BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I06

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004229630.1|  PREDICTED: cellulose synthase A catalytic su...    126   7e-30   Solanum lycopersicum
ref|NP_001275292.1|  cellulose synthase                                 126   7e-30   Solanum tuberosum [potatoes]
ref|XP_011087713.1|  PREDICTED: cellulose synthase A catalytic su...    121   3e-28   Sesamum indicum [beniseed]
gb|AIA10372.1|  cellulose synthase                                      118   4e-27   Boehmeria nivea [Chinese silk-plant]
gb|EYU29030.1|  hypothetical protein MIMGU_mgv1a000570mg                117   6e-27   Erythranthe guttata [common monkey flower]
gb|AEK31218.1|  cellulose synthase A                                    117   6e-27   Eucalyptus camaldulensis
gb|ABY25277.1|  cellulose synthase                                      117   6e-27   Eucalyptus grandis [rose gum]
ref|NP_001289668.1|  cellulose synthase A catalytic subunit 3 [UD...    117   6e-27   Eucalyptus grandis [rose gum]
gb|AAY60846.1|  cellulose synthase 4                                    117   7e-27   Eucalyptus grandis [rose gum]
emb|CDP07782.1|  unnamed protein product                                116   2e-26   Coffea canephora [robusta coffee]
ref|XP_002278997.1|  PREDICTED: cellulose synthase A catalytic su...    116   2e-26   Vitis vinifera
ref|XP_004510986.1|  PREDICTED: cellulose synthase A catalytic su...    116   3e-26   Cicer arietinum [garbanzo]
ref|XP_010088232.1|  OsCesA3 protein                                    115   4e-26   Morus notabilis
ref|XP_002298432.1|  hypothetical protein POPTR_0001s27320g             114   7e-26   
gb|AAL23710.2|  cellulose synthase                                      114   9e-26   Populus tremuloides
gb|AIS86004.1|  cellulose synthase 3                                    114   9e-26   Populus tomentosa [Chinese white poplar]
gb|AIS85991.1|  cellulose synthase 3                                    114   9e-26   Populus tomentosa [Chinese white poplar]
gb|AIS85990.1|  cellulose synthase 3                                    114   9e-26   Populus tomentosa [Chinese white poplar]
gb|AFZ78554.1|  cellulose synthase                                      114   9e-26   Populus tomentosa [Chinese white poplar]
gb|AIS85996.1|  cellulose synthase 3                                    114   1e-25   Populus tomentosa [Chinese white poplar]
gb|AIS85978.1|  cellulose synthase 3                                    114   1e-25   Populus tomentosa [Chinese white poplar]
gb|AIS86011.1|  cellulose synthase 3                                    114   1e-25   Populus tomentosa [Chinese white poplar]
gb|AIS86009.1|  cellulose synthase 3                                    114   1e-25   Populus tomentosa [Chinese white poplar]
gb|AIS85989.1|  cellulose synthase 3                                    114   1e-25   Populus tomentosa [Chinese white poplar]
gb|AIS85987.1|  cellulose synthase 3                                    114   1e-25   Populus tomentosa [Chinese white poplar]
gb|AIS85977.1|  cellulose synthase 3                                    114   1e-25   Populus tomentosa [Chinese white poplar]
gb|KJB19276.1|  hypothetical protein B456_003G092600                    114   1e-25   Gossypium raimondii
gb|AFB18638.1|  CESA10                                                  114   1e-25   Gossypium hirsutum [American cotton]
gb|KJB19277.1|  hypothetical protein B456_003G092600                    114   1e-25   Gossypium raimondii
gb|AGV22107.1|  cellulose synthase 2                                    114   1e-25   Betula luminifera [liang ye hua]
emb|CBI24889.3|  unnamed protein product                                113   1e-25   Vitis vinifera
ref|XP_007028786.1|  Cellulose synthase family protein                  114   2e-25   
gb|KHG04072.1|  putative cellulose synthase A catalytic subunit 8...    113   3e-25   Gossypium arboreum [tree cotton]
ref|XP_010032436.1|  PREDICTED: cellulose synthase A catalytic su...    112   4e-25   Eucalyptus grandis [rose gum]
gb|KDO83405.1|  hypothetical protein CISIN_1g001413mg                   112   4e-25   Citrus sinensis [apfelsine]
ref|XP_006482874.1|  PREDICTED: cellulose synthase A catalytic su...    112   4e-25   Citrus sinensis [apfelsine]
ref|XP_006439113.1|  hypothetical protein CICLE_v10030723mg             112   4e-25   
ref|XP_003540527.1|  PREDICTED: cellulose synthase A catalytic su...    112   6e-25   Glycine max [soybeans]
gb|KHN19454.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    112   6e-25   Glycine soja [wild soybean]
ref|XP_011025442.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    112   6e-25   Populus euphratica
gb|KJB19278.1|  hypothetical protein B456_003G092600                    112   6e-25   Gossypium raimondii
ref|XP_007220288.1|  hypothetical protein PRUPE_ppa000593mg             112   7e-25   
ref|XP_009364979.1|  PREDICTED: cellulose synthase A catalytic su...    111   8e-25   Pyrus x bretschneideri [bai li]
ref|XP_008231249.1|  PREDICTED: cellulose synthase A catalytic su...    111   9e-25   Prunus mume [ume]
ref|XP_007133819.1|  hypothetical protein PHAVU_011G211500g             111   1e-24   Phaseolus vulgaris [French bean]
ref|XP_007052526.1|  Cellulose synthase family protein isoform 2        111   1e-24   
gb|AIS86005.1|  cellulose synthase 3                                    111   1e-24   Populus tomentosa [Chinese white poplar]
ref|XP_007052527.1|  Cellulose synthase family protein isoform 3        111   1e-24   
ref|XP_002532166.1|  Cellulose synthase A catalytic subunit 6 [UD...    111   1e-24   Ricinus communis
ref|XP_009354747.1|  PREDICTED: cellulose synthase A catalytic su...    111   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_008375180.1|  PREDICTED: cellulose synthase A catalytic su...    111   1e-24   Malus domestica [apple tree]
gb|KDO83418.1|  hypothetical protein CISIN_1g001413mg                   109   2e-24   Citrus sinensis [apfelsine]
ref|XP_010486710.1|  PREDICTED: cellulose synthase A catalytic su...    110   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010486709.1|  PREDICTED: cellulose synthase A catalytic su...    110   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006369624.1|  hypothetical protein POPTR_0001s27320g             110   2e-24   
emb|CBI29854.3|  unnamed protein product                                110   3e-24   Vitis vinifera
gb|AAC39336.1|  cellulose synthase catalytic subunit                    110   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196136.1|  cellulose synthase A catalytic subunit 3 [UDP-f...    110   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002529615.1|  Cellulose synthase A catalytic subunit 6 [UD...    109   4e-24   
ref|XP_003542849.1|  PREDICTED: cellulose synthase A catalytic su...    109   4e-24   Glycine max [soybeans]
gb|KHN37622.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    109   4e-24   Glycine soja [wild soybean]
ref|XP_010653789.1|  PREDICTED: cellulose synthase A catalytic su...    109   4e-24   Vitis vinifera
gb|ACC59195.1|  cellulose synthase                                      109   4e-24   Betula platyphylla [Asian white birch]
gb|KDO83414.1|  hypothetical protein CISIN_1g001413mg                   109   4e-24   Citrus sinensis [apfelsine]
ref|XP_002873198.1|  hypothetical protein ARALYDRAFT_487306             109   4e-24   
ref|XP_009386450.1|  PREDICTED: probable cellulose synthase A cat...    109   5e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007052528.1|  Cellulose synthase family protein isoform 4        109   5e-24   
gb|AFZ78557.1|  cellulose synthase                                      109   5e-24   Populus tomentosa [Chinese white poplar]
gb|AEP33557.1|  cellulose synthase catalytic subunit                    109   5e-24   Gossypium gossypioides
gb|KHG16921.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    109   5e-24   Gossypium arboreum [tree cotton]
ref|XP_011047398.1|  PREDICTED: cellulose synthase A catalytic su...    109   6e-24   Populus euphratica
gb|AEP33540.1|  cellulose synthase catalytic subunit                    109   6e-24   Gossypium mustelinum
gb|AEP33543.1|  cellulose synthase catalytic subunit                    109   6e-24   Gossypium darwinii
gb|AEP33541.1|  cellulose synthase catalytic subunit                    108   7e-24   Gossypium mustelinum
ref|XP_010278977.1|  PREDICTED: cellulose synthase A catalytic su...    108   7e-24   Nelumbo nucifera [Indian lotus]
gb|ADZ16120.1|  cellulose synthase A3                                   108   8e-24   Gossypium herbaceum subsp. africanum
gb|KJB22792.1|  hypothetical protein B456_004G065900                    108   8e-24   Gossypium raimondii
gb|ADZ16121.1|  cellulose synthase A3                                   108   8e-24   Gossypium raimondii
gb|AEP33536.1|  cellulose synthase catalytic subunit                    108   8e-24   Gossypium thurberi
gb|AAD39534.2|  cellulose synthase catalytic subunit                    108   8e-24   Gossypium hirsutum [American cotton]
gb|AEP33545.1|  cellulose synthase catalytic subunit                    108   9e-24   Gossypium tomentosum
ref|XP_008790520.1|  PREDICTED: probable cellulose synthase A cat...    108   9e-24   Phoenix dactylifera
gb|AEP33547.1|  cellulose synthase catalytic subunit                    108   9e-24   Gossypium barbadense var. brasiliense
gb|AEP33554.1|  cellulose synthase catalytic subunit                    108   9e-24   Gossypium davidsonii
gb|AEP33538.1|  cellulose synthase catalytic subunit                    108   9e-24   Gossypium schwendimanii
gb|AEP33553.1|  cellulose synthase catalytic subunit                    108   9e-24   Gossypium harknessii
gb|AEP33552.1|  cellulose synthase catalytic subunit                    108   9e-24   Gossypium armourianum
gb|AEP33551.1|  cellulose synthase catalytic subunit                    108   9e-24   Gossypium hirsutum subsp. latifolium
gb|AEP33537.1|  cellulose synthase catalytic subunit                    108   9e-24   Gossypium laxum
gb|ADZ16119.1|  cellulose synthase A3                                   108   9e-24   Gossypium barbadense [Egyptian cotton]
gb|AII73575.1|  cellulose synthase 3                                    108   1e-23   Medicago sativa [alfalfa]
ref|XP_003599196.1|  Cellulose synthase                                 108   1e-23   Medicago truncatula
ref|XP_009130870.1|  PREDICTED: cellulose synthase A catalytic su...    108   1e-23   Brassica rapa
emb|CDY52141.1|  BnaA03g55200D                                          108   1e-23   Brassica napus [oilseed rape]
gb|ADZ16123.1|  cellulose synthase A3                                   108   1e-23   Gossypium hirsutum [American cotton]
ref|XP_006373780.1|  hypothetical protein POPTR_0016s05520g             108   1e-23   Populus trichocarpa [western balsam poplar]
gb|AFZ78565.1|  cellulose synthase                                      108   1e-23   Populus tomentosa [Chinese white poplar]
gb|ACU87559.2|  cellulose synthase                                      108   1e-23   Leucaena leucocephala [cassie]
ref|XP_006398979.1|  hypothetical protein EUTSA_v10012528mg             108   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_009407580.1|  PREDICTED: probable cellulose synthase A cat...    108   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAT66941.1|  CesA2                                                   108   1e-23   Acacia mangium
gb|AEE60898.1|  cellulose synthase                                      108   1e-23   Populus tomentosa [Chinese white poplar]
ref|XP_002314037.1|  cellulose synthase family protein                  108   1e-23   
gb|AFZ78564.1|  cellulose synthase                                      108   1e-23   Populus tomentosa [Chinese white poplar]
gb|AEP33559.1|  cellulose synthase catalytic subunit                    108   1e-23   Gossypium trilobum
gb|ACU80553.2|  cellulose synthase                                      108   1e-23   Leucaena leucocephala [cassie]
ref|XP_011033321.1|  PREDICTED: cellulose synthase A catalytic su...    108   2e-23   Populus euphratica
ref|XP_010937172.1|  PREDICTED: probable cellulose synthase A cat...    107   2e-23   Elaeis guineensis
ref|XP_006289427.1|  hypothetical protein CARUB_v10002932mg             107   2e-23   Capsella rubella
ref|XP_004499886.1|  PREDICTED: cellulose synthase A catalytic su...    107   2e-23   Cicer arietinum [garbanzo]
ref|XP_010491404.1|  PREDICTED: cellulose synthase A catalytic su...    107   2e-23   
gb|AGC65585.1|  CESA3ixr1-2                                             107   2e-23   Binary plant gene expression vector pKM24-MD1
gb|AGC65584.1|  GFP-CESA3ixr1-2                                         107   3e-23   Binary plant gene expression vector pKM24-MD1
ref|XP_010464777.1|  PREDICTED: cellulose synthase A catalytic su...    107   3e-23   
ref|XP_010464776.1|  PREDICTED: cellulose synthase A catalytic su...    107   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010257191.1|  PREDICTED: cellulose synthase A catalytic su...    107   4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_011020351.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    106   5e-23   Populus euphratica
dbj|BAJ33658.1|  unnamed protein product                                106   5e-23   Eutrema halophilum
ref|XP_011048033.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    106   5e-23   Populus euphratica
ref|XP_010906116.1|  PREDICTED: probable cellulose synthase A cat...    106   5e-23   Elaeis guineensis
ref|XP_011093547.1|  PREDICTED: cellulose synthase A catalytic su...    106   6e-23   
ref|XP_002322712.1|  cellulose synthase family protein                  106   6e-23   
ref|XP_009407595.1|  PREDICTED: probable cellulose synthase A cat...    106   6e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011033320.1|  PREDICTED: cellulose synthase A catalytic su...    106   7e-23   Populus euphratica
emb|CDX80951.1|  BnaC03g02050D                                          105   8e-23   
ref|XP_002308955.1|  cellulose synthase family protein                  105   1e-22   
ref|XP_004306536.1|  PREDICTED: cellulose synthase A catalytic su...    105   1e-22   Fragaria vesca subsp. vesca
gb|KDO83412.1|  hypothetical protein CISIN_1g001413mg                   105   1e-22   Citrus sinensis [apfelsine]
ref|XP_010452418.1|  PREDICTED: cellulose synthase A catalytic su...    105   1e-22   Camelina sativa [gold-of-pleasure]
emb|CDY04942.1|  BnaAnng01240D                                          105   1e-22   
ref|XP_009125590.1|  PREDICTED: cellulose synthase A catalytic su...    105   1e-22   Brassica rapa
gb|KDP43475.1|  hypothetical protein JCGZ_16762                         105   1e-22   Jatropha curcas
ref|XP_010491044.1|  PREDICTED: cellulose synthase A catalytic su...    105   1e-22   Camelina sativa [gold-of-pleasure]
emb|CDP13491.1|  unnamed protein product                                105   2e-22   Coffea canephora [robusta coffee]
gb|AEP33556.1|  cellulose synthase catalytic subunit                    105   2e-22   Gossypium aridum
emb|CDY14127.1|  BnaC02g02440D                                          105   2e-22   Brassica napus [oilseed rape]
ref|XP_008460760.1|  PREDICTED: cellulose synthase A catalytic su...    104   2e-22   Cucumis melo [Oriental melon]
gb|AEP33539.1|  cellulose synthase catalytic subunit                    104   2e-22   Gossypium turneri
ref|XP_004149389.1|  PREDICTED: cellulose synthase A catalytic su...    104   2e-22   Cucumis sativus [cucumbers]
ref|XP_004162186.1|  PREDICTED: cellulose synthase A catalytic su...    104   2e-22   
gb|AHL45025.1|  cellulose synthase 3A                                   104   3e-22   Linum usitatissimum
gb|AHL45026.1|  cellulose synthase 3B                                   104   3e-22   Linum usitatissimum
gb|EAZ03185.1|  hypothetical protein OsI_25338                          104   3e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001059162.1|  Os07g0208500                                       104   3e-22   
ref|XP_007148880.1|  hypothetical protein PHAVU_005G022100g             103   4e-22   Phaseolus vulgaris [French bean]
ref|XP_010667061.1|  PREDICTED: cellulose synthase A catalytic su...    103   4e-22   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG03009.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    103   4e-22   Gossypium arboreum [tree cotton]
ref|XP_004955797.1|  PREDICTED: probable cellulose synthase A cat...    103   4e-22   Setaria italica
