BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I05

Length=538
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009782446.1|  PREDICTED: COP9 signalosome complex subunit 1      280   2e-89   Nicotiana sylvestris
ref|XP_009620565.1|  PREDICTED: COP9 signalosome complex subunit 1      276   1e-87   Nicotiana tomentosiformis
ref|XP_004229835.1|  PREDICTED: COP9 signalosome complex subunit 1      273   7e-87   Solanum lycopersicum
emb|CDP08878.1|  unnamed protein product                                273   1e-86   Coffea canephora [robusta coffee]
emb|CAY85529.1|  Cop11 protein                                          273   1e-86   Carica papaya [mamon]
ref|XP_006445146.1|  hypothetical protein CICLE_v10020177mg             273   2e-86   Citrus clementina [clementine]
ref|XP_006339459.1|  PREDICTED: COP9 signalosome complex subunit ...    270   2e-85   Solanum tuberosum [potatoes]
ref|XP_011091695.1|  PREDICTED: COP9 signalosome complex subunit ...    269   6e-85   Sesamum indicum [beniseed]
gb|EYU32064.1|  hypothetical protein MIMGU_mgv1a006374mg                268   2e-84   Erythranthe guttata [common monkey flower]
ref|XP_003521302.1|  PREDICTED: COP9 signalosome complex subunit ...    265   1e-83   Glycine max [soybeans]
emb|CBI50749.1|  Cop11 protein                                          265   2e-83   Citrus x paradisi [grapefruit]
ref|XP_007134963.1|  hypothetical protein PHAVU_010G090500g             264   5e-83   Phaseolus vulgaris [French bean]
ref|XP_010255512.1|  PREDICTED: COP9 signalosome complex subunit 1      263   7e-83   Nelumbo nucifera [Indian lotus]
gb|EPS64067.1|  hypothetical protein M569_10712                         261   4e-82   Genlisea aurea
ref|XP_002511799.1|  cop9 signalosome complex subunit, putative         260   8e-82   Ricinus communis
ref|XP_002272895.1|  PREDICTED: COP9 signalosome complex subunit 1      259   2e-81   Vitis vinifera
gb|KJB41228.1|  hypothetical protein B456_007G095800                    261   2e-81   Gossypium raimondii
emb|CAN74681.1|  hypothetical protein VITISV_025856                     260   2e-81   Vitis vinifera
gb|KJB41227.1|  hypothetical protein B456_007G095800                    259   2e-81   Gossypium raimondii
gb|KHG02078.1|  COP9 signalosome complex subunit 1 -like protein        259   3e-81   Gossypium arboreum [tree cotton]
gb|KDP28684.1|  hypothetical protein JCGZ_14455                         258   5e-81   Jatropha curcas
ref|XP_010692381.1|  PREDICTED: COP9 signalosome complex subunit 1      258   1e-80   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN27284.1|  COP9 signalosome complex subunit 1                      256   2e-80   Glycine soja [wild soybean]
ref|XP_010091550.1|  COP9 signalosome complex subunit 1                 256   1e-79   
ref|XP_008438090.1|  PREDICTED: COP9 signalosome complex subunit 1      253   7e-79   Cucumis melo [Oriental melon]
ref|XP_008375905.1|  PREDICTED: COP9 signalosome complex subunit ...    253   8e-79   Malus domestica [apple tree]
ref|XP_009349943.1|  PREDICTED: COP9 signalosome complex subunit ...    253   8e-79   Pyrus x bretschneideri [bai li]
ref|XP_004133880.1|  PREDICTED: COP9 signalosome complex subunit ...    253   8e-79   Cucumis sativus [cucumbers]
ref|XP_003528882.1|  PREDICTED: COP9 signalosome complex subunit ...    253   1e-78   Glycine max [soybeans]
ref|XP_007051916.1|  COP9 signalosome complex subunit 1                 254   2e-78   
ref|XP_009343538.1|  PREDICTED: COP9 signalosome complex subunit 1      251   4e-78   Pyrus x bretschneideri [bai li]
ref|XP_004510858.1|  PREDICTED: COP9 signalosome complex subunit ...    249   2e-77   Cicer arietinum [garbanzo]
ref|XP_002320757.1|  COP9 signalosome complex subunit 1 family pr...    247   1e-76   Populus trichocarpa [western balsam poplar]
ref|XP_008232739.1|  PREDICTED: COP9 signalosome complex subunit 1      247   2e-76   Prunus mume [ume]
ref|XP_007220993.1|  hypothetical protein PRUPE_ppa005760mg             246   2e-76   Prunus persica
ref|XP_011023415.1|  PREDICTED: COP9 signalosome complex subunit ...    246   5e-76   Populus euphratica
ref|XP_002301330.1|  COP9 signalosome complex subunit 1 family pr...    243   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_011035139.1|  PREDICTED: COP9 signalosome complex subunit ...    238   4e-74   Populus euphratica
gb|KFK35313.1|  hypothetical protein AALP_AA5G268100                    240   7e-74   Arabis alpina [alpine rockcress]
ref|XP_010523727.1|  PREDICTED: COP9 signalosome complex subunit 1      240   9e-74   Tarenaya hassleriana [spider flower]
ref|XP_011035131.1|  PREDICTED: COP9 signalosome complex subunit ...    239   1e-73   Populus euphratica
ref|XP_004306835.1|  PREDICTED: COP9 signalosome complex subunit 1      239   1e-73   Fragaria vesca subsp. vesca
ref|XP_006291146.1|  hypothetical protein CARUB_v10017264mg             238   6e-73   Capsella rubella
ref|XP_002876595.1|  FUSCA protein FUS6                                 238   7e-73   
gb|KHG16839.1|  COP9 signalosome complex subunit 1 -like protein        237   1e-72   Gossypium arboreum [tree cotton]
gb|KEH18953.1|  COP9 signalosome complex subunit 1                      237   2e-72   Medicago truncatula
gb|KJB49394.1|  hypothetical protein B456_008G117100                    236   2e-72   Gossypium raimondii
emb|CDY65304.1|  BnaCnng46520D                                          236   2e-72   Brassica napus [oilseed rape]
ref|XP_011093171.1|  PREDICTED: COP9 signalosome complex subunit ...    235   3e-72   Sesamum indicum [beniseed]
gb|ACJ85006.1|  unknown                                                 235   7e-72   Medicago truncatula
emb|CDY52333.1|  BnaA09g38820D                                          235   8e-72   Brassica napus [oilseed rape]
ref|XP_011093170.1|  PREDICTED: COP9 signalosome complex subunit ...    235   9e-72   Sesamum indicum [beniseed]
ref|XP_009116776.1|  PREDICTED: COP9 signalosome complex subunit ...    234   1e-71   Brassica rapa
