCTPPTPTPLIPLSSSSFTSSRFNL-IQFNGRQLCLRRRLFLLSPKAT  62

Query  238  TDQPGQVQE-DEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
             DQ G+V+E +E  VDS + PYCSID+K+KKS+GEMEQDFLQALQ+FYYEGKAIMSNEEF
Sbjct  63   ADQQGKVEEFEESAVDSKIFPYCSIDKKDKKSVGEMEQDFLQALQSFYYEGKAIMSNEEF  122

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI+SDKE+D LKM+LKM+GS+IV
Sbjct  123  DNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPILSDKEYDDLKMRLKMNGSEIV  180



>ref|XP_004511624.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Cicer arietinum]
Length=320

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 118/136 (87%), Gaps = 3/136 (2%)
 Frame = +1

Query  181  AGRKISVRRRFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQ  360
             GR   +RRR  +   KAT+DQ  Q QED V +DS +L YCSID+KEKKS+GE+EQDFLQ
Sbjct  45   GGRYSRLRRRLFLFSTKATSDQ--QSQEDGV-IDSKILQYCSIDKKEKKSVGELEQDFLQ  101

Query  361  ALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKE  540
            ALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEAS+AYV+G PIMSDKE
Sbjct  102  ALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASIAYVSGKPIMSDKE  161

Query  541  FDKLKMKLKMDGSDIV  588
            FD+LKMKLKM+GS+IV
Sbjct  162  FDQLKMKLKMEGSEIV  177



>ref|NP_192933.2| PGR5-like protein 1B [Arabidopsis thaliana]
 sp|Q8GYC7.1|PGL1B_ARATH RecName: Full=PGR5-like protein 1B, chloroplastic; AltName: Full=Ferredoxin-plastoquinone 
reductase 2; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAC42372.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63369.1| At4g11960 [Arabidopsis thaliana]
 gb|AEE83074.1| PGR5-like protein 1B [Arabidopsis thaliana]
Length=313

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 139/174 (80%), Gaps = 8/174 (5%)
 Frame = +1

Query  67   LVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKATTDQ  246
            + ++LT PRF   S ++P   + S +   A      +  GR IS+RRR  +L  KA+TDQ
Sbjct  1    MAFTLTIPRFSAIS-RKPITCSSSRTQCPAP-----FTHGRSISLRRRLTLLPLKASTDQ  54

Query  247  PGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLK  426
             GQV  +EV  DS +LPYCSI++ EK+++GEMEQ+FLQA+Q+FYYEGKAIMSNEEFDNLK
Sbjct  55   SGQVGGEEV--DSKILPYCSINKNEKRTIGEMEQEFLQAMQSFYYEGKAIMSNEEFDNLK  112

Query  427  EELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EELMWEGSSVVMLS+DEQRFLEASMAYV+G PI+SD+E+DKLKMKLKMDGS+IV
Sbjct  113  EELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSEIV  166



>ref|XP_010676600.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676601.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=328

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 145/184 (79%), Gaps = 9/184 (5%)
 Frame = +1

Query  55   MATKL-VYSLTTPRFLHASFKRPFIsapsaslpsasr-----lplIYFAGRKISVRRRFL  216
            MA+KL V +LT+P    A  ++P +S  S+S  S++      +   +   R++++RR+ L
Sbjct  1    MASKLGVAALTSPSVFTAPIRKPLVSVSSSSSSSSTSFSLKDVSAKFMGVRRLAIRRKLL  60

Query  217  VLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAI  396
            +L PKA TD+ GQ   DEV VDSN+L YCS+D+K KKSLGE+EQ+FLQALQ FYYEGKAI
Sbjct  61   LLPPKAATDKQGQAG-DEV-VDSNMLQYCSLDKK-KKSLGELEQEFLQALQTFYYEGKAI  117

Query  397  MSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDG  576
            MSNEEFDNLKEELMWEGSS+VMLS+DEQRFLEASMAYVAG PI+SD+EFD+L++KLK +G
Sbjct  118  MSNEEFDNLKEELMWEGSSIVMLSSDEQRFLEASMAYVAGNPILSDEEFDELRLKLKTEG  177

Query  577  SDIV  588
            S IV
Sbjct  178  SMIV  181



>emb|CAB40937.1| putative protein [Arabidopsis thaliana]
 emb|CAB78239.1| putative protein [Arabidopsis thaliana]
Length=338

 Score =   207 bits (526),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 139/174 (80%), Gaps = 8/174 (5%)
 Frame = +1

Query  67   LVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKATTDQ  246
            + ++LT PRF   S ++P   + S +   A      +  GR IS+RRR  +L  KA+TDQ
Sbjct  1    MAFTLTIPRFSAIS-RKPITCSSSRTQCPAP-----FTHGRSISLRRRLTLLPLKASTDQ  54

Query  247  PGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLK  426
             GQV  +EV  DS +LPYCSI++ EK+++GEMEQ+FLQA+Q+FYYEGKAIMSNEEFDNLK
Sbjct  55   SGQVGGEEV--DSKILPYCSINKNEKRTIGEMEQEFLQAMQSFYYEGKAIMSNEEFDNLK  112

Query  427  EELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EELMWEGSSVVMLS+DEQRFLEASMAYV+G PI+SD+E+DKLKMKLKMDGS+IV
Sbjct  113  EELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSEIV  166



>ref|XP_004515785.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Cicer arietinum]
Length=322

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 140/179 (78%), Gaps = 9/179 (5%)
 Frame = +1

Query  58   ATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKAT  237
            A+K+ ++LT PR   A    PFI   S+           +F  R + +RRR  +L PKAT
Sbjct  4    ASKVAFTLTPPRPCTAPTPTPFIPNSSSLSRP-------HFISRHLCLRRRLFLLSPKAT  56

Query  238  TDQPGQVQE--DEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
             DQ G+V++   +  VDSNVLPYCSID+KEKKS+GE+EQDFLQALQ+FYYEGKAIMSNEE
Sbjct  57   ADQQGKVEDFDGDAVVDSNVLPYCSIDKKEKKSVGELEQDFLQALQSFYYEGKAIMSNEE  116

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS+DEQ+FLEAS+AYV+G PI++DK++D+LK++LK +GS+IV
Sbjct  117  FDNLKEELMWEGSSVVMLSSDEQKFLEASIAYVSGNPILNDKQYDELKLRLKREGSEIV  175



>ref|XP_002299573.1| hypothetical protein POPTR_0001s08420g [Populus trichocarpa]
 gb|EEE84378.1| hypothetical protein POPTR_0001s08420g [Populus trichocarpa]
Length=327

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 5/175 (3%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlpl-IYFAGRKISVRRRFLVLCPK  231
            MA KL ++LT+PR L A  ++PFIS+ S+  P +      ++F  ++ S+RRR L+   K
Sbjct  1    MAGKLAFTLTSPRVLIAPIQKPFISSSSSLPPPSCSSSTRVHFNVKQFSLRRRMLLPPTK  60

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            AT DQ     EDE+ VD  +L YCSID++ KKS+GEMEQ+FLQALQAFYYEGKAIMSNEE
Sbjct  61   ATADQQA---EDEM-VDGKILQYCSIDKRGKKSIGEMEQEFLQALQAFYYEGKAIMSNEE  116

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDG  576
            FDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+  PIMSDKE+D+LKMKLK+  
Sbjct  117  FDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSENPIMSDKEYDELKMKLKVSA  171



>gb|AFK41277.1| unknown [Medicago truncatula]
Length=315

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 136/182 (75%), Gaps = 18/182 (10%)
 Frame = +1

Query  55   MATKLV-YSLTTPRFLHASFKRPFIsapsaslpsasrlplIYF--AGRKISVRRRFLVLC  225
            MA+KL+ ++LT P     S   P +               I+F   GR  S+RR   +L 
Sbjct  1    MASKLLAFTLTCPSSPSFSTSAPRVLP-------------IHFNAGGRHSSLRRGLFLLS  47

Query  226  PKATTDQ-PGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMS  402
            PKAT+DQ  G+V+ED V V S +L YCSID+KEKKSLGE+EQDFLQALQA YYEGKA MS
Sbjct  48   PKATSDQQAGKVEEDAV-VYSKILQYCSIDQKEKKSLGELEQDFLQALQASYYEGKATMS  106

Query  403  NEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSD  582
            NEEFDNLKEELMWEGSSVVMLS+ EQ+FLEAS+AYV+G P+MSDKEFD+LK+KLKM+GS+
Sbjct  107  NEEFDNLKEELMWEGSSVVMLSSSEQKFLEASIAYVSGKPLMSDKEFDELKLKLKMEGSE  166

Query  583  IV  588
            IV
Sbjct  167  IV  168



>ref|XP_003549873.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Glycine 
max]
Length=332

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 144/182 (79%), Gaps = 5/182 (3%)
 Frame = +1

Query  58   ATKLVYSLTTPRFLHASFK--RPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPK  231
            A+KL ++LT PR   A         S+ S+S  SAS +  I F GR + +RRR  +L PK
Sbjct  4    ASKLAFTLTPPRPCTAPLTPISSLSSSSSSSSASASGINFIQFNGRHLCLRRRLFLLSPK  63

Query  232  ATTDQPGQVQE---DEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMS  402
            AT DQ G+V+E   D   VDS +LPYCSID+KEKKS+GE+EQ+FLQALQAFYYEGKAIMS
Sbjct  64   ATADQQGKVEEFEDDSNVVDSKILPYCSIDKKEKKSIGELEQEFLQALQAFYYEGKAIMS  123