ref|XP_009601834.1|  PREDICTED: cellulose synthase A catalytic su...    103   5e-22   Nicotiana tomentosiformis
gb|KJB25017.1|  hypothetical protein B456_004G172400                    103   5e-22   Gossypium raimondii
gb|KJB25016.1|  hypothetical protein B456_004G172400                    103   5e-22   Gossypium raimondii
ref|XP_002963550.1|  family 2 glycosyltransferase                       103   5e-22   
ref|XP_008784835.1|  PREDICTED: probable cellulose synthase A cat...    103   6e-22   Phoenix dactylifera
gb|AFI71894.1|  cellulose synthase 3                                    103   6e-22   Paeonia lactiflora [common garden peony]
ref|NP_001104959.1|  cellulose synthase-9                               103   7e-22   
ref|XP_008668614.1|  PREDICTED: cellulose synthase-9 isoform X1         103   7e-22   
ref|NP_001105621.1|  cellulose synthase-4                               103   8e-22   
tpg|DAA59989.1|  TPA: putative cellulose synthase family protein        103   9e-22   
ref|XP_010547260.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    102   9e-22   
ref|XP_006838305.1|  hypothetical protein AMTR_s00103p00124340          102   9e-22   Amborella trichopoda
gb|AAY43220.1|  cellulose synthase BoCesA4                              102   1e-21   Bambusa oldhamii
ref|XP_006650766.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...    102   1e-21   
gb|KDO83415.1|  hypothetical protein CISIN_1g001413mg                   102   1e-21   Citrus sinensis [apfelsine]
ref|XP_002461675.1|  hypothetical protein SORBIDRAFT_02g006290          102   1e-21   
gb|KDO83417.1|  hypothetical protein CISIN_1g001413mg                   102   1e-21   Citrus sinensis [apfelsine]
gb|KDO83416.1|  hypothetical protein CISIN_1g001413mg                   102   1e-21   Citrus sinensis [apfelsine]
ref|XP_006439112.1|  hypothetical protein CICLE_v10030723mg             102   1e-21   
ref|XP_006439115.1|  hypothetical protein CICLE_v10030723mg             102   1e-21   
ref|XP_006657551.1|  PREDICTED: probable cellulose synthase A cat...    102   1e-21   Oryza brachyantha
gb|ACZ82298.1|  cellulose synthase                                      102   2e-21   Phyllostachys edulis [kikko-chiku]
ref|XP_003557396.1|  PREDICTED: probable cellulose synthase A cat...    102   2e-21   Brachypodium distachyon [annual false brome]
gb|ADH95191.1|  cellulose synthase                                      101   2e-21   Phyllostachys edulis [kikko-chiku]
ref|XP_007052525.1|  Cellulose synthase family protein isoform 1        101   3e-21   
ref|XP_010241248.1|  PREDICTED: cellulose synthase A catalytic su...    101   3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_006842872.1|  hypothetical protein AMTR_s00081p00171100          101   3e-21   Amborella trichopoda
ref|XP_009799381.1|  PREDICTED: cellulose synthase A catalytic su...    101   3e-21   Nicotiana sylvestris
ref|XP_003533898.2|  PREDICTED: cellulose synthase A catalytic su...    101   4e-21   Glycine max [soybeans]
gb|ACS94418.1|  cellulose synthase A                                  98.6    4e-21   Leucaena leucocephala [cassie]
gb|ACT16002.1|  cellulose synthase                                      100   5e-21   Phyllostachys edulis [kikko-chiku]
ref|XP_010228235.1|  PREDICTED: probable cellulose synthase A cat...    100   5e-21   Brachypodium distachyon [annual false brome]
ref|XP_010925238.1|  PREDICTED: probable cellulose synthase A cat...    100   5e-21   Elaeis guineensis
gb|EPS69824.1|  hypothetical protein M569_04932                         100   6e-21   Genlisea aurea
ref|XP_002307145.1|  cellulose synthase family protein                  100   6e-21   Populus trichocarpa [western balsam poplar]
ref|XP_004503981.1|  PREDICTED: cellulose synthase A catalytic su...    100   6e-21   Cicer arietinum [garbanzo]
ref|XP_008784981.1|  PREDICTED: probable cellulose synthase A cat...    100   7e-21   Phoenix dactylifera
ref|XP_010914890.1|  PREDICTED: probable cellulose synthase A cat...    100   7e-21   Elaeis guineensis
gb|AAY43222.1|  cellulose synthase BoCesA5                              100   7e-21   Bambusa oldhamii
ref|XP_008219478.1|  PREDICTED: cellulose synthase A catalytic su...    100   7e-21   Prunus mume [ume]
ref|XP_007221583.1|  hypothetical protein PRUPE_ppa000611mg             100   7e-21   Prunus persica
gb|AAQ63936.1|  cellulose synthase                                      100   7e-21   Pinus radiata
ref|XP_004981340.1|  PREDICTED: probable cellulose synthase A cat...    100   8e-21   Setaria italica
ref|XP_008792060.1|  PREDICTED: probable cellulose synthase A cat...    100   8e-21   Phoenix dactylifera
gb|AAO25581.1|  cellulose synthase                                      100   8e-21   Populus tremuloides
ref|XP_002960719.1|  hypothetical protein SELMODRAFT_73698              100   9e-21   Selaginella moellendorffii
ref|XP_007137035.1|  hypothetical protein PHAVU_009G094200g             100   9e-21   Phaseolus vulgaris [French bean]
ref|XP_002983952.1|  family 2 glycosyltransferase                       100   9e-21   
gb|KHN07088.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    100   9e-21   Glycine soja [wild soybean]
ref|XP_004136343.1|  PREDICTED: cellulose synthase A catalytic su...    100   9e-21   Cucumis sativus [cucumbers]
ref|XP_003526416.1|  PREDICTED: cellulose synthase A catalytic su...    100   9e-21   Glycine max [soybeans]
gb|ACO06090.1|  cellulose synthase                                      100   1e-20   Phyllostachys edulis [kikko-chiku]
ref|XP_008466397.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    1e-20   Cucumis melo [Oriental melon]
gb|KGN60109.1|  hypothetical protein Csa_3G878780                     99.8    1e-20   Cucumis sativus [cucumbers]
ref|XP_004135931.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    1e-20   Cucumis sativus [cucumbers]
ref|NP_001104955.1|  cellulose synthase5                              99.8    1e-20   
tpg|DAA52080.1|  TPA: cellulose synthase5                             99.8    1e-20   
ref|XP_011013552.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    1e-20   Populus euphratica
gb|AAT09898.1|  cellulose synthase                                    99.8    1e-20   Populus tremula x Populus tremuloides
ref|XP_011013550.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    1e-20   Populus euphratica
ref|XP_011021978.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    1e-20   Populus euphratica
ref|XP_011021980.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    1e-20   Populus euphratica
ref|XP_004291468.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    1e-20   Fragaria vesca subsp. vesca
ref|XP_008461291.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    1e-20   Cucumis melo [Oriental melon]
ref|XP_011459196.1|  PREDICTED: cellulose synthase A catalytic su...  99.8    1e-20   Fragaria vesca subsp. vesca
gb|AAY43221.1|  cellulose synthase BoCesA4                            99.8    1e-20   Bambusa oldhamii
gb|AFG25777.1|  cellulose synthase 3                                  99.8    1e-20   Bambusa emeiensis
gb|KJB22794.1|  hypothetical protein B456_004G065900                  99.4    1e-20   Gossypium raimondii
gb|KJB14950.1|  hypothetical protein B456_002G150300                  99.4    1e-20   Gossypium raimondii
gb|AFB18634.1|  CESA5                                                 99.4    1e-20   Gossypium hirsutum [American cotton]
ref|XP_010250039.1|  PREDICTED: probable cellulose synthase A cat...  99.4    2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010648652.1|  PREDICTED: cellulose synthase A catalytic su...  99.4    2e-20   Vitis vinifera
gb|AGV22109.1|  cellulose synthase 7                                  99.4    2e-20   Betula luminifera [liang ye hua]
ref|XP_006296592.1|  hypothetical protein CARUB_v10012872mg           99.4    2e-20   Capsella rubella
gb|KCW81421.1|  hypothetical protein EUGRSUZ_C02801                   99.4    2e-20   Eucalyptus grandis [rose gum]
ref|NP_001289657.1|  cellulose synthase A catalytic subunit 1         99.0    2e-20   Eucalyptus grandis [rose gum]
ref|XP_010228016.1|  PREDICTED: probable cellulose synthase A cat...  99.0    2e-20   
ref|XP_010228012.1|  PREDICTED: probable cellulose synthase A cat...  99.0    2e-20   
gb|AEK31219.1|  cellulose synthase A                                  99.0    2e-20   Eucalyptus camaldulensis
gb|AFZ78553.1|  cellulose synthase                                    99.0    2e-20   Populus tomentosa [Chinese white poplar]
ref|XP_010254360.1|  PREDICTED: probable cellulose synthase A cat...  99.0    2e-20   Nelumbo nucifera [Indian lotus]
gb|AFM37966.1|  cellulose synthase catalytic subunit                  99.0    2e-20   Cunninghamia lanceolata [China fir]
ref|XP_008366693.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    3e-20   Malus domestica [apple tree]
ref|NP_001051648.1|  Os03g0808100                                     98.6    3e-20   
ref|XP_002463687.1|  hypothetical protein SORBIDRAFT_01g004210        98.6    3e-20   
gb|KHG02518.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...  98.6    3e-20   Gossypium arboreum [tree cotton]
ref|XP_008232182.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    3e-20   Prunus mume [ume]
gb|KHN39939.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...  98.6    3e-20   Glycine soja [wild soybean]
gb|KDP33612.1|  hypothetical protein JCGZ_07183                       98.6    3e-20   Jatropha curcas
ref|XP_007213713.1|  hypothetical protein PRUPE_ppa000567mg           98.6    3e-20   Prunus persica
ref|XP_008394069.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    3e-20   
ref|XP_009623502.1|  PREDICTED: cellulose synthase A catalytic su...  98.6    3e-20   Nicotiana tomentosiformis
ref|XP_003630174.1|  Cellulose synthase A catalytic subunit           98.6    3e-20   Medicago truncatula
gb|KEH19084.1|  cellulose synthase-like protein                       98.6    3e-20   Medicago truncatula
ref|XP_003522623.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    4e-20   Glycine max [soybeans]
ref|XP_007159799.1|  hypothetical protein PHAVU_002G268200g           98.2    4e-20   Phaseolus vulgaris [French bean]
gb|KHN08123.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...  98.2    4e-20   Glycine soja [wild soybean]
ref|XP_009768318.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    4e-20   Nicotiana sylvestris
ref|XP_010525969.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    4e-20   Tarenaya hassleriana [spider flower]
ref|XP_003531396.1|  PREDICTED: cellulose synthase A catalytic su...  98.2    4e-20   Glycine max [soybeans]
emb|CBI21020.3|  unnamed protein product                              97.8    4e-20   Vitis vinifera
gb|EPS68064.1|  hypothetical protein M569_06709                       98.2    4e-20   Genlisea aurea
gb|EMT00418.1|  Putative cellulose synthase A catalytic subunit 2...  97.8    5e-20   
ref|XP_009355721.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    5e-20   Pyrus x bretschneideri [bai li]
ref|XP_004245031.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    5e-20   Solanum lycopersicum
gb|EYU32338.1|  hypothetical protein MIMGU_mgv1a000544mg              97.8    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_003546888.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    5e-20   Glycine max [soybeans]
ref|XP_010088737.1|  Isoxaben-resistant protein 2                     97.8    6e-20   Morus notabilis
ref|XP_010048223.1|  PREDICTED: cellulose synthase A catalytic su...  97.8    6e-20   Eucalyptus grandis [rose gum]
ref|XP_002308657.1|  cellulose synthase family protein                97.8    6e-20   
gb|KDP35302.1|  hypothetical protein JCGZ_09461                       97.8    6e-20   Jatropha curcas
gb|AFZ78556.1|  cellulose synthase                                    97.4    7e-20   Populus tomentosa [Chinese white poplar]
gb|AAO25536.1|  cellulose synthase                                    97.4    7e-20   Populus tremuloides
ref|XP_002310628.1|  cellulose synthase family protein                97.4    7e-20   Populus trichocarpa [western balsam poplar]
gb|AGV22108.1|  cellulose synthase 6                                  97.4    7e-20   Betula luminifera [liang ye hua]
ref|XP_002310629.1|  hypothetical protein POPTR_0007s07120g           97.4    7e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011039709.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    8e-20   Populus euphratica
ref|XP_002324291.1|  TGACG-motif binding family protein               97.4    8e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011071168.1|  PREDICTED: cellulose synthase A catalytic su...  97.4    8e-20   Sesamum indicum [beniseed]
ref|XP_002967423.1|  hypothetical protein SELMODRAFT_86720            97.1    9e-20   
ref|XP_002960291.1|  family 2 glycosyltransferase                     97.1    9e-20   
ref|XP_002515536.1|  Cellulose synthase A catalytic subunit 6 [UD...  97.1    9e-20   Ricinus communis
gb|KCW81422.1|  hypothetical protein EUGRSUZ_C02801                   97.1    9e-20   Eucalyptus grandis [rose gum]
emb|CDP12843.1|  unnamed protein product                              97.1    1e-19   Coffea canephora [robusta coffee]
gb|AHL45024.1|  cellulose synthase 1B                                 97.1    1e-19   Linum usitatissimum
ref|XP_011026459.1|  PREDICTED: cellulose synthase A catalytic su...  97.1    1e-19   Populus euphratica
gb|AAT66940.1|  CesA1                                                 97.1    1e-19   Acacia mangium
dbj|BAJ96780.1|  predicted protein                                    96.7    1e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010110357.1|  Protein radially swollen 1                       96.7    1e-19   Morus notabilis
tpg|DAA52081.1|  TPA: cellulose synthase5                             96.3    1e-19   
ref|XP_011081578.1|  PREDICTED: cellulose synthase A catalytic su...  96.7    1e-19   Sesamum indicum [beniseed]
ref|XP_006361724.1|  PREDICTED: cellulose synthase A catalytic su...  96.7    1e-19   
gb|AGC97433.2|  cellulose synthase                                    96.7    2e-19   
gb|ABI78958.1|  cellulose synthase 5                                  96.3    2e-19   
gb|KHG24947.1|  Cellulose synthase A catalytic subunit 2 [UDP-for...  96.3    2e-19   
ref|XP_010106861.1|  Isoxaben-resistant protein 2                     96.3    2e-19   
ref|XP_001757887.1|  cellulose synthase 5, glycosyltransferase fa...  96.3    2e-19   
emb|CDP11417.1|  unnamed protein product                              96.3    2e-19   
tpg|DAA53225.1|  TPA: cellulose synthase3                             96.3    2e-19   
ref|XP_010520165.1|  PREDICTED: cellulose synthase A catalytic su...  96.3    2e-19   
gb|AAR29963.1|  putative cellulose synthase catalytic subunit         96.3    2e-19   
gb|KJB18370.1|  hypothetical protein B456_003G049300                  96.3    2e-19   
emb|CAN60659.1|  hypothetical protein VITISV_018069                   96.3    2e-19   
gb|KJB18373.1|  hypothetical protein B456_003G049300                  95.9    2e-19   
ref|XP_008463088.1|  PREDICTED: cellulose synthase A catalytic su...  95.9    2e-19   
ref|XP_004138382.1|  PREDICTED: cellulose synthase A catalytic su...  95.9    2e-19   
ref|XP_008463087.1|  PREDICTED: cellulose synthase A catalytic su...  95.9    2e-19   
ref|XP_006450469.1|  hypothetical protein CICLE_v10007296mg           95.9    2e-19   
gb|AAY43225.1|  cellulose synthase BoCesA3                            95.9    2e-19   
gb|AFG25776.1|  cellulose synthase 2                                  95.9    3e-19   
gb|AFW81389.1|  cellulose synthase1                                   95.9    3e-19   
gb|AIA61439.1|  cellulose synthase                                    95.9    3e-19   
gb|AFW81388.1|  cellulose synthase1                                   95.9    3e-19   
gb|ACZ82297.1|  cellulose synthase                                    95.9    3e-19   
gb|EYU17481.1|  hypothetical protein MIMGU_mgv1a000527mg              95.9    3e-19   
ref|XP_010558902.1|  PREDICTED: cellulose synthase A catalytic su...  95.9    3e-19   
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...  95.5    3e-19   
ref|XP_003568832.2|  PREDICTED: probable cellulose synthase A cat...  95.9    3e-19   
ref|XP_007048203.1|  Cellulose synthase 6                             95.5    3e-19   
gb|AHL45023.1|  cellulose synthase 1A                                 95.5    3e-19   
