BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I08

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006338180.1|  PREDICTED: uncharacterized protein LOC102600519  95.9    2e-19   Solanum tuberosum [potatoes]
ref|XP_009781515.1|  PREDICTED: uncharacterized protein LOC104230414  94.7    4e-19   Nicotiana sylvestris
ref|XP_004239332.1|  PREDICTED: uncharacterized protein LOC101267991  94.7    4e-19   Solanum lycopersicum
ref|XP_009592422.1|  PREDICTED: uncharacterized protein LOC104089279  92.8    2e-18   Nicotiana tomentosiformis
ref|XP_011070605.1|  PREDICTED: uncharacterized protein LOC105156229  85.1    8e-16   Sesamum indicum [beniseed]
ref|XP_002527792.1|  conserved hypothetical protein                   77.0    6e-13   Ricinus communis
ref|XP_010101955.1|  hypothetical protein L484_011972                 74.3    9e-13   
ref|XP_003531149.1|  PREDICTED: uncharacterized protein LOC100795...  68.2    5e-10   Glycine max [soybeans]
gb|KHN46086.1|  Transmembrane protein 214                             67.0    8e-10   Glycine soja [wild soybean]
ref|XP_007225688.1|  hypothetical protein PRUPE_ppa003121mg           67.0    1e-09   
ref|XP_008221426.1|  PREDICTED: uncharacterized protein LOC103321411  66.6    1e-09   Prunus mume [ume]
ref|XP_003524856.1|  PREDICTED: uncharacterized protein LOC100777...  66.2    2e-09   Glycine max [soybeans]
gb|EPS70947.1|  hypothetical protein M569_03811                       65.5    4e-09   Genlisea aurea
ref|XP_006302022.1|  hypothetical protein CARUB_v10020004mg           65.1    4e-09   Capsella rubella
ref|XP_008389199.1|  PREDICTED: uncharacterized protein LOC103451563  65.1    4e-09   
ref|XP_008464702.1|  PREDICTED: uncharacterized protein LOC103502522  64.7    6e-09   Cucumis melo [Oriental melon]
ref|XP_004142274.1|  PREDICTED: uncharacterized protein LOC101205264  64.7    6e-09   Cucumis sativus [cucumbers]
ref|NP_177234.1|  uncharacterized protein                             64.3    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010265344.1|  PREDICTED: transmembrane protein 214-like        63.9    9e-09   Nelumbo nucifera [Indian lotus]
ref|XP_002888794.1|  hypothetical protein ARALYDRAFT_476207           63.9    1e-08   
emb|CDY09481.1|  BnaC02g20230D                                        63.2    2e-08   Brassica napus [oilseed rape]
ref|XP_009351509.1|  PREDICTED: uncharacterized protein LOC103943042  62.8    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_009349518.1|  PREDICTED: uncharacterized protein LOC103941062  62.8    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_007158805.1|  hypothetical protein PHAVU_002G183300g           62.4    3e-08   Phaseolus vulgaris [French bean]
ref|XP_002284658.1|  PREDICTED: uncharacterized protein LOC100264607  62.0    4e-08   Vitis vinifera
emb|CAN67931.1|  hypothetical protein VITISV_007906                   61.6    6e-08   Vitis vinifera
ref|XP_006390841.1|  hypothetical protein EUTSA_v10018292mg           61.6    6e-08   Eutrema salsugineum [saltwater cress]
ref|XP_004297471.1|  PREDICTED: uncharacterized protein LOC101304959  61.2    8e-08   Fragaria vesca subsp. vesca
ref|XP_009127825.1|  PREDICTED: transmembrane protein 214-like        60.8    1e-07   Brassica rapa
emb|CDY03722.1|  BnaA02g15150D                                        60.8    1e-07   
ref|XP_009115558.1|  PREDICTED: uncharacterized protein LOC103840791  60.8    1e-07   Brassica rapa
emb|CDY21420.1|  BnaA09g30070D                                        60.5    1e-07   Brassica napus [oilseed rape]
gb|KJB78162.1|  hypothetical protein B456_012G181300                  60.5    1e-07   Gossypium raimondii
ref|XP_010555138.1|  PREDICTED: uncharacterized protein LOC104824713  60.5    1e-07   
gb|KJB78163.1|  hypothetical protein B456_012G181300                  60.5    1e-07   Gossypium raimondii
ref|XP_006416118.1|  hypothetical protein EUTSA_v10007115mg           60.5    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_006838127.1|  hypothetical protein AMTR_s00106p00069950        60.1    2e-07   Amborella trichopoda
ref|XP_010552700.1|  PREDICTED: uncharacterized protein LOC104823001  59.7    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_007045199.1|  Transmembrane protein 214-A isoform 2            59.3    3e-07   
ref|XP_010274735.1|  PREDICTED: transmembrane protein 214             59.3    3e-07   Nelumbo nucifera [Indian lotus]
ref|XP_007045198.1|  Transmembrane protein 214-A isoform 1            58.9    4e-07   
ref|XP_010415766.1|  PREDICTED: uncharacterized protein LOC104701723  58.9    4e-07   Camelina sativa [gold-of-pleasure]
gb|EYU33132.1|  hypothetical protein MIMGU_mgv1a003637mg              58.9    4e-07   Erythranthe guttata [common monkey flower]
ref|XP_004504570.1|  PREDICTED: uncharacterized protein LOC101509424  58.9    5e-07   Cicer arietinum [garbanzo]
ref|XP_010471078.1|  PREDICTED: uncharacterized protein LOC104750915  58.2    9e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010427867.1|  PREDICTED: uncharacterized protein LOC104712634  57.8    9e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009105745.1|  PREDICTED: transmembrane protein 214-like        57.8    1e-06   Brassica rapa
ref|XP_002890568.1|  hypothetical protein ARALYDRAFT_313192           57.8    1e-06   
emb|CDY11548.1|  BnaC06g31910D                                        57.4    1e-06   Brassica napus [oilseed rape]
emb|CDY11546.1|  BnaC06g31930D                                        57.4    1e-06   Brassica napus [oilseed rape]
emb|CDX96276.1|  BnaA07g28870D                                        57.4    1e-06   
gb|KDO64591.1|  hypothetical protein CISIN_1g007667mg                 57.0    2e-06   Citrus sinensis [apfelsine]
ref|XP_006448218.1|  hypothetical protein CICLE_v10014686mg           57.0    2e-06   Citrus clementina [clementine]
ref|XP_006469208.1|  PREDICTED: uncharacterized protein LOC102617537  57.0    2e-06   Citrus sinensis [apfelsine]
gb|KHG06009.1|  Transmembrane protein                                 57.0    2e-06   Gossypium arboreum [tree cotton]
emb|CDY04741.1|  BnaC05g18480D                                        55.5    6e-06   
gb|KHG06257.1|  Transmembrane protein                                 55.5    6e-06   Gossypium arboreum [tree cotton]
ref|XP_002311510.1|  hypothetical protein POPTR_0008s13110g           54.3    2e-05   
ref|XP_009334426.1|  PREDICTED: uncharacterized protein LOC103927255  54.3    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_010460098.1|  PREDICTED: uncharacterized protein LOC104741034  53.5    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006306980.1|  hypothetical protein CARUB_v10008554mg           53.5    3e-05   
ref|XP_002315874.1|  hypothetical protein POPTR_0010s12060g           53.1    3e-05   
ref|XP_010477606.1|  PREDICTED: uncharacterized protein LOC104756681  52.8    4e-05   Camelina sativa [gold-of-pleasure]
ref|XP_011023730.1|  PREDICTED: uncharacterized protein LOC105125123  52.4    5e-05   Populus euphratica
gb|KFK44407.1|  hypothetical protein AALP_AA1G253100                  52.4    7e-05   Arabis alpina [alpine rockcress]
ref|XP_010498822.1|  PREDICTED: uncharacterized protein LOC104776443  52.4    7e-05   Camelina sativa [gold-of-pleasure]
gb|KFK41505.1|  hypothetical protein AALP_AA2G138500                  51.2    1e-04   Arabis alpina [alpine rockcress]
ref|XP_008381341.1|  PREDICTED: uncharacterized protein LOC103444196  51.2    1e-04   
gb|KJB15411.1|  hypothetical protein B456_002G176900                  51.2    2e-04   Gossypium raimondii
gb|KJB15412.1|  hypothetical protein B456_002G176900                  51.2    2e-04   Gossypium raimondii
gb|KJB15413.1|  hypothetical protein B456_002G176900                  51.2    2e-04   Gossypium raimondii
gb|ABE65646.1|  unknown                                               50.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25773.1|  BnaA07g10090D                                        50.4    2e-04   Brassica napus [oilseed rape]
ref|NP_173730.1|  uncharacterized protein                             50.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAU44392.1|  hypothetical protein AT1G23170                        50.1    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103190.1|  PREDICTED: uncharacterized protein LOC103829284  50.4    3e-04   Brassica rapa
gb|EYU30086.1|  hypothetical protein MIMGU_mgv1a0056372mg             47.0    3e-04   Erythranthe guttata [common monkey flower]
ref|NP_001185070.1|  uncharacterized protein                          50.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAC00602.1|  Unknown protein                                       50.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038613.1|  PREDICTED: uncharacterized protein LOC105135446  49.3    6e-04   Populus euphratica
ref|XP_008343054.1|  PREDICTED: uncharacterized protein LOC103405822  48.9    0.001   