Query  403  NEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSD  582
            NEEFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PIMSDKEFD+LK++LK +GS+
Sbjct  124  NEEFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGNPIMSDKEFDELKLRLKKEGSE  183

Query  583  IV  588
            IV
Sbjct  184  IV  185



>gb|KHN09744.1| PGR5-like protein 1A, chloroplastic [Glycine soja]
Length=333

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 144/183 (79%), Gaps = 6/183 (3%)
 Frame = +1

Query  58   ATKLVYSLTTPRFLHASFK---RPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCP  228
            A+KL ++LT PR   A          S+ S+S  SAS +  I F GR + +RRR  +L P
Sbjct  4    ASKLAFTLTPPRPCTAPLTPISSLSSSSSSSSSASASGINFIQFNGRHLCLRRRLFLLSP  63

Query  229  KATTDQPGQVQE---DEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIM  399
            KAT DQ G+V+E   D   VDS +LPYCSID+KEKKS+GE+EQ+FLQALQAFYYEGKAIM
Sbjct  64   KATADQQGKVEEFEDDSNVVDSKILPYCSIDKKEKKSIGELEQEFLQALQAFYYEGKAIM  123

Query  400  SNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGS  579
            SNEEFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PIMSDKEFD+LK++LK +GS
Sbjct  124  SNEEFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGNPIMSDKEFDELKLRLKKEGS  183

Query  580  DIV  588
            +IV
Sbjct  184  EIV  186



>ref|XP_010433977.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Camelina sativa]
Length=319

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 145/179 (81%), Gaps = 8/179 (4%)
 Frame = +1

Query  55   MATKLV-YSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPK  231
            M++K++ ++L+TPRF   S ++P     +   PS +     +   R IS+RRR L+L  +
Sbjct  1    MSSKMMAFTLSTPRFSSIS-RKPI----NTCSPSRTHSVPHFSHARSISLRRRLLLLPLQ  55

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            A+TDQ GQV  +EV  DS +LPYCSI++ EK+++GE+EQ+FLQA+Q+FYYEGKA+MSNEE
Sbjct  56   ASTDQSGQVGGEEV--DSKILPYCSINKNEKRTIGELEQEFLQAMQSFYYEGKAVMSNEE  113

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI+SD+E+DKLKMKLKMDGS+IV
Sbjct  114  FDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSEIV  172



>emb|CAA19804.1| putative protein [Arabidopsis thaliana]
 emb|CAB79244.1| putative protein [Arabidopsis thaliana]
Length=340

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 142/197 (72%), Gaps = 23/197 (12%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFA-GRKISVRRRFLVLCPK  231
            M +K+++SLT+PR   A  ++P  S   +    +SR      + G+ IS+RRR  +L  K
Sbjct  1    MGSKMLFSLTSPRLFSAVSRKPSSSFSPSPPSPSSRTQWTQLSPGKSISLRRRVFLLPAK  60

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            ATT+Q   V  D V  DSNVLPYCSI++ EKK++GEMEQ+FLQALQ+FYY+GKAIMSNEE
Sbjct  61   ATTEQ--SVGGDNV--DSNVLPYCSINKAEKKTIGEMEQEFLQALQSFYYDGKAIMSNEE  116

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLK--------  567
            FDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI++D+E+DKLK+KLK        
Sbjct  117  FDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKVSIHFLCF  176

Query  568  ----------MDGSDIV  588
                      +DGSDIV
Sbjct  177  SENRHTLIRLIDGSDIV  193



>ref|XP_008238748.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Prunus mume]
Length=320

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 139/178 (78%), Gaps = 4/178 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MATKL ++LT+P   + S +RPF+S  S S    S      F GR++ +RRR LVL  KA
Sbjct  1    MATKLAFTLTSPTPFNPSSQRPFVSVSSPSTRVES----FQFRGRQLCLRRRLLVLPSKA  56

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQ     EDE   D  +L YCSID+K KKSLGE+EQDFLQALQ+FYY+GKAIMSNEEF
Sbjct  57   TADQRQDKVEDEEVFDGKILQYCSIDKKGKKSLGELEQDFLQALQSFYYDGKAIMSNEEF  116

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI++D+EFDKLKM+LK +GSDIV
Sbjct  117  DNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGNPILTDEEFDKLKMRLKTEGSDIV  174



>gb|KCW77643.1| hypothetical protein EUGRSUZ_D01944 [Eucalyptus grandis]
Length=285

 Score =   200 bits (509),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 120/144 (83%), Gaps = 8/144 (6%)
 Frame = +1

Query  178  FAGRKISVRRRFLVLCPKATTDQ-------PGQVQEDEVEVDSNVLPYCSIDRKEKKSLG  336
            F GR++ VR R LV+  KAT DQ         +  E +VE DSNVLPYCSID+KEKKS+G
Sbjct  47   FDGRQLGVRGRVLVIPVKATADQQGKVEEGKVEEGESDVE-DSNVLPYCSIDKKEKKSIG  105

Query  337  EMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAG  516
            E+EQDFLQA+QAFYYEGKA+MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEASMAYV+G
Sbjct  106  ELEQDFLQAMQAFYYEGKAVMSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVSG  165

Query  517  TPIMSDKEFDKLKMKLKMDGSDIV  588
             PIMSD+E+D LK+KLK +GS+IV
Sbjct  166  NPIMSDQEYDDLKLKLKTEGSEIV  189



>ref|XP_010455613.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Camelina sativa]
Length=319

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 144/179 (80%), Gaps = 8/179 (4%)
 Frame = +1

Query  55   MATKLV-YSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPK  231
            M++K++ ++L+ PRF   S ++P     +   PS +     +   R IS+RRR L+L  +
Sbjct  1    MSSKMMAFTLSIPRFSSIS-RKPI----NTCSPSRTHSVPHFSHARSISLRRRLLLLPLQ  55

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            A+TDQ GQV  +EV  DS +LPYCSI++ EK+++GE+EQ+FLQA+Q+FYYEGKAIMSNEE
Sbjct  56   ASTDQSGQVGGEEV--DSKILPYCSINKNEKRTIGELEQEFLQAMQSFYYEGKAIMSNEE  113

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI+SD+E+DKLKMKLKMDGS+IV
Sbjct  114  FDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSEIV  172



>ref|XP_010422149.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Camelina sativa]
Length=319

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 121/134 (90%), Gaps = 2/134 (1%)
 Frame = +1

Query  187  RKISVRRRFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQAL  366
            R IS+RRR L+L  +A+TDQ GQV  +EV  DS +LPYCSI++ EK+++GEMEQ+FLQA+
Sbjct  41   RSISLRRRLLLLPLQASTDQSGQVGGEEV--DSKILPYCSINKNEKRTIGEMEQEFLQAM  98

Query  367  QAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFD  546
            Q+FYYEGKAIMSNEEFDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI+SD+E+D
Sbjct  99   QSFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILSDEEYD  158

Query  547  KLKMKLKMDGSDIV  588
            KLKMKLKMDGS IV
Sbjct  159  KLKMKLKMDGSGIV  172



>ref|XP_010053364.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Eucalyptus grandis]
 gb|KCW77642.1| hypothetical protein EUGRSUZ_D01944 [Eucalyptus grandis]
Length=336

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 120/144 (83%), Gaps = 8/144 (6%)
 Frame = +1

Query  178  FAGRKISVRRRFLVLCPKATTDQ-------PGQVQEDEVEVDSNVLPYCSIDRKEKKSLG  336
            F GR++ VR R LV+  KAT DQ         +  E +VE DSNVLPYCSID+KEKKS+G
Sbjct  47   FDGRQLGVRGRVLVIPVKATADQQGKVEEGKVEEGESDVE-DSNVLPYCSIDKKEKKSIG  105

Query  337  EMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAG  516
            E+EQDFLQA+QAFYYEGKA+MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEASMAYV+G
Sbjct  106  ELEQDFLQAMQAFYYEGKAVMSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVSG  165

Query  517  TPIMSDKEFDKLKMKLKMDGSDIV  588
             PIMSD+E+D LK+KLK +GS+IV
Sbjct  166  NPIMSDQEYDDLKLKLKTEGSEIV  189



>ref|XP_007211199.1| hypothetical protein PRUPE_ppa008744mg [Prunus persica]
 gb|EMJ12398.1| hypothetical protein PRUPE_ppa008744mg [Prunus persica]
Length=321

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 139/178 (78%), Gaps = 4/178 (2%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MATKL ++LT+P   + S +RPF+S  S S    S      F GR++ +RRR LVL  KA
Sbjct  1    MATKLAFTLTSPTPFNPSSQRPFVSVSSPSTRVES----FQFRGRQLCLRRRLLVLPSKA  56

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQ     EDE   D  +L YCSID+K KKSLGE+EQDFLQALQ+FYY+GKAIMSNEEF
Sbjct  57   TADQRQDKVEDEEVFDGKILQYCSIDKKGKKSLGELEQDFLQALQSFYYDGKAIMSNEEF  116

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI++D+E+DKLKM+LK +GSDIV
Sbjct  117  DNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPILTDEEYDKLKMRLKTEGSDIV  174



>ref|XP_009362831.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Pyrus x bretschneideri]
Length=324

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MATKL ++LT+P   + S +RP +S  S S        +          RR  LVL  KA
Sbjct  1    MATKLGFNLTSPTPFNPSIQRPLVSVSSPSSTRVESFQISGRQLCLRLRRRHLLVLPAKA  60