gb|AAY43219.2|  cellulose synthase BoCesA3                            95.5    3e-19   
ref|XP_002319002.2|  cellulose synthase 6 family protein              95.5    3e-19   
ref|XP_010432725.1|  PREDICTED: cellulose synthase A catalytic su...  95.5    3e-19   
ref|XP_010526207.1|  PREDICTED: cellulose synthase A catalytic su...  95.5    3e-19   
ref|XP_006654097.1|  PREDICTED: probable cellulose synthase A cat...  95.5    3e-19   
ref|XP_010447394.1|  PREDICTED: cellulose synthase A catalytic su...  95.5    3e-19   
ref|XP_002871389.1|  hypothetical protein ARALYDRAFT_908936           95.5    3e-19   
ref|NP_196549.1|  cellulose synthase A catalytic subunit 5 [UDP-f...  95.5    3e-19   
ref|XP_008796456.1|  PREDICTED: probable cellulose synthase A cat...  95.5    3e-19   
gb|AFZ78558.1|  cellulose synthase                                    95.5    3e-19   
ref|XP_007213712.1|  hypothetical protein PRUPE_ppa000567mg           95.1    3e-19   
ref|XP_010091161.1|  OsCesA7 protein                                  95.5    3e-19   
ref|XP_002265955.1|  PREDICTED: cellulose synthase A catalytic su...  95.5    4e-19   
ref|XP_001767133.1|  cellulose synthase 4, glycosyltransferase fa...  95.5    4e-19   
ref|XP_010556863.1|  PREDICTED: cellulose synthase A catalytic su...  95.5    4e-19   
ref|XP_010932185.1|  PREDICTED: probable cellulose synthase A cat...  95.5    4e-19   
ref|XP_002440694.1|  hypothetical protein SORBIDRAFT_09g005280        95.1    4e-19   
gb|EMT09789.1|  Putative cellulose synthase A catalytic subunit 8...  95.1    4e-19   
dbj|BAD06322.1|  putative cellulose synthase                          95.1    4e-19   
ref|XP_006367803.1|  PREDICTED: cellulose synthase A catalytic su...  95.1    4e-19   
ref|NP_001105574.1|  cellulose synthase2                              95.1    4e-19   
ref|XP_004237809.1|  PREDICTED: cellulose synthase A catalytic su...  95.1    4e-19   
ref|XP_009758840.1|  PREDICTED: cellulose synthase A catalytic su...  95.1    4e-19   
gb|AAT09895.1|  cellulose synthase                                    95.1    4e-19   
gb|AFZ78561.1|  cellulose synthase                                    95.1    4e-19   
ref|XP_008796554.1|  PREDICTED: probable cellulose synthase A cat...  95.1    4e-19   
ref|XP_002302169.1|  CesA7A-like family protein                       95.1    5e-19   
ref|XP_010541595.1|  PREDICTED: cellulose synthase A catalytic su...  95.1    5e-19   
gb|AGV22110.1|  cellulose synthase 8                                  95.1    5e-19   
ref|XP_006399471.1|  hypothetical protein EUTSA_v10012521mg           95.1    5e-19   
ref|XP_010260984.1|  PREDICTED: cellulose synthase A catalytic su...  95.1    5e-19   
ref|XP_011042869.1|  PREDICTED: cellulose synthase A catalytic su...  95.1    5e-19   
gb|AFZ78560.1|  cellulose synthase                                    94.7    5e-19   
ref|XP_011074751.1|  PREDICTED: cellulose synthase A catalytic su...  94.7    5e-19   
dbj|BAG06272.1|  cellulose synthase Z632                              94.7    5e-19   
gb|AEE60899.1|  cellulose synthase                                    94.7    5e-19   
ref|XP_011044242.1|  PREDICTED: cellulose synthase A catalytic su...  94.7    5e-19   
ref|XP_004968377.1|  PREDICTED: probable cellulose synthase A cat...  94.7    6e-19   
ref|XP_010091789.1|  OsCesA4 protein                                  95.1    6e-19   
emb|CBI18221.3|  unnamed protein product                              94.7    6e-19   
ref|XP_007019545.1|  Cellulose synthase 6                             94.7    6e-19   
ref|XP_010270654.1|  PREDICTED: probable cellulose synthase A cat...  94.7    6e-19   
gb|ACT16001.1|  cellulose synthase                                    94.7    6e-19   
gb|KJB18372.1|  hypothetical protein B456_003G049300                  94.7    6e-19   
gb|AEK86669.1|  cellulose synthase 5                                  94.7    6e-19   
ref|XP_010546378.1|  PREDICTED: cellulose synthase A catalytic su...  94.7    6e-19   
ref|XP_011079381.1|  PREDICTED: cellulose synthase A catalytic su...  94.7    6e-19   
ref|XP_011079380.1|  PREDICTED: cellulose synthase A catalytic su...  94.7    6e-19   
ref|XP_011079382.1|  PREDICTED: cellulose synthase A catalytic su...  94.7    7e-19   
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g           94.7    7e-19   
emb|CBI21555.3|  unnamed protein product                              94.4    7e-19   
ref|XP_007013842.1|  Cellulose synthase 1                             94.4    7e-19   
ref|XP_009629755.1|  PREDICTED: cellulose synthase A catalytic su...  94.4    7e-19   
ref|XP_011101270.1|  PREDICTED: cellulose synthase A catalytic su...  94.4    7e-19   
ref|XP_002277635.1|  PREDICTED: cellulose synthase A catalytic su...  94.4    8e-19   
gb|ACJ38667.1|  cellulose synthase                                    94.4    8e-19   
ref|XP_010445007.1|  PREDICTED: cellulose synthase A catalytic su...  94.4    8e-19   
ref|XP_006364140.1|  PREDICTED: cellulose synthase A catalytic su...  94.4    8e-19   
ref|XP_010491630.1|  PREDICTED: cellulose synthase A catalytic su...  94.4    8e-19   
ref|XP_010452989.1|  PREDICTED: cellulose synthase A catalytic su...  94.4    9e-19   
ref|XP_004152851.1|  PREDICTED: cellulose synthase A catalytic su...  94.4    9e-19   
gb|EYU31127.1|  hypothetical protein MIMGU_mgv1a000549mg              94.4    9e-19   
gb|EYU36833.1|  hypothetical protein MIMGU_mgv1a000540mg              94.4    9e-19   
gb|AAZ86086.1|  cellulose synthase catalytic subunit                  94.4    9e-19   
gb|ABI78959.1|  cellulose synthase 6                                  94.4    9e-19   
ref|XP_006849886.1|  hypothetical protein AMTR_s00022p00086120        94.4    9e-19   
ref|XP_010547636.1|  PREDICTED: cellulose synthase A catalytic su...  94.4    9e-19   
ref|XP_008348984.1|  PREDICTED: cellulose synthase A catalytic su...  94.0    9e-19   
gb|KHN41284.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...  94.0    9e-19   
emb|CDX72357.1|  BnaC07g43790D                                        94.0    1e-18   
gb|AAZ86087.1|  cellulose synthase catalytic subunit                  94.0    1e-18   
ref|XP_006285557.1|  hypothetical protein CARUB_v10006999mg           94.0    1e-18   
ref|NP_194967.1|  cellulose synthase A catalytic subunit 1 [UDP-f...  94.0    1e-18   
ref|XP_002867245.1|  hypothetical protein ARALYDRAFT_491486           94.0    1e-18   
ref|NP_001104954.1|  cellulose synthase-1                             94.0    1e-18   
gb|ABI78960.1|  cellulose synthase 7                                  94.0    1e-18   
gb|ACS68189.1|  cellulose synthase 1.1 catalytic subunit              94.0    1e-18   
gb|KFK29850.1|  hypothetical protein AALP_AA7G186800                  94.0    1e-18   
gb|KHN34038.1|  Cellulose synthase A catalytic subunit 6 [UDP-for...  94.0    1e-18   
ref|XP_003525098.1|  PREDICTED: cellulose synthase A catalytic su...  94.0    1e-18   
gb|ADR74043.1|  cellulose synthase                                    94.0    1e-18   
gb|AFZ78555.1|  cellulose synthase                                    94.0    1e-18   
gb|ADV58936.1|  cellulose synthase                                    94.0    1e-18   
gb|AAP40636.1|  cellulose synthase 6                                  94.0    1e-18   
gb|KJB11046.1|  hypothetical protein B456_001G238100                  94.0    1e-18   
gb|KJB11047.1|  hypothetical protein B456_001G238100                  94.0    1e-18   
emb|CDY13484.1|  BnaA03g52020D                                        94.0    1e-18   
gb|AAY43217.1|  cellulose synthase BoCesA1                            94.0    1e-18   
gb|ACS68190.1|  cellulose synthase 1.2 catalytic subunit              94.0    1e-18   
gb|AFW69155.1|  putative cellulose synthase family protein            94.0    1e-18   
gb|EYU17480.1|  hypothetical protein MIMGU_mgv1a000527mg              94.0    1e-18   
ref|XP_002306707.1|  CesA7A-like family protein                       94.0    1e-18   
ref|XP_006412477.1|  hypothetical protein EUTSA_v10024278mg           94.0    1e-18   
gb|AGT16647.1|  cellulose synthase                                    94.0    1e-18   
ref|XP_011023647.1|  PREDICTED: probable cellulose synthase A cat...  94.0    1e-18   
ref|XP_010241683.1|  PREDICTED: cellulose synthase A catalytic su...  94.0    1e-18   
ref|XP_004252570.1|  PREDICTED: cellulose synthase A catalytic su...  94.0    1e-18   
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...  93.6    1e-18   
ref|XP_006847152.1|  hypothetical protein AMTR_s00017p00239550        93.6    1e-18   
ref|XP_004290503.1|  PREDICTED: cellulose synthase A catalytic su...  93.6    1e-18   
ref|XP_004509860.1|  PREDICTED: cellulose synthase A catalytic su...  93.6    1e-18   
ref|XP_009597841.1|  PREDICTED: cellulose synthase A catalytic su...  93.6    1e-18   
gb|KCW70399.1|  hypothetical protein EUGRSUZ_F03635                   93.6    1e-18   
ref|XP_008440995.1|  PREDICTED: cellulose synthase A catalytic su...  93.6    1e-18   
ref|XP_009417280.1|  PREDICTED: probable cellulose synthase A cat...  93.6    1e-18   
gb|KHM98952.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...  93.6    1e-18   
gb|AAC29067.1|  cellulose synthase                                    93.6    1e-18   
ref|XP_006382504.1|  cellulose synthase 6 family protein              93.6    1e-18   
ref|NP_001289648.1|  probable cellulose synthase A catalytic subu...  93.6    2e-18   
gb|AAY43216.1|  cellulose synthase BoCesA8                            93.6    2e-18   
gb|KHG11461.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...  93.6    2e-18   
gb|AFZ78563.1|  cellulose synthase                                    93.6    2e-18   
ref|XP_011036833.1|  PREDICTED: probable cellulose synthase A cat...  93.6    2e-18   
gb|AES65133.2|  cellulose synthase-like protein                       93.6    2e-18   
gb|AFB18635.1|  CESA6                                                 93.6    2e-18   
ref|XP_009408434.1|  PREDICTED: probable cellulose synthase A cat...  93.6    2e-18   
ref|XP_003594882.1|  Cellulose synthase                               93.2    2e-18   
gb|KJB53892.1|  hypothetical protein B456_009G010200                  93.6    2e-18   
gb|KJB18371.1|  hypothetical protein B456_003G049300                  93.2    2e-18   
ref|XP_004141979.1|  PREDICTED: probable cellulose synthase A cat...  93.2    2e-18   
ref|XP_011036830.1|  PREDICTED: probable cellulose synthase A cat...  93.2    2e-18   
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg              93.2    2e-18   
ref|XP_009138081.1|  PREDICTED: cellulose synthase A catalytic su...  93.2    2e-18   
ref|XP_010689561.1|  PREDICTED: cellulose synthase A catalytic su...  93.2    2e-18   
gb|KCW70400.1|  hypothetical protein EUGRSUZ_F03635                   93.2    2e-18   
ref|XP_002864919.1|  hypothetical protein ARALYDRAFT_496689           93.2    2e-18   
ref|XP_009785781.1|  PREDICTED: cellulose synthase A catalytic su...  93.2    2e-18   
ref|XP_010670651.1|  PREDICTED: cellulose synthase A catalytic su...  93.2    2e-18   
gb|KHG10785.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...  93.2    2e-18   
gb|AEX20380.1|  cellulose synthase 2-Dt                               93.2    2e-18   
ref|XP_009358418.1|  PREDICTED: cellulose synthase A catalytic su...  93.2    2e-18   
ref|XP_004965873.1|  PREDICTED: probable cellulose synthase A cat...  93.2    2e-18   
gb|AEX20379.1|  cellulose synthase catalytic subunit 2-At             93.2    2e-18   
emb|CDY42621.1|  BnaC01g00330D                                        93.2    2e-18   
ref|XP_009115076.1|  PREDICTED: cellulose synthase A catalytic su...  93.2    2e-18   
gb|KHG11460.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...  93.2    2e-18   
ref|XP_002325122.1|  cellulose synthase family protein                93.2    2e-18   
ref|XP_010270659.1|  PREDICTED: probable cellulose synthase A cat...  93.2    2e-18   
emb|CDY41973.1|  BnaA01g05450D                                        93.2    2e-18   
emb|CDX68844.1|  BnaC01g06090D                                        93.2    2e-18   
tpg|DAA52078.1|  TPA: cellulose synthase5                             85.9    2e-18   
ref|NP_201279.1|  cellulose synthase A catalytic subunit 6 [UDP-f...  93.2    2e-18   
gb|ACS68191.1|  cellulose synthase 2.1 catalytic subunit              93.2    2e-18   
ref|XP_002524299.1|  Cellulose synthase A catalytic subunit 6 [UD...  93.2    2e-18   
gb|KHG19749.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...  92.8    2e-18   
ref|XP_002960761.1|  cellulose synthase 4-1                           92.8    2e-18   
gb|KCW78813.1|  hypothetical protein EUGRSUZ_C00246                   92.8    2e-18   
gb|AFB18636.1|  CESA7                                                 92.8    2e-18   
ref|XP_009385959.1|  PREDICTED: probable cellulose synthase A cat...  92.8    2e-18   
ref|XP_009350646.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    2e-18   
ref|XP_007138849.1|  hypothetical protein PHAVU_009G242700g           92.8    2e-18   
ref|XP_009350645.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    2e-18   
ref|XP_008243020.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    2e-18   
ref|XP_007204670.1|  hypothetical protein PRUPE_ppa000618mg           92.8    2e-18   
gb|KJB53884.1|  hypothetical protein B456_009G009700                  92.8    2e-18   
gb|AFB18637.1|  CESA8                                                 92.8    2e-18   
ref|XP_002460229.1|  hypothetical protein SORBIDRAFT_02g025020        92.8    2e-18   
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12          92.8    2e-18   
dbj|BAJ05813.1|  cellulose synthase catalytic subunit                 92.8    2e-18   
ref|NP_001063207.1|  Os09g0422500                                     92.8    2e-18   
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    2e-18   
ref|XP_008450511.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    2e-18   
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    2e-18   
ref|XP_009126053.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    3e-18   
gb|KJB07762.1|  hypothetical protein B456_001G044700                  92.8    3e-18   
ref|XP_006411737.1|  hypothetical protein EUTSA_v10024277mg           92.8    3e-18   
ref|XP_008338760.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    3e-18   
gb|AFR58756.2|  cellulose synthase 3                                  92.8    3e-18   
gb|AGJ71354.1|  cellulose synthase 3                                  92.8    3e-18   
gb|AEK31217.1|  cellulose synthase A                                  92.8    3e-18   
gb|KCW78815.1|  hypothetical protein EUGRSUZ_C00246                   92.8    3e-18   
gb|AGE09566.1|  cellulose synthase-like protein                       92.8    3e-18   
gb|AAM26299.1|  cellulose synthase                                    92.8    3e-18   
gb|KCW78814.1|  hypothetical protein EUGRSUZ_C00246                   92.8    3e-18   
gb|AAR29962.1|  putative cellulose synthase catalytic subunit         92.8    3e-18   
gb|KJB07761.1|  hypothetical protein B456_001G044700                  92.8    3e-18   
gb|KCW78812.1|  hypothetical protein EUGRSUZ_C00246                   92.8    3e-18   
gb|AAX18649.1|  cellulose synthase catalytic subunit                  92.8    3e-18   
gb|AHL45030.1|  cellulose synthase 6D                                 92.8    3e-18   
gb|ACQ99194.1|  cellulose synthase                                    92.8    3e-18   
ref|XP_006279743.1|  hypothetical protein CARUB_v10027598mg           92.8    3e-18   
ref|XP_003536418.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    3e-18   
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    3e-18   
ref|XP_008235611.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    3e-18   
ref|XP_011083940.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    3e-18   
ref|XP_010255731.1|  PREDICTED: probable cellulose synthase A cat...  92.8    3e-18   
ref|XP_010047060.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    3e-18   
gb|ACJ38665.1|  cellulose synthase                                    92.8    3e-18   
ref|XP_004287144.1|  PREDICTED: cellulose synthase A catalytic su...  92.8    3e-18   
gb|AAT57672.1|  cellulose synthase catalytic subunit                  92.8    3e-18   
gb|KJB22608.1|  hypothetical protein B456_004G057400                  92.8    3e-18   
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein      92.8    3e-18   