ref|XP_006402517.1|  hypothetical protein EUTSA_v10005978mg             233   3e-71   Eutrema salsugineum [saltwater cress]
ref|XP_008362845.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...    228   5e-71   
emb|CDX67853.1|  BnaA07g18930D                                          232   2e-70   
emb|CDY45683.1|  BnaCnng13480D                                          229   1e-69   Brassica napus [oilseed rape]
ref|XP_010469035.1|  PREDICTED: COP9 signalosome complex subunit 1      229   2e-69   Camelina sativa [gold-of-pleasure]
emb|CAB71044.1|  FUSCA PROTEIN FUS6                                     228   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567109.1|  COP9 signalosome complex subunit 1                    228   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413455.1|  PREDICTED: COP9 signalosome complex subunit ...    228   2e-69   Camelina sativa [gold-of-pleasure]
gb|AAA32792.1|  FUS6                                                    228   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104291.1|  PREDICTED: COP9 signalosome complex subunit 1      228   5e-69   Brassica rapa
ref|XP_010512447.1|  PREDICTED: COP9 signalosome complex subunit ...    226   1e-68   Camelina sativa [gold-of-pleasure]
dbj|BAC42193.1|  putative FUSCA protein FUS6                            226   3e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010055224.1|  PREDICTED: COP9 signalosome complex subunit 1      225   4e-68   Eucalyptus grandis [rose gum]
ref|XP_006857876.1|  hypothetical protein AMTR_s00069p00104060          220   8e-67   
gb|ADE77099.1|  unknown                                                 220   4e-66   Picea sitchensis
ref|XP_010919243.1|  PREDICTED: COP9 signalosome complex subunit ...    218   2e-65   Elaeis guineensis
ref|XP_008799523.1|  PREDICTED: COP9 signalosome complex subunit 1      217   7e-65   Phoenix dactylifera
ref|XP_009384079.1|  PREDICTED: COP9 signalosome complex subunit ...    214   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384078.1|  PREDICTED: COP9 signalosome complex subunit ...    214   2e-63   
tpg|DAA42931.1|  TPA: hypothetical protein ZEAMMB73_064772              209   2e-63   
ref|XP_010933872.1|  PREDICTED: COP9 signalosome complex subunit ...    212   6e-63   Elaeis guineensis
ref|XP_004985986.1|  PREDICTED: COP9 signalosome complex subunit ...    211   7e-63   Setaria italica
gb|EYU30315.1|  hypothetical protein MIMGU_mgv1a017887mg                202   9e-63   Erythranthe guttata [common monkey flower]
ref|XP_008795398.1|  PREDICTED: COP9 signalosome complex subunit ...    210   2e-62   Phoenix dactylifera
ref|XP_002465983.1|  hypothetical protein SORBIDRAFT_01g049510          209   5e-62   Sorghum bicolor [broomcorn]
ref|NP_001149716.1|  fusca homolog                                      209   6e-62   Zea mays [maize]
tpg|DAA42932.1|  TPA: COP9 signalosome complex subunit 1                209   7e-62   
ref|XP_004492680.1|  PREDICTED: probable methyltransferase PMT15-...    216   1e-61   
gb|AAG17476.1|AF106844_1  rCOP11 protein                                207   6e-61   Oryza sativa Indica Group [Indian rice]
ref|NP_001048760.1|  Os03g0116500                                       206   6e-61   
gb|AAF40112.1|AF160800_1  constitutive photomorphogenic 11              206   6e-61   Oryza sativa Indica Group [Indian rice]
pdb|4LCT|A  Chain A, Crystal Structure And Versatile Functional R...    203   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382294.1|  PREDICTED: COP9 signalosome complex subunit ...    205   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382292.1|  PREDICTED: COP9 signalosome complex subunit ...    205   1e-59   
ref|XP_006649270.1|  PREDICTED: COP9 signalosome complex subunit ...    203   1e-59   
gb|AFW89801.1|  hypothetical protein ZEAMMB73_510109                    193   7e-59   
ref|XP_009411462.1|  PREDICTED: COP9 signalosome complex subunit 1      200   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003623834.1|  COP9 signalosome complex subunit                   194   4e-56   Medicago truncatula
gb|ABN08825.1|  Proteasome component region PCI                         194   4e-56   Medicago truncatula
ref|XP_003558971.1|  PREDICTED: COP9 signalosome complex subunit 1      193   7e-56   Brachypodium distachyon [annual false brome]
ref|XP_001758275.1|  predicted protein                                  190   1e-54   
dbj|BAJ99160.1|  predicted protein                                      190   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001781784.1|  predicted protein                                  182   8e-52   
ref|XP_003574218.1|  PREDICTED: COP9 signalosome complex subunit ...    182   2e-51   
emb|CAB91509.1|  FUSCA6 protein                                         170   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002992519.1|  hypothetical protein SELMODRAFT_135331             177   8e-50   
dbj|BAK01545.1|  predicted protein                                      177   9e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002990169.1|  hypothetical protein SELMODRAFT_235966             177   9e-50   Selaginella moellendorffii
gb|EMT23876.1|  hypothetical protein F775_13561                         175   9e-49   
gb|EMS50485.1|  COP9 signalosome complex subunit 1                      166   2e-45   Triticum urartu
ref|XP_001702205.1|  hypothetical protein CHLREDRAFT_194712             146   3e-38   Chlamydomonas reinhardtii
ref|XP_002499830.1|  predicted protein                                  142   2e-36   Micromonas commoda
ref|XP_005847304.1|  hypothetical protein CHLNCDRAFT_35625              140   8e-36   Chlorella variabilis
ref|XP_002953121.1|  hypothetical protein VOLCADRAFT_63341              137   1e-34   Volvox carteri f. nagariensis
gb|EMT19620.1|  hypothetical protein F775_30940                         135   2e-34   
ref|XP_004338219.1|  PCI domain containing protein                      133   2e-33   Acanthamoeba castellanii str. Neff