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQ G+V+ D+V VDS +LPYCSID+K KKSLGE+EQDFLQALQ+FYY+GKAIMSNEEF
Sbjct  61   TADQQGKVENDDV-VDSKILPYCSIDKKAKKSLGELEQDFLQALQSFYYDGKAIMSNEEF  119

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI++D+E+D+LK++LK +GSDIV
Sbjct  120  DNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPILTDQEYDELKLRLKTEGSDIV  177



>ref|XP_006290008.1| hypothetical protein CARUB_v10003639mg [Capsella rubella]
 gb|EOA22906.1| hypothetical protein CARUB_v10003639mg [Capsella rubella]
Length=315

 Score =   198 bits (504),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 112/120 (93%), Gaps = 2/120 (2%)
 Frame = +1

Query  229  KATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            +A+TDQ GQV  ++V  DS +LPYCSI++ EK+++GEMEQ+FLQA+Q+FYYEGKA+MSNE
Sbjct  51   QASTDQSGQVGGEDV--DSKILPYCSINKNEKRTIGEMEQEFLQAMQSFYYEGKAVMSNE  108

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQRFLEASMAYV+G PI+SD+E+DKLKMKLKMDGS+IV
Sbjct  109  EFDNLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSEIV  168



>ref|XP_008381938.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Malus domestica]
Length=323

 Score =   197 bits (500),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 138/178 (78%), Gaps = 2/178 (1%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKA  234
            MATKL ++LT+    + S +RPF+S  S+S        +          RRR LVL   A
Sbjct  1    MATKLGFTLTSTTPFNPSIQRPFVSVSSSSSTRVESFQISGRQLCLXLRRRRLLVLPAXA  60

Query  235  TTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            T DQ G+V++D+V VDS +LPYCSID K KKSLGE+EQDFLQALQ+FYY+GKAIMSNEEF
Sbjct  61   TADQQGKVEKDDV-VDSKILPYCSIDXK-KKSLGELEQDFLQALQSFYYDGKAIMSNEEF  118

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI++D+E+D LKM+LK +GSDIV
Sbjct  119  DNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGKPILTDQEYDDLKMRLKTEGSDIV  176



>ref|XP_003559404.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Brachypodium 
distachyon]
Length=318

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +1

Query  202  RRRFLVLCPKAT-TDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFY  378
            R   L+L P+AT      Q QEDEV VDSNVLPYCS+DRKEKK++GEMEQ+FL+ALQ+FY
Sbjct  47   RAALLLLRPRATDQQGQVQQQEDEV-VDSNVLPYCSLDRKEKKTIGEMEQEFLRALQSFY  105

Query  379  YEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKM  558
            Y+ KAIMSNEEFDNLKEELMWEGSSVVMLSADEQR LEASMAY+AG PIM+D EFD+LK+
Sbjct  106  YDQKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRLLEASMAYIAGNPIMTDAEFDQLKL  165

Query  559  KLKMDGSDIV  588
            +LK DGSDIV
Sbjct  166  RLKQDGSDIV  175



>gb|KEH31685.1| PGR5-like protein 1A [Medicago truncatula]
Length=319

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 136/180 (76%), Gaps = 10/180 (6%)
 Frame = +1

Query  58   ATKLVYSLTTPRFLHASFKRPFIsapsaslpsasrlplIYFAGRKISVRRRFLVLCPKAT  237
            ATK+ ++L  PR   A    PFI    +S+         +   R + +RRR  +L PKAT
Sbjct  4    ATKVAFTLAPPRPCSAP-PTPFIPFSFSSVSPP------HLNSRHLCLRRRLFLLSPKAT  56

Query  238  TDQPGQVQE--DEVEVDSNVLPYCSID-RKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
             DQ G V +   +  +D+NVLPYCSID +KEKKS+GE+EQ+FLQALQ+FYYEGKAIMSNE
Sbjct  57   ADQQGNVGDFDGDAVIDTNVLPYCSIDQKKEKKSVGELEQEFLQALQSFYYEGKAIMSNE  116

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQ+FLEASMAYV+G PI++DKE+DKLK+ LK +GS+IV
Sbjct  117  EFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGNPILTDKEYDKLKLNLKREGSEIV  176



>ref|XP_006477587.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Citrus sinensis]
Length=315

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 106/113 (94%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  GQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKE  429
            GQV+ DEV VDS +L YCSID+KEKKSLGE+EQ+FLQALQAFYYEGKA+MSNEEFDNLKE
Sbjct  57   GQVEGDEV-VDSKILQYCSIDKKEKKSLGELEQEFLQALQAFYYEGKAVMSNEEFDNLKE  115

Query  430  ELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            ELMWEGSSVVMLS+ EQ+FLEASMAYVAG PIMSD+E+DKLK KLKM+GS+IV
Sbjct  116  ELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEGSEIV  168



>ref|XP_008652279.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Zea mays]
 tpg|DAA60327.1| TPA: hypothetical protein ZEAMMB73_572664 [Zea mays]
Length=329

 Score =   191 bits (486),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 106/117 (91%), Gaps = 4/117 (3%)
 Frame = +1

Query  250  GQVQEDEVE----VDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFD  417
            G+VQ+ E E    VDSN+LPYCSI+RKEKKS+GEMEQ+FLQA+QAFYYEGKAIMSNEEFD
Sbjct  65   GEVQQQEAEADQVVDSNMLPYCSINRKEKKSIGEMEQEFLQAMQAFYYEGKAIMSNEEFD  124

Query  418  NLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            NLKEELMWEGSSVVMLS DEQ+ LEA+MAYV+G PIM+D EFD+LK++LK +GSDIV
Sbjct  125  NLKEELMWEGSSVVMLSPDEQKLLEAAMAYVSGNPIMTDDEFDQLKLRLKKEGSDIV  181



>ref|XP_009389075.1| PREDICTED: PGR5-like protein 1B, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 108/120 (90%), Gaps = 1/120 (1%)
 Frame = +1

Query  229  KATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            +AT DQ GQVQ+DE+ VD  +L YCSID+K+KK+LGE+EQ+FLQALQ+FYY+ KAIMSNE
Sbjct  55   RATADQQGQVQDDEI-VDGKILQYCSIDKKDKKTLGELEQEFLQALQSFYYDKKAIMSNE  113

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS DEQ+ LEASMAYV+G PIM+D EFD+LK++LK +GSDIV
Sbjct  114  EFDNLKEELMWEGSSVVMLSPDEQKLLEASMAYVSGNPIMTDAEFDELKLRLKKEGSDIV  173



>ref|NP_001190702.1| PGR5-like protein 1B [Arabidopsis thaliana]
 gb|AEE83075.1| PGR5-like protein 1B [Arabidopsis thaliana]
Length=296

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = +1

Query  274  EVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSS  453
            EVDS +LPYCSI++ EK+++GEMEQ+FLQA+Q+FYYEGKAIMSNEEFDNLKEELMWEGSS
Sbjct  45   EVDSKILPYCSINKNEKRTIGEMEQEFLQAMQSFYYEGKAIMSNEEFDNLKEELMWEGSS  104

Query  454  VVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            VVMLS+DEQRFLEASMAYV+G PI+SD+E+DKLKMKLKMDGS+IV
Sbjct  105  VVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSEIV  149



>ref|NP_001141772.2| hypothetical protein [Zea mays]
 ref|XP_008668009.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF85350.1| unknown [Zea mays]
 gb|ACF87023.2| unknown [Zea mays]
 tpg|DAA52579.1| TPA: hypothetical protein ZEAMMB73_712670 [Zea mays]
 tpg|DAA52580.1| TPA: hypothetical protein ZEAMMB73_712670 [Zea mays]
 tpg|DAA52581.1| TPA: hypothetical protein ZEAMMB73_712670 [Zea mays]
 tpg|DAA52582.1| TPA: hypothetical protein ZEAMMB73_712670 [Zea mays]
Length=322

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 3/119 (3%)
 Frame = +1

Query  238  TDQPGQVQE--DEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            T+Q GQVQE  DEV VD N+LPYCSIDRK+KK+LGEMEQ+FLQALQAFYY+ KAIMSNEE
Sbjct  59   TEQQGQVQEQDDEV-VDRNILPYCSIDRKQKKTLGEMEQEFLQALQAFYYDQKAIMSNEE  117

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVML+ DEQ+ LEAS+AY +G PIMSD EFD+LK++LK DGS IV
Sbjct  118  FDNLKEELMWEGSSVVMLNEDEQKLLEASLAYTSGNPIMSDAEFDELKLRLKTDGSVIV  176



>gb|KHG00657.1| PGR5-like protein 1A, chloroplastic [Gossypium arboreum]
Length=301

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 105/113 (93%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  GQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKE  429
             +V+ED V VDS +LPYCSID+K+KKSLGEMEQ+FLQALQAFYYEGKAIMSNEEFDNLKE
Sbjct  22   NKVEEDNV-VDSKILPYCSIDKKKKKSLGEMEQEFLQALQAFYYEGKAIMSNEEFDNLKE  80

Query  430  ELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EL WEGSSVVMLS+DEQ+FLEASMAYV G P++SD+EFD LK++LK++GS+IV
Sbjct  81   ELTWEGSSVVMLSSDEQKFLEASMAYVYGKPVLSDEEFDDLKLRLKIEGSEIV  133



>ref|XP_003557298.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Brachypodium 
distachyon]
 ref|XP_010228160.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Brachypodium 
distachyon]
Length=322