>ref|XP_004229630.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Solanum lycopersicum]
Length=1083

 Score =   126 bits (317),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            MD E D KGKSLKT   QVCQICGDGVGTTV+GE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MDPEGDVKGKSLKTLGGQVCQICGDGVGTTVNGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|NP_001275292.1| cellulose synthase [Solanum tuberosum]
 gb|AAP97495.1| cellulose synthase [Solanum tuberosum]
Length=1083

 Score =   126 bits (317),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            MD E D KGKSLKT   QVCQICGDGVGTTV+GE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MDPEGDVKGKSLKTLGGQVCQICGDGVGTTVNGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_011087713.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Sesamum indicum]
 ref|XP_011087722.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Sesamum indicum]
Length=1066

 Score =   121 bits (304),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 53/64 (83%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SEA TKGK+LK    QVCQICGD VG TVDGE FVAC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEAATKGKTLKNMGSQVCQICGDDVGLTVDGEPFVACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIA10372.1| cellulose synthase [Boehmeria nivea]
Length=1079

 Score =   118 bits (296),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            MDSEA+T  KSLK    QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MDSEAETGAKSLKNLGSQVCQICGDTVGKTTDGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|EYU29030.1| hypothetical protein MIMGU_mgv1a000570mg [Erythranthe guttata]
Length=1065

 Score =   117 bits (294),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SEA+ KGK+LK    QVCQICGD VG T DG+ FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEAENKGKALKNMGSQVCQICGDNVGLTADGDAFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEK31218.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1080

 Score =   117 bits (294),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GKS+K    QVCQICGD VG +VDGE FVAC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGGKSMKILGGQVCQICGDNVGKSVDGEPFVACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|ABY25277.1| cellulose synthase [Eucalyptus grandis]
Length=1080

 Score =   117 bits (294),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GKS+K    QVCQICGD VG +VDGE FVAC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGGKSMKILGGQVCQICGDNVGKSVDGEPFVACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|NP_001289668.1| cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Eucalyptus 
grandis]
 gb|ABY25274.1| cellulose synthase [Eucalyptus grandis]
 gb|KCW66107.1| hypothetical protein EUGRSUZ_G03380 [Eucalyptus grandis]
 gb|KCW66108.1| hypothetical protein EUGRSUZ_G03380 [Eucalyptus grandis]
Length=1080

 Score =   117 bits (294),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GKS+K    QVCQICGD VG +VDGE FVAC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGGKSMKILGGQVCQICGDNVGKSVDGEPFVACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AAY60846.1| cellulose synthase 4 [Eucalyptus grandis]
Length=1080

 Score =   117 bits (294),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GKS+K    QVCQICGD VG +VDGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGGKSMKILGGQVCQICGDNVGKSVDGESFVACSVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>emb|CDP07782.1| unnamed protein product [Coffea canephora]
Length=1083

 Score =   116 bits (290),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/64 (80%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +TKGK LK    Q CQICGD VG TVDGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETKGKVLKNLCGQACQICGDTVGKTVDGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_002278997.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Vitis vinifera]
Length=1081

 Score =   116 bits (290),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            MDSE ++  KSLK    QVCQICGD VG TVDGE F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MDSEGESGAKSLKGLGGQVCQICGDNVGKTVDGEPFIACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_004510986.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cicer arietinum]
Length=1077

 Score =   116 bits (290),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +  GK + T S QVCQICGD VG TVDGEQF+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGEAVGKPMTTLSAQVCQICGDNVGKTVDGEQFIACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
             CPQ
Sbjct  61   CCPQ  64



>ref|XP_010088232.1| OsCesA3 protein [Morus notabilis]
 gb|EXB32784.1| OsCesA3 protein [Morus notabilis]
Length=1077

 Score =   115 bits (288),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K++K+   QVCQICGD VG TVDGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKAMKSLGGQVCQICGDNVGKTVDGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_002298432.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
 ref|XP_006369625.1| cellulose synthase family protein [Populus trichocarpa]
 ref|XP_006369626.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
 gb|EEE83237.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
 gb|ERP66194.1| cellulose synthase family protein [Populus trichocarpa]
 gb|ERP66195.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
Length=1081

 Score =   114 bits (286),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AAL23710.2| cellulose synthase [Populus tremuloides]
Length=1078

 Score =   114 bits (285),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIS86004.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (285),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIS85991.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (285),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIS85990.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86003.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86006.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86010.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (285),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AFZ78554.1| cellulose synthase [Populus tomentosa]
 gb|AIS85972.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85973.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85974.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85975.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85976.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85979.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85984.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85985.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85986.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85988.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86012.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (285),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIS85996.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86001.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIS85978.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85980.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85981.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85982.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85983.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85992.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85995.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85997.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85998.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85999.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86007.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86008.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIS86011.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIS86009.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIS85989.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85993.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS85994.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86000.1| cellulose synthase 3 [Populus tomentosa]
 gb|AIS86002.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIS85987.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIS85977.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KJB19276.1| hypothetical protein B456_003G092600 [Gossypium raimondii]
Length=1068

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD+ AD+  KS K   QVCQIC D VG+  DGE FVACH+CAFPVCRPCYEYERKDG QS
Sbjct  1    MDATADSVAKSGKIGGQVCQICSDNVGSNADGESFVACHICAFPVCRPCYEYERKDGTQS  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>gb|AFB18638.1| CESA10 [Gossypium hirsutum]
Length=1068

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD+ AD+  KS K   QVCQIC D VG+  DGE FVACH+CAFPVCRPCYEYERKDG QS
Sbjct  1    MDATADSVAKSGKIGGQVCQICSDNVGSNADGESFVACHICAFPVCRPCYEYERKDGTQS  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>gb|KJB19277.1| hypothetical protein B456_003G092600 [Gossypium raimondii]
Length=1069

 Score =   114 bits (285),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD+ AD+  KS K   QVCQIC D VG+  DGE FVACH+CAFPVCRPCYEYERKDG QS
Sbjct  1    MDATADSVAKSGKIGGQVCQICSDNVGSNADGESFVACHICAFPVCRPCYEYERKDGTQS  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>gb|AGV22107.1| cellulose synthase 2 [Betula luminifera]
Length=1084

 Score =   114 bits (284),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GKS K     VCQICGD VG TVDGE F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETVGKSTKNLVGHVCQICGDNVGKTVDGEPFIACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>emb|CBI24889.3| unnamed protein product [Vitis vinifera]
Length=929

 Score =   113 bits (283),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 50/64 (78%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            MDSE ++  KSLK    QVCQICGD VG TVDGE F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MDSEGESGAKSLKGLGGQVCQICGDNVGKTVDGEPFIACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_007028786.1| Cellulose synthase family protein [Theobroma cacao]
 gb|EOY09288.1| Cellulose synthase family protein [Theobroma cacao]
Length=1069

 Score =   114 bits (284),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MDS AD+  KS K   QVCQIC D VG T D E FVACHVCAFPVCRPCYEYERKDG QS
Sbjct  1    MDSAADSVSKSGKMGGQVCQICSDNVGLTADSEPFVACHVCAFPVCRPCYEYERKDGTQS  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>gb|KHG04072.1| putative cellulose synthase A catalytic subunit 8 [UDP-forming] 
[Gossypium arboreum]
Length=1068

 Score =   113 bits (282),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD+ AD+  KS K   QVCQIC D VG+  DGE F+ACH+CAFPVCRPCYEYERKDG QS
Sbjct  1    MDATADSVAKSGKIGGQVCQICSDNVGSNADGESFLACHICAFPVCRPCYEYERKDGTQS  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>ref|XP_010032436.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Eucalyptus grandis]
 ref|XP_010032437.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Eucalyptus grandis]
 gb|KCW51830.1| hypothetical protein EUGRSUZ_J01278 [Eucalyptus grandis]
Length=1079

 Score =   112 bits (281),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+S+A+  GK LK+   QVCQICG+ VG T+DGE F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESDAENGGKPLKSLGGQVCQICGENVGKTLDGEPFIACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KDO83405.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83406.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83407.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83408.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83409.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83410.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83411.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=1079

 Score =   112 bits (281),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  KS+K    QVCQICGD VG TVDG  FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKSIKNVGGQVCQICGDNVGKTVDGNPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_006482874.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482875.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
 ref|XP_006482876.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X3 [Citrus sinensis]
 ref|XP_006482877.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X4 [Citrus sinensis]
Length=1079

 Score =   112 bits (281),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  KS+K    QVCQICGD VG TVDG  FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKSIKNLGGQVCQICGDNVGKTVDGNPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_006439113.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 ref|XP_006439114.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52353.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52354.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
Length=1079

 Score =   112 bits (281),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  KS+K    QVCQICGD VG TVDG  FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKSIKNLGGQVCQICGDNVGKTVDGNPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_003540527.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Glycine max]
Length=1079

 Score =   112 bits (280),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +   K +     QVCQICGDGVG TVDGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGEAGAKPVTALGAQVCQICGDGVGKTVDGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KHN19454.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1093

 Score =   112 bits (280),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +   K +     QVCQICGDGVG TVDGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGEAGAKPVTALGAQVCQICGDGVGKTVDGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_011025442.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Populus euphratica]
Length=1079

 Score =   112 bits (280),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK + +   QVCQIC D VG TVDGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGGKPMTSIVGQVCQICSDSVGKTVDGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KJB19278.1| hypothetical protein B456_003G092600 [Gossypium raimondii]
Length=903

 Score =   112 bits (279),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD+ AD+  KS K   QVCQIC D VG+  DGE FVACH+CAFPVCRPCYEYERKDG QS
Sbjct  1    MDATADSVAKSGKIGGQVCQICSDNVGSNADGESFVACHICAFPVCRPCYEYERKDGTQS  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>ref|XP_007220288.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
 gb|EMJ21487.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
Length=1082

 Score =   112 bits (279),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K+   QVCQICGD VG T DGE F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPVKSLGGQVCQICGDNVGKTADGEPFIACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_009364979.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Pyrus x bretschneideri]
 ref|XP_009364980.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Pyrus x bretschneideri]
Length=1081

 Score =   111 bits (278),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K+   QVCQICGD VG T DGE F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETAVKPMKSLGGQVCQICGDNVGKTADGEPFIACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_008231249.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Prunus mume]
 ref|XP_008231250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Prunus mume]
Length=1082

 Score =   111 bits (278),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K+   QVCQICGD VG T DGE F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPVKSLGGQVCQICGDNVGKTADGEPFIACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_007133819.1| hypothetical protein PHAVU_011G211500g [Phaseolus vulgaris]
 gb|ESW05813.1| hypothetical protein PHAVU_011G211500g [Phaseolus vulgaris]
Length=1074

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +   K +   S QVCQICGDGVG  VDGE F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGEAGAKPVTALSAQVCQICGDGVGKNVDGEPFIACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_007052526.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 ref|XP_007052530.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 gb|EOX96683.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 gb|EOX96687.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
Length=1068

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    QVCQICGD VG   DG+ F+AC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDVGGKPMKNLGGQVCQICGDNVGKNADGDPFIACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AIS86005.1| cellulose synthase 3 [Populus tomentosa]
Length=1079

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/64 (75%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DG  FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGGPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_007052527.1| Cellulose synthase family protein isoform 3 [Theobroma cacao]
 gb|EOX96684.1| Cellulose synthase family protein isoform 3 [Theobroma cacao]
Length=1108

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    QVCQICGD VG   DG+ F+AC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDVGGKPMKNLGGQVCQICGDNVGKNADGDPFIACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_002532166.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF30219.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=1085

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K+   QVCQIC D VGTT+DG+ FVAC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPVKSVGRQVCQICSDNVGTTLDGDPFVACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_009354747.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Pyrus x bretschneideri]
 ref|XP_009354748.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1082

 Score =   111 bits (277),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K+   +VCQICGD VG T DGE F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETAAKPMKSIGGKVCQICGDNVGKTADGEPFIACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_008375180.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Malus domestica]
Length=1082

 Score =   111 bits (277),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K+   +VCQICGD VG T DGE F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETAAKPMKSIGGKVCQICGDNVGKTADGEPFIACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KDO83418.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=544

 Score =   109 bits (272),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  KS+K    QVCQICGD VG TVDG  FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKSIKNVGGQVCQICGDNVGKTVDGNPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_010486710.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Camelina sativa]
Length=1071

 Score =   110 bits (275),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS---DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            MD+E +T GK + +S   +Q+C+IC D VG TVDGE FVAC  C+FPVCRPCYEYERKDG
Sbjct  1    MDTEVETTGKMMSSSNAGEQICEICSDNVGKTVDGEPFVACDFCSFPVCRPCYEYERKDG  60

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  61   NQSCPQ  66



>ref|XP_010486709.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Camelina sativa]
Length=1071

 Score =   110 bits (275),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS---DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            MD+E +T GK + +S   +Q+C+IC D VG TVDGE FVAC  C+FPVCRPCYEYERKDG
Sbjct  1    MDTEVETTGKMMSSSNAGEQICEICSDNVGKTVDGEPFVACDFCSFPVCRPCYEYERKDG  60

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  61   NQSCPQ  66



>ref|XP_006369624.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
 gb|ERP66193.1| hypothetical protein POPTR_0001s27320g [Populus trichocarpa]
Length=1031

 Score =   110 bits (275),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG T DGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKTADGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>emb|CBI29854.3| unnamed protein product [Vitis vinifera]
Length=1243

 Score =   110 bits (275),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/53 (85%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  357  SLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            S  T DQVCQIC D VGTTVDGE F+AC VCAFPVCRPCYEYERKDGNQSCPQ
Sbjct  167  SKHTGDQVCQICNDNVGTTVDGEPFIACSVCAFPVCRPCYEYERKDGNQSCPQ  219



>gb|AAC39336.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
Length=1065

 Score =   110 bits (274),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK +K    Q CQIC D VG TVDG++FVAC +C+FPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETAGKPMKNIVPQTCQICSDNVGKTVDGDRFVACDICSFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|NP_196136.1| cellulose synthase A catalytic subunit 3 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q941L0.2|CESA3_ARATH RecName: Full=Cellulose synthase A catalytic subunit 3 [UDP-forming]; 
Short=AtCesA3; AltName: Full=Constitutive expression 
of VSP1 protein 1; AltName: Full=Isoxaben-resistant protein 
1; Short=Ath-B; AltName: Full=Protein ECTOPIC LIGNIN 1; AltName: 
Full=Protein RADIALLY SWOLLEN 5; Short=AtRSW5 [Arabidopsis 
thaliana]
 dbj|BAB09693.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AAN86168.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED90836.1| cellulose synthase A catalytic subunit 3 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AHL38644.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1065