>ref|XP_006338180.1| PREDICTED: uncharacterized protein LOC102600519 [Solanum tuberosum]
Length=583

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 73/100 (73%), Gaps = 8/100 (8%)
 Frame = +3

Query  96   MEDKSMASESTHHI---ESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGV  266
            MEDKS+  ES+H +   +++HGWQKV+Y KK KK QQ    SDS +++ANGS    +SG 
Sbjct  1    MEDKSIPFESSHSVSNNDNNHGWQKVTYVKKQKKKQQ--KLSDSGKVIANGS---AISGA  55

Query  267  DNVFRSLEKQSEERRSRIEAQRAAMFLEDEAPVRSAAKHR  386
            DNV++SLEK S+ERR RI AQ AAM+   +APVRSA KHR
Sbjct  56   DNVYKSLEKHSDERRKRIAAQTAAMYAVGDAPVRSAMKHR  95



>ref|XP_009781515.1| PREDICTED: uncharacterized protein LOC104230414 [Nicotiana sylvestris]
Length=587

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 7/99 (7%)
 Frame = +3

Query  96   MEDKSMASESTH--HIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVD  269
            M +KS+A ES H   I++ HGWQKV+Y+KK KK Q KP  SDS +++ANGSV   V G D
Sbjct  1    MAEKSIAFESNHSGPIDTTHGWQKVTYAKKQKKKQAKP--SDSGKVIANGSV---VPGAD  55

Query  270  NVFRSLEKQSEERRSRIEAQRAAMFLEDEAPVRSAAKHR  386
            NVF+SLEK S+ERR RI  Q AAM+  D+APVR   KHR
Sbjct  56   NVFQSLEKHSDERRKRIAEQTAAMYGVDDAPVRLGLKHR  94



>ref|XP_004239332.1| PREDICTED: uncharacterized protein LOC101267991 [Solanum lycopersicum]
Length=583

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 73/100 (73%), Gaps = 8/100 (8%)
 Frame = +3

Query  96   MEDKSMASESTHHI---ESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGV  266
            MEDKS+  ES+H +   +++HGWQKV+Y KK KK QQ    SDS +++ANGS    +SG 
Sbjct  1    MEDKSIPFESSHSVSNNDNNHGWQKVTYVKKQKKKQQ--KISDSGKVIANGS---AISGA  55

Query  267  DNVFRSLEKQSEERRSRIEAQRAAMFLEDEAPVRSAAKHR  386
            DNV++SLEK S+ERR RI AQ AAM+   +APVRSA KHR
Sbjct  56   DNVYKSLEKHSDERRKRIAAQTAAMYGVGDAPVRSAMKHR  95



>ref|XP_009592422.1| PREDICTED: uncharacterized protein LOC104089279 [Nicotiana tomentosiformis]
Length=582

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 71/100 (71%), Gaps = 8/100 (8%)
 Frame = +3

Query  96   MEDKSMASESTHH---IESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGV  266
            M +KS+A ES H     ++ HGWQKV+Y+KK KK Q KP  SDS +++ANGSV   V GV
Sbjct  1    MAEKSIAFESNHSGPITDNTHGWQKVTYAKKQKKKQAKP--SDSGKVIANGSV---VPGV  55

Query  267  DNVFRSLEKQSEERRSRIEAQRAAMFLEDEAPVRSAAKHR  386
            DNVF+SLEK S+ERR RI AQ AAM+  D+APV    KHR
Sbjct  56   DNVFQSLEKHSDERRKRIAAQTAAMYGVDDAPVILGLKHR  95



>ref|XP_011070605.1| PREDICTED: uncharacterized protein LOC105156229 [Sesamum indicum]
Length=589

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 7/100 (7%)
 Frame = +3

Query  99   EDKS--MASESTHHIE-SDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVD  269
            EDKS  +ASE  +  E ++HGWQKV+Y+KK +K Q K AASDSSR + NGS    +    
Sbjct  3    EDKSFSLASEPINRAEDNNHGWQKVTYAKKQRKTQNKKAASDSSRALPNGS--GILPDKT  60

Query  270  NVFRSLEKQSEERRSRIEAQRAAMFL--EDEAPVRSAAKH  383
             VF+ LEK +EERR ++EAQRAA     EDE P RS   H
Sbjct  61   GVFKGLEKHAEERRRKLEAQRAAAVYDDEDEIPRRSKINH  100



>ref|XP_002527792.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34602.1| conserved hypothetical protein [Ricinus communis]
Length=589

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 103/148 (70%), Gaps = 13/148 (9%)
 Frame = +3

Query  126  THHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVD--NVFRSLEKQS  299
            T++  +DHGWQKV+Y+K+ +K  QKPA  D++  V NG +  T +  D  NVFRSLE+QS
Sbjct  18   TNNHNTDHGWQKVTYAKRQRK--QKPA--DTAAAVTNGKINGTAAANDKANVFRSLEQQS  73

Query  300  EERRSR-IEAQRAAMFLEDEAPVRSAAKHRsddededsdsWGADRGSGVQNGEVDGkkke  476
            EERR R IE+QRAA  + + APVRS   HRSDD++ED      D   G +  E   +KK 
Sbjct  74   EERRRRIIESQRAAD-VPEAAPVRS-KHHRSDDDEED----DDDSEDGAKGNEKAAEKKV  127

Query  477  kqkkpkkpkvtvaeaaakIDASDLSAFL  560
            KQKK KKPKVTVAEAA KIDASDL+AFL
Sbjct  128  KQKKAKKPKVTVAEAAVKIDASDLAAFL  155



>ref|XP_010101955.1| hypothetical protein L484_011972 [Morus notabilis]
 gb|EXB90879.1| hypothetical protein L484_011972 [Morus notabilis]
Length=305

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 61/88 (69%), Gaps = 13/88 (15%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPAA--SDS-----SRIVANGSVGATVSGVDNVFRSLEKQSE  302
            DHGWQKV+Y+K+ +K +   AA  SDS     S+I ANGS+    +G DNVFRSLE+QSE
Sbjct  31   DHGWQKVTYAKRQRKTKPSAAAAVSDSLANGTSKIAANGSL----AGGDNVFRSLEQQSE  86

Query  303  ERRSRI-EAQRAAMFLED-EAPVRSAAK  380
            +RR RI EAQRAA  + D  AP RS A+
Sbjct  87   DRRRRILEAQRAANGVADGNAPARSKAR  114



>ref|XP_003531149.1| PREDICTED: uncharacterized protein LOC100795409 isoform 1 [Glycine 
max]
Length=599

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 70/113 (62%), Gaps = 20/113 (18%)
 Frame = +3

Query  96   MEDKSMASESTHHIES-------DHGWQKVSYSKKHKKNQQKPAA------SDSSRIVAN  236
            ME+K  A+  + H ES       DHGWQKV+Y+KK KK     A       ++SS++V N
Sbjct  1    MEEKHAAAIESAHAESNGVSHGADHGWQKVTYAKKQKKKTVNAANGGPDSRANSSKLVPN  60

Query  237  GSVGATVSGVDNVFRSLEKQSEERRSRI-EAQR--AAMFLEDEAPVRSAAKHR  386
            G    T+SG D VFRSLE QSE+RR +I EA++   A + +++AP+RS  +HR
Sbjct  61   G----TLSGNDGVFRSLELQSEDRRRKIVEAKKLADAAYDDEDAPLRSKQRHR  109