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +1

Query  232  ATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEE  411
            A  ++ G++Q ++  VDSNVLPYC++DRKEKKS+GEMEQ+FLQALQ+FYY+ KAIMSNEE
Sbjct  60   AEAERQGRMQREDDVVDSNVLPYCNLDRKEKKSIGEMEQEFLQALQSFYYDKKAIMSNEE  119

Query  412  FDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            FDNLKEELMWEGSSVVMLS DEQR LEASMAYVAG PIM+D EFD+LK++LK +GS+IV
Sbjct  120  FDNLKEELMWEGSSVVMLSPDEQRLLEASMAYVAGKPIMTDIEFDELKLRLKKEGSEIV  178



>ref|XP_008776921.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Phoenix dactylifera]
Length=324

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 104/117 (89%), Gaps = 2/117 (2%)
 Frame = +1

Query  241  DQPGQVQEDEVEVDSNVLPYCSIDRK-EKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFD  417
            DQ GQVQ+DEV VDS +LPYCS+DRK EKK+LGE+EQ+FLQALQ+FYYE KAIMSNEEFD
Sbjct  62   DQQGQVQDDEV-VDSKILPYCSVDRKAEKKTLGELEQEFLQALQSFYYEKKAIMSNEEFD  120

Query  418  NLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            NLKEELMWEGSSVVMLS DEQ+ LEASMAY AG PIM+D EFD+LK +L+ +GS IV
Sbjct  121  NLKEELMWEGSSVVMLSPDEQKLLEASMAYAAGKPIMTDAEFDELKARLRKEGSSIV  177



>gb|EEC83915.1| hypothetical protein OsI_29970 [Oryza sativa Indica Group]
Length=326

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = +1

Query  259  QEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELM  438
             ED V VDSNVLPYCSI+RKEKK++GEMEQ+FLQALQAFYY+ KA+MSNEEFDNLKEELM
Sbjct  66   NEDGV-VDSNVLPYCSINRKEKKTIGEMEQEFLQALQAFYYDKKAVMSNEEFDNLKEELM  124

Query  439  WEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            WEGSSVVMLS DEQR LEASMAYVAG PIM+D EFD+LK++L+ +GS+IV
Sbjct  125  WEGSSVVMLSPDEQRLLEASMAYVAGNPIMTDAEFDELKLRLRKEGSEIV  174



>gb|EEE69030.1| hypothetical protein OsJ_28011 [Oryza sativa Japonica Group]
Length=334

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = +1

Query  259  QEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELM  438
             ED V VDSNVLPYCSI+RKEKK++GEMEQ+FLQALQAFYY+ KA+MSNEEFDNLKEELM
Sbjct  74   NEDGV-VDSNVLPYCSINRKEKKTIGEMEQEFLQALQAFYYDKKAVMSNEEFDNLKEELM  132

Query  439  WEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            WEGSSVVMLS DEQR LEASMAYVAG PIM+D EFD+LK++L+ +GS+IV
Sbjct  133  WEGSSVVMLSPDEQRLLEASMAYVAGNPIMTDAEFDELKLRLRKEGSEIV  182



>ref|NP_001062297.1| Os08g0526300 [Oryza sativa Japonica Group]
 dbj|BAD08743.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD11572.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24211.1| Os08g0526300 [Oryza sativa Japonica Group]
Length=329

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = +1

Query  259  QEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELM  438
             ED V VDSNVLPYCSI+RKEKK++GEMEQ+FLQALQAFYY+ KA+MSNEEFDNLKEELM
Sbjct  74   NEDGV-VDSNVLPYCSINRKEKKTIGEMEQEFLQALQAFYYDKKAVMSNEEFDNLKEELM  132

Query  439  WEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            WEGSSVVMLS DEQR LEASMAYVAG PIM+D EFD+LK++L+ +GS+IV
Sbjct  133  WEGSSVVMLSPDEQRLLEASMAYVAGNPIMTDAEFDELKLRLRKEGSEIV  182



>ref|XP_009398865.1| PREDICTED: PGR5-like protein 1B, chloroplastic, partial [Musa 
acuminata subsp. malaccensis]
Length=264

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = +1

Query  250  GQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKE  429
            G+   DEV +DS +LPYCSID+K+KK+LGE+EQ+FLQALQAFYYE KAIMSNEEFDNLKE
Sbjct  6    GEAPSDEV-IDSKILPYCSIDKKDKKTLGELEQEFLQALQAFYYEKKAIMSNEEFDNLKE  64

Query  430  ELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            ELMWEGSSVVMLS DEQ+FLEASMAYV+G PI++D EFD+LK++LK +GS IV
Sbjct  65   ELMWEGSSVVMLSPDEQKFLEASMAYVSGNPILTDAEFDELKLRLKKEGSSIV  117



>ref|XP_004980979.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Setaria 
italica]
Length=308

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  VDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSV  456
            VDSNVLPYCSIDRK+KK++GEMEQ+FLQALQ+FYY+ KAIMSNEEFDNLKEELMWEGSSV
Sbjct  60   VDSNVLPYCSIDRKQKKTMGEMEQEFLQALQSFYYDQKAIMSNEEFDNLKEELMWEGSSV  119

Query  457  VMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            VMLS DEQ+ LEASMAY +G PIMSD EFD+LK+KLK DGS IV
Sbjct  120  VMLSPDEQKLLEASMAYASGNPIMSDAEFDELKLKLKKDGSVIV  163



>gb|EMT22967.1| hypothetical protein F775_30979 [Aegilops tauschii]
Length=331

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  DSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVV  459
            D NVLPYCSID K+KK++GEMEQ+FL+ALQ+FYY+ KAIMSNEEFDNLKEELMWEGSSVV
Sbjct  79   DGNVLPYCSIDGKKKKTIGEMEQEFLRALQSFYYDQKAIMSNEEFDNLKEELMWEGSSVV  138

Query  460  MLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            MLSADEQR LEASMAY+AG PIMSD EFD+LK++LK DGSDIV
Sbjct  139  MLSADEQRLLEASMAYIAGNPIMSDAEFDELKLRLKQDGSDIV  181



>ref|XP_010934076.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Elaeis guineensis]
 ref|XP_010934077.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Elaeis guineensis]
Length=326

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +1

Query  238  TDQPGQVQEDEVEVDSNVLPYCSIDRK-EKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TDQ GQVQ DEV VDS +LPYCSID+K EKK+LGE+EQ+FLQALQ+FYYE KAIMSNEEF
Sbjct  63   TDQQGQVQGDEV-VDSKILPYCSIDKKAEKKTLGELEQEFLQALQSFYYEKKAIMSNEEF  121

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS DEQ+ LEASMAY +G  IM+D EFD+LK +L+ +GSDIV
Sbjct  122  DNLKEELMWEGSSVVMLSPDEQKLLEASMAYASGKSIMTDAEFDELKSRLRKEGSDIV  179



>ref|XP_010918997.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Elaeis guineensis]
Length=324

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 2/118 (2%)
 Frame = +1

Query  238  TDQPGQVQEDEVEVDSNVLPYCSIDRK-EKKSLGEMEQDFLQALQAFYYEGKAIMSNEEF  414
            TDQ GQ+Q+DE+ VDS +LPYCSID+K EKK+LGE+EQ+FLQALQ+FYYE KAIMSNEEF
Sbjct  61   TDQQGQLQDDEI-VDSKILPYCSIDKKAEKKTLGELEQEFLQALQSFYYEKKAIMSNEEF  119

Query  415  DNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            DNLKEELMWEGSSVVMLS DEQ+ LEASMAY AG  IM+D EFD+LK +L+ +GS IV
Sbjct  120  DNLKEELMWEGSSVVMLSPDEQKLLEASMAYAAGKSIMTDAEFDELKARLRKEGSSIV  177



>gb|AFK39966.1| unknown [Lotus japonicus]
Length=309

 Score =   180 bits (456),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 135/181 (75%), Gaps = 22/181 (12%)
 Frame = +1

Query  55   MATKLVYSLTTPRFLHASFKRPFIsapsaslpsas-rlplIYFAGRK--ISVRRRFLVLC  225
            MA+KL  +LT        ++RPF +    +   ++ R  L+ F GR+     RRR L+L 
Sbjct  1    MASKLASTLT--------YQRPFTATTQPTSSISTPRAHLVQFNGRRNVCLRRRRLLLLS  52

Query  226  PKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSN  405
            PKA+ DQ G+V++D V+         SI  KEKKS+GE+EQDFLQALQAFYYEGKAIMSN
Sbjct  53   PKASADQQGKVEKDAVD---------SI--KEKKSIGELEQDFLQALQAFYYEGKAIMSN  101

Query  406  EEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDI  585
            EEFDNLKEELMWEGSSVVMLS+DEQ+FLEA+M YV+G PIMSDKE+D+LK++LKM+GS+I
Sbjct  102  EEFDNLKEELMWEGSSVVMLSSDEQKFLEAAMGYVSGKPIMSDKEYDELKLRLKMEGSEI  161

Query  586  V  588
            V
Sbjct  162  V  162



>ref|XP_006828898.1| hypothetical protein AMTR_s00001p00191890 [Amborella trichopoda]
 gb|ERM96314.1| hypothetical protein AMTR_s00001p00191890 [Amborella trichopoda]
Length=353

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +1

Query  229  KATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            +AT  + GQV+E E   D N+LPYCSID K KK+LGE+E +FLQALQ+FYY+ KAIM+NE
Sbjct  91   RATDQKEGQVKEGEAS-DDNILPYCSIDNKRKKTLGELESEFLQALQSFYYDKKAIMTNE  149