 Score =   110 bits (274),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK +K    Q CQIC D VG TVDG++FVAC +C+FPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETAGKPMKNIVPQTCQICSDNVGKTVDGDRFVACDICSFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_002529615.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF32760.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=899

 Score =   109 bits (273),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 51/67 (76%), Gaps = 4/67 (6%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQ----VCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKD  494
            MD E D  G   K + Q    +CQIC D VGTTV+GE FVACHVCAFPVCRPCYEYERKD
Sbjct  1    MDLEGDAGGGGPKNAKQNAIQICQICSDNVGTTVNGEPFVACHVCAFPVCRPCYEYERKD  60

Query  495  GNQSCPQ  515
            GNQSCPQ
Sbjct  61   GNQSCPQ  67



>ref|XP_003542849.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Glycine max]
 ref|XP_006594411.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Glycine max]
 ref|XP_006594412.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X3 [Glycine max]
 ref|XP_006594413.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X4 [Glycine max]
Length=1080

 Score =   109 bits (273),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +   K +     QVCQIC DGVG TVDGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGEAGAKPVTALGAQVCQICSDGVGKTVDGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KHN37622.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1091

 Score =   109 bits (273),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +   K +     QVCQIC DGVG TVDGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGEAGAKPVTALGAQVCQICSDGVGKTVDGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_010653789.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Vitis vinifera]
Length=1087

 Score =   109 bits (273),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 45/53 (85%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  357  SLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            S  T DQVCQIC D VGTTVDGE F+AC VCAFPVCRPCYEYERKDGNQSCPQ
Sbjct  11   SKHTGDQVCQICNDNVGTTVDGEPFIACSVCAFPVCRPCYEYERKDGNQSCPQ  63



>gb|ACC59195.1| cellulose synthase [Betula platyphylla]
Length=1084

 Score =   109 bits (273),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GKS K     VCQICGD VG TVDGE F+AC  CAFPVCRPCYEYER+DGNQ
Sbjct  1    MESEGETVGKSTKNLVGHVCQICGDNVGKTVDGEPFIACDDCAFPVCRPCYEYERRDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KDO83414.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=850

 Score =   109 bits (272),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  KS+K    QVCQICGD VG TVDG  FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKSIKNVGGQVCQICGDNVGKTVDGNPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_002873198.1| hypothetical protein ARALYDRAFT_487306 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49457.1| hypothetical protein ARALYDRAFT_487306 [Arabidopsis lyrata subsp. 
lyrata]
Length=1065

 Score =   109 bits (273),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS-DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK +K    Q+CQIC D VG TVDGE FVAC  C+FPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETAGKPMKNVVPQICQICSDNVGKTVDGEPFVACDFCSFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_009386450.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
 ref|XP_009386451.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1066

 Score =   109 bits (272),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            +D E    GK   +  QVCQICGDGVGTTVDG+ FVAC VC FPVCRPCYEYERKDGNQS
Sbjct  3    VDGEKRKPGK--HSGGQVCQICGDGVGTTVDGDIFVACDVCGFPVCRPCYEYERKDGNQS  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>ref|XP_007052528.1| Cellulose synthase family protein isoform 4, partial [Theobroma 
cacao]
 ref|XP_007052529.1| Cellulose synthase family protein isoform 4, partial [Theobroma 
cacao]
 gb|EOX96685.1| Cellulose synthase family protein isoform 4, partial [Theobroma 
cacao]
 gb|EOX96686.1| Cellulose synthase family protein isoform 4, partial [Theobroma 
cacao]
Length=898

 Score =   109 bits (272),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    QVCQICGD VG   DG+ F+AC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDVGGKPMKNLGGQVCQICGDNVGKNADGDPFIACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AFZ78557.1| cellulose synthase [Populus tomentosa]
Length=1079

 Score =   109 bits (272),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K + + + QVCQIC D VG TVDGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKPMTSIAGQVCQICSDSVGKTVDGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33557.1| cellulose synthase catalytic subunit [Gossypium gossypioides]
Length=1067

 Score =   109 bits (272),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K+   Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKSLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KHG16921.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Gossypium 
arboreum]
Length=1064

 Score =   109 bits (272),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_011047398.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X1 [Populus euphratica]
 ref|XP_011047399.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X2 [Populus euphratica]
 ref|XP_011047400.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X1 [Populus euphratica]
Length=1079

 Score =   109 bits (272),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K +K T  QVCQICGD VG   DGE FVAC VCAFPVCRPCYEYERK GNQ
Sbjct  1    MESEGETGAKPMKSTGGQVCQICGDNVGKNADGEPFVACDVCAFPVCRPCYEYERKHGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33540.1| cellulose synthase catalytic subunit [Gossypium mustelinum]
Length=1067

 Score =   109 bits (272),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33543.1| cellulose synthase catalytic subunit [Gossypium darwinii]
Length=1067

 Score =   109 bits (272),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGSQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33541.1| cellulose synthase catalytic subunit [Gossypium mustelinum]
Length=1067

 Score =   108 bits (271),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_010278977.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010278978.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010278979.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1056

 Score =   108 bits (271),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE     K LK    QVCQICGD VGTT DGE FVAC +C+FPVCRPCYEYERKDGNQ
Sbjct  1    MESEGAAAPKPLKHLGGQVCQICGDNVGTTADGELFVACDICSFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|ADZ16120.1| cellulose synthase A3 [Gossypium herbaceum subsp. africanum]
Length=1067

 Score =   108 bits (271),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KJB22792.1| hypothetical protein B456_004G065900 [Gossypium raimondii]
 gb|KJB22793.1| hypothetical protein B456_004G065900 [Gossypium raimondii]
Length=1067

 Score =   108 bits (271),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|ADZ16121.1| cellulose synthase A3 [Gossypium raimondii]
Length=1067

 Score =   108 bits (271),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33536.1| cellulose synthase catalytic subunit [Gossypium thurberi]
Length=1067

 Score =   108 bits (271),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIVGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AAD39534.2| cellulose synthase catalytic subunit [Gossypium hirsutum]
Length=1067

 Score =   108 bits (271),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33545.1| cellulose synthase catalytic subunit [Gossypium tomentosum]
Length=1067

 Score =   108 bits (271),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_008790520.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Phoenix dactylifera]
Length=1068

 Score =   108 bits (271),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 2/64 (3%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+ + +T GKS K    QVCQICGDGVG TVDG+ FVAC VC FPVCRPCYEYERKDGNQ
Sbjct  1    MEVDGET-GKSAKYAGGQVCQICGDGVGATVDGDLFVACDVCGFPVCRPCYEYERKDGNQ  59

Query  504  SCPQ  515
            SCPQ
Sbjct  60   SCPQ  63



>gb|AEP33547.1| cellulose synthase catalytic subunit [Gossypium barbadense var. 
brasiliense]
 gb|AEP33549.1| cellulose synthase catalytic subunit [Gossypium barbadense var. 
peruvianum]
Length=1066

 Score =   108 bits (270),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33554.1| cellulose synthase catalytic subunit [Gossypium davidsonii]
 gb|AEP33555.1| cellulose synthase catalytic subunit [Gossypium klotzschianum]
Length=1067

 Score =   108 bits (270),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33538.1| cellulose synthase catalytic subunit [Gossypium schwendimanii]
Length=1067

 Score =   108 bits (270),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33553.1| cellulose synthase catalytic subunit [Gossypium harknessii]
Length=1067

 Score =   108 bits (270),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33552.1| cellulose synthase catalytic subunit [Gossypium armourianum]
Length=1067

 Score =   108 bits (270),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33551.1| cellulose synthase catalytic subunit [Gossypium hirsutum subsp. 
latifolium]
Length=1067

 Score =   108 bits (270),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AEP33537.1| cellulose synthase catalytic subunit [Gossypium laxum]
Length=1067

 Score =   108 bits (270),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|ADZ16119.1| cellulose synthase A3 [Gossypium barbadense]
Length=1067

 Score =   108 bits (270),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AII73575.1| cellulose synthase 3 [Medicago sativa]
Length=1078

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            MDSE +   K +KT   +VCQICGD +G+ V+G+ F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  2    MDSEGEAGDKPMKTLGSKVCQICGDNIGSAVNGDPFIACGVCAFPVCRPCYEYERKDGNQ  61

Query  504  SCPQ  515
            SCPQ
Sbjct  62   SCPQ  65



>ref|XP_003599196.1| Cellulose synthase [Medicago truncatula]
 gb|AES69447.1| cellulose synthase-like protein [Medicago truncatula]
Length=1078

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            MDSE +   K +KT   +VCQICGD +G+ V+G+ F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  2    MDSEGEAGDKPMKTLGSKVCQICGDNIGSAVNGDPFIACGVCAFPVCRPCYEYERKDGNQ  61

Query  504  SCPQ  515
            SCPQ
Sbjct  62   SCPQ  65



>ref|XP_009130870.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Brassica rapa]
 ref|XP_009130871.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Brassica rapa]
Length=1066

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK + +   Q+CQIC D VG TVDG++FVAC VC FPVCRPCYE+ERKDGNQ
Sbjct  1    MESEGETAGKPMTSVGGQICQICSDNVGKTVDGDRFVACDVCGFPVCRPCYEFERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>emb|CDY52141.1| BnaA03g55200D [Brassica napus]
Length=1066

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK + +   Q+CQIC D VG TVDG++FVAC VC FPVCRPCYE+ERKDGNQ
Sbjct  1    MESEGETAGKPMTSVGGQICQICSDNVGKTVDGDRFVACDVCGFPVCRPCYEFERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|ADZ16123.1| cellulose synthase A3 [Gossypium hirsutum]
Length=1067

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_006373780.1| hypothetical protein POPTR_0016s05520g [Populus trichocarpa]
 gb|ERP51577.1| hypothetical protein POPTR_0016s05520g [Populus trichocarpa]
Length=1064

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD E D      K   QVCQIC D +G T+DGE FVACHVCAFPVCRPCYEYERKDGNQS
Sbjct  1    MDLEGDDAAGPKKI--QVCQICSDDIGKTIDGEPFVACHVCAFPVCRPCYEYERKDGNQS  58

Query  507  CPQ  515
            CPQ
Sbjct  59   CPQ  61



>gb|AFZ78565.1| cellulose synthase [Populus tomentosa]
Length=1064

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD E D      K   QVCQIC D +G T+DGE FVACHVCAFPVCRPCYEYERKDGNQS
Sbjct  1    MDLEGDDAAGPKKI--QVCQICSDDIGKTIDGEPFVACHVCAFPVCRPCYEYERKDGNQS  58

Query  507  CPQ  515
            CPQ
Sbjct  59   CPQ  61



>gb|ACU87559.2| cellulose synthase [Leucaena leucocephala]
Length=1075

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS--DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGN  500
            M+SE +   K  KT+   QVCQICGD VG TVDGE F+AC VCAFPVCRPCYEYERKDGN
Sbjct  1    MESEGEAGAKP-KTALGGQVCQICGDNVGKTVDGEPFIACDVCAFPVCRPCYEYERKDGN  59

Query  501  QSCPQ  515
            QSCPQ
Sbjct  60   QSCPQ  64



>ref|XP_006398979.1| hypothetical protein EUTSA_v10012528mg [Eutrema salsugineum]
 gb|ESQ40432.1| hypothetical protein EUTSA_v10012528mg [Eutrema salsugineum]
Length=1065

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK +K    Q+CQIC D VG TVDG+ FVAC  C+FPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETAGKPMKNVGGQICQICSDDVGKTVDGDPFVACDFCSFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_009407580.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009407588.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X1 [Musa acuminata subsp. malaccensis]
Length=1066

 Score =   108 bits (270),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +3

Query  348  KGKSLKTSD-QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            KGK +K S  QVCQICGD VGTTVDG+ FVAC VC FPVCRPCYEYERKDGNQSCPQ
Sbjct  7    KGKPVKHSGGQVCQICGDSVGTTVDGDLFVACDVCGFPVCRPCYEYERKDGNQSCPQ  63



>gb|AAT66941.1| CesA2 [Acacia mangium]
Length=1075

 Score =   108 bits (269),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS--DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGN  500
            M+SE +   K  KT+   QVCQICGD VG TVDGE F+AC VCAFPVCRPCYEYERKDGN
Sbjct  1    MESEGEAGAKP-KTALGAQVCQICGDSVGKTVDGEPFIACDVCAFPVCRPCYEYERKDGN  59

Query  501  QSCPQ  515
            QSCPQ
Sbjct  60   QSCPQ  64



>gb|AEE60898.1| cellulose synthase [Populus tomentosa]
Length=1079

 Score =   108 bits (269),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K + +   QVCQIC D VG TVDGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKPMTSIVGQVCQICSDSVGKTVDGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_002314037.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE87992.1| cellulose synthase family protein [Populus trichocarpa]
Length=1079

 Score =   108 bits (269),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  K + +   QVCQIC D VG TVDGE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKPMTSIVGQVCQICSDSVGKTVDGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|AFZ78564.1| cellulose synthase [Populus tomentosa]
Length=1061

 Score =   108 bits (269),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD E D  G       QVCQIC D +G TVDGE FVACHVC+FPVCRPCYEYERKDGNQS
Sbjct  1    MDLEGDATGPK---KIQVCQICSDDIGKTVDGEPFVACHVCSFPVCRPCYEYERKDGNQS  57

Query  507  CPQ  515
            CPQ
Sbjct  58   CPQ  60



>gb|AEP33559.1| cellulose synthase catalytic subunit [Gossypium trilobum]
Length=1067

 Score =   108 bits (269),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG  F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIVGKPMKNLGGQTCQICGDNVGKNTDGNPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|ACU80553.2| cellulose synthase [Leucaena leucocephala]
Length=1073

 Score =   108 bits (269),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS--DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGN  500
            M+SE +   K  KT+   QVCQICGD VG TVDGE F+AC VCAFPVCRPCYEYERKDGN
Sbjct  1    MESEGEAGAKP-KTALVGQVCQICGDNVGKTVDGEPFIACDVCAFPVCRPCYEYERKDGN  59

Query  501  QSCPQ  515
            QSCPQ
Sbjct  60   QSCPQ  64



>ref|XP_011033321.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Populus euphratica]
Length=1064

 Score =   108 bits (269),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD E D      K   QVCQIC D +G T+DGE FVACHVCAFPVCRPCYEYERKDGNQS
Sbjct  1    MDLEGDDASGPKKI--QVCQICSDDIGKTIDGEPFVACHVCAFPVCRPCYEYERKDGNQS  58

Query  507  CPQ  515
            CPQ
Sbjct  59   CPQ  61



>ref|XP_010937172.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Elaeis guineensis]
Length=1077

 Score =   107 bits (268),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 2/64 (3%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M++E +  GKSLK    QVCQICGDGVGTTVDG+ FVAC VC FPVCRPCYEYERKDG Q
Sbjct  1    MEAEGE-PGKSLKHQGSQVCQICGDGVGTTVDGDLFVACDVCRFPVCRPCYEYERKDGTQ  59

Query  504  SCPQ  515
             CPQ
Sbjct  60   CCPQ  63



>ref|XP_006289427.1| hypothetical protein CARUB_v10002932mg [Capsella rubella]
 gb|EOA22325.1| hypothetical protein CARUB_v10002932mg [Capsella rubella]
Length=1065

 Score =   107 bits (268),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSD-QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK +K +  ++CQIC D VG TV+G+ FVAC +C+FPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETAGKPMKNAAAKICQICSDNVGKTVEGDPFVACDICSFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_004499886.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cicer arietinum]
Length=1078

 Score =   107 bits (268),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            MDSE + + K++KT   Q CQICGD +GTTVD + F AC VCAFPVCR CYEYERKDGNQ
Sbjct  2    MDSEGEAREKAIKTLGSQECQICGDNIGTTVDSDPFTACGVCAFPVCRACYEYERKDGNQ  61