>gb|KHN46086.1| Transmembrane protein 214 [Glycine soja]
Length=537

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 17/94 (18%)
 Frame = +3

Query  96   MEDKSMASESTHHIES-------DHGWQKVSYSKKHKKNQQKPAAS-----DSSRIVANG  239
            ME+K  A+  + H ES       DHGWQKV+Y+KK KK     A S     +S+++V NG
Sbjct  1    MEEKHAAANESAHAESNGVSHGADHGWQKVTYAKKQKKKTVNAANSADSRANSNKLVPNG  60

Query  240  SVGATVSGVDNVFRSLEKQSEERRSRI-EAQRAA  338
                T+SG D VFRSLE QSE+RR +I EA++ A
Sbjct  61   ----TLSGNDGVFRSLELQSEDRRRKIVEAKKMA  90



>ref|XP_007225688.1| hypothetical protein PRUPE_ppa003121mg [Prunus persica]
 gb|EMJ26887.1| hypothetical protein PRUPE_ppa003121mg [Prunus persica]
Length=601

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +3

Query  123  STH-HIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQS  299
            +TH H  +DHGWQKV+  ++ K    KP+ +DS   +     G T++G + VFRSLEKQS
Sbjct  24   NTHIHTNNDHGWQKVTAKRQRK---TKPSKADSINNLNKLVPGVTIAGGEGVFRSLEKQS  80

Query  300  EERRSRI-EAQRAAMFLEDE-APVRS  371
            E+RR RI EAQRAA    D  APVRS
Sbjct  81   EDRRRRILEAQRAANADADSLAPVRS  106



>ref|XP_008221426.1| PREDICTED: uncharacterized protein LOC103321411 [Prunus mume]
Length=604

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +3

Query  123  STH-HIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQS  299
            +TH H  +DHGWQKV+  ++ K    KP+ +DS   +     G T++G + VFRSLEKQS
Sbjct  27   NTHIHTNNDHGWQKVTAKRQRK---AKPSKADSINNLNKLVPGVTIAGGEGVFRSLEKQS  83

Query  300  EERRSRI-EAQRAAMFLEDE-APVRS  371
            E+RR RI EAQRAA    D  APVRS
Sbjct  84   EDRRRRILEAQRAANADADSLAPVRS  109



>ref|XP_003524856.1| PREDICTED: uncharacterized protein LOC100777797 isoform 1 [Glycine 
max]
Length=597

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 53/87 (61%), Gaps = 16/87 (18%)
 Frame = +3

Query  96   MEDKSMASESTHHIES-------DHGWQKVSYSKKHKKNQQKPAAS-----DSSRIVANG  239
            ME+K  A+  + H ES       DHGWQKV+Y+KK KK     A S     +S+++V NG
Sbjct  1    MEEKHAAANESAHAESNGVSHGADHGWQKVTYAKKQKKKTVNAANSADSRANSNKLVPNG  60

Query  240  SVGATVSGVDNVFRSLEKQSEERRSRI  320
                T+SG D VFRSLE QSE+RR +I
Sbjct  61   ----TLSGNDGVFRSLELQSEDRRRKI  83



>gb|EPS70947.1| hypothetical protein M569_03811, partial [Genlisea aurea]
Length=587

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (74%), Gaps = 3/73 (4%)
 Frame = +3

Query  138  ESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSR  317
            E+ +GWQKVSY+KK + +Q+K A SDSSR ++NGSV    S  ++VF+ LEK +EERR +
Sbjct  19   ENSNGWQKVSYAKKQR-SQKKNAPSDSSRALSNGSV--LPSEKNSVFQGLEKHAEERRKK  75

Query  318  IEAQRAAMFLEDE  356
            + AQRAA  + D+
Sbjct  76   LGAQRAASAIYDD  88



>ref|XP_006302022.1| hypothetical protein CARUB_v10020004mg [Capsella rubella]
 gb|EOA34920.1| hypothetical protein CARUB_v10020004mg [Capsella rubella]
Length=610

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 56/80 (70%), Gaps = 9/80 (11%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPA---ASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRS  314
            DHGW+KV Y K+++K  QKPA    ++  +IV NG+V    +G DNVFRSLE+Q+E+RR 
Sbjct  22   DHGWKKVVYPKRNRK--QKPADQATANGGKIVQNGAVA---NGGDNVFRSLEEQAEDRRR  76

Query  315  RI-EAQRAAMFLEDEAPVRS  371
            RI  A+ AA+  +D+  VRS
Sbjct  77   RILAAKMAAVDSDDDGAVRS  96



>ref|XP_008389199.1| PREDICTED: uncharacterized protein LOC103451563 [Malus domestica]
Length=609

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 52/86 (60%), Gaps = 6/86 (7%)
 Frame = +3

Query  123  STHHIES--DHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQ  296
            STHH  +  DHGWQKV+  +  KK +      ++   +  G   A  +GV   FRSLEKQ
Sbjct  29   STHHTTTNNDHGWQKVTAKRPRKKKESNAETINNQNKLVPGVANANGNGV---FRSLEKQ  85

Query  297  SEERRSRI-EAQRAAMFLEDEAPVRS  371
            SE+RR RI EAQRA + L+D AP RS
Sbjct  86   SEDRRRRILEAQRANVDLDDVAPARS  111



>ref|XP_008464702.1| PREDICTED: uncharacterized protein LOC103502522 [Cucumis melo]
Length=591

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 48/81 (59%), Gaps = 15/81 (19%)
 Frame = +3

Query  96   MEDKSMASES-----------THHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGS  242
            MEDK +A ES           T H   DHGWQKV+Y+K+ +K  +      S++I +NG 
Sbjct  1    MEDKLVALESAPTIEDHDAALTSHPHVDHGWQKVTYAKRQRKTNKPSNDLLSTKIASNG-  59

Query  243  VGATVSGVDNVFRSLEKQSEE  305
               TV G DNVFRSLE++SEE
Sbjct  60   ---TVPGADNVFRSLEQKSEE  77



>ref|XP_004142274.1| PREDICTED: uncharacterized protein LOC101205264 [Cucumis sativus]
 ref|XP_004163644.1| PREDICTED: uncharacterized protein LOC101224709 [Cucumis sativus]
 gb|KGN49627.1| hypothetical protein Csa_5G031960 [Cucumis sativus]
Length=591

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 48/81 (59%), Gaps = 15/81 (19%)
 Frame = +3

Query  96   MEDKSMASES-----------THHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGS  242
            MEDK +A ES           T H   DHGWQKV+Y+K+ +K  +      S++I +NG 
Sbjct  1    MEDKHVALESPPTIEDHDAALTSHPHVDHGWQKVTYAKRQRKTNKPSNDLLSTKIASNG-  59

Query  243  VGATVSGVDNVFRSLEKQSEE  305
               TV G DNVFRSLE++SEE
Sbjct  60   ---TVPGADNVFRSLEQKSEE  77



>ref|NP_177234.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001185367.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD55492.1|AC008148_2 Unknown protein [Arabidopsis thaliana]
 gb|AAG52333.1|AC011663_12 unknown protein; 13405-15968 [Arabidopsis thaliana]
 gb|AAM97096.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37737.1| At1g70770 [Arabidopsis thaliana]
 dbj|BAH56789.1| AT1G70770 [Arabidopsis thaliana]
 gb|AEE35112.1| uncharacterized protein AT1G70770 [Arabidopsis thaliana]
 gb|AEE35113.1| uncharacterized protein AT1G70770 [Arabidopsis thaliana]
Length=610

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 8/84 (10%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQ--KPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSR  317
            DHGW+KV Y K+H+K +Q  +  A+    + +NG+V    +G DNVFRSLE+Q+E+RR R
Sbjct  20   DHGWKKVVYPKRHRKQKQADQATANGGKTVASNGTVA---NGGDNVFRSLEEQAEDRRRR  76

Query  318  I-EAQRAAMFLEDEAPVRSAAKHR  386
            I  A+  A+  +D+  VRS  KHR
Sbjct  77   ILAAKMTAIDSDDDGVVRS--KHR  98



>ref|XP_010265344.1| PREDICTED: transmembrane protein 214-like [Nelumbo nucifera]
Length=595

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 6/65 (9%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVD--NVFRSLEKQSEERRSR  317
            DHGWQKV+Y+K+ +KN+   +A D  +   NG     V G D  NVF+SLE+QS+ERR R
Sbjct  30   DHGWQKVTYAKRQRKNKPSDSAGDPGKFRPNG----VVVGGDNLNVFQSLEEQSKERRRR  85

Query  318  IEAQR  332
            +EAQ+
Sbjct  86   VEAQK  90



>ref|XP_002888794.1| hypothetical protein ARALYDRAFT_476207 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65053.1| hypothetical protein ARALYDRAFT_476207 [Arabidopsis lyrata subsp. 
lyrata]
Length=616