ref|XP_005647635.1|  PCI-domain-containing protein                      125   1e-30   Coccomyxa subellipsoidea C-169
gb|EWM28121.1|  fusca protein fus6                                      124   9e-30   Nannochloropsis gaditana
gb|EWM28122.1|  fusca protein fus6                                      122   3e-29   Nannochloropsis gaditana
gb|EMT16886.1|  hypothetical protein F775_12844                         117   5e-28   
ref|XP_003062080.1|  predicted protein                                  117   6e-28   Micromonas pusilla CCMP1545
ref|XP_002673052.1|  predicted protein                                  108   1e-24   Naegleria gruberi strain NEG-M
emb|CBN79714.1|  conserved unknown protein                              108   2e-24   Ectocarpus siliculosus
gb|KIY96361.1|  COP9 signalosome complex subunit 1                      104   3e-23   Monoraphidium neglectum
gb|ERZ96782.1|  hypothetical protein GLOINDRAFT_12251                   102   2e-22   
gb|EXX71082.1|  proteasome regulatory particle lid subunit RPN7         102   2e-22   Rhizophagus irregularis DAOM 197198w
gb|EXX71081.1|  proteasome regulatory particle lid subunit RPN7         102   2e-22   Rhizophagus irregularis DAOM 197198w
ref|XP_009529697.1|  hypothetical protein PHYSODRAFT_346736             102   2e-22   Phytophthora sojae
dbj|GAM24105.1|  hypothetical protein SAMD00019534_072800               102   2e-22   Acytostelium subglobosum LB1
ref|XP_005784981.1|  hypothetical protein EMIHUDRAFT_429574             102   3e-22   Emiliania huxleyi CCMP1516
ref|XP_005782292.1|  hypothetical protein EMIHUDRAFT_468481             100   6e-22   Emiliania huxleyi CCMP1516
ref|XP_008904528.1|  hypothetical protein PPTG_10821                  99.8    2e-21   Phytophthora parasitica INRA-310
gb|ETL94579.1|  hypothetical protein L917_07486                       99.4    2e-21   Phytophthora parasitica
gb|KFH69103.1|  hypothetical protein MVEG_05904                         100   4e-21   Mortierella verticillata NRRL 6337
ref|XP_001628909.1|  predicted protein                                98.2    1e-20   Nematostella vectensis
ref|XP_011124184.1|  hypothetical protein AOL_s00097g49               98.2    1e-20   Arthrobotrys oligospora ATCC 24927
ref|XP_002908960.1|  COP9 signalosome complex subunit 1, putative     97.4    1e-20   Phytophthora infestans T30-4
gb|EKC21956.1|  COP9 signalosome complex subunit 1                    95.5    8e-20   Crassostrea gigas
ref|XP_011440531.1|  PREDICTED: COP9 signalosome complex subunit ...  95.5    9e-20   
ref|XP_004344506.2|  proteasome component region PCI                  95.5    9e-20   Capsaspora owczarzaki ATCC 30864
gb|EKC37296.1|  COP9 signalosome complex subunit 1                    95.5    1e-19   Crassostrea gigas
ref|XP_011421157.1|  PREDICTED: COP9 signalosome complex subunit ...  95.1    1e-19   Crassostrea gigas
ref|XP_011421153.1|  PREDICTED: COP9 signalosome complex subunit ...  95.1    1e-19   Crassostrea gigas
gb|KDO34257.1|  hypothetical protein SPRG_19085                       93.2    3e-19   Saprolegnia parasitica CBS 223.65
gb|EFA79052.1|  COP9 signalosome complex subunit 1                    94.0    4e-19   Heterostelium album PN500
ref|NP_001040322.1|  G protein pathway suppressor 1                   93.6    5e-19   Bombyx mori [silk moth]
ref|XP_009844457.1|  hypothetical protein H257_17375                  93.2    6e-19   Aphanomyces astaci
ref|XP_009017274.1|  hypothetical protein HELRODRAFT_111705           93.2    7e-19   Helobdella robusta
ref|XP_011111513.1|  hypothetical protein H072_5664                   93.2    8e-19   
ref|XP_008611944.1|  hypothetical protein SDRG_07865                  92.4    8e-19   Saprolegnia diclina VS20
ref|XP_006682569.1|  hypothetical protein BATDEDRAFT_14705            92.8    1e-18   Batrachochytrium dendrobatidis JAM81
gb|KFM79956.1|  COP9 signalosome complex subunit 1                    92.8    1e-18   Stegodyphus mimosarum
ref|XP_003838129.1|  similar to COP9 signalosome complex subunit 1    92.4    1e-18   Leptosphaeria maculans JN3
gb|EHJ77730.1|  G protein pathway suppressor 1                        92.4    1e-18   
ref|XP_008544126.1|  PREDICTED: COP9 signalosome complex subunit 1    92.0    2e-18   Microplitis demolitor
emb|CDX79636.1|  BnaC03g19720D                                        91.7    2e-18   
ref|XP_009065339.1|  hypothetical protein LOTGIDRAFT_184282           91.3    3e-18   Lottia gigantea
ref|XP_006814658.1|  PREDICTED: COP9 signalosome complex subunit ...  90.9    4e-18   Saccoglossus kowalevskii
gb|EWC47867.1|  hypothetical protein DRE_02749                        90.9    5e-18   Drechslerella stenobrocha 248
ref|XP_002733264.2|  PREDICTED: COP9 signalosome complex subunit ...  90.9    5e-18   Saccoglossus kowalevskii
ref|XP_006814657.1|  PREDICTED: COP9 signalosome complex subunit ...  90.5    5e-18   Saccoglossus kowalevskii
ref|XP_011311032.1|  PREDICTED: COP9 signalosome complex subunit 1    90.5    6e-18   Fopius arisanus
ref|XP_003746672.1|  PREDICTED: COP9 signalosome complex subunit ...  90.9    6e-18   Galendromus occidentalis
ref|XP_003293224.1|  COP9 signalosome complex subunit 1               90.1    7e-18   Dictyostelium purpureum
gb|EFX74404.1|  hypothetical protein DAPPUDRAFT_307307                90.1    1e-17   Daphnia pulex
ref|XP_968588.1|  PREDICTED: COP9 signalosome complex subunit 1       90.1    1e-17   Tribolium castaneum [rust-red flour beetle]
ref|XP_011503070.1|  PREDICTED: COP9 signalosome complex subunit 1    90.1    1e-17   Ceratosolen solmsi marchali
ref|XP_003382062.1|  COP9 signalosome complex subunit 1               87.8    1e-17   Trichinella spiralis
ref|XP_787846.3|  PREDICTED: COP9 signalosome complex subunit 1       89.4    2e-17   
ref|XP_002591224.1|  hypothetical protein BRAFLDRAFT_116394           89.4    2e-17   Branchiostoma floridae
ref|XP_639011.1|  COP9 signalosome complex subunit 1                  88.6    3e-17   Dictyostelium discoideum AX4