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EFDNLKEELMWEGSSVVMLS+DEQ+ LEASMAYVAG PI+SD EFD+LK++LK +GS IV
Sbjct  150  EFDNLKEELMWEGSSVVMLSSDEQKLLEASMAYVAGKPILSDAEFDQLKLRLKQEGSKIV  209



>ref|XP_006660041.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Oryza brachyantha]
Length=334

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +1

Query  283  SNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVM  462
            +NVLPYCSI+RKEKK++GEMEQ+FLQALQAFYY+ KA+MSNEEFDNLKEELMWEGSSVVM
Sbjct  86   TNVLPYCSINRKEKKTIGEMEQEFLQALQAFYYDKKAVMSNEEFDNLKEELMWEGSSVVM  145

Query  463  LSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            LS DEQR LEASMAYVAG PIM+D EFD+LK++L+ +GS+IV
Sbjct  146  LSPDEQRLLEASMAYVAGNPIMTDAEFDELKLRLRKEGSEIV  187



>ref|XP_008783584.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Phoenix dactylifera]
Length=352

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 2/117 (2%)
 Frame = +1

Query  241  DQPGQVQEDEVEVDSNVLPYCSIDRK-EKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFD  417
            DQ GQVQ+ EV +DS +LPYCS+D+K EKK+LGE+EQ+FL+ALQ+FYY+ KAIMSNEEFD
Sbjct  90   DQQGQVQDGEV-IDSKILPYCSLDKKAEKKTLGELEQEFLEALQSFYYDKKAIMSNEEFD  148

Query  418  NLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            NLKEELMWEGSSVVMLS DEQ+ LEASMAY AG PIM+D EFDKLK +L+ +GS IV
Sbjct  149  NLKEELMWEGSSVVMLSPDEQKLLEASMAYAAGNPIMTDAEFDKLKSRLRKEGSGIV  205



>gb|EEC76574.1| hypothetical protein OsI_14406 [Oryza sativa Indica Group]
 gb|EEC76575.1| hypothetical protein OsI_14407 [Oryza sativa Indica Group]
 gb|EEE60337.1| hypothetical protein OsJ_13437 [Oryza sativa Japonica Group]
Length=322

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 95/108 (88%), Gaps = 4/108 (4%)
 Frame = +1

Query  277  VDSNVLPYCSIDRK----EKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWE  444
            VDSNVL YCSID K    EK+SLGEMEQ+FLQALQAFYY+ KAIMSNEEFDNLKEELMWE
Sbjct  70   VDSNVLQYCSIDGKGKKAEKRSLGEMEQEFLQALQAFYYDQKAIMSNEEFDNLKEELMWE  129

Query  445  GSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            GSSVVMLS DEQR LEASMAY AG PIMSD EFD+LK++LK DGSDIV
Sbjct  130  GSSVVMLSPDEQRLLEASMAYAAGNPIMSDAEFDQLKLRLKKDGSDIV  177



>ref|NP_001051955.1| Os03g0857400 [Oryza sativa Japonica Group]
 gb|AAP21396.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99994.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13869.1| Os03g0857400 [Oryza sativa Japonica Group]
 dbj|BAG93829.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 95/108 (88%), Gaps = 4/108 (4%)
 Frame = +1

Query  277  VDSNVLPYCSIDRK----EKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWE  444
            VDSNVL YCSID K    EK+SLGEMEQ+FLQALQAFYY+ KAIMSNEEFDNLKEELMWE
Sbjct  72   VDSNVLQYCSIDGKGKKAEKRSLGEMEQEFLQALQAFYYDQKAIMSNEEFDNLKEELMWE  131

Query  445  GSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            GSSVVMLS DEQR LEASMAY AG PIMSD EFD+LK++LK DGSDIV
Sbjct  132  GSSVVMLSPDEQRLLEASMAYAAGNPIMSDAEFDQLKLRLKKDGSDIV  179



>ref|XP_006652042.1| PREDICTED: PGR5-like protein 1A, chloroplastic-like [Oryza brachyantha]
Length=296

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  253  QVQEDEVEVDSNVLPYCSID-RKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKE  429
            Q Q+DEV VDSNVL YCSID +K+K++LGEMEQ+FLQALQAFYY+ KAIMSNEEFDNLKE
Sbjct  42   QQQQDEV-VDSNVLQYCSIDGKKQKRTLGEMEQEFLQALQAFYYDQKAIMSNEEFDNLKE  100

Query  430  ELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            ELMWEGS+VVMLS DEQR LEASMAY AG PIMSD EFD LK+KLK DGS IV
Sbjct  101  ELMWEGSTVVMLSPDEQRLLEASMAYAAGNPIMSDAEFDDLKLKLKKDGSGIV  153



>ref|XP_001772047.1| predicted protein [Physcomitrella patens]
 gb|EDQ63128.1| predicted protein [Physcomitrella patens]
Length=287

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +1

Query  250  GQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKE  429
            G     + EVD  VLPYC I++K+KK+LGEMEQDFL+ALQ+FY++ K IMSNEEFD LKE
Sbjct  7    GNDPGSDSEVDDKVLPYCDINKKQKKTLGEMEQDFLEALQSFYFDSKPIMSNEEFDLLKE  66

Query  430  ELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            EL WEGSSVV+LS+DEQRFLEAS++Y AG PI+SD+ FD+LK+KLK  GS + 
Sbjct  67   ELTWEGSSVVILSSDEQRFLEASLSYAAGKPILSDQAFDELKLKLKQKGSKVA  119



>gb|ABK25031.1| unknown [Picea sitchensis]
Length=350

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = +1

Query  256  VQEDEVEVDSNVLPYCSIDRK-EKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEE  432
            V+E+E+ VD+N+LPYCSID+K EK++LGE+EQDFL+ALQ+FY+E K+ M+NEEFD+LKEE
Sbjct  76   VKEEEI-VDNNILPYCSIDKKSEKRTLGELEQDFLEALQSFYFEKKSTMTNEEFDHLKEE  134

Query  433  LMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDI  585
            LMWEGSSVVMLS DEQ+F+EAS+AY  G PIM+D E+D LK +LK   S +
Sbjct  135  LMWEGSSVVMLSPDEQKFMEASLAYAVGKPIMTDAEYDDLKFRLKKASSKV  185



>ref|XP_004956010.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like [Setaria 
italica]
Length=230

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +1

Query  340  MEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGT  519
            MEQ+FLQA+QAFYYE KA+MSNEEFDNLKEELMWEGSSVVMLS DEQR LEASMAYV+G 
Sbjct  1    MEQEFLQAMQAFYYERKAVMSNEEFDNLKEELMWEGSSVVMLSPDEQRLLEASMAYVSGN  60

Query  520  PIMSDKEFDKLKMKLKMDGSDIV  588
            PIM+D EFD+LK+KLK +GS+IV
Sbjct  61   PIMTDAEFDELKLKLKKEGSNIV  83



>gb|EMS46577.1| hypothetical protein TRIUR3_31517 [Triticum urartu]
Length=408

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +1

Query  340  MEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGT  519
            MEQ+FL+ALQ+FYY+ KAIMSNEEFDNLKEELMWEGSSVVMLSADEQR LEASMAY+AG 
Sbjct  1    MEQEFLRALQSFYYDQKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRLLEASMAYIAGN  60

Query  520  PIMSDKEFDKLKMKLKMDGSDIV  588
            PIMSD EFD+LK++LK DGSDIV
Sbjct  61   PIMSDAEFDELKLRLKQDGSDIV  83



>ref|XP_002964064.1| hypothetical protein SELMODRAFT_66389, partial [Selaginella moellendorffii]
 gb|EFJ34397.1| hypothetical protein SELMODRAFT_66389, partial [Selaginella moellendorffii]
Length=250

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = +1

Query  280  DSNVLPYCSIDRKEKK-SLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSV  456
            D+ +LPYCSID+K+ K S+GE+EQ+FLQALQ+FYY+ K +M+NEEFDNLKEEL+WEGS+V
Sbjct  1    DNKILPYCSIDKKKDKKSVGELEQEFLQALQSFYYDKKPMMTNEEFDNLKEELLWEGSNV  60

Query  457  VMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMD  573
            V+LS DEQRF+EAS+AY AG  +MSD+E+D+LK+KLK +
Sbjct  61   VILSPDEQRFMEASLAYAAGKRLMSDEEYDRLKLKLKSN  99



>ref|XP_005650025.1| hypothetical protein COCSUDRAFT_28046 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25481.1| hypothetical protein COCSUDRAFT_28046 [Coccomyxa subellipsoidea 
C-169]
Length=349

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 83/109 (76%), Gaps = 5/109 (5%)
 Frame = +1

Query  277  VDSNVLPYCSIDR-----KEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMW  441
            VD N+L YC++D+     + KKSLGE EQDFL+AL+AFYYE    MSNEEFDNLKEEL+W
Sbjct  78   VDENILDYCTLDKTGARPRSKKSLGEKEQDFLEALRAFYYEEAPTMSNEEFDNLKEELLW  137

Query  442  EGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
             GS V +LS+ EQRFLEAS+A+ AG  I+SD+E+D LK +L+   S +V
Sbjct  138  AGSKVAILSSTEQRFLEASLAFQAGKSIVSDEEYDSLKDQLRKKNSKVV  186



>tpg|DAA52585.1| TPA: hypothetical protein ZEAMMB73_384055 [Zea mays]
Length=221

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 82/114 (72%), Gaps = 4/114 (4%)
 Frame = +1