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 10/81 (12%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPA----ASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERR  311
            DHGW+KV Y K+H+K  QKPA    A+    +  NG+V    +G DNVFRSLE+Q+E+RR
Sbjct  22   DHGWKKVVYPKRHRK--QKPADQATANGGKTVAQNGTVA---NGGDNVFRSLEEQAEDRR  76

Query  312  SRI-EAQRAAMFLEDEAPVRS  371
             RI  A+ AA+  +D+  VRS
Sbjct  77   RRILAAKMAAVDSDDDGVVRS  97



>emb|CDY09481.1| BnaC02g20230D [Brassica napus]
Length=593

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 18/83 (22%)
 Frame = +3

Query  123  STHHIESDHGWQKVSYSKKHKKNQQKPA---ASDSSRI-VANGSVGATVSGVDNVFRSLE  290
            +T H+  DHGW+KV Y K+H+K  QKPA   A++   + VANG         DNVFRSLE
Sbjct  18   NTTHV--DHGWKKVVYPKRHRK--QKPADQTATNGKNVDVANG---------DNVFRSLE  64

Query  291  KQSEERRSRI-EAQRAAMFLEDE  356
            +Q+E+RR RI  A+ AA+ +EDE
Sbjct  65   EQAEDRRKRILAAKMAAVDVEDE  87



>ref|XP_009351509.1| PREDICTED: uncharacterized protein LOC103943042 [Pyrus x bretschneideri]
Length=606

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 6/86 (7%)
 Frame = +3

Query  123  STHH--IESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQ  296
            +THH    +DHGWQKV+  +  KK +      ++   +  G   A  +G   VFRSLEKQ
Sbjct  30   NTHHSHANNDHGWQKVTAKRPRKKKESNAEVINNQNKLVPGIASANGNG---VFRSLEKQ  86

Query  297  SEERRSRI-EAQRAAMFLEDEAPVRS  371
            SE+RR RI EAQRA + L+D AP RS
Sbjct  87   SEDRRRRILEAQRANVDLDDVAPARS  112



>ref|XP_009349518.1| PREDICTED: uncharacterized protein LOC103941062 [Pyrus x bretschneideri]
Length=610

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 6/86 (7%)
 Frame = +3

Query  123  STHH--IESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQ  296
            +THH    +DHGWQKV+  +  KK +      ++   +  G   A  +G   VFRSLEKQ
Sbjct  34   NTHHSHANNDHGWQKVTAKRPRKKKESNAEVINNQNKLVPGIASANGNG---VFRSLEKQ  90

Query  297  SEERRSRI-EAQRAAMFLEDEAPVRS  371
            SE+RR RI EAQRA + L+D AP RS
Sbjct  91   SEDRRRRILEAQRANVDLDDVAPARS  116



>ref|XP_007158805.1| hypothetical protein PHAVU_002G183300g [Phaseolus vulgaris]
 gb|ESW30799.1| hypothetical protein PHAVU_002G183300g [Phaseolus vulgaris]
Length=593

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 9/65 (14%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPA-ASD----SSRIVANGSVGATVSGVDNVFRSLEKQSEE  305
            SDHGWQKV+Y+KK KK       ASD    S+++V NG    T+SG D VFRSLE QSE+
Sbjct  23   SDHGWQKVTYAKKQKKKTNNSVNASDSRANSNKLVPNG----TLSGSDGVFRSLELQSED  78

Query  306  RRSRI  320
            RR +I
Sbjct  79   RRRKI  83



>ref|XP_002284658.1| PREDICTED: uncharacterized protein LOC100264607 [Vitis vinifera]
Length=594

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 5/85 (6%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAAS--DSSRIVANGSVGATVSGVDNVFRSLEKQSEERRS  314
            S+HGWQKV+Y+K+++K Q   + S  +S ++  NG++        NVFRSLE+Q+EERR 
Sbjct  23   SNHGWQKVTYAKRNRKQQSNNSDSVGNSEKVRVNGTLAT--GDKPNVFRSLEQQAEERRR  80

Query  315  RI-EAQRAAMFLEDEAPVRSAAKHR  386
            R+ EAQ  A    D+  VRS +KHR
Sbjct  81   RVLEAQMVAAAAADDHQVRSKSKHR  105



>emb|CAN67931.1| hypothetical protein VITISV_007906 [Vitis vinifera]
Length=594

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 5/85 (6%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAAS--DSSRIVANGSVGATVSGVDNVFRSLEKQSEERRS  314
            S+HGWQKV+Y+K+++K Q   + S  +S ++  NG++        NVFRSLE+Q+EERR 
Sbjct  23   SNHGWQKVTYAKRNRKQQSNNSDSVGNSEKVRVNGTL--XTGDKPNVFRSLEQQAEERRR  80

Query  315  RI-EAQRAAMFLEDEAPVRSAAKHR  386
            R+ EAQ  A    D+  VRS +KHR
Sbjct  81   RVLEAQMVAAAAADDHQVRSKSKHR  105



>ref|XP_006390841.1| hypothetical protein EUTSA_v10018292mg [Eutrema salsugineum]
 gb|ESQ28127.1| hypothetical protein EUTSA_v10018292mg [Eutrema salsugineum]
Length=617

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 55/87 (63%), Gaps = 12/87 (14%)
 Frame = +3

Query  117  SESTHHIESDHGWQKVSYSKKHKKNQQKPA-----ASDSSRIVANGSVGATVSGVDNVFR  281
            SE+  +   DHGW+KV Y K+++K  QKPA        S + VANG    T +  DNVFR
Sbjct  18   SEANGNSHVDHGWKKVVYPKRNRK--QKPADQSVNGGVSGKTVANG----TQANGDNVFR  71

Query  282  SLEKQSEERRSRI-EAQRAAMFLEDEA  359
            SLE+Q+E+RR RI  A+ AA  LEDE+
Sbjct  72   SLEEQAEDRRRRILAAKMAAADLEDES  98



>ref|XP_004297471.1| PREDICTED: uncharacterized protein LOC101304959 [Fragaria vesca 
subsp. vesca]
Length=604

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEER  308
            SDHGWQKV+Y K+ +KN+   + ++ +R+V     GA +SG DNVFR +EK++EER
Sbjct  32   SDHGWQKVTYQKRQRKNKAAESVNNHNRLVP----GAVISGGDNVFRGVEKEAEER  83



>ref|XP_009127825.1| PREDICTED: transmembrane protein 214-like [Brassica rapa]
Length=586

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 13/79 (16%)
 Frame = +3

Query  123  STHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSE  302
            +T H+  DHGW+KV Y K+H+K  QKPA   ++        G   +G DNVFRSLE+Q+E
Sbjct  18   NTTHV--DHGWKKVVYPKRHRK--QKPADQTATN-------GQNANG-DNVFRSLEEQAE  65

Query  303  ERRSRI-EAQRAAMFLEDE  356
            +RR RI  A+ AA+ +EDE
Sbjct  66   DRRKRILAAKMAAVDVEDE  84



>emb|CDY03722.1| BnaA02g15150D [Brassica napus]
Length=590

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 13/79 (16%)
 Frame = +3

Query  123  STHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSE  302
            +T H+  DHGW+KV Y K+H+K  QKPA   ++        G   +G DNVFRSLE+Q+E
Sbjct  18   NTTHV--DHGWKKVVYPKRHRK--QKPADQTATN-------GQNANG-DNVFRSLEEQAE  65

Query  303  ERRSRI-EAQRAAMFLEDE  356
            +RR RI  A+ AA+ +EDE
Sbjct  66   DRRKRILAAKMAAVDVEDE  84



>ref|XP_009115558.1| PREDICTED: uncharacterized protein LOC103840791 [Brassica rapa]
Length=605

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 97/144 (67%), Gaps = 11/144 (8%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAASDSSRI-VANGSVGATVSGVDNVFRSLEKQSEERRSR  317
            +DHGW+KV Y K+++K  QKPA   +S   V NG++    S  DNVFRSLE+Q+E+RR R
Sbjct  21   TDHGWKKVVYPKRNRK--QKPADQTTSGTHVPNGAL----SNGDNVFRSLEEQAEDRRRR  74

Query  318  IEAQRAAMFLEDEAPVRSAAKHRsddededsdsWG---ADRGSGVQNGEVDGkkkekqkk  488
            I A + A    D++   + +K RS+  D++   +G    + G+G +N +V+G KK K KK
Sbjct  75   ILAAKKAADASDDS-DLARSKRRSNGYDDEGYGYGDSEGEIGAGKENAKVEGAKKPKVKK  133