ref|XP_007289108.1|  26S proteasome subunit RPN7                      88.6    3e-17   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_003746673.1|  PREDICTED: COP9 signalosome complex subunit ...  88.6    4e-17   
ref|XP_008865767.1|  hypothetical protein H310_03609                  89.0    5e-17   Aphanomyces invadans
dbj|GAM38706.1|  hypothetical protein TCE0_033f09652                  87.8    5e-17   Talaromyces cellulolyticus
gb|KIK48588.1|  hypothetical protein CY34DRAFT_798102                 87.8    7e-17   Suillus luteus UH-Slu-Lm8-n1
gb|KDR21197.1|  COP9 signalosome complex subunit 1                    87.8    7e-17   Zootermopsis nevadensis
ref|XP_003700110.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  87.4    8e-17   
ref|XP_007267270.1|  hypothetical protein FOMMEDRAFT_87024            87.0    1e-16   Fomitiporia mediterranea MF3/22
gb|KFB48458.1|  AGAP004953-PA-like protein                            86.7    1e-16   Anopheles sinensis
ref|XP_008469553.1|  PREDICTED: COP9 signalosome complex subunit ...  85.5    1e-16   
gb|KDN34252.1|  hypothetical protein RSAG8_12661                      84.7    1e-16   Rhizoctonia solani AG-8 WAC10335
ref|XP_006300166.1|  hypothetical protein CARUB_v10016397mg           84.7    1e-16   
emb|CCA73886.1|  related to COP9 signalosome complex subunit 1        86.7    2e-16   Serendipita indica DSM 11827
gb|ENN72798.1|  hypothetical protein YQE_10602                        86.7    2e-16   Dendroctonus ponderosae
gb|ELU09497.1|  hypothetical protein CAPTEDRAFT_174845                86.7    2e-16   Capitella teleta
gb|KIN06127.1|  hypothetical protein OIDMADRAFT_38484                 86.3    2e-16   Oidiodendron maius Zn
ref|XP_002483342.1|  COP9 signalosome subunit 1 (CsnA), putative      86.3    2e-16   Talaromyces stipitatus ATCC 10500
gb|KIP03274.1|  hypothetical protein PHLGIDRAFT_77841                 86.3    2e-16   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_315051.4|  AGAP004953-PA                                       86.3    2e-16   Anopheles gambiae str. PEST
ref|XP_007281056.1|  cop9 signalosome subunit 1                       85.9    3e-16   
ref|XP_007601931.1|  26S proteasome subunit RPN7                      85.9    3e-16   
gb|EQB45604.1|  26S proteasome subunit RPN7                           85.5    3e-16   Colletotrichum gloeosporioides Cg-14
ref|XP_005704355.1|  COP9 signalosome complex subunit 1               85.1    4e-16   Galdieria sulphuraria
gb|KIN98194.1|  hypothetical protein M404DRAFT_859808                 85.9    4e-16   Pisolithus tinctorius Marx 270
ref|XP_011337550.1|  PREDICTED: COP9 signalosome complex subunit ...  85.5    4e-16   Ooceraea biroi
ref|XP_011337549.1|  PREDICTED: COP9 signalosome complex subunit ...  85.5    4e-16   Ooceraea biroi
gb|ETN67188.1|  G protein pathway suppressor 1                        85.5    4e-16   Anopheles darlingi [American malaria mosquito]
gb|ESZ92994.1|  hypothetical protein SBOR_6615                        85.5    4e-16   Sclerotinia borealis F-4128
ref|XP_011252985.1|  PREDICTED: COP9 signalosome complex subunit 1    85.5    4e-16   Camponotus floridanus
emb|CCX10685.1|  Similar to COP9 signalosome complex subunit 1; a...  85.1    5e-16   Pyronema omphalodes CBS 100304
ref|XP_011146522.1|  PREDICTED: COP9 signalosome complex subunit ...  85.1    5e-16   Harpegnathos saltator
ref|XP_011146521.1|  PREDICTED: COP9 signalosome complex subunit ...  85.1    5e-16   Harpegnathos saltator
ref|XP_011146519.1|  PREDICTED: COP9 signalosome complex subunit ...  85.1    5e-16   
ref|XP_007706832.1|  hypothetical protein COCCADRAFT_567              85.1    6e-16   Bipolaris zeicola 26-R-13
gb|EUN27903.1|  hypothetical protein COCVIDRAFT_97010                 84.7    6e-16   Bipolaris victoriae FI3
ref|XP_003031510.1|  hypothetical protein SCHCODRAFT_77341            84.7    7e-16   Schizophyllum commune H4-8
gb|EQL36724.1|  hypothetical protein BDFG_01694                       85.1    7e-16   Blastomyces dermatitidis ATCC 26199
gb|EGE83463.1|  COP9 signalosome subunit 1                            84.7    7e-16   Blastomyces dermatitidis ATCC 18188
ref|XP_001861384.1|  conserved hypothetical protein                   82.0    1e-15   Culex quinquefasciatus
gb|KFZ12912.1|  hypothetical protein V502_06860                       84.0    1e-15   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|XP_007689963.1|  hypothetical protein COCMIDRAFT_7059             84.0    1e-15   Bipolaris oryzae ATCC 44560
gb|ELR06053.1|  hypothetical protein GMDG_07764                       84.0    1e-15   Pseudogymnoascus destructans 20631-21
ref|XP_003492343.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  84.0    1e-15   
ref|XP_003397875.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  84.0    1e-15   
gb|EFN70555.1|  COP9 signalosome complex subunit 1b                   84.3    1e-15   Camponotus floridanus
ref|XP_007698377.1|  hypothetical protein COCSADRAFT_35685            83.6    2e-15   Bipolaris sorokiniana ND90Pr
ref|XP_003305532.1|  hypothetical protein PTT_18397                   83.6    2e-15   
ref|XP_001937413.1|  COP9 signalosome subunit 1                       83.6    2e-15   Pyrenophora tritici-repentis Pt-1C-BFP
gb|KFY85144.1|  hypothetical protein V500_08674                       84.7    2e-15   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_008076949.1|  Winged helix DNA-binding protein                 83.6    2e-15   Glarea lozoyensis ATCC 20868
emb|CEL53360.1|  COP9 signalosome complex subunit 1 OS=Arabidopsi...  83.6    2e-15   Rhizoctonia solani AG-1 IB
ref|XP_008031050.1|  hypothetical protein SETTUDRAFT_166034           83.2    2e-15   Exserohilum turcica Et28A
ref|XP_011055548.1|  PREDICTED: COP9 signalosome complex subunit 1    83.2    2e-15   Acromyrmex echinatior
ref|XP_006617842.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  83.2    3e-15   Apis dorsata [rock honeybee]
ref|XP_003690236.1|  PREDICTED: COP9 signalosome complex subunit ...  83.2    3e-15   