Query  232  ATTDQPGQVQE--DEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSN  405
            A++  P QVQE  DEV VD N+LPYCSIDRK+KK+LGEMEQ+FLQALQAFYY+ KAIMSN
Sbjct  3    ASSIPPCQVQEQDDEV-VDRNILPYCSIDRKQKKTLGEMEQEFLQALQAFYYDQKAIMSN  61

Query  406  EEFDNLKEELMWEGSSVVMLSADEQRFL-EASMAYVAGTPIMSDKEFDKLKMKL  564
            EEFDNLKEELMWEGSSVV+        + E     +    + SD   D +KM L
Sbjct  62   EEFDNLKEELMWEGSSVVIAKQTNSVIVKEGPRCSLRSHKVYSDLNVDYIKMFL  115



>ref|XP_002975457.1| hypothetical protein SELMODRAFT_232511 [Selaginella moellendorffii]
 gb|EFJ23658.1| hypothetical protein SELMODRAFT_232511 [Selaginella moellendorffii]
Length=323

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 87/102 (85%), Gaps = 2/102 (2%)
 Frame = +1

Query  250  GQVQEDEVEV-DSNVLPYCSIDRKEKK-SLGEMEQDFLQALQAFYYEGKAIMSNEEFDNL  423
             Q   D+ E+ D+ +LPYCSID+K+ K S+GE+EQ+FLQALQ+FYY+ + +M+NEEFDNL
Sbjct  54   NQTAVDQEELSDNKILPYCSIDKKKDKKSVGELEQEFLQALQSFYYDKEPMMTNEEFDNL  113

Query  424  KEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDK  549
            KEEL+WEGS+VV+LS DEQRF+EAS+AY AG  +MSD+E+D+
Sbjct  114  KEELLWEGSNVVILSPDEQRFMEASLAYAAGKRLMSDEEYDR  155



>ref|XP_002951714.1| hypothetical protein VOLCADRAFT_109811 [Volvox carteri f. nagariensis]
 gb|EFJ47165.1| hypothetical protein VOLCADRAFT_109811 [Volvox carteri f. nagariensis]
Length=339

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 4/94 (4%)
 Frame = +1

Query  298  YCSIDRKEKK----SLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVML  465
            YC++D K KK    SLGEMEQDFL A+ A+YYEGK  MS+EEF+ LK+EL+W GS+V +L
Sbjct  64   YCALDDKGKKASKRSLGEMEQDFLAAMTAWYYEGKPTMSDEEFNLLKDELIWSGSTVAVL  123

Query  466  SADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLK  567
            S+DEQRFLEASMAY  G PIMSD+E+D LK +L+
Sbjct  124  SSDEQRFLEASMAYAKGKPIMSDEEYDLLKAELR  157



>ref|XP_001692513.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03991.1| predicted protein [Chlamydomonas reinhardtii]
Length=333

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 82/109 (75%), Gaps = 4/109 (4%)
 Frame = +1

Query  250  GQVQEDEVEVDSNVLPYCSID---RKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDN  420
            G + EDE  + +    YC+ID   +K K+SLGEMEQ+FL A+ ++YYEGK  MS+EEF  
Sbjct  47   GYISEDE-GLGNVAADYCAIDGAGKKAKRSLGEMEQEFLAAMTSWYYEGKPTMSDEEFSL  105

Query  421  LKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLK  567
            LKEEL+W GS V +LS+DEQRFLEASMAY  G PIM+D+++D LK +L+
Sbjct  106  LKEELIWSGSMVAVLSSDEQRFLEASMAYAKGKPIMTDEDYDALKAELR  154



>ref|XP_005850458.1| hypothetical protein CHLNCDRAFT_34513 [Chlorella variabilis]
 gb|EFN58356.1| hypothetical protein CHLNCDRAFT_34513 [Chlorella variabilis]
Length=305

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = +1

Query  280  DSNVLPYCSIDRKEKK----SLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEG  447
            D+N+  +CS+D   K+    +LGE EQ FL+AL AFYY+G+  +++EEFD LK+EL+W G
Sbjct  48   DANINQFCSLDADGKRIAPMTLGEKEQVFLEALSAFYYDGRPAITDEEFDMLKDELVWSG  107

Query  448  SSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            S V +LS DEQRFLEA ++Y  G P+MSD +FD LK+KL+  GS I 
Sbjct  108  SKVAVLSTDEQRFLEAQISYNKGKPVMSDTDFDALKLKLRQSGSIIT  154



>ref|XP_005707770.1| hypothetical protein Gasu_14910 [Galdieria sulphuraria]
 gb|EME31250.1| hypothetical protein Gasu_14910 [Galdieria sulphuraria]
Length=346

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 87/123 (71%), Gaps = 6/123 (5%)
 Frame = +1

Query  229  KATTDQPGQVQEDEVEVDSNVLPYCSID----RKEKKSLGEMEQDFLQALQAFYYEGKAI  396
            K++   PG  Q++ + VDSN+L +C++D     K++ +LGE E  F+ A+ + YY G+ I
Sbjct  64   KSSATLPGD-QKEPILVDSNILEFCTVDPNTGEKKEMTLGEKELLFMDAISS-YYRGEPI  121

Query  397  MSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDG  576
            +SN +FD L+EEL W+GS +VMLS DE RFLEA  AY  GTPIMSD+EFD+LK KL+  G
Sbjct  122  LSNNDFDILQEELAWQGSKMVMLSRDELRFLEAYRAYSNGTPIMSDQEFDELKAKLRKSG  181

Query  577  SDI  585
            S I
Sbjct  182  SSI  184



>gb|KDO63647.1| hypothetical protein CISIN_1g019981mg [Citrus sinensis]
Length=211

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +1

Query  397  MSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDG  576
            MSNEEFDNLKEELMWEGSSVVMLS+ EQ+FLEASMAYVAG PIMSD+E+DKLK KLKM+G
Sbjct  1    MSNEEFDNLKEELMWEGSSVVMLSSAEQKFLEASMAYVAGKPIMSDEEYDKLKQKLKMEG  60

Query  577  SDIV  588
            S+IV
Sbjct  61   SEIV  64



>ref|XP_011398911.1| PGR5-like protein 1B, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM26015.1| PGR5-like protein 1B, chloroplastic [Auxenochlorella protothecoides]
Length=549

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 90/134 (67%), Gaps = 8/134 (6%)
 Frame = +1

Query  202  RRRFLVLCPKATTDQPGQVQEDEVEVD---SNVLPYCSID-----RKEKKSLGEMEQDFL  357
            R++  V C +  ++     ++ +V+VD   +NV  +CSID     R  + SLGE EQ FL
Sbjct  243  RKQNDVQCRECKSNITFNAEKRQVDVDDCSTNVNAFCSIDETGARRLTQLSLGEKEQMFL  302

Query  358  QALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDK  537
            +AL +FY+EGK  +S++EFD LKEEL+W GS V +LS+DE RF+EA  AY +G P++SD 
Sbjct  303  EALSSFYFEGKPKLSDQEFDLLKEELLWNGSKVAVLSSDEIRFIEAQKAYRSGKPLLSDD  362

Query  538  EFDKLKMKLKMDGS  579
            EFD L+ +L+ + S
Sbjct  363  EFDALRGRLRRNAS  376


 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 76/107 (71%), Gaps = 5/107 (5%)
 Frame = +1

Query  274  EVDSNVLPYCSID-----RKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELM  438
            +  +NV  +CSID     R  + SLGE EQ FL+AL +FY+EGK  +S++EFD LKEEL+
Sbjct  18   DCSTNVNAFCSIDETGARRLTQLSLGEKEQMFLEALSSFYFEGKPKLSDQEFDLLKEELL  77

Query  439  WEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGS  579
            W GS V +LS+DE RF+EA  AY +G P++SD EFD L+ +L+ + S
Sbjct  78   WNGSKVAVLSSDEIRFIEAQKAYRSGKPLLSDDEFDALRGRLRRNAS  124



>gb|KIY98308.1| PGR5-like protein 1B [Monoraphidium neglectum]
Length=623

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 79/112 (71%), Gaps = 11/112 (10%)
 Frame = +1

Query  262  EDEVEVDSNVLPYCSID------RKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNL  423
            ED +  D     YCSID      ++  +SLGEMEQ+FL A+ A+Y++GKA +S+ EFD L
Sbjct  338  EDHLAAD-----YCSIDSAGKRVKRGTRSLGEMEQEFLDAMSAYYFDGKAAISDAEFDLL  392

Query  424  KEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGS  579
            KEEL+W GS VV+L +DEQRFLEA  ++ +G  IMSD+EFD L+ +L+  GS
Sbjct  393  KEELLWAGSKVVVLDSDEQRFLEAVRSWGSGNAIMSDEEFDALRNELRTKGS  444



>ref|NP_001061513.2| Os08g0310500 [Oryza sativa Japonica Group]
 dbj|BAF23427.2| Os08g0310500 [Oryza sativa Japonica Group]
Length=199

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 3/71 (4%)
 Frame = +1

Query  262  EDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFL--QALQAFYYEGKAIMSNEEFDNLKEEL  435
            ED+V VDSNVLPYCSI+RKEKK++GEM Q+FL  +   AFYY+ KAI+SNE FDNLKEEL
Sbjct  70   EDDV-VDSNVLPYCSINRKEKKTIGEMAQEFLSRRCRPAFYYDKKAIISNEVFDNLKEEL  128

Query  436  MWEGSSVVMLS  468
            MWEGSSVVML+
Sbjct  129  MWEGSSVVMLT  139



>gb|AAQ56392.1| hypothetical protein OSJNBa0003M24.11 [Oryza sativa Japonica 
Group]
 dbj|BAC92661.1| hypothetical protein [Oryza sativa Japonica Group]
Length=176