Query  504  SCPQ  515
            SCPQ
Sbjct  62   SCPQ  65



>ref|XP_010491404.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Camelina sativa]
Length=1071

 Score =   107 bits (268),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 4/67 (6%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS---DQVCQICGDGVGTTVDGEQ-FVACHVCAFPVCRPCYEYERKD  494
            MDSEA+T GK + +S   +Q+C+IC D VG TVDGE+ FVAC  C+FPVCRPCYEYERKD
Sbjct  1    MDSEAETTGKMMSSSNAGEQICEICSDNVGKTVDGEEPFVACDFCSFPVCRPCYEYERKD  60

Query  495  GNQSCPQ  515
            GNQ CPQ
Sbjct  61   GNQCCPQ  67



>gb|AGC65585.1| CESA3ixr1-2 [Binary plant gene expression vector pKM24-MD1]
Length=1066

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +3

Query  330  DSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            +SE +T GK +K    Q CQIC D VG TVDG++FVAC +C+FPVCRPCYEYERKDGNQS
Sbjct  3    ESEGETAGKPMKNIVPQTCQICSDNVGKTVDGDRFVACDICSFPVCRPCYEYERKDGNQS  62

Query  507  CPQ  515
            CPQ
Sbjct  63   CPQ  65



>gb|AGC65584.1| GFP-CESA3ixr1-2 [Binary plant gene expression vector pKM24-MD1]
Length=1344

 Score =   107 bits (267),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +3

Query  330  DSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            +SE +T GK +K    Q CQIC D VG TVDG++FVAC +C+FPVCRPCYEYERKDGNQS
Sbjct  281  ESEGETAGKPMKNIVPQTCQICSDNVGKTVDGDRFVACDICSFPVCRPCYEYERKDGNQS  340

Query  507  CPQ  515
            CPQ
Sbjct  341  CPQ  343



>ref|XP_010464777.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Camelina sativa]
Length=1072

 Score =   107 bits (266),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS---DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            MDSE +T GK + +S   +Q+C+IC D VG TVDGE FVAC  C+FPVCR CYEYERKDG
Sbjct  1    MDSEVETTGKMMSSSNAGEQICEICSDNVGKTVDGEPFVACDFCSFPVCRLCYEYERKDG  60

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  61   NQSCPQ  66



>ref|XP_010464776.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Camelina sativa]
Length=1073

 Score =   107 bits (266),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS---DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            MDSE +T GK + +S   +Q+C+IC D VG TVDGE FVAC  C+FPVCR CYEYERKDG
Sbjct  1    MDSEVETTGKMMSSSNAGEQICEICSDNVGKTVDGEPFVACDFCSFPVCRLCYEYERKDG  60

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  61   NQSCPQ  66



>ref|XP_010257191.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nelumbo nucifera]
Length=1076

 Score =   107 bits (266),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            M+SE +   K+ K   QVCQICGD VGTTV GE F+AC VCAFPVCRPCYEYERKDG QS
Sbjct  1    MESEGEAAPKTSKHG-QVCQICGDNVGTTVSGELFIACDVCAFPVCRPCYEYERKDGTQS  59

Query  507  CPQ  515
            CPQ
Sbjct  60   CPQ  62



>ref|XP_011020351.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Populus euphratica]
Length=1085

 Score =   106 bits (265),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD E D  G       QVCQIC D +G TVDGE FVACHVC+FPVCRPCYEYERKDG+QS
Sbjct  1    MDLEGDATGPK---KIQVCQICSDDIGKTVDGEPFVACHVCSFPVCRPCYEYERKDGSQS  57

Query  507  CPQ  515
            CPQ
Sbjct  58   CPQ  60



>dbj|BAJ33658.1| unnamed protein product [Thellungiella halophila]
Length=1065

 Score =   106 bits (265),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK +K    Q+CQIC D VG TV+G+ FVAC  C+FPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETAGKPMKNVGGQICQICSDDVGKTVNGDPFVACDFCSFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_011048033.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Populus euphratica]
Length=1061

 Score =   106 bits (265),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD E D  G       QVCQIC D +G TVDGE FVACHVC+FPVCRPCYEYERKDG+QS
Sbjct  1    MDLEGDATGPK---KIQVCQICSDDIGKTVDGEPFVACHVCSFPVCRPCYEYERKDGSQS  57

Query  507  CPQ  515
            CPQ
Sbjct  58   CPQ  60



>ref|XP_010906116.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Elaeis guineensis]
 ref|XP_010906117.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Elaeis guineensis]
Length=1068

 Score =   106 bits (265),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = +3

Query  351  GKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            GKS K    QVCQICGD VGTTVDG+ FVAC VC FPVCRPCYEYERKDGNQSCPQ
Sbjct  8    GKSTKHAGGQVCQICGDDVGTTVDGDLFVACDVCGFPVCRPCYEYERKDGNQSCPQ  63



>ref|XP_011093547.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Sesamum indicum]
Length=1047

 Score =   106 bits (264),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQICGD VG TVDGE FVAC VCAFPVCRPCYEYERKDGNQSCPQ
Sbjct  4    QVCQICGDNVGLTVDGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQ  50



>ref|XP_002322712.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEF04473.1| cellulose synthase family protein [Populus trichocarpa]
Length=1068

 Score =   106 bits (264),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQIC D +G T+DGE FVACHVCAFPVCRPCYEYERKDGNQSCPQ
Sbjct  19   QVCQICSDDIGKTIDGEPFVACHVCAFPVCRPCYEYERKDGNQSCPQ  65



>ref|XP_009407595.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X2 [Musa acuminata subsp. malaccensis]
Length=1065

 Score =   106 bits (264),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  348  KGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            KG    +  QVCQICGD VGTTVDG+ FVAC VC FPVCRPCYEYERKDGNQSCPQ
Sbjct  7    KGPVKHSGGQVCQICGDSVGTTVDGDLFVACDVCGFPVCRPCYEYERKDGNQSCPQ  62



>ref|XP_011033320.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Populus euphratica]
Length=1068

 Score =   106 bits (264),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQIC D +G T+DGE FVACHVCAFPVCRPCYEYERKDGNQSCPQ
Sbjct  19   QVCQICSDDIGKTIDGEPFVACHVCAFPVCRPCYEYERKDGNQSCPQ  65



>emb|CDX80951.1| BnaC03g02050D [Brassica napus]
Length=1066

 Score =   105 bits (263),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK + +   Q+CQIC D VG TVDG+ FVAC VC FPVCRPCY++ERKDGNQ
Sbjct  1    MESEGETAGKPMTSVGGQICQICSDNVGKTVDGDWFVACDVCGFPVCRPCYDFERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_002308955.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE92478.1| cellulose synthase family protein [Populus trichocarpa]
Length=1058

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 47/63 (75%), Gaps = 3/63 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD E D  G       QVCQIC D +  TVDGE FVACHVC+FPVCRPCYEYERKDGNQS
Sbjct  1    MDLEGDATGPK---KIQVCQICSDDIDKTVDGEPFVACHVCSFPVCRPCYEYERKDGNQS  57

Query  507  CPQ  515
            CPQ
Sbjct  58   CPQ  60



>ref|XP_004306536.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Fragaria vesca subsp. vesca]
Length=1083

 Score =   105 bits (262),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T+ K +K     VCQICGD VG T  GE F+AC VC+FPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETEAKPMKNLGGLVCQICGDNVGKTAAGEPFIACDVCSFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KDO83412.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=1082

 Score =   105 bits (262),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  354  KSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            KS+K    QVCQICGD VG TVDG  FVAC VCAFPVCRPCYEYERKDGNQSCPQ
Sbjct  13   KSIKNVGGQVCQICGDNVGKTVDGNPFVACDVCAFPVCRPCYEYERKDGNQSCPQ  67



>ref|XP_010452418.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Camelina sativa]
Length=1060

 Score =   105 bits (262),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS-DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK +K    Q+CQIC D VG TVD + FVAC  C+FPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETAGKPMKNVVPQICQICSDNVGKTVDEDPFVACDFCSFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>emb|CDY04942.1| BnaAnng01240D [Brassica napus]
Length=1066

 Score =   105 bits (262),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+S+ +T GK + +   Q+CQIC D VG TVDG++FVAC +C FPVCRPCYEYERK GNQ
Sbjct  1    MESDGETAGKPMTSVGGQICQICSDNVGKTVDGDRFVACDICGFPVCRPCYEYERKHGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_009125590.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Brassica rapa]
 gb|ACS68192.1| cellulose synthase 3.1 catalytic subunit [Brassica napus]
Length=1066

 Score =   105 bits (262),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+S+ +T GK + +   Q+CQIC D VG TVDG++FVAC +C FPVCRPCYEYERK GNQ
Sbjct  1    MESDGETAGKPMTSVGGQICQICSDNVGKTVDGDRFVACDICGFPVCRPCYEYERKHGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KDP43475.1| hypothetical protein JCGZ_16762 [Jatropha curcas]
Length=1078

 Score =   105 bits (261),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            M+SE +T G       QVCQICGD VG TV G+ F+AC VCAFPVCRPCYEYERKDGNQS
Sbjct  1    MESEGET-GPMKNVGGQVCQICGDNVGKTVAGDPFIACDVCAFPVCRPCYEYERKDGNQS  59

Query  507  CPQ  515
            CPQ
Sbjct  60   CPQ  62



>ref|XP_010491044.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Camelina sativa]
Length=1061

 Score =   105 bits (261),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS-DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T GK +K    Q+CQIC D VG TVD + FVAC  C+FPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETAGKPMKNVVPQICQICSDNVGKTVDEDPFVACDFCSFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>emb|CDP13491.1| unnamed protein product [Coffea canephora]
Length=1082

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/59 (75%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = +3

Query  342  DTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            D+  K LK  + Q+CQICGDGVG T DG+ FVAC+ CAFPVCRPCYEYERKDGNQSCPQ
Sbjct  26   DSGPKPLKNLNGQICQICGDGVGLTADGDMFVACNECAFPVCRPCYEYERKDGNQSCPQ  84



>gb|AEP33556.1| cellulose synthase catalytic subunit [Gossypium aridum]
 gb|AEP33558.1| cellulose synthase catalytic subunit [Gossypium lobatum]
Length=1067

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICG  VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGYNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>emb|CDY14127.1| BnaC02g02440D [Brassica napus]
Length=1066

 Score =   105 bits (261),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+S+ +T GK + +   Q+CQIC D VG TVDG++FVAC +C FPVCRPCYEYERK GNQ
Sbjct  1    MESDGETAGKPMTSVGGQICQICSDSVGKTVDGDRFVACDICGFPVCRPCYEYERKHGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_008460760.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
Length=1050

 Score =   104 bits (260),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = +3

Query  336  EADTK-GKSLKT--SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            E DT  GK  K     QVCQIC D VGTT DGE FVAC VCAFPVCRPCYEYERKDGNQS
Sbjct  2    EVDTNPGKPSKQIGGGQVCQICSDSVGTTADGEPFVACDVCAFPVCRPCYEYERKDGNQS  61

Query  507  CPQ  515
            CPQ
Sbjct  62   CPQ  64



>gb|AEP33539.1| cellulose synthase catalytic subunit [Gossypium turneri]
Length=1067

 Score =   104 bits (260),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCR CYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRRCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_004149389.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
 gb|KGN53854.1| hypothetical protein Csa_4G166980 [Cucumis sativus]
Length=1050

 Score =   104 bits (260),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/63 (76%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = +3

Query  336  EADTK-GKSLKT--SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            E DT  GK  K     QVCQIC D VGTT DGE FVAC VCAFPVCRPCYEYERKDGNQS
Sbjct  2    EVDTNPGKPSKQIGGGQVCQICSDSVGTTADGEPFVACDVCAFPVCRPCYEYERKDGNQS  61

Query  507  CPQ  515
            CPQ
Sbjct  62   CPQ  64



>ref|XP_004162186.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
Length=1070

 Score =   104 bits (260),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQIC D VGTT DGE FVAC VCAFPVCRPCYEYERKDGNQSCPQ
Sbjct  38   QVCQICSDSVGTTADGEPFVACDVCAFPVCRPCYEYERKDGNQSCPQ  84



>gb|AHL45025.1| cellulose synthase 3A [Linum usitatissimum]
Length=1060

 Score =   104 bits (259),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            M+ EAD  G +     QVCQIC D +G T DGE F+ACHVCAFPVCRPCYEYERKDG QS
Sbjct  1    MELEAD-HGGTKNVKQQVCQICSDDIGKTSDGEPFLACHVCAFPVCRPCYEYERKDGTQS  59

Query  507  CPQ  515
            CPQ
Sbjct  60   CPQ  62



>gb|AHL45026.1| cellulose synthase 3B [Linum usitatissimum]
Length=1059

 Score =   104 bits (259),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            M+ EAD  G +     QVCQIC D +G T DGE F+ACHVCAFPVCRPCYEYERKDG QS
Sbjct  1    MELEAD-HGGTKNVKQQVCQICSDDIGKTSDGEPFLACHVCAFPVCRPCYEYERKDGTQS  59

Query  507  CPQ  515
            CPQ
Sbjct  60   CPQ  62



>gb|EAZ03185.1| hypothetical protein OsI_25338 [Oryza sativa Indica Group]
Length=1063

 Score =   104 bits (259),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD +AD        S Q CQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+
Sbjct  1    MDGDADAVKSGRHGSGQACQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQA  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>ref|NP_001059162.1| Os07g0208500 [Oryza sativa Japonica Group]
 sp|Q84ZN6.1|CESA8_ORYSJ RecName: Full=Probable cellulose synthase A catalytic subunit 
8 [UDP-forming]; AltName: Full=OsCesA8 [Oryza sativa Japonica 
Group]
 dbj|BAC57282.1| cellulose synthase-4 [Oryza sativa Japonica Group]
 dbj|BAD30175.1| cellulose synthase-4 [Oryza sativa Japonica Group]
 dbj|BAF21076.1| Os07g0208500 [Oryza sativa Japonica Group]
 gb|EAZ39084.1| hypothetical protein OsJ_23516 [Oryza sativa Japonica Group]
 dbj|BAG92935.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1081

 Score =   104 bits (259),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD +AD        S Q CQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+
Sbjct  1    MDGDADAVKSGRHGSGQACQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQA  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>ref|XP_007148880.1| hypothetical protein PHAVU_005G022100g [Phaseolus vulgaris]
 gb|ESW20874.1| hypothetical protein PHAVU_005G022100g [Phaseolus vulgaris]
Length=1075

 Score =   103 bits (258),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +   K +     QVCQICGD +   VDG  F+AC VCAFPVCRPCYEYERKDGNQ
Sbjct  2    MESEGEAGAKPMNALGGQVCQICGDNIANNVDGSSFIACDVCAFPVCRPCYEYERKDGNQ  61

Query  504  SCPQ  515
            SCPQ
Sbjct  62   SCPQ  65



>ref|XP_010667061.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1061

 Score =   103 bits (258),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  366  TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            TS+QVCQIC D +GT VDGE F+AC VCAFPVCR CYEYERKDGNQSCPQ
Sbjct  15   TSEQVCQICSDKIGTNVDGEPFIACDVCAFPVCRACYEYERKDGNQSCPQ  64



>gb|KHG03009.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1068

 Score =   103 bits (258),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +3

Query  339  ADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
             D  GK +K    QVCQICGD VG   DG+ F+AC VCAFPVCRPCYEYERKDGNQSCPQ
Sbjct  4    GDIGGKPMKNLGGQVCQICGDNVGKNADGDPFIACDVCAFPVCRPCYEYERKDGNQSCPQ  63



>ref|XP_004955797.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming]-like [Setaria italica]
Length=1081

 Score =   103 bits (258),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            M+ +AD      +   QVCQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+
Sbjct  1    MEGDADAVKSGRRGGGQVCQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQA  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>ref|XP_009601834.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana tomentosiformis]
 ref|XP_009601835.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana tomentosiformis]
Length=1087

 Score =   103 bits (258),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 56/64 (88%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            MD EAD KGKSLKT   QVCQICGDGVGTTV GE FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MDPEADVKGKSLKTLGGQVCQICGDGVGTTVGGEPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KJB25017.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
Length=1054