Query  489  pkkpkvtvaeaaakIDASDLSAFL  560
             KKPKVT+AEAAAKIDAS+L AFL
Sbjct  134  EKKPKVTLAEAAAKIDASNLEAFL  157



>emb|CDY21420.1| BnaA09g30070D [Brassica napus]
Length=605

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 97/144 (67%), Gaps = 11/144 (8%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAASDSSRI-VANGSVGATVSGVDNVFRSLEKQSEERRSR  317
            +DHGW+KV Y K+++K  QKPA   +S   V NG++    S  DNVFRSLE+Q+E+RR R
Sbjct  21   TDHGWKKVVYPKRNRK--QKPADQTTSGTHVPNGAL----SNGDNVFRSLEEQAEDRRRR  74

Query  318  IEAQRAAMFLEDEAPVRSAAKHRsddededsdsWG---ADRGSGVQNGEVDGkkkekqkk  488
            I A + A    D++   + +K RS+  D++   +G    + G+G +N +V+G KK K KK
Sbjct  75   ILAAKKAADASDDS-DLARSKRRSNGYDDEGYGYGDSEGEIGAGKENAKVEGAKKPKVKK  133

Query  489  pkkpkvtvaeaaakIDASDLSAFL  560
             KKPKVT+AEAAAKIDAS+L AFL
Sbjct  134  EKKPKVTLAEAAAKIDASNLEAFL  157



>gb|KJB78162.1| hypothetical protein B456_012G181300 [Gossypium raimondii]
Length=606

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 8/68 (12%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQK--PAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRS  314
            +DHGWQKVSY K+ +K + K  P   + +R+  NG++    +G  NVF SLE+QSE+RR 
Sbjct  22   TDHGWQKVSYPKRQRKTKSKADPEKPNLTRL--NGTL---TNGGPNVFHSLEQQSEDRRR  76

Query  315  RI-EAQRA  335
            RI EAQRA
Sbjct  77   RILEAQRA  84



>ref|XP_010555138.1| PREDICTED: uncharacterized protein LOC104824713 [Tarenaya hassleriana]
Length=597

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 11/82 (13%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPA----ASDSSRIVANGSVGATVSGVDNVFRSLEKQSEER  308
            SDHGWQKV Y K+ +K  QKPA     + S +++ NGS+    +  DNVFRSLE+Q+E+R
Sbjct  21   SDHGWQKVVYPKRQRK--QKPADQAANAASGKLLTNGSL----ANGDNVFRSLEQQAEDR  74

Query  309  RSRI-EAQRAAMFLEDEAPVRS  371
            R RI  AQ AA   +  APVRS
Sbjct  75   RRRILAAQVAADAADGSAPVRS  96



>gb|KJB78163.1| hypothetical protein B456_012G181300 [Gossypium raimondii]
Length=607

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 8/68 (12%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQK--PAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRS  314
            +DHGWQKVSY K+ +K + K  P   + +R+  NG++    +G  NVF SLE+QSE+RR 
Sbjct  22   TDHGWQKVSYPKRQRKTKSKADPEKPNLTRL--NGTL---TNGGPNVFHSLEQQSEDRRR  76

Query  315  RI-EAQRA  335
            RI EAQRA
Sbjct  77   RILEAQRA  84



>ref|XP_006416118.1| hypothetical protein EUTSA_v10007115mg [Eutrema salsugineum]
 gb|ESQ34471.1| hypothetical protein EUTSA_v10007115mg [Eutrema salsugineum]
Length=608

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 93/142 (65%), Gaps = 4/142 (3%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSRI  320
            +DHGW+KV Y K+++K  QKPA   ++ I  N +    ++  DNVFRSLE+Q+E+R  RI
Sbjct  21   TDHGWKKVVYPKRNRK--QKPADQAANGIAGNVAPNGALANGDNVFRSLEEQAEDRHRRI  78

Query  321  -EAQRAAMFLEDEAPVRSAAK-HRsddededsdsWGADRGSGVQNGEVDGkkkekqkkpk  494
             EA++AA   +     RS  + +   D+  D D   A+  +G +N + +G KK K KK K
Sbjct  79   LEAKKAADASDGSDLTRSKRRSNGYGDDGYDFDDSDAENAAGKENLKAEGAKKPKPKKEK  138

Query  495  kpkvtvaeaaakIDASDLSAFL  560
            KPKVT+AEAAAKIDAS+L+AFL
Sbjct  139  KPKVTLAEAAAKIDASNLAAFL  160



>ref|XP_006838127.1| hypothetical protein AMTR_s00106p00069950 [Amborella trichopoda]
 gb|ERN00696.1| hypothetical protein AMTR_s00106p00069950 [Amborella trichopoda]
Length=600

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 59/101 (58%), Gaps = 19/101 (19%)
 Frame = +3

Query  96   MEDKSMASESTHHIE----SDHGWQKVSYSKKHKK-----NQQKPAASDSSRIVANGSVG  248
            ME+ S A+  +  +E    S+HGWQKV Y K+H+K      Q +   SD ++I +NG+  
Sbjct  1    MEEASAAALESITMEDASHSNHGWQKVVYPKRHRKQALKDQQNQHPVSDLNKIKSNGNES  60

Query  249  ATVSGVDNVFRSLEKQSEERRSR-IEAQRAAMFLEDEAPVR  368
                   NVFRS+E+Q+EERR R +EAQRA      E PV+
Sbjct  61   -------NVFRSVEQQAEERRRRVVEAQRANAI--AELPVK  92



>ref|XP_010552700.1| PREDICTED: uncharacterized protein LOC104823001 [Tarenaya hassleriana]
Length=604

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 3/66 (5%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSRI-  320
            DHGWQKV Y K+ +K  QKPA   ++   A      T++  DNVFRSLE+Q+EERR RI 
Sbjct  22   DHGWQKVVYPKRQRK--QKPADQAANAASAKPLPNGTLANGDNVFRSLEQQAEERRRRIF  79

Query  321  EAQRAA  338
             AQ AA
Sbjct  80   TAQLAA  85



>ref|XP_007045199.1| Transmembrane protein 214-A isoform 2 [Theobroma cacao]
 gb|EOY01031.1| Transmembrane protein 214-A isoform 2 [Theobroma cacao]
Length=466

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +3

Query  114  ASESTHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEK  293
            A E+T    SDHGWQKVSY K+ +K +        +    NGS+    +G  NVFRS+E+
Sbjct  9    AHETTTANHSDHGWQKVSYPKRQRKTKPNADPEKPNLTRPNGSL---TNGAPNVFRSVEQ  65

Query  294  QSEERRSR-IEAQR  332
             SE+RR R +EAQR
Sbjct  66   HSEDRRRRTLEAQR  79



>ref|XP_010274735.1| PREDICTED: transmembrane protein 214 [Nelumbo nucifera]
Length=595

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 45/63 (71%), Gaps = 5/63 (8%)
 Frame = +3

Query  147  HGWQKVSYSKKHKKNQQKPA-ASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSRIE  323
            HGWQKV+Y+K+ +K   KP+ A+D S+   NG V   V    NVF+SLE+Q++ERR R+E
Sbjct  30   HGWQKVTYAKRQRK--PKPSDAADPSKFRPNGVV--VVGDEPNVFQSLEEQAKERRRRVE  85

Query  324  AQR  332
            AQ+
Sbjct  86   AQK  88



>ref|XP_007045198.1| Transmembrane protein 214-A isoform 1 [Theobroma cacao]
 gb|EOY01030.1| Transmembrane protein 214-A isoform 1 [Theobroma cacao]
Length=582

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +3

Query  114  ASESTHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEK  293
            A E+T    SDHGWQKVSY K+ +K +        +    NGS+    +G  NVFRS+E+
Sbjct  9    AHETTTANHSDHGWQKVSYPKRQRKTKPNADPEKPNLTRPNGSL---TNGAPNVFRSVEQ  65

Query  294  QSEERRSR-IEAQR  332
             SE+RR R +EAQR
Sbjct  66   HSEDRRRRTLEAQR  79



>ref|XP_010415766.1| PREDICTED: uncharacterized protein LOC104701723 [Camelina sativa]
Length=609

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 16/86 (19%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPA----ASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERR  311
            DHGW+KV Y K+++K   KPA    A++  + V NG+      G DNVFRSLE+Q+E+RR
Sbjct  22   DHGWKKVVYPKRNRK--AKPADQATAANGGKTVQNGT------G-DNVFRSLEEQAEDRR  72