ref|XP_011160573.1|  PREDICTED: COP9 signalosome complex subunit 1    83.2    3e-15   Solenopsis invicta [imported red fire ant]
ref|XP_002150783.1|  COP9 signalosome subunit 1 (CsnA), putative      82.8    3e-15   Talaromyces marneffei ATCC 18224
gb|KIK22558.1|  hypothetical protein PISMIDRAFT_102310                83.2    3e-15   Pisolithus microcarpus 441
gb|EFZ22741.1|  hypothetical protein SINV_15878                       83.2    3e-15   
ref|XP_008848475.1|  PREDICTED: COP9 signalosome complex subunit ...  81.3    3e-15   
ref|XP_005712200.1|  unnamed protein product                          82.8    3e-15   Chondrus crispus [carageen]
ref|XP_007317130.1|  hypothetical protein SERLADRAFT_464634           82.8    3e-15   Serpula lacrymans var. lacrymans S7.9
gb|KEY67336.1|  hypothetical protein S7711_04587                      82.8    4e-15   Stachybotrys chartarum IBT 7711
gb|KFY35039.1|  hypothetical protein V494_06258                       82.8    4e-15   Pseudogymnoascus sp. VKM F-4513 (FW-928)
emb|CCI48382.1|  unnamed protein product                              82.4    4e-15   Albugo candida
gb|KFY06820.1|  hypothetical protein V492_07711                       82.4    4e-15   Pseudogymnoascus sp. VKM F-4246
ref|XP_005109229.1|  PREDICTED: COP9 signalosome complex subunit ...  82.8    4e-15   Aplysia californica
ref|XP_005177221.1|  PREDICTED: COP9 signalosome complex subunit 1b   82.8    4e-15   Musca domestica
emb|CCI48381.1|  unnamed protein product                              82.4    4e-15   Albugo candida
gb|KFA75238.1|  hypothetical protein S40288_00264                     82.4    4e-15   Stachybotrys chartarum IBT 40288
emb|CCI48385.1|  unnamed protein product                              82.4    4e-15   Albugo candida
emb|CCI48383.1|  unnamed protein product                              82.0    5e-15   Albugo candida
ref|XP_001889263.1|  predicted protein                                82.4    5e-15   Laccaria bicolor S238N-H82
gb|EMD89882.1|  hypothetical protein COCHEDRAFT_1214926               82.0    6e-15   Bipolaris maydis C5
gb|KFA65400.1|  hypothetical protein S40285_00492                     82.0    6e-15   Stachybotrys chlorohalonata IBT 40285
emb|CCI48384.1|  unnamed protein product                              82.0    6e-15   Albugo candida
emb|CCI48386.1|  unnamed protein product                              82.0    6e-15   Albugo candida
ref|XP_001262038.1|  COP9 signalosome subunit 1 (CsnA), putative      81.6    8e-15   Aspergillus fischeri NRRL 181
gb|KFY26394.1|  hypothetical protein V491_01329                       81.6    9e-15   Pseudogymnoascus sp. VKM F-3775
emb|CCD49571.1|  similar to COP9 signalosome complex subunit 1        81.3    9e-15   Botrytis cinerea T4
ref|XP_008596586.1|  26S proteasome subunit RPN7                      81.3    1e-14   Beauveria bassiana ARSEF 2860
gb|KGQ09618.1|  COP9 signalosome complex subunit 1                    81.6    1e-14   Beauveria bassiana D1-5
gb|EPQ63974.1|  hypothetical protein BGT96224_1394                    81.3    1e-14   Blumeria graminis f. sp. tritici 96224
gb|KFY52679.1|  hypothetical protein V496_08265                       81.3    1e-14   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_007800623.1|  COP9 signalosome complex subunit 1               81.3    1e-14   Endocarpon pusillum Z07020
ref|XP_007778616.1|  hypothetical protein W97_02526                   80.9    1e-14   Coniosporium apollinis CBS 100218
gb|KFY75451.1|  hypothetical protein V499_04576                       80.9    2e-14   Pseudogymnoascus sp. VKM F-103
ref|XP_004655102.1|  PREDICTED: COP9 signalosome complex subunit 1    80.9    2e-14   Jaculus jaculus
gb|KDQ32656.1|  hypothetical protein PLEOSDRAFT_1060409               80.9    2e-14   Pleurotus ostreatus PC15
gb|KFX86106.1|  hypothetical protein O988_09765                       80.5    2e-14   Pseudogymnoascus sp. VKM F-3808
ref|XP_005350956.1|  PREDICTED: COP9 signalosome complex subunit ...  80.9    2e-14   Microtus ochrogaster [prairie voles]
ref|XP_005350957.1|  PREDICTED: COP9 signalosome complex subunit ...  80.9    2e-14   
dbj|BAN21327.1|  cop9 signalosome complex subunit                     80.5    2e-14   Riptortus pedestris
gb|EST08794.1|  hypothetical protein PSEUBRA_SCAF14g01551             80.9    2e-14   Kalmanozyma brasiliensis GHG001
gb|KIJ16576.1|  hypothetical protein PAXINDRAFT_113755                80.5    2e-14   Paxillus involutus ATCC 200175
gb|KFY25754.1|  hypothetical protein V493_04474                       80.5    2e-14   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|KIJ64919.1|  hypothetical protein HYDPIDRAFT_89529                 80.5    2e-14   Hydnomerulius pinastri MD-312
ref|XP_005350959.1|  PREDICTED: COP9 signalosome complex subunit ...  80.5    2e-14   Microtus ochrogaster [prairie voles]
gb|EDM06904.1|  G protein pathway suppressor 1, isoform CRA_c         80.5    2e-14   Rattus norvegicus [brown rat]
sp|P97834.1|CSN1_RAT  RecName: Full=COP9 signalosome complex subu...  80.1    2e-14   Rattus norvegicus [brown rat]
sp|Q99LD4.1|CSN1_MOUSE  RecName: Full=COP9 signalosome complex su...  80.1    2e-14   Mus musculus [mouse]
ref|NP_446421.3|  COP9 signalosome complex subunit 1                  80.5    2e-14   Rattus norvegicus [brown rat]
ref|NP_663345.2|  COP9 signalosome complex subunit 1 isoform 1        80.5    2e-14   Mus musculus [mouse]
ref|XP_006987714.1|  PREDICTED: COP9 signalosome complex subunit ...  80.5    2e-14   Peromyscus maniculatus bairdii
gb|EDK98233.1|  mCG1038039                                            80.1    2e-14   Mus musculus [mouse]
gb|EJU01508.1|  G protein pathway suppressor 1                        80.1    3e-14   Dacryopinax primogenitus
gb|KFY40433.1|  hypothetical protein V495_05430                       80.1    3e-14   Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|KFX93867.1|  hypothetical protein V490_04620                       80.1    3e-14   Pseudogymnoascus sp. VKM F-3557