 Score =   103 bits (257),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +3

Query  339  ADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
             D  GK +K    QVCQICGD VG   DG+ F+AC VCAFPVCRPCYEYERKDGNQSCPQ
Sbjct  4    GDIGGKPMKNLGGQVCQICGDNVGKNADGDPFIACGVCAFPVCRPCYEYERKDGNQSCPQ  63



>gb|KJB25016.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
 gb|KJB25018.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
 gb|KJB25019.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
 gb|KJB25020.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
Length=1068

 Score =   103 bits (257),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +3

Query  339  ADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
             D  GK +K    QVCQICGD VG   DG+ F+AC VCAFPVCRPCYEYERKDGNQSCPQ
Sbjct  4    GDIGGKPMKNLGGQVCQICGDNVGKNADGDPFIACGVCAFPVCRPCYEYERKDGNQSCPQ  63



>ref|XP_002963550.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 ref|XP_002981528.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17343.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ35421.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1093

 Score =   103 bits (257),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQICGD VG TVDGE FVAC+ CAFPVCRPCYEYERKDGNQSCPQ
Sbjct  36   QVCQICGDDVGCTVDGELFVACNECAFPVCRPCYEYERKDGNQSCPQ  82



>ref|XP_008784835.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Phoenix dactylifera]
Length=1077

 Score =   103 bits (257),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +3

Query  336  EADTK-GKSLKTS-DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSC  509
            EAD + GKSLK    QVCQICGDGVG  VDG+ FVAC VC FPVCRPCYEYERKDG Q C
Sbjct  2    EADGEPGKSLKQQGSQVCQICGDGVGKNVDGDLFVACDVCRFPVCRPCYEYERKDGTQCC  61

Query  510  PQ  515
            PQ
Sbjct  62   PQ  63



>gb|AFI71894.1| cellulose synthase 3 [Paeonia lactiflora]
Length=1081

 Score =   103 bits (257),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +3

Query  339  ADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
             ++  K+LK    Q CQICGD VG  VDG+ FVAC+VCAFPVCRPCYEYERKDGNQSCPQ
Sbjct  4    GESGAKNLKGPGSQACQICGDSVGKNVDGDPFVACNVCAFPVCRPCYEYERKDGNQSCPQ  63



>ref|NP_001104959.1| cellulose synthase-9 [Zea mays]
 gb|AAF89969.1|AF200533_1 cellulose synthase-9 [Zea mays]
Length=1079

 Score =   103 bits (256),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            M+ +AD      +   QVCQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+
Sbjct  1    MEGDADGVKSGRRGGGQVCQICGDGVGTTAEGDVFTACDVCGFPVCRPCYEYERKDGTQA  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>ref|XP_008668614.1| PREDICTED: cellulose synthase-9 isoform X1 [Zea mays]
 tpg|DAA39506.1| TPA: cellulose synthase9 [Zea mays]
Length=1079

 Score =   103 bits (256),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            M+ +AD      +   QVCQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+
Sbjct  1    MEGDADGVKSGRRGGGQVCQICGDGVGTTAEGDVFTACDVCGFPVCRPCYEYERKDGTQA  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>ref|NP_001105621.1| cellulose synthase-4 [Zea mays]
 gb|AAF89964.1|AF200528_1 cellulose synthase-4 [Zea mays]
Length=1077

 Score =   103 bits (256),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            M+ +AD      +   QVCQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+
Sbjct  1    MEGDADGVKSGRRGGGQVCQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQA  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>tpg|DAA59989.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1077

 Score =   103 bits (256),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            M+ +AD      +   QVCQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+
Sbjct  1    MEGDADGVKSGRRGGGQVCQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQA  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>ref|XP_010547260.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Tarenaya hassleriana]
Length=1078

 Score =   102 bits (255),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +3

Query  333  SEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSC  509
            +E ++  KS+K+   QVCQICGD VG T +G+ FVAC VCAFPVCR CYEYERKDGNQSC
Sbjct  4    AEGESGAKSMKSLGGQVCQICGDSVGKTAEGDPFVACDVCAFPVCRACYEYERKDGNQSC  63

Query  510  PQ  515
            PQ
Sbjct  64   PQ  65



>ref|XP_006838305.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda]
 gb|ERN00874.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda]
Length=1088

 Score =   102 bits (255),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +3

Query  345  TKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            T   S   S QVCQICGD VG T +GE FVAC VC+FPVCRPCYEYERKDGNQSCPQ
Sbjct  10   TMKPSKHISGQVCQICGDDVGVTAEGELFVACDVCSFPVCRPCYEYERKDGNQSCPQ  66



>gb|AAY43220.1| cellulose synthase BoCesA4 [Bambusa oldhamii]
Length=1061

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +3

Query  330  DSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSC  509
            D+EA   G+    S QVCQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+C
Sbjct  4    DAEAVKSGR--HGSGQVCQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQAC  61

Query  510  PQ  515
            PQ
Sbjct  62   PQ  63



>ref|XP_006650766.1| PREDICTED: LOW QUALITY PROTEIN: probable cellulose synthase A 
catalytic subunit 2 [UDP-forming]-like [Oryza brachyantha]
Length=1073

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +3

Query  342  DTKGKSLKTSD--QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            D  G + K+    QVCQICGDGVGTT DGE F AC VC FPVCRPCYEYERKDG+Q+CPQ
Sbjct  2    DGGGDAAKSGKHGQVCQICGDGVGTTADGELFTACDVCGFPVCRPCYEYERKDGSQACPQ  61



>gb|KDO83415.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=813

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  KS+K    QVCQICGD VG TVDG  FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKSIKNVGGQVCQICGDNVGKTVDGNPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_002461675.1| hypothetical protein SORBIDRAFT_02g006290 [Sorghum bicolor]
 gb|EER98196.1| hypothetical protein SORBIDRAFT_02g006290 [Sorghum bicolor]
Length=1081

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            M+ +AD      +   QVCQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+
Sbjct  1    MEGDADGVKSGRRGGGQVCQICGDGVGTTAEGDVFTACDVCGFPVCRPCYEYERKDGTQA  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>gb|KDO83417.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=773

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  KS+K    QVCQICGD VG TVDG  FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKSIKNVGGQVCQICGDNVGKTVDGNPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KDO83416.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=811

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  KS+K    QVCQICGD VG TVDG  FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKSIKNVGGQVCQICGDNVGKTVDGNPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_006439112.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52352.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
Length=773

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  KS+K    QVCQICGD VG TVDG  FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKSIKNLGGQVCQICGDNVGKTVDGNPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_006439115.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52355.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
Length=811

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +T  KS+K    QVCQICGD VG TVDG  FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGETGVKSIKNLGGQVCQICGDNVGKTVDGNPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_006657551.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming]-like [Oryza brachyantha]
Length=1081

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD +AD        S Q CQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+
Sbjct  1    MDGDADAVKSGRHGSGQACQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQA  60

Query  507  CP  512
            CP
Sbjct  61   CP  62



>gb|ACZ82298.1| cellulose synthase [Phyllostachys edulis]
Length=1056

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +3

Query  330  DSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSC  509
            D+EA   G+    S QVCQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+C
Sbjct  4    DAEAVKSGR--HGSGQVCQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQAC  61

Query  510  PQ  515
            PQ
Sbjct  62   PQ  63



>ref|XP_003557396.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X1 [Brachypodium distachyon]
Length=1083

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            MD +A           QVCQICGDGVGTT DGE F  C VC FPVCRPCYEYERKDG Q+
Sbjct  1    MDVDAGAVKSGRHGGGQVCQICGDGVGTTADGEVFAPCDVCGFPVCRPCYEYERKDGTQA  60

Query  507  CPQ  515
            CPQ
Sbjct  61   CPQ  63



>gb|ADH95191.1| cellulose synthase [Phyllostachys edulis]
Length=1081

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +3

Query  330  DSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSC  509
            D+EA   G+      QVCQICGDGVGTT +G+ F AC+VC FPVCRPCYEYERKDG Q+C
Sbjct  4    DAEAVKSGR--HGGGQVCQICGDGVGTTAEGDVFAACNVCGFPVCRPCYEYERKDGTQAC  61

Query  510  PQ  515
            PQ
Sbjct  62   PQ  63



>ref|XP_007052525.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
 gb|EOX96682.1| Cellulose synthase family protein isoform 1 [Theobroma cacao]
Length=1237

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    QVCQICGD VG   DG+ F+AC+VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDVGGKPMKNLGGQVCQICGDNVGKNADGDPFIACNVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_010241248.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010241249.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010241250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1071

 Score =   101 bits (251),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQS  506
            M+S  +   K+ K   QVCQICGD VGTTV GE F+AC VCAF VCRPCYEYERKDG QS
Sbjct  1    MESGGEATSKTSKHG-QVCQICGDNVGTTVSGELFIACDVCAFSVCRPCYEYERKDGTQS  59

Query  507  CPQ  515
            CPQ
Sbjct  60   CPQ  62



>ref|XP_006842872.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
 gb|ERN04547.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
Length=1083

 Score =   101 bits (251),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  E +   K +K  + QVCQICGD VG T  GE FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VMIRHEGEVGPKPIKNLNSQVCQICGDTVGLTASGEPFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>ref|XP_009799381.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana sylvestris]
Length=1087

 Score =   101 bits (251),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 55/64 (86%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            MD EAD KGKSLKT   QVCQICGDGVGTTV G+ FVAC VCAFPVCRPCYEYERKDGNQ
Sbjct  1    MDPEADVKGKSLKTLGGQVCQICGDGVGTTVGGDPFVACDVCAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>ref|XP_003533898.2| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Glycine max]
 ref|XP_006587173.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Glycine max]
Length=1074

 Score =   101 bits (251),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE +   K +KT   ++CQICGD +G   +G+ F+AC VCAFPVCR CYEYERKDGNQ
Sbjct  2    MESEGEAGAKPMKTLGGKICQICGDNIGNNANGDPFIACDVCAFPVCRACYEYERKDGNQ  61

Query  504  SCPQ  515
            SCPQ
Sbjct  62   SCPQ  65



>gb|ACS94418.1| cellulose synthase A [Leucaena leucocephala]
Length=410

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS--DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGN  500
            M+SE +   K  KT+   QVCQICGD VG TVDGE F+AC VCAFPVCRPCYEYERKDGN
Sbjct  1    MESEGEAGAKP-KTALGGQVCQICGDNVGKTVDGEPFIACDVCAFPVCRPCYEYERKDGN  59

Query  501  QSCPQ  515
            QSCPQ
Sbjct  60   QSCPQ  64



>gb|ACT16002.1| cellulose synthase [Phyllostachys edulis]
Length=1081

 Score =   100 bits (250),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +3

Query  330  DSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSC  509
            D+EA   G+      QVCQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+C
Sbjct  4    DAEAVKSGR--HGGGQVCQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQAC  61

Query  510  PQ  515
            PQ
Sbjct  62   PQ  63



>ref|XP_010228235.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X2 [Brachypodium distachyon]
Length=1082

 Score =   100 bits (250),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQICGDGVGTT DGE F  C VC FPVCRPCYEYERKDG Q+CPQ
Sbjct  16   QVCQICGDGVGTTADGEVFAPCDVCGFPVCRPCYEYERKDGTQACPQ  62



>ref|XP_010925238.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Elaeis guineensis]
Length=1077

 Score =   100 bits (250),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  E +   K LK  + QVCQICGD VG TV G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VMIRHEGEAGPKPLKNLNGQVCQICGDTVGLTVTGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>gb|EPS69824.1| hypothetical protein M569_04932, partial [Genlisea aurea]
Length=1067

 Score =   100 bits (249),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +3

Query  348  KGKS-LKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            +GKS  K   QVCQICGD VG T  GE FVAC+VCAFPVCRPCYEYERKDGNQ CPQ
Sbjct  1    QGKSPKKMGSQVCQICGDTVGLTAAGEIFVACNVCAFPVCRPCYEYERKDGNQCCPQ  57



>ref|XP_002307145.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE94141.1| cellulose synthase family protein [Populus trichocarpa]
Length=1096

 Score =   100 bits (249),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS+K  S QVCQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_004503981.1| PREDICTED: cellulose synthase A catalytic subunit 6 [UDP-forming]-like 
[Cicer arietinum]
Length=1096

 Score =   100 bits (249),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +++E + + KS++  S Q+CQICGD +  TVDGE FVAC+ CAFPVCRPCYEYERK+G
Sbjct  18   VLINAEENGRIKSVRELSGQICQICGDEIEVTVDGEPFVACNECAFPVCRPCYEYERKEG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_008784981.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Phoenix dactylifera]
Length=1077

 Score =   100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  E +   K LK  + QVCQICGD VG TV G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VMIRHEGEAGPKPLKNLNGQVCQICGDTVGLTVTGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>ref|XP_010914890.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Elaeis guineensis]
Length=1077

 Score =   100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  E +   K LK  + QVCQICGD VG TV G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VMIRHEGEAGPKPLKNLNGQVCQICGDTVGLTVTGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>gb|AAY43222.1| cellulose synthase BoCesA5 [Bambusa oldhamii]
Length=1080

 Score =   100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            MD       KS K    QVCQICGD VGTT DGE F AC VC FPVCRPCYEYERKDG Q
Sbjct  1    MDGGGGDAAKSGKHGGGQVCQICGDSVGTTADGELFTACDVCGFPVCRPCYEYERKDGTQ  60

Query  504  SCPQ  515
            +CPQ
Sbjct  61   ACPQ  64



>ref|XP_008219478.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Prunus mume]
Length=1072

 Score =   100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSAPKPLKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>ref|XP_007221583.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica]
 gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica]
Length=1072

 Score =   100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSAPKPLKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>gb|AAQ63936.1| cellulose synthase [Pinus radiata]
Length=1066

 Score =   100 bits (249),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQICGD VG T DG+ FVAC+VCAFPVCRPCY+YERKDGNQSCPQ
Sbjct  2    QVCQICGDDVGLTADGDLFVACNVCAFPVCRPCYDYERKDGNQSCPQ  48



>ref|XP_004981340.1| PREDICTED: probable cellulose synthase A catalytic subunit 2 
[UDP-forming]-like [Setaria italica]
Length=1079

 Score =   100 bits (248),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQICGDGVGT  DGE F AC VC FPVCRPCYEYERKDG Q+CPQ
Sbjct  18   QVCQICGDGVGTAADGELFTACDVCGFPVCRPCYEYERKDGTQACPQ  64



>ref|XP_008792060.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Phoenix dactylifera]
Length=1077

 Score =   100 bits (248),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  E +   K LK  + QVCQICGD VG TV G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VMIRHEGEAGPKPLKNLNGQVCQICGDTVGPTVTGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>gb|AAO25581.1| cellulose synthase [Populus tremuloides]
Length=1096

 Score =   100 bits (248),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS+K  S QVCQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_002960719.1| hypothetical protein SELMODRAFT_73698 [Selaginella moellendorffii]
 gb|EFJ38258.1| hypothetical protein SELMODRAFT_73698 [Selaginella moellendorffii]
Length=1082

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQICGD VG TVDG+ FVAC+ CAFPVCRPCY+YERKDGNQ+CPQ
Sbjct  34   QVCQICGDDVGLTVDGDLFVACNECAFPVCRPCYDYERKDGNQACPQ  80



>ref|XP_007137035.1| hypothetical protein PHAVU_009G094200g [Phaseolus vulgaris]
 gb|ESW09029.1| hypothetical protein PHAVU_009G094200g [Phaseolus vulgaris]
Length=1084

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +3

Query  339  ADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            +D+  K LK+ + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDGNQSCPQ
Sbjct  25   SDSGSKPLKSLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQ  84



>ref|XP_002983952.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ14964.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=1090

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQICGD VG TVDG+ FVAC+ CAFPVCRPCY+YERKDGNQ+CPQ
Sbjct  34   QVCQICGDDVGLTVDGDLFVACNECAFPVCRPCYDYERKDGNQACPQ  80



>gb|KHN07088.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine 
soja]
Length=1084

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +3

Query  339  ADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            +D+  K LK+ + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDGNQSCPQ
Sbjct  25   SDSGSKPLKSLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQ  84