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 3/74 (4%)
 Frame = +1

Query  262  EDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFL--QALQAFYYEGKAIMSNEEFDNLKEEL  435
            ED+V VDSNVLPYCSI+RKEKK++GEM Q+FL  +   AFYY+ KAI+SNE FDNLKEEL
Sbjct  70   EDDV-VDSNVLPYCSINRKEKKTIGEMAQEFLSRRCRPAFYYDKKAIISNEVFDNLKEEL  128

Query  436  MWEGSSVVMLSADE  477
            MWEGSSVVML+  E
Sbjct  129  MWEGSSVVMLNDSE  142



>ref|XP_005844699.1| hypothetical protein CHLNCDRAFT_59756 [Chlorella variabilis]
 gb|EFN52597.1| hypothetical protein CHLNCDRAFT_59756 [Chlorella variabilis]
Length=304

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = +1

Query  274  EVDSNVLPYCSIDRKEKK-----SLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELM  438
            EVD N+  YCS+D+  ++     +  E EQ FL+A+ AFYY+ K ++S+ EFDNLK+EL 
Sbjct  43   EVDENIGEYCSLDKDGRRPDHELTTAEKEQLFLEAMAAFYYDEKPVLSDTEFDNLKQELQ  102

Query  439  WEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKL  564
            WEGS VV+L+ +E+R LEA +A+  G PIMSD++++ LK  L
Sbjct  103  WEGSKVVVLTKEEKRLLEAKLAFKKGKPIMSDEQYEALKASL  144



>ref|XP_005719217.1| unnamed protein product [Chondrus crispus]
 emb|CDF39306.1| unnamed protein product [Chondrus crispus]
Length=338

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 87/148 (59%), Gaps = 18/148 (12%)
 Frame = +1

Query  193  ISVRRRFLVLCPKA--------TTDQPGQVQ----EDEVEVDSNVLPYCSIDRKEKK---  327
            IS R R LV+  +A           +P Q +    + EV +D N+  +CSI+ +  K   
Sbjct  54   ISARPRTLVVRQQAPPSLIRMDANGKPSQAETEEPQTEVIIDENIAGFCSINPRTGKRAE  113

Query  328  -SLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMA  504
             S+ E E+ FL A QA Y+ G + +SNEEFD LKEEL W+GS VV LS DE  FL+A+ +
Sbjct  114  LSVREKERVFLDAAQA-YFRGDSTLSNEEFDTLKEELTWQGSDVVTLSRDEFMFLDAAKS  172

Query  505  YVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            Y  G P M ++EFDKLK KL +D   IV
Sbjct  173  YEEGNPTMPNEEFDKLKKKL-IDAGSIV  199



>gb|EAY97101.1| hypothetical protein OsI_19024 [Oryza sativa Indica Group]
Length=176

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 3/74 (4%)
 Frame = +1

Query  262  EDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFL--QALQAFYYEGKAIMSNEEFDNLKEEL  435
            ED+V VDSNVLPY SI+RKEKK++GEM ++FL  +   AFYY+ KA++SNE FDNLKEEL
Sbjct  70   EDDV-VDSNVLPYYSINRKEKKTIGEMAEEFLSRRCRPAFYYDKKAVISNEVFDNLKEEL  128

Query  436  MWEGSSVVMLSADE  477
            MWEGS+VVML+  E
Sbjct  129  MWEGSTVVMLNDSE  142



>ref|XP_005539297.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM83261.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=328

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 79/131 (60%), Gaps = 5/131 (4%)
 Frame = +1

Query  208  RFLVLCPKATTDQPGQVQEDEVEVDSNVLPYCSIDRKEKKS----LGEMEQDFLQALQAF  375
            R +    K T    G V   + + D  +  Y S D +   S    LGE E+ +L+A+ +F
Sbjct  45   RLVAAVEKETEKVQGSVNGSDADADGGLQGYKSTDPRTGASRELSLGEKERLYLEAVYSF  104

Query  376  YYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLK  555
            Y  G+ I+SNEEF+ LKE+L W GS V++++ DEQRFL A+ A+  G PIMSD++FD LK
Sbjct  105  Y-NGEPILSNEEFNVLKEDLQWNGSQVILMNRDEQRFLNAAQAFYNGKPIMSDEDFDALK  163

Query  556  MKLKMDGSDIV  588
             +L+  GS I 
Sbjct  164  DRLRKQGSQIA  174



>ref|XP_002289386.1| hypothetical protein THAPSDRAFT_268713 [Thalassiosira pseudonana 
CCMP1335]
 gb|EED92923.1| hypothetical protein THAPSDRAFT_268713 [Thalassiosira pseudonana 
CCMP1335]
Length=327

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 68/98 (69%), Gaps = 4/98 (4%)
 Frame = +1

Query  298  YCSIDRKEKK----SLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVML  465
            YC +D+   +    ++ E E+ FL ALQ++Y+ G+ ++++ EFD LKE+L W GS VV L
Sbjct  86   YCVVDKASGELVRLTIEEKERIFLDALQSYYFSGRQVLNDAEFDLLKEDLSWNGSPVVNL  145

Query  466  SADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGS  579
            +  E ++L A  AY+ G+P +SD+EFD+LK +LK +GS
Sbjct  146  NRKEAKYLAAVQAYLKGSPTLSDREFDQLKAELKEEGS  183



>ref|XP_002177079.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51542.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=326

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 85/154 (55%), Gaps = 22/154 (14%)
 Frame = +1

Query  181  AGRKISVRRRF---------LVLCPKATT-----DQPGQVQEDEVEVDSNVLP---YCSI  309
            A  KIS+ R F         L L P A       +  G+  E ++  D++ +P   +C  
Sbjct  30   APPKISITRVFMSEEKEKEDLTLVPSARKQIAFDEAKGRFFETDIS-DADCIPDEEFCIT  88

Query  310  DRKE----KKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADE  477
            D       + ++ E E+ FL ALQ++Y  G+ ++S++EFD LKE+L W GS +V+++  E
Sbjct  89   DNDSGSMIRLTIEEKERIFLDALQSYYNSGRKMLSDDEFDLLKEDLTWNGSPMVVMNRKE  148

Query  478  QRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGS  579
              +L A  AY+ G PIMSD EFD LK  LK +GS
Sbjct  149  AAYLNAMQAYLKGDPIMSDSEFDSLKQDLKDEGS  182



>ref|XP_007508174.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20665.1| predicted protein [Bathycoccus prasinos]
Length=336

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = +1

Query  232  ATTDQ-PGQVQEDEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNE  408
            +++DQ P +   D+   + +V P CSID  E  SL ++E  ++ AL  +Y +GK  +S+ 
Sbjct  46   SSSDQDPSKSMADDTTPNVSVGPSCSIDEPETCSLADLEILYVDALWNYYNDGKFTLSDG  105

Query  409  EFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLK  567
            ++D ++EEL W+GS    L  DE +F++A+MAY  G  IM D E++ LK K+K
Sbjct  106  QYDRIREELNWQGSGFPTLRRDEIQFVQAAMAYSRGEKIMGDDEYEDLKRKIK  158



>ref|XP_003061604.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54234.1| predicted protein [Micromonas pusilla CCMP1545]
Length=329

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +1

Query  253  QVQEDEVEVDSN--VLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLK  426
               +DE  V  N  V   CSID     SL ++E  ++ AL  FY  G   +S+E++D L+
Sbjct  46   SASQDEAAVSPNASVSLSCSIDDPSSCSLADLEMLYIDALWNFYNGGSFTLSDEQYDRLR  105

Query  427  EELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDG  576
            EEL W+GS    L   E +F+EAS+AY  G P+++D+E++ LK K+K +G
Sbjct  106  EELNWQGSGFPTLRRYEVQFVEASIAYARGEPVVTDEEYEDLKRKVKAEG  155



>gb|EJK45793.1| hypothetical protein THAOC_35578 [Thalassiosira oceanica]
Length=695

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 76/115 (66%), Gaps = 8/115 (7%)
 Frame = +1

Query  241  DQPGQVQEDEVEVDSNVLP---YCSIDRKE----KKSLGEMEQDFLQALQAFYYEGKAIM  399
            +Q G+  E  ++ + + +P   YC +D++     + +L E E+ F+ ALQ++Y  G+ ++
Sbjct  450  EQAGRFFETNIDPE-DCIPDEEYCIVDKETGNYIRLTLEEKERIFMDALQSYYVSGRQLL  508

Query  400  SNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKL  564
            ++ EFD LKE+L W+GSS+V ++  E ++L A  AY+ G PI+SD+EFD LK +L
Sbjct  509  NDAEFDMLKEDLAWQGSSLVNMNRQETKYLAAVQAYLKGEPIVSDEEFDALKTEL  563



>ref|XP_002509148.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70406.1| predicted protein [Micromonas sp. RCC299]
Length=318

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 66/104 (63%), Gaps = 0/104 (0%)
 Frame = +1

Query  265  DEVEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWE  444
            +EV  +++V   CSID     SL ++E  ++ AL  +Y  G   +++E++D L+EEL W+
Sbjct  41   EEVSPNASVSASCSIDDPSSCSLADLEMMYIDALWNYYNGGDFTLTDEQYDRLREELNWQ  100

Query  445  GSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDG  576
            GS    L   E +F+EA+++Y  G P +SDKE+++LK K++  G
Sbjct  101  GSGFPTLRRYEVQFVEAAISYARGEPKVSDKEYEELKRKVRAAG  144