ref|XP_009159907.1|  26S proteasome regulatory subunit N7             80.5    3e-14   Exophiala dermatitidis NIH/UT8656
ref|XP_005069845.1|  PREDICTED: COP9 signalosome complex subunit ...  80.5    3e-14   Mesocricetus auratus [Syrian golden hamster]
ref|XP_005069847.1|  PREDICTED: COP9 signalosome complex subunit ...  80.1    3e-14   
emb|CCU82656.1|  putative COP9 signalosome complex subunit 1          80.1    3e-14   Blumeria graminis f. sp. hordei DH14
emb|CDM32858.1|  COP9 signalosome complex subunit 1                   80.1    3e-14   Penicillium roqueforti FM164
gb|KIW02547.1|  hypothetical protein PV09_06003                       80.1    3e-14   Verruconis gallopava
gb|KEQ98830.1|  hypothetical protein AUEXF2481DRAFT_26080             80.1    3e-14   Aureobasidium subglaciale EXF-2481
ref|NP_001171345.1|  COP9 signalosome complex subunit 1 isoform 2     80.1    3e-14   
ref|XP_006247928.1|  PREDICTED: COP9 signalosome complex subunit ...  80.5    3e-14   
ref|XP_006532807.1|  PREDICTED: COP9 signalosome complex subunit ...  80.1    3e-14   
gb|EDM06903.1|  G protein pathway suppressor 1, isoform CRA_b         80.1    3e-14   
ref|XP_006987716.1|  PREDICTED: COP9 signalosome complex subunit ...  80.1    3e-14   
dbj|BAC40386.1|  unnamed protein product                              80.1    3e-14   
ref|XP_006247927.1|  PREDICTED: COP9 signalosome complex subunit ...  80.1    3e-14   
ref|XP_006532808.1|  PREDICTED: COP9 signalosome complex subunit ...  80.1    3e-14   
ref|XP_005350958.1|  PREDICTED: COP9 signalosome complex subunit ...  80.1    3e-14   
gb|EDM06902.1|  G protein pathway suppressor 1, isoform CRA_a         80.1    3e-14   
ref|XP_006247929.1|  PREDICTED: COP9 signalosome complex subunit ...  80.1    3e-14   
ref|XP_004359652.1|  COP9 signalosome complex subunit 1               80.1    3e-14   
gb|EPS31376.1|  hypothetical protein PDE_06331                        80.1    3e-14   
ref|XP_005069846.1|  PREDICTED: COP9 signalosome complex subunit ...  79.7    4e-14   
ref|XP_003496954.2|  PREDICTED: COP9 signalosome complex subunit ...  79.7    4e-14   
gb|KFZ08697.1|  hypothetical protein V501_05852                       79.7    4e-14   
gb|KIM23050.1|  hypothetical protein M408DRAFT_332530                 79.7    4e-14   
gb|EEH33735.2|  COP9 signalosome complex subunit 1                    79.7    4e-14   
emb|CCT68991.1|  related to COP9 signalosome complex subunit 1 (G...  79.7    4e-14   
ref|XP_010352643.1|  PREDICTED: COP9 signalosome complex subunit ...  80.1    4e-14   
emb|CDO77396.1|  hypothetical protein BN946_scf184857.g2              80.1    4e-14   
ref|XP_001113420.1|  PREDICTED: COP9 signalosome complex subunit ...  79.3    4e-14   
ref|XP_002793255.1|  COP9 signalosome complex subunit 1               79.7    4e-14   
gb|EGW06284.1|  COP9 signalosome complex subunit 1                    79.3    5e-14   
ref|XP_007957752.1|  PREDICTED: COP9 signalosome complex subunit 1    79.3    5e-14   
ref|XP_001210193.1|  hypothetical protein ATEG_00107                  79.3    5e-14   
ref|XP_003382064.1|  putative COP9 signalosome complex subunit 1      78.2    5e-14   
gb|KIW65618.1|  hypothetical protein PV04_07861                       79.3    5e-14   
dbj|GAD94163.1|  COP9 signalosome subunit 1 (CsnA), putative          79.3    6e-14   
gb|KFX45910.1|  COP9 signalosome complex subunit 1                    79.0    6e-14   
gb|EAW89741.1|  G protein pathway suppressor 1, isoform CRA_a         79.0    6e-14   
gb|EKV19903.1|  COP9 signalosome subunit 1 (CsnA), putative           79.0    7e-14   
gb|KIM41217.1|  hypothetical protein M413DRAFT_445262                 79.0    7e-14   
ref|XP_007775165.1|  G protein pathway suppressor 1                   79.0    7e-14   
ref|XP_009189787.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    7e-14   
gb|KDR76888.1|  hypothetical protein GALMADRAFT_245996                79.0    7e-14   
dbj|BAE01412.1|  unnamed protein product                              79.0    7e-14   
ref|XP_008011513.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    8e-14   
ref|XP_004040848.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    8e-14   
ref|XP_008011512.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    8e-14   
ref|XP_005256419.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    8e-14   
ref|XP_008011515.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    8e-14   
gb|AAC50906.2|  Gps1                                                  79.0    8e-14   
ref|XP_008011516.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    8e-14   
ref|XP_007365464.1|  PCI-domain-containing protein                    79.0    8e-14   
dbj|BAK63325.1|  COP9 signalosome complex subunit 1                   79.0    8e-14   
ref|XP_006940740.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    8e-14   
pdb|4D10|A  Chain A, Crystal Structure Of The Cop9 Signalosome        79.0    8e-14   
ref|NP_997657.1|  COP9 signalosome complex subunit 1 isoform 1        79.0    8e-14   
ref|XP_005256420.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    8e-14   
ref|XP_007339731.1|  PCI-domain-containing protein                    79.0    8e-14   
ref|XP_010758496.1|  hypothetical protein PADG_02525                  79.0    8e-14   
ref|XP_005256412.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    8e-14   
ref|XP_005256411.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    8e-14   
gb|EEH17569.1|  hypothetical protein PABG_00132                       79.0    8e-14   
ref|XP_008954725.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    8e-14   
gb|EUC61439.1|  COP9 signalosome complex subunit 1                    79.7    8e-14   
ref|XP_005256410.1|  PREDICTED: COP9 signalosome complex subunit ...  79.0    9e-14   
gb|KIM57683.1|  hypothetical protein SCLCIDRAFT_16897                 79.0    9e-14   
ref|XP_002828011.3|  PREDICTED: COP9 signalosome complex subunit ...  78.6    9e-14   
ref|XP_010340581.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    9e-14   