Query  312  SRI-EAQRAAMFLEDEAPVRSAAKHR  386
             RI  A+ AA+  +DE  VRS  KHR
Sbjct  73   RRILAAKMAAVDSDDEGLVRS--KHR  96



>gb|EYU33132.1| hypothetical protein MIMGU_mgv1a003637mg [Erythranthe guttata]
Length=572

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 11/95 (12%)
 Frame = +3

Query  99   EDKSMASESTHHIE-SDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNV  275
            EDKS  SE  H  E S HGWQKV+Y KK  K  +    + SS ++ NGS    V+  + V
Sbjct  3    EDKSF-SELIHRGEDSSHGWQKVTYVKKRTKASK----NTSSNLLPNGS--GAVADKNGV  55

Query  276  FRSLEKQSEERRSRIEAQRAAMFLEDE---APVRS  371
            F+++EK +E+RR  ++A+RAA  L D+    PVRS
Sbjct  56   FKAVEKNAEDRRRILDAKRAASSLYDDDDGFPVRS  90



>ref|XP_004504570.1| PREDICTED: uncharacterized protein LOC101509424 [Cicer arietinum]
Length=590

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 53/83 (64%), Gaps = 4/83 (5%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSRI  320
            +DHGWQKV+Y+KK KK      AS  SR  +N     T +G D VFRSLE QSE+RR RI
Sbjct  25   ADHGWQKVTYAKKQKKKDANGIASSDSRANSN---KLTFNGNDVVFRSLELQSEDRRRRI  81

Query  321  -EAQRAAMFLEDEAPVRSAAKHR  386
             EA+ AA    D+APVRS  + R
Sbjct  82   LEARAAADAEFDDAPVRSKQRSR  104



>ref|XP_010471078.1| PREDICTED: uncharacterized protein LOC104750915 [Camelina sativa]
Length=605

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 13/83 (16%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPA-ASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSRI  320
            DHGW+KV Y K+++K   KPA  ++  + V NG+      G DNVFRSLE+Q+E+RR RI
Sbjct  22   DHGWKKVVYPKRNRK--AKPADQANGGKTVQNGT------G-DNVFRSLEEQAEDRRRRI  72

Query  321  EAQR-AAMFLEDEAPVRSAAKHR  386
             A + AA+  +DE  VRS  KHR
Sbjct  73   LAAKTAAVDSDDEGLVRS--KHR  93



>ref|XP_010427867.1| PREDICTED: uncharacterized protein LOC104712634 [Camelina sativa]
Length=610

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 16/86 (19%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPA----ASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERR  311
            DHGW+KV Y K+++K   KPA    A++  + V NG+      G DNVFRSLE+Q+E+RR
Sbjct  22   DHGWKKVVYPKRNRKT--KPADQATAANGGKTVQNGT------G-DNVFRSLEEQAEDRR  72

Query  312  SRI-EAQRAAMFLEDEAPVRSAAKHR  386
             RI  A+ AA+  +D+  VRS  KHR
Sbjct  73   RRILAAKMAAVDSDDDGVVRS--KHR  96



>ref|XP_009105745.1| PREDICTED: transmembrane protein 214-like [Brassica rapa]
Length=602

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 14/74 (19%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPA---ASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRS  314
            DHGW+KV Y K+++K  QKPA   A++  +  ANG         DNVFRSLE+Q+E+RR 
Sbjct  20   DHGWKKVVYPKRNRK--QKPADQTATNGGKNAANG---------DNVFRSLEEQAEDRRK  68

Query  315  RIEAQRAAMFLEDE  356
            RI A + A+   DE
Sbjct  69   RILAAKMAVSDSDE  82



>ref|XP_002890568.1| hypothetical protein ARALYDRAFT_313192 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66827.1| hypothetical protein ARALYDRAFT_313192 [Arabidopsis lyrata subsp. 
lyrata]
Length=1269

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 5/69 (7%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSV---GATVSGVDNVFRSLEKQSEERR  311
            +DHGW+KV Y K+++K  QKPA   +   V +G +   GA  +G DN+FRSLE+Q+E+R 
Sbjct  22   NDHGWKKVVYPKRNRK--QKPADQAAVANVVSGKLIPNGALSNGGDNIFRSLEEQAEDRH  79

Query  312  SRIEAQRAA  338
             RI A + A
Sbjct  80   RRILAAKKA  88



>emb|CDY11548.1| BnaC06g31910D [Brassica napus]
Length=602

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 14/74 (19%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPA---ASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRS  314
            DHGW+KV Y K+++K  QKPA   A++  +  ANG         DNVFRSLE+Q+E+RR 
Sbjct  20   DHGWKKVVYPKRNRK--QKPADQTATNGGKNAANG---------DNVFRSLEEQAEDRRR  68

Query  315  RIEAQRAAMFLEDE  356
            RI A + A+   DE
Sbjct  69   RILAAKMAVSDSDE  82



>emb|CDY11546.1| BnaC06g31930D [Brassica napus]
Length=602

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 14/74 (19%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPA---ASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRS  314
            DHGW+KV Y K+++K  QKPA   A++  +  ANG         DNVFRSLE+Q+E+RR 
Sbjct  20   DHGWKKVVYPKRNRK--QKPADQTATNGGKNAANG---------DNVFRSLEEQAEDRRR  68

Query  315  RIEAQRAAMFLEDE  356
            RI A + A+   DE
Sbjct  69   RILAAKMAVSDSDE  82



>emb|CDX96276.1| BnaA07g28870D [Brassica napus]
Length=599

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 14/74 (19%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPA---ASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRS  314
            DHGW+KV Y K+++K  QKPA   A++  +  ANG         DNVFRSLE+Q+E+RR 
Sbjct  20   DHGWKKVVYPKRNRK--QKPADQTATNGGKNAANG---------DNVFRSLEEQAEDRRR  68

Query  315  RIEAQRAAMFLEDE  356
            RI A + A+   DE
Sbjct  69   RILAAKMAVSDSDE  82



>gb|KDO64591.1| hypothetical protein CISIN_1g007667mg [Citrus sinensis]
Length=496

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 4/60 (7%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPAASDSSRIVA-NGSVGATVSGVDNVFRSLEKQSEERRSRI  320
            DHGWQKV+Y+K+ +K   KP A  S+ +VA NG  G++    +NVFR+LE+Q+EER  RI
Sbjct  25   DHGWQKVTYAKRQRKT--KPGADPSNALVAANGGAGSS-GEKNNVFRNLEQQAEERHLRI  81



>ref|XP_006448218.1| hypothetical protein CICLE_v10014686mg [Citrus clementina]
 gb|ESR61458.1| hypothetical protein CICLE_v10014686mg [Citrus clementina]
Length=594

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 4/60 (7%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPAASDSSRIVA-NGSVGATVSGVDNVFRSLEKQSEERRSRI  320
            DHGWQKV+Y+K+ +K   KP A  S+ +VA NG  G++    +NVFR+LE+Q+EER  RI
Sbjct  25   DHGWQKVTYAKRQRKT--KPGADPSNALVAANGGAGSS-GEKNNVFRNLEQQAEERHLRI  81



>ref|XP_006469208.1| PREDICTED: uncharacterized protein LOC102617537 [Citrus sinensis]
 gb|KDO64590.1| hypothetical protein CISIN_1g007667mg [Citrus sinensis]
Length=594

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 4/60 (7%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPAASDSSRIVA-NGSVGATVSGVDNVFRSLEKQSEERRSRI  320
            DHGWQKV+Y+K+ +K   KP A  S+ +VA NG  G++    +NVFR+LE+Q+EER  RI
Sbjct  25   DHGWQKVTYAKRQRKT--KPGADPSNALVAANGGAGSS-GEKNNVFRNLEQQAEERHLRI  81



>gb|KHG06009.1| Transmembrane protein [Gossypium arboreum]
 gb|KHG17504.1| Transmembrane protein [Gossypium arboreum]
Length=606

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 7/67 (10%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVS-GVDNVFRSLEKQSEERRSR  317
            +DHGWQKVSY K+ +K + K   +D  +   N  +  T++ G  NVF SLE+QSE+RR R
Sbjct  22   TDHGWQKVSYPKRQRKTKSK---ADPEK--PNTRLSGTLTDGGPNVFHSLEQQSEDRRRR  76