>ref|XP_004136343.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004169170.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cucumis sativus]
Length=1081

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  + Q CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSGPKPLKNLNSQTCQICGDTVGLTASGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>ref|XP_003526416.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Glycine max]
Length=1084

 Score =   100 bits (248),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +3

Query  339  ADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            +D+  K LK+ + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDGNQSCPQ
Sbjct  25   SDSGSKPLKSLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQ  84



>gb|ACO06090.1| cellulose synthase [Phyllostachys edulis]
Length=1065

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQICGDGVGTT +G+ F AC+VC FPVCRPCYEYERKDG Q+CPQ
Sbjct  2    QVCQICGDGVGTTAEGDVFAACNVCGFPVCRPCYEYERKDGTQACPQ  48



>ref|XP_008466397.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Cucumis melo]
Length=1081

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  + Q CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSGPKPLKNINSQTCQICGDTVGLTASGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>gb|KGN60109.1| hypothetical protein Csa_3G878780 [Cucumis sativus]
Length=1062

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  + Q CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSGPKPLKNLNSQTCQICGDTVGLTASGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>ref|XP_004135931.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
 gb|KGN45128.1| hypothetical protein Csa_7G428160 [Cucumis sativus]
Length=1083

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +3

Query  339  ADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            A++  K +K      CQICGD VG TV+GE FVAC VC FPVCRPCYEYERKDGNQSCPQ
Sbjct  4    AESSAKVIKNMGPNACQICGDHVGKTVEGEPFVACDVCTFPVCRPCYEYERKDGNQSCPQ  63



>ref|NP_001104955.1| cellulose synthase5 [Zea mays]
 gb|AAF89965.1|AF200529_1 cellulose synthase-5 [Zea mays]
Length=1076

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  336  EADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            +A   GK +  + QVCQICGDGVGT  DG+ F AC VC FPVCRPCYEYERKDG Q+CPQ
Sbjct  5    DATNSGKHV--AGQVCQICGDGVGTAADGDLFTACDVCGFPVCRPCYEYERKDGTQACPQ  62



>tpg|DAA52080.1| TPA: cellulose synthase5 [Zea mays]
Length=1076

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  336  EADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            +A   GK +  + QVCQICGDGVGT  DG+ F AC VC FPVCRPCYEYERKDG Q+CPQ
Sbjct  5    DATNSGKHV--AGQVCQICGDGVGTAADGDLFTACDVCGFPVCRPCYEYERKDGTQACPQ  62



>ref|XP_011013552.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X3 [Populus euphratica]
Length=1096

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS+K  S QVCQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>gb|AAT09898.1| cellulose synthase [Populus tremula x Populus tremuloides]
Length=1096

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS+K  S QVCQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_011013550.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X1 [Populus euphratica]
 ref|XP_011013551.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
isoform X2 [Populus euphratica]
Length=1097

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS+K  S QVCQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_011021978.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X1 [Populus euphratica]
 ref|XP_011021979.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X2 [Populus euphratica]
Length=1097

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS+K  S QVCQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_011021980.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
isoform X3 [Populus euphratica]
Length=1096

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS+K  S QVCQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X2 [Fragaria vesca subsp. vesca]
Length=1069

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSSSKPLKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_008461291.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
 ref|XP_008461292.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
 ref|XP_008461293.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
 ref|XP_008461294.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
Length=1083

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +3

Query  339  ADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            A++  K +K      CQICGD VG TV+GE FVAC VC FPVCRPCYEYERKDGNQSCPQ
Sbjct  4    AESAAKVIKNMGPNACQICGDHVGKTVEGEPFVACDVCTFPVCRPCYEYERKDGNQSCPQ  63



>ref|XP_011459196.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X1 [Fragaria vesca subsp. vesca]
Length=1072

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSSSKPLKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>gb|AAY43221.1| cellulose synthase BoCesA4 [Bambusa oldhamii]
Length=1067

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            QVCQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+CPQ
Sbjct  1    QVCQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQACPQ  47



>gb|AFG25777.1| cellulose synthase 3 [Bambusa emeiensis]
Length=1081

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +3

Query  330  DSEADTKGKSLKTSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSC  509
            D+EA   G+      Q+CQICGDGVGTT +G+ F AC VC FPVCRPCYEYERKDG Q+C
Sbjct  4    DAEAVKSGR--HGGGQLCQICGDGVGTTAEGDVFAACDVCGFPVCRPCYEYERKDGTQAC  61

Query  510  PQ  515
            PQ
Sbjct  62   PQ  63



>gb|KJB22794.1| hypothetical protein B456_004G065900 [Gossypium raimondii]
Length=894

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+SE D  GK +K    Q CQICGD VG   DG+ F+AC++CAFPVCRPCYEYERKDGNQ
Sbjct  1    MESEGDIGGKPMKNLGGQTCQICGDNVGKNTDGDPFIACNICAFPVCRPCYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KJB14950.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
 gb|KJB14951.1| hypothetical protein B456_002G150300 [Gossypium raimondii]
Length=1095

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS+K  S Q CQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>gb|AFB18634.1| CESA5 [Gossypium hirsutum]
Length=1095

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS+K  S Q CQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_010250039.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V + +E +   K LK  + QVCQICGD VG T  G+ FVAC+ CAFPVCRPCYEYER+DG
Sbjct  18   VMIRNEGEAGPKPLKHLNGQVCQICGDTVGVTATGDVFVACNECAFPVCRPCYEYERRDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>ref|XP_010648652.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Vitis vinifera]
Length=1084

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSGPKPLKHLNGQICQICGDTVGLTAAGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>gb|AGV22109.1| cellulose synthase 7 [Betula luminifera]
Length=1085

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSGPKPLKHLNGQICQICGDSVGLTASGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_006296592.1| hypothetical protein CARUB_v10012872mg [Capsella rubella]
 gb|EOA29490.1| hypothetical protein CARUB_v10012872mg [Capsella rubella]
Length=1077

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +3

Query  327  MDSEADTKGKSLKTS--DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGN  500
            M+ E +T GK + ++  + +C IC D  G TVDGE FVAC  C+FPVCRPCYEYERKDGN
Sbjct  2    MEPEGETAGKLMGSNAGELICGICSDNFGKTVDGEPFVACAFCSFPVCRPCYEYERKDGN  61

Query  501  QSCPQ  515
            QSCPQ
Sbjct  62   QSCPQ  66



>gb|KCW81421.1| hypothetical protein EUGRSUZ_C02801 [Eucalyptus grandis]
Length=1085

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D   K LK  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDGGPKPLKNLNGQICQICGDTVGLTASGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>ref|NP_001289657.1| cellulose synthase A catalytic subunit 1 [Eucalyptus grandis]
 gb|AAY60847.1| cellulose synthase 5 [Eucalyptus grandis]
Length=1085

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D   K LK  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDGGPKPLKNLNGQICQICGDTVGLTASGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>ref|XP_010228016.1| PREDICTED: probable cellulose synthase A catalytic subunit 2 
[UDP-forming] isoform X2 [Brachypodium distachyon]
Length=1068

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            Q CQICGDGVGT  DGE F AC VC FPVCRPCYEYERKDG Q+CPQ
Sbjct  18   QACQICGDGVGTAADGELFTACDVCGFPVCRPCYEYERKDGTQACPQ  64



>ref|XP_010228012.1| PREDICTED: probable cellulose synthase A catalytic subunit 2 
[UDP-forming] isoform X1 [Brachypodium distachyon]
Length=1078

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            Q CQICGDGVGT  DGE F AC VC FPVCRPCYEYERKDG Q+CPQ
Sbjct  18   QACQICGDGVGTAADGELFTACDVCGFPVCRPCYEYERKDGTQACPQ  64



>gb|AEK31219.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1085

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D   K LK  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDGGPKPLKNLNGQICQICGDTVGLTAGGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>gb|AFZ78553.1| cellulose synthase [Populus tomentosa]
Length=1096

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS+K  S QVCQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVKELSGQVCQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ CPQ
Sbjct  78   NQVCPQ  83



>ref|XP_010254360.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  E +   K LK  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYER+DG
Sbjct  18   VMIRKEGEAGPKPLKHLNGQICQICGDTVGVTATGDVFVACNECAFPVCRPCYEYERRDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>gb|AFM37966.1| cellulose synthase catalytic subunit [Cunninghamia lanceolata]
Length=1091

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKTSD-QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  E D   K LK  D Q C ICGD VG T DGE FVAC+ CAFPVCRPCYEYERK+G
Sbjct  18   VLIRHEGDVGPKPLKDLDSQKCHICGDNVGVTADGELFVACNECAFPVCRPCYEYERKEG  77

Query  498  NQSCPQ  515
            N+SCPQ
Sbjct  78   NKSCPQ  83



>ref|XP_008366693.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Malus domestica]
Length=1072

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K +K  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSSSKPVKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|NP_001051648.1| Os03g0808100 [Oryza sativa Japonica Group]
 sp|Q84M43.1|CESA2_ORYSJ RecName: Full=Probable cellulose synthase A catalytic subunit 
2 [UDP-forming]; AltName: Full=OsCesA2 [Oryza sativa Japonica 
Group]
 sp|A2XN66.1|CESA2_ORYSI RecName: Full=Probable cellulose synthase A catalytic subunit 
2 [UDP-forming]; AltName: Full=OsCesA2 [Oryza sativa Indica 
Group]
 gb|AAP21426.1| putative cellulose synthase catalytic subunit [Oryza sativa Japonica 
Group]
 gb|AAS07381.1| cellulose synthase [Oryza sativa Japonica Group]
 gb|ABF99460.1| Cellulose synthase A catalytic subunit 3, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13562.1| Os03g0808100 [Oryza sativa Japonica Group]
 gb|EAY92276.1| hypothetical protein OsI_13999 [Oryza sativa Indica Group]
 gb|EAZ28997.1| hypothetical protein OsJ_13045 [Oryza sativa Japonica Group]
Length=1073

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
             VCQICGDGVGT  DGE F AC VC FPVCRPCYEYERKDG+Q+CPQ
Sbjct  11   HVCQICGDGVGTAADGELFTACDVCGFPVCRPCYEYERKDGSQACPQ  57



>ref|XP_002463687.1| hypothetical protein SORBIDRAFT_01g004210 [Sorghum bicolor]
 gb|EER90685.1| hypothetical protein SORBIDRAFT_01g004210 [Sorghum bicolor]
Length=1032

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
             VCQICGDGVGT  DGE F AC VC FPVCRPCYEYERKDG Q+CPQ
Sbjct  20   HVCQICGDGVGTAADGELFTACDVCGFPVCRPCYEYERKDGTQACPQ  66



>gb|KHG02518.1| Cellulose synthase A catalytic subunit 2 [UDP-forming] [Gossypium 
arboreum]
Length=1095

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS+K  S Q CQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVKELSGQTCQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_008232182.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming] 
[Prunus mume]
Length=1095

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS++  S Q+CQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>gb|KHN39939.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1073

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M    +   K + T   QVCQICGD +G  V+G+ F+AC+VCAFPVCR CYEYERKDGNQ
Sbjct  1    MTESEEAGAKPMNTLGGQVCQICGDNIGNNVNGDPFIACNVCAFPVCRACYEYERKDGNQ  60

Query  504  SCPQ  515
            SCPQ
Sbjct  61   SCPQ  64



>gb|KDP33612.1| hypothetical protein JCGZ_07183 [Jatropha curcas]
Length=1084

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  + Q CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSGPKPLKNLNGQTCQICGDNVGVTASGDTFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
             QSCPQ
Sbjct  78   TQSCPQ  83



>ref|XP_007213713.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
 gb|EMJ14912.1| hypothetical protein PRUPE_ppa000567mg [Prunus persica]
Length=1095

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS++  S Q+CQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENARIKSVQELSGQICQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_008394069.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Malus domestica]
Length=1072

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K +K  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSAPKPVKNLNGQICQICGDTVGVTATGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_009623502.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Nicotiana tomentosiformis]
Length=1085

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKTSD-QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  D Q+CQICGD VG T  G+ FVAC+ CAFPVCR CYEYERKDG
Sbjct  18   VRIRHDSDSGPKPLKPLDSQICQICGDTVGLTASGDLFVACNECAFPVCRACYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>ref|XP_003630174.1| Cellulose synthase A catalytic subunit [Medicago truncatula]
 gb|AET04650.1| cellulose synthase-like protein [Medicago truncatula]
Length=1098

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +++E + + KS++  S Q+C ICGD +  TVDGE FVAC+ CAFPVCRPCYEYERK+G
Sbjct  18   VLINAEENGRIKSVRELSGQICMICGDEIEVTVDGEPFVACNECAFPVCRPCYEYERKEG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>gb|KEH19084.1| cellulose synthase-like protein [Medicago truncatula]
Length=1078

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  327  MDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQ  503
            M+ E +  GK + T  DQVC+ICG+ +G TVDGE F+AC  CAFPVCR CYEYERKDG Q
Sbjct  2    MEPEGEAGGKPMTTLGDQVCKICGENIGKTVDGEPFIACDACAFPVCRLCYEYERKDGKQ  61

Query  504  SCPQ  515
            SC Q
Sbjct  62   SCLQ  65



>ref|XP_003522623.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Glycine max]
Length=1084

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +3

Query  339  ADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            +D+  K +K  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDGNQSCPQ
Sbjct  25   SDSGSKPMKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQ  84



>ref|XP_007159799.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
 gb|ESW31793.1| hypothetical protein PHAVU_002G268200g [Phaseolus vulgaris]
Length=1097

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS++  S Q+CQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENGRIKSVRELSGQICQICGDEIEVTVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>gb|KHN08123.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine 
soja]
Length=1084

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +3

Query  339  ADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDGNQSCPQ  515
            +D+  K +K  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDGNQSCPQ
Sbjct  25   SDSGSKPMKNLNGQICQICGDTVGLTATGDVFVACNECAFPVCRPCYEYERKDGNQSCPQ  84



>ref|XP_009768318.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1085

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKTSD-QVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K+LK  D Q+CQICGD VG T  G+ FVAC+ CAFPVCR CYEYERKDG
Sbjct  18   VRIRHDSDSGPKALKPLDNQICQICGDTVGLTASGDLFVACNECAFPVCRACYEYERKDG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>ref|XP_010525969.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010525970.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X2 [Tarenaya hassleriana]
Length=1085

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D + K LK  + Q+CQICGDGVG T +G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDGEPKPLKNLNGQICQICGDGVGLTENGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
             Q CPQ
Sbjct  78   TQCCPQ  83



>ref|XP_003531396.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like 
[Glycine max]
 gb|KHN29142.1| Cellulose synthase A catalytic subunit 6 [UDP-forming] [Glycine 
soja]
Length=1097

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKT-SDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V ++++ + + KS++  S Q+CQICGD +  TVDGE FVAC+ CAFPVCRPCYEYER++G
Sbjct  18   VLINADENGRIKSVRELSGQICQICGDEIEITVDGEPFVACNECAFPVCRPCYEYERREG  77

Query  498  NQSCPQ  515
            NQ+CPQ
Sbjct  78   NQACPQ  83



>emb|CBI21020.3| unnamed protein product [Vitis vinifera]
Length=921

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLK-TSDQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  ++D+  K LK  + Q+CQICGD VG T  G+ FVAC+ CAFPVCRPCYEYERKDG
Sbjct  18   VRIRHDSDSGPKPLKHLNGQICQICGDTVGLTAAGDVFVACNECAFPVCRPCYEYERKDG  77

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  78   NQSCPQ  83



>gb|EPS68064.1| hypothetical protein M569_06709, partial [Genlisea aurea]
Length=1088

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +3

Query  321  VTMDSEADTKGKSLKTS-DQVCQICGDGVGTTVDGEQFVACHVCAFPVCRPCYEYERKDG  497
            V +  + +T  KS+K S  Q+CQICGD VG   +G+ FVAC+ CAFPVCR CYEYERKDG
Sbjct  20   VRIRHDPETVPKSVKNSASQICQICGDSVGAAANGDTFVACNECAFPVCRACYEYERKDG  79

Query  498  NQSCPQ  515
            NQSCPQ
Sbjct  80   NQSCPQ  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325