ref|XP_006940741.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    9e-14   
ref|XP_007379572.1|  hypothetical protein PUNSTDRAFT_56670            78.6    9e-14   
emb|CAH93182.1|  hypothetical protein                                 78.6    9e-14   
ref|XP_010340582.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    9e-14   
ref|XP_008692092.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    1e-13   
ref|XP_006886193.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    1e-13   
ref|XP_005256417.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    1e-13   
ref|XP_007589519.1|  putative cop9 signalosome subunit 1 protein      78.6    1e-13   
gb|KGL90265.1|  COP9 signalosome complex subunit 1                    78.6    1e-13   
ref|XP_008692091.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_008943554.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
gb|KFQ34436.1|  COP9 signalosome complex subunit 1                    78.2    1e-13   
ref|XP_010340579.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    1e-13   
ref|XP_004639519.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_010340577.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    1e-13   
ref|XP_002406220.1|  26S proteasome regulatory complex, subunit R...  78.2    1e-13   
ref|XP_011202927.1|  PREDICTED: COP9 signalosome complex subunit 1b   78.2    1e-13   
ref|XP_008043372.1|  G protein pathway suppressor 1                   78.2    1e-13   
ref|XP_008048094.1|  PREDICTED: COP9 signalosome complex subunit 1    78.2    1e-13   
ref|XP_005256415.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    1e-13   
ref|XP_009189782.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    1e-13   
ref|XP_009189781.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    1e-13   
ref|XP_005001531.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_010616974.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_005256414.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    1e-13   
ref|XP_006666819.1|  COP9 signalosome subunit 1, putative             78.2    1e-13   
ref|XP_010352642.1|  PREDICTED: COP9 signalosome complex subunit ...  78.6    1e-13   
ref|XP_010616975.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_004639518.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_005001530.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_008518649.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_005597063.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_007741215.1|  hypothetical protein A1O5_02409                  78.2    1e-13   
ref|XP_004861069.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_006743161.1|  PREDICTED: COP9 signalosome complex subunit 1    78.2    1e-13   
ref|XP_002912928.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_004861064.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_003464870.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    1e-13   
ref|XP_005407281.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    2e-13   
ref|XP_009879564.1|  PREDICTED: COP9 signalosome complex subunit 1    78.2    2e-13   
ref|XP_004861065.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    2e-13   
ref|XP_006061846.1|  PREDICTED: COP9 signalosome complex subunit 1    77.8    2e-13   
ref|XP_005407278.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    2e-13   
ref|XP_008574495.1|  PREDICTED: COP9 signalosome complex subunit 1    78.2    2e-13   
gb|KGO45755.1|  26S proteasome, regulatory subunit Rpn7               77.8    2e-13   
ref|XP_005407279.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    2e-13   
ref|XP_003464871.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
gb|KIK91164.1|  hypothetical protein PAXRUDRAFT_150114                77.8    2e-13   
ref|XP_005694104.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_007524525.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_006886192.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    2e-13   
ref|XP_008153196.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_010948939.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_010948937.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_010854648.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
emb|CCA15119.1|  COP9 signalosome complex subunit 1 putative          77.8    2e-13   
ref|XP_007434244.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_007434243.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
gb|ELR49314.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
ref|XP_011222157.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    2e-13   
ref|XP_006172767.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_011222147.1|  PREDICTED: COP9 signalosome complex subunit ...  78.2    2e-13   
gb|KIW91955.1|  hypothetical protein Z519_06937                       77.8    2e-13   
gb|KFO92235.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
gb|KGO76112.1|  Winged helix-turn-helix transcription repressor D...  77.8    2e-13   
gb|EHB09356.1|  COP9 signalosome complex subunit 1                    78.2    2e-13   
ref|XP_003217340.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_004894687.1|  PREDICTED: COP9 signalosome complex subunit 1    78.2    2e-13   
ref|XP_007434242.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_010138488.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
gb|EWZ38446.1|  hypothetical protein FOZG_10048                       77.8    2e-13   
gb|KFO52922.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
gb|EXL76321.1|  hypothetical protein FOPG_08953                       77.4    2e-13   
gb|KFU85954.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
gb|EXL98978.1|  hypothetical protein FOIG_08889                       77.4    2e-13   
ref|XP_002563490.1|  Pc20g09960                                       77.8    2e-13   
gb|KFV00315.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
ref|XP_003211510.1|  PREDICTED: COP9 signalosome complex subunit 1    77.8    2e-13   