>gb|EJK57224.1| hypothetical protein THAOC_22761 [Thalassiosira oceanica]
Length=321

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = +1

Query  298  YCSIDRKE----KKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVML  465
            +C ID +     + ++ E E+ FL ALQ++Y  G+ IM + EFD LKE+LMW GS +V L
Sbjct  82   FCVIDPENDEPIRLTVEEKERMFLDALQSYYVSGRQIMDDAEFDALKEDLMWNGSELVNL  141

Query  466  SADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            +  E  +LEA   +  G P MSD EFD L+ +L+ D   +V
Sbjct  142  NRREIAYLEAMQGFNKGAPTMSDAEFDALREELR-DAKSVV  181



>ref|XP_005823018.1| hypothetical protein GUITHDRAFT_90093 [Guillardia theta CCMP2712]
 gb|EKX36038.1| hypothetical protein GUITHDRAFT_90093 [Guillardia theta CCMP2712]
Length=253

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +1

Query  322  KKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASM  501
            K +L   E+ +L A  AF+ +GK+I+S+ E+D LK +L +EGS V ++S +E +F+ A+ 
Sbjct  22   KLTLAAKEKLYLDATSAFHNDGKSILSDAEYDKLKSDLAFEGSYVGLMSREEVKFMVAAN  81

Query  502  AYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
             Y  G PIMSD+EFD L+ KLK   S  V
Sbjct  82   RYQEGKPIMSDEEFDSLRRKLKQQNSRAV  110



>emb|CBJ29877.1| conserved unknown protein [Ectocarpus siliculosus]
Length=347

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = +1

Query  298  YCSIDRKEKKSL----GEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVML  465
            YC+ID    K +    GE E+ F  A+Q+FYY  + ++ +++FD LKE+L WEGS VV++
Sbjct  106  YCAIDETTGKPMLLTTGEKERIFTDAIQSFYYNQRQMLDDDDFDKLKEDLAWEGSPVVLM  165

Query  466  SADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGS  579
            + DEQ F+ A  AY  G  I+ D+EFD+LK  L+  GS
Sbjct  166  NRDEQLFMSAMAAYSRGDKIIDDEEFDRLKASLRESGS  203



>ref|XP_005785885.1| hypothetical protein EMIHUDRAFT_441626 [Emiliania huxleyi CCMP1516]
 gb|EOD33456.1| hypothetical protein EMIHUDRAFT_441626 [Emiliania huxleyi CCMP1516]
Length=215

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 65/117 (56%), Gaps = 5/117 (4%)
 Frame = +1

Query  253  QVQEDE-----VEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFD  417
            QVQ++E        D  +L       + +  L E E+ +L  L AFY + K ++ + E++
Sbjct  2    QVQQEEGSSAPSPYDEFLLADVKTGERSRIGLDEKEKLYLDCLDAFYNDEKPVLGDSEYE  61

Query  418  NLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
             LK +L +EGS +   S DE ++L A+  +V G P +SD E+D L+ KLK  GS +V
Sbjct  62   TLKTDLQFEGSRIAAFSKDEIKYLIANKRFVMGKPFLSDSEYDSLRRKLKTAGSPVV  118



>ref|XP_005787281.1| hypothetical protein EMIHUDRAFT_441130 [Emiliania huxleyi CCMP1516]
 gb|EOD34852.1| hypothetical protein EMIHUDRAFT_441130 [Emiliania huxleyi CCMP1516]
Length=266

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 65/117 (56%), Gaps = 5/117 (4%)
 Frame = +1

Query  253  QVQEDE-----VEVDSNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFD  417
            QVQ++E        D  +L       + +  L E E+ +L  L AFY + K ++ + E++
Sbjct  2    QVQQEEGSSAPSPYDEFLLADVKTGERSRIGLDEKEKLYLDCLDAFYNDEKPVLGDSEYE  61

Query  418  NLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
             LK +L +EGS +   S DE ++L A+  +V G P +SD E+D L+ KLK  GS +V
Sbjct  62   TLKTDLQFEGSRIAAFSKDEIKYLIANKRFVMGKPFLSDSEYDSLRRKLKTAGSPVV  118



>ref|XP_005833759.1| hypothetical protein GUITHDRAFT_107552 [Guillardia theta CCMP2712]
 gb|EKX46779.1| hypothetical protein GUITHDRAFT_107552 [Guillardia theta CCMP2712]
Length=195

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +1

Query  328  SLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAY  507
            SL   EQ +L    A+  + ++++S+E+++ LK +L +EGS V+++S +E +F+ A+  Y
Sbjct  2    SLFAKEQLYLDCCAAYNVDAESLLSDEDYEKLKTDLTFEGSQVILMSREEIKFMVAANRY  61

Query  508  VAGTPIMSDKEFDKLKMKLKMDGS  579
              G PIMSD+EFD L+ KLK  GS
Sbjct  62   NKGKPIMSDEEFDTLRKKLKNKGS  85



>ref|XP_001420406.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98699.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=281

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = +1

Query  283  SNVLP----YCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGS  450
            SNV P     CSID     SL ++E  ++ AL  +Y  GK  +S+E++D L+EEL W+GS
Sbjct  6    SNVNPDIGVSCSIDDPSSCSLADLELMYVDALWNYYNGGKFTLSDEDYDRLREELNWQGS  65

Query  451  SVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDG  576
                L   E  F++A+++Y  G  ++ D ++++LK ++K +G
Sbjct  66   GFPTLRRYEIEFVQAAISYSRGESVVDDDKYEELKRRVKAEG  107



>emb|CEF99527.1| unnamed product [Ostreococcus tauri]
Length=325

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 60/98 (61%), Gaps = 0/98 (0%)
 Frame = +1

Query  283  SNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVM  462
            ++V   CSID     SL ++E  ++ AL  +Y  GK  +++E++D L+EEL W+GS    
Sbjct  54   ASVSASCSIDDPASCSLADLELMYVDALWNYYNGGKFTLTDEQYDRLREELNWQGSGFPT  113

Query  463  LSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDG  576
            L   E  F++A+++Y  G  ++ D ++++LK K+K  G
Sbjct  114  LRRYEIEFVQAAISYSRGEAVVDDAKYEELKRKVKAAG  151



>ref|XP_003081836.1| putative heme activated protein (ISS) [Ostreococcus tauri]
Length=651

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 60/98 (61%), Gaps = 0/98 (0%)
 Frame = +1

Query  283  SNVLPYCSIDRKEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVM  462
            ++V   CSID     SL ++E  ++ AL  +Y  GK  +++E++D L+EEL W+GS    
Sbjct  380  ASVSASCSIDDPASCSLADLELMYVDALWNYYNGGKFTLTDEQYDRLREELNWQGSGFPT  439

Query  463  LSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDG  576
            L   E  F++A+++Y  G  ++ D ++++LK K+K  G
Sbjct  440  LRRYEIEFVQAAISYSRGEAVVDDAKYEELKRKVKAAG  477



>ref|XP_002293951.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED88960.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=292

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  352  FLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEASMAYVAGTPIMS  531
            +  +L ++Y  GK ++ N  +D L E L WEGSSV  +SA E +F+    A   G P+M 
Sbjct  191  YFDSLHSYYKTGKPLLDNANYDELHENLTWEGSSVATMSAQEAQFVSTVAASKRGEPLMD  250

Query  532  DKEFDKLKMKLKMDGSDIV  588
            D E+  LK  LK  GS +V
Sbjct  251  DDEYKALKADLKQKGSWVV  269



>ref|XP_008347100.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Malus domestica]
Length=245

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  469  ADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            +DEQ+FLEASMAYV+G PI++D+E+D+LK++LK +GSDIV
Sbjct  59   SDEQKFLEASMAYVSGKPILTDQEYDELKLRLKTEGSDIV  98



>ref|XP_008665769.1| PREDICTED: uncharacterized protein LOC103644336 [Zea mays]
 ref|XP_008665771.1| PREDICTED: uncharacterized protein LOC103644336 [Zea mays]
 ref|XP_008665772.1| PREDICTED: uncharacterized protein LOC103644336 [Zea mays]
Length=396

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  442  EGSSVVMLSADEQRFLEASMAYVAGTPIMSDKEFDKLKMKLKMD  573
             G++  +L+ DEQ+ LEASMAY +G PIMSD EFD+LK+KLK +
Sbjct  203  RGAASSLLNEDEQKLLEASMAYASGNPIMSDAEFDELKLKLKTN  246



>ref|XP_002185714.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65184.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=246

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +1

Query  316  KEKKSLGEMEQDFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSADEQRFLEA  495
            K   SL   E  +  AL  +Y  G  +++N +++ L++ L  EGS VV + A E  F+ A
Sbjct  133  KAAGSLVVKELIYFDALHTYYRAGTPLLNNSDYETLRDNLTGEGSVVVNMKAKETIFVMA  192

Query  496  SMAYVAGTPIMSDKEFDKLKMKLKMDGS  579
              +   G P+M D ++  LK +LK  GS
Sbjct  193  VASSRRGDPVMDDLQYTTLKRELKAQGS  220



>dbj|BAG91915.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG88079.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96816.1| unnamed protein product [Oryza sativa Japonica Group]
Length=177

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  499  MAYVAGTPIMSDKEFDKLKMKLKMDGSDIV  588
            MAYVAG PIM+D EFD+LK++L+ +GS+IV
Sbjct  1    MAYVAGNPIMTDAEFDELKLRLRKEGSEIV  30



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925