Query  318  I-EAQRA  335
            I EAQRA
Sbjct  77   ILEAQRA  83



>emb|CDY04741.1| BnaC05g18480D [Brassica napus]
Length=606

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 8/62 (13%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGS--VGATVSGVDNVFRSLEKQSEERRS  314
            +DHGW+KV Y K+++K  QKPA        ANG+      +S  DNVFRSLE+Q+E+RR 
Sbjct  21   TDHGWKKVVYPKRNRK--QKPA----DHTTANGTHFPNGALSNGDNVFRSLEEQAEDRRR  74

Query  315  RI  320
            RI
Sbjct  75   RI  76



>gb|KHG06257.1| Transmembrane protein [Gossypium arboreum]
Length=579

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 6/67 (9%)
 Frame = +3

Query  120  ESTHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQS  299
            E T+    DHGWQKVSY K+ +K   KP A D +   +NG++    +G  +VFRSLE+QS
Sbjct  8    EPTNANHVDHGWQKVSYPKRQRKT--KPNA-DPNLPRSNGTL---TNGSASVFRSLEQQS  61

Query  300  EERRSRI  320
            E+RR RI
Sbjct  62   EDRRRRI  68



>ref|XP_002311510.1| hypothetical protein POPTR_0008s13110g [Populus trichocarpa]
 gb|EEE88877.1| hypothetical protein POPTR_0008s13110g [Populus trichocarpa]
Length=567

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 9/88 (10%)
 Frame = +3

Query  123  STHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSE  302
            +TH   +DHGWQKV+Y+K+ +K  QKPAA  ++      +     +  +NVFRSLE QSE
Sbjct  17   NTHSNTNDHGWQKVTYAKRQRK--QKPAAHSAA------NNSNDNNEPNNVFRSLELQSE  68

Query  303  ERRSR-IEAQRAAMFLEDEAPVRSAAKH  383
            +RR + IE+QR A      A  RS +KH
Sbjct  69   DRRLKIIESQRVAANAVAVADTRSRSKH  96



>ref|XP_009334426.1| PREDICTED: uncharacterized protein LOC103927255 [Pyrus x bretschneideri]
Length=609

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 6/73 (8%)
 Frame = +3

Query  147  HGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSRI-E  323
            + WQ VSY K+++K+  K   +DS+  + NG     VS   +VFR +E  SEERR R+ E
Sbjct  36   YAWQTVSYPKRNRKSSSKAIPADSNGGLHNG----VVSSASDVFRPIELHSEERRRRVLE  91

Query  324  AQRAAMFLEDEAP  362
            AQ AA+F  D AP
Sbjct  92   AQSAAIF-GDAAP  103



>ref|XP_010460098.1| PREDICTED: uncharacterized protein LOC104741034 [Camelina sativa]
Length=611

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 12/75 (16%)
 Frame = +3

Query  120  ESTH-HIESDHGWQKVSYSKKHKKNQQKPA-------ASDSSRIVANGSVGATVSGVDNV  275
            E+T+ +  SDHGW+KV Y K+++K  QKPA        + +  ++ NG++     G DNV
Sbjct  14   ETTNGNTNSDHGWKKVVYPKRNRK--QKPADQAATANGTITGNLIPNGALSN--GGGDNV  69

Query  276  FRSLEKQSEERRSRI  320
            FRSLE+Q+E R  RI
Sbjct  70   FRSLEEQAEGRHRRI  84



>ref|XP_006306980.1| hypothetical protein CARUB_v10008554mg, partial [Capsella rubella]
 gb|EOA39878.1| hypothetical protein CARUB_v10008554mg, partial [Capsella rubella]
Length=641

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 7/69 (10%)
 Frame = +3

Query  123  STHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSV---GATVSGVDNVFRSLEK  293
            S+H+  +DHGW+KV Y K+++K  QKPA   ++     G++   GA  +G DNVFRSLE+
Sbjct  45   SSHN--NDHGWKKVVYPKRNRK--QKPADQAAAANGVTGNLIPNGALANGGDNVFRSLEE  100

Query  294  QSEERRSRI  320
            Q+E R  RI
Sbjct  101  QAEGRHRRI  109



>ref|XP_002315874.1| hypothetical protein POPTR_0010s12060g [Populus trichocarpa]
 gb|EEF02045.1| hypothetical protein POPTR_0010s12060g [Populus trichocarpa]
Length=594

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKP-AASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSRI  320
            DHGWQKV+Y K+ +K +    +A+++S  +AN S     +  +NVFRSLE QSE+RR +I
Sbjct  24   DHGWQKVTYPKRQRKQRSAADSAANNSHPIANDS-----NKPNNVFRSLELQSEDRRRKI  78

Query  321  -EAQRAAMFLEDEAPVRSAAKH  383
             E+Q AA         RS +KH
Sbjct  79   LESQSAAADAAAVVDTRSRSKH  100



>ref|XP_010477606.1| PREDICTED: uncharacterized protein LOC104756681 [Camelina sativa]
Length=612

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 13/68 (19%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSV-GATVS-------GVDNVFRSLEKQ  296
            +DHGW+KV Y K+++K  QKPA   ++   ANG+V G  +S       G DNVFRSLE+Q
Sbjct  22   NDHGWKKVVYPKRNRK--QKPADQSTA---ANGTVTGNLISNGALSNGGGDNVFRSLEEQ  76

Query  297  SEERRSRI  320
            +E R  RI
Sbjct  77   AEGRHRRI  84



>ref|XP_011023730.1| PREDICTED: uncharacterized protein LOC105125123 [Populus euphratica]
Length=589

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 9/88 (10%)
 Frame = +3

Query  123  STHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSE  302
            ++H   +DHGWQKV+Y+K+ +K  QKPAA  ++      +     +  +NVFRSLE QSE
Sbjct  17   NSHSNTNDHGWQKVTYAKRQRK--QKPAAHSAA------NNSNDNNEPNNVFRSLELQSE  68

Query  303  ERRSR-IEAQRAAMFLEDEAPVRSAAKH  383
            +RR + IE+QR A      A  RS +KH
Sbjct  69   DRRLKIIESQRVAANAVAVADTRSRSKH  96



>gb|KFK44407.1| hypothetical protein AALP_AA1G253100 [Arabis alpina]
Length=600

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 47/81 (58%), Gaps = 9/81 (11%)
 Frame = +3

Query  96   MEDKSMASESTHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNV  275
            ME     + + ++  +DHGW+KV Y K+++K  QKP    ++        G  +S  DNV
Sbjct  7    MEYNGFETTNGNNTHNDHGWKKVEYPKRNRK--QKPTDQATTN-------GTALSNGDNV  57

Query  276  FRSLEKQSEERRSRIEAQRAA  338
            FRSLE+Q+++R  +I A + A
Sbjct  58   FRSLEEQAQDRHRKILAAKKA  78



>ref|XP_010498822.1| PREDICTED: uncharacterized protein LOC104776443 [Camelina sativa]
Length=611

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 11/67 (16%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPA-------ASDSSRIVANGSVGATVSGVDNVFRSLEKQS  299
            +DHGW+KV Y K+++K  QKPA        + +  ++ NG++     G DNVFRSLE+Q+
Sbjct  22   NDHGWKKVVYPKRNRK--QKPADQAATANGTVTGNLIPNGALSN--GGRDNVFRSLEEQA  77

Query  300  EERRSRI  320
            E R  RI
Sbjct  78   EGRHRRI  84



>gb|KFK41505.1| hypothetical protein AALP_AA2G138500 [Arabis alpina]
Length=595

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 9/80 (11%)
 Frame = +3

Query  123  STHHIESDHGWQKVSYSKKHKKNQQKPAASD--SSRIVANGSVGATVSGVDNVFRSLEKQ  296
            S  H   DHGWQKV Y K+++K +   AA++  S ++V+NG+ G      DNVFRSLEK+
Sbjct  15   SNGHTHVDHGWQKVVYPKRNRKQKPDQAATNGVSGKVVSNGTGG------DNVFRSLEKE  68

Query  297  SEERRSRIEAQRAAMFLEDE  356
            +EERR RI A++ A+ ++DE
Sbjct  69   AEERRRRILAEKRAI-VDDE  87



>ref|XP_008381341.1| PREDICTED: uncharacterized protein LOC103444196 [Malus domestica]
Length=599

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 88/138 (64%), Gaps = 10/138 (7%)
 Frame = +3

Query  147  HGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSRIEA  326
            + WQ VSYSK+++K+  K   +DS+  + +G     VS   +VFR +E  SEERR R+  
Sbjct  35   YAWQTVSYSKRNRKSSSKALPADSNGDLHDG----VVSSASDVFRPIELHSEERRRRVLE  90