ref|NP_001095564.1|  COP9 signalosome complex subunit 1               77.8    2e-13   
ref|XP_004177013.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
gb|EXK40538.1|  hypothetical protein FOMG_07340                       77.4    2e-13   
ref|XP_010993795.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_008629067.1|  PREDICTED: COP9 signalosome complex subunit 1    77.8    2e-13   
ref|XP_005530682.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
gb|KFQ98921.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
tpg|DAA18252.1|  TPA: G protein pathway suppressor 1                  77.8    2e-13   
gb|KFQ42017.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
gb|KFM07635.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
ref|XP_010006948.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
gb|KFP01541.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
ref|XP_010993796.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_010566442.1|  PREDICTED: COP9 signalosome complex subunit 1    77.4    2e-13   
ref|XP_008102780.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_005495717.1|  PREDICTED: COP9 signalosome complex subunit 1    77.8    2e-13   
ref|XP_010206570.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  77.8    2e-13   
gb|KFV65376.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
gb|EWZ38445.1|  hypothetical protein FOZG_10048                       77.4    2e-13   
ref|XP_004432936.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
gb|KFP92121.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
ref|XP_010078808.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
ref|XP_010009709.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
ref|XP_009081235.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
ref|XP_009874438.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
gb|EXK40537.1|  hypothetical protein FOMG_07340                       77.4    2e-13   
ref|XP_005429856.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_009487431.1|  PREDICTED: COP9 signalosome complex subunit 1    77.8    2e-13   
ref|XP_008492794.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  77.4    2e-13   
gb|EWY91781.1|  hypothetical protein FOYG_08750                       77.4    2e-13   
gb|KFO09191.1|  COP9 signalosome complex subunit 1                    77.4    2e-13   
ref|XP_008102781.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|XP_004093043.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  77.4    2e-13   
gb|KFQ54542.1|  COP9 signalosome complex subunit 1                    77.4    2e-13   
ref|XP_009896204.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  77.8    2e-13   
gb|EGU84844.1|  hypothetical protein FOXB_04625                       77.4    2e-13   
ref|XP_010121403.1|  PREDICTED: COP9 signalosome complex subunit 1    77.8    2e-13   
ref|XP_005056283.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
ref|XP_009819101.1|  PREDICTED: COP9 signalosome complex subunit 1    77.8    2e-13   
ref|XP_009580391.1|  PREDICTED: COP9 signalosome complex subunit 1    77.8    2e-13   
gb|EWY91780.1|  hypothetical protein FOYG_08750                       77.4    2e-13   
ref|XP_006869550.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
ref|XP_009465232.1|  PREDICTED: COP9 signalosome complex subunit 1    77.8    2e-13   
gb|EOB07172.1|  COP9 signalosome complex subunit 1                    77.4    2e-13   
ref|XP_006869551.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
gb|KFZ66422.1|  COP9 signalosome complex subunit 1                    77.4    2e-13   
ref|XP_005144264.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
gb|EXL98977.1|  hypothetical protein FOIG_08889                       77.4    2e-13   
gb|KGL79039.1|  COP9 signalosome complex subunit 1                    77.4    2e-13   
ref|XP_007524524.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
ref|XP_006869552.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
ref|XP_011188906.1|  PREDICTED: COP9 signalosome complex subunit 1b   77.4    2e-13   
ref|XP_009693375.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  77.8    2e-13   
ref|XP_003237214.1|  COP9 signalosome subunit 1                       77.4    2e-13   
gb|ETE70339.1|  COP9 signalosome complex subunit 1                    77.8    2e-13   
ref|XP_010215524.1|  PREDICTED: COP9 signalosome complex subunit ...  77.8    2e-13   
ref|NP_001006206.1|  COP9 signalosome complex subunit 1               77.4    2e-13   
gb|KFP09891.1|  COP9 signalosome complex subunit 1                    77.4    2e-13   
gb|EMC84076.1|  COP9 signalosome complex subunit 1                    77.4    2e-13   
ref|XP_002372821.1|  COP9 signalosome subunit 1 (CsnA), putative      77.0    2e-13   
ref|XP_004040849.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
ref|XP_009667080.1|  PREDICTED: COP9 signalosome complex subunit 1    77.4    2e-13   
ref|XP_008011519.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
ref|XP_009913378.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    2e-13   
gb|AAP88836.1|  G protein pathway suppressor 1                        77.4    2e-13   
ref|XP_005243996.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  77.4    2e-13   
ref|XP_009913389.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    3e-13   
ref|XP_006869549.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    3e-13   
ref|XP_009642521.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...  77.4    3e-13   
gb|KFQ66319.1|  COP9 signalosome complex subunit 1                    77.4    3e-13   
ref|XP_010281563.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    3e-13   
gb|KEQ85852.1|  hypothetical protein M438DRAFT_373388                 77.4    3e-13   
emb|CCM06321.1|  predicted protein                                    77.4    3e-13   
dbj|BAG60198.1|  unnamed protein product                              77.4    3e-13   
ref|XP_009930888.1|  PREDICTED