Query  327  QRAAMFLEDEAPVRSAAKHRsddededsdsWGADRGSGVQNGEVDGkkkekqkkpkkpkv  506
             +AA    D AP    A  R+ D+D++ DS G   G+ V+NGE    KK KQKKPKKPKV
Sbjct  91   AQAAAVSGDVAP---GASKRTSDDDDEGDSDGEVAGAAVENGE---VKKVKQKKPKKPKV  144

Query  507  tvaeaaakIDASDLSAFL  560
            TVAEAA+K+DA DL AFL
Sbjct  145  TVAEAASKMDAGDLGAFL  162



>gb|KJB15411.1| hypothetical protein B456_002G176900 [Gossypium raimondii]
Length=575

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 6/67 (9%)
 Frame = +3

Query  120  ESTHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQS  299
            E+T+    DHGWQKVSY K+ +K   KP A D +    NG++    +G   VF SLE+QS
Sbjct  8    ETTNANHVDHGWQKVSYPKRQRKT--KPNA-DPNLPRPNGTL---TNGSAGVFHSLEQQS  61

Query  300  EERRSRI  320
            ++RR RI
Sbjct  62   DDRRRRI  68



>gb|KJB15412.1| hypothetical protein B456_002G176900 [Gossypium raimondii]
 gb|KJB15414.1| hypothetical protein B456_002G176900 [Gossypium raimondii]
Length=458

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 6/67 (9%)
 Frame = +3

Query  120  ESTHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQS  299
            E+T+    DHGWQKVSY K+ +K   KP A D +    NG++    +G   VF SLE+QS
Sbjct  8    ETTNANHVDHGWQKVSYPKRQRKT--KPNA-DPNLPRPNGTL---TNGSAGVFHSLEQQS  61

Query  300  EERRSRI  320
            ++RR RI
Sbjct  62   DDRRRRI  68



>gb|KJB15413.1| hypothetical protein B456_002G176900 [Gossypium raimondii]
Length=577

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 6/67 (9%)
 Frame = +3

Query  120  ESTHHIESDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQS  299
            E+T+    DHGWQKVSY K+ +K   KP A D +    NG++    +G   VF SLE+QS
Sbjct  8    ETTNANHVDHGWQKVSYPKRQRKT--KPNA-DPNLPRPNGTL---TNGSAGVFHSLEQQS  61

Query  300  EERRSRI  320
            ++RR RI
Sbjct  62   DDRRRRI  68



>gb|ABE65646.1| unknown [Arabidopsis thaliana]
Length=229

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 10/71 (14%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATV------SGVDNVFRSLEKQSEE  305
            DHGW+KV Y K+++K  QKPA  D +    NG  G  +      +G  NVFRSLE+Q+E 
Sbjct  23   DHGWKKVVYPKRNRK--QKPA--DQAAATKNGVTGNLIPNGTLSNGGGNVFRSLEEQAEG  78

Query  306  RRSRIEAQRAA  338
            R  +I A + A
Sbjct  79   RHLQILAAKKA  89



>emb|CDY25773.1| BnaA07g10090D [Brassica napus]
Length=602

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 10/64 (16%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSV----GATVSGVDNVFRSLEKQSEER  308
            SDHGW+KV Y K+++K  QKP+   ++   ANG      G + +G DNVFRSLE+++E+R
Sbjct  21   SDHGWKKVVYPKRNRK--QKPSDQTTT---ANGGTHVPDGTSPNG-DNVFRSLEEKAEDR  74

Query  309  RSRI  320
              RI
Sbjct  75   HRRI  78



>ref|NP_173730.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30350.1| uncharacterized protein AT1G23170 [Arabidopsis thaliana]
Length=569

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 10/71 (14%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATV------SGVDNVFRSLEKQSEE  305
            DHGW+KV Y K+++K  QKPA  D +    NG  G  +      +G  NVFRSLE+Q+E 
Sbjct  23   DHGWKKVVYPKRNRK--QKPA--DQAAATKNGVTGNLIPNGTLSNGGGNVFRSLEEQAEG  78

Query  306  RRSRIEAQRAA  338
            R  +I A + A
Sbjct  79   RHLQILAAKKA  89



>gb|AAU44392.1| hypothetical protein AT1G23170 [Arabidopsis thaliana]
Length=375

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 10/71 (14%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATV------SGVDNVFRSLEKQSEE  305
            DHGW+KV Y K+++K  QKPA  D +    NG  G  +      +G  NVFRSLE+Q+E 
Sbjct  23   DHGWKKVVYPKRNRK--QKPA--DQAAATKNGVTGNLIPNGTLSNGGGNVFRSLEEQAEG  78

Query  306  RRSRIEAQRAA  338
            R  +I A + A
Sbjct  79   RHLQILAAKKA  89



>ref|XP_009103190.1| PREDICTED: uncharacterized protein LOC103829284 [Brassica rapa]
Length=598

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 7/60 (12%)
 Frame = +3

Query  141  SDHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSRI  320
            SDHGW+KV Y K+++K  QKP+   ++   ANG     V   DNVFRSLE+++E+R  RI
Sbjct  21   SDHGWKKVVYPKRNRK--QKPSDQTTT---ANGETH--VPNGDNVFRSLEEKAEDRHRRI  73



>gb|EYU30086.1| hypothetical protein MIMGU_mgv1a0056372mg, partial [Erythranthe 
guttata]
Length=62

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 4/52 (8%)
 Frame = +3

Query  99   EDKS--MASESTHHIESD--HGWQKVSYSKKHKKNQQKPAASDSSRIVANGS  242
            EDKS  + +E   H   D  HGWQKV+Y KK +K Q +  ASD S ++ANGS
Sbjct  3    EDKSFTITAEPISHAAEDNSHGWQKVTYVKKQRKTQNQKTASDPSAVLANGS  54



>ref|NP_001185070.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30351.1| uncharacterized protein AT1G23170 [Arabidopsis thaliana]
Length=615

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 10/71 (14%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATV------SGVDNVFRSLEKQSEE  305
            DHGW+KV Y K+++K  QKPA  D +    NG  G  +      +G  NVFRSLE+Q+E 
Sbjct  23   DHGWKKVVYPKRNRK--QKPA--DQAAATKNGVTGNLIPNGTLSNGGGNVFRSLEEQAEG  78

Query  306  RRSRIEAQRAA  338
            R  +I A + A
Sbjct  79   RHLQILAAKKA  89



>gb|AAC00602.1| Unknown protein [Arabidopsis thaliana]
Length=1299

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 10/71 (14%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATV------SGVDNVFRSLEKQSEE  305
            DHGW+KV Y K+++K  QKPA  D +    NG  G  +      +G  NVFRSLE+Q+E 
Sbjct  23   DHGWKKVVYPKRNRK--QKPA--DQAAATKNGVTGNLIPNGTLSNGGGNVFRSLEEQAEG  78

Query  306  RRSRIEAQRAA  338
            R  +I A + A
Sbjct  79   RHLQILAAKKA  89



>ref|XP_011038613.1| PREDICTED: uncharacterized protein LOC105135446 [Populus euphratica]
Length=593

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 47/90 (52%), Gaps = 23/90 (26%)
 Frame = +3

Query  144  DHGWQKVSYSKKHKKNQQK---------PAASDSSRIVANGSVGATVSGVDNVFRSLEKQ  296
            DHGWQKV+Y K+ +K +           P A+DS++              +NVFRSLE Q
Sbjct  24   DHGWQKVTYPKRQRKQRSAADSAASNSHPIANDSNK-------------PNNVFRSLELQ  70

Query  297  SEERRSRI-EAQRAAMFLEDEAPVRSAAKH  383
            SE+RR +I E+Q AA         RS +KH
Sbjct  71   SEDRRRKILESQSAAADAAAVVDTRSRSKH  100



>ref|XP_008343054.1| PREDICTED: uncharacterized protein LOC103405822 [Malus domestica]
Length=598

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 5/66 (8%)
 Frame = +3

Query  147  HGWQKVSYSKKHKKNQQKPAASDSSRIVANGSVGATVSGVDNVFRSLEKQSEERRSRI-E  323
            + WQ VSY K+++K+  K   +DS+  + NG VG++ S   +VFR +E  SEERR R+ E
Sbjct  35   YAWQTVSYPKRNRKSSSKAIPADSNGGLHNG-VGSSAS---DVFRPIELHSEERRRRVME  90

Query  324  AQRAAM  341
            AQ AA+
Sbjct  91   AQSAAV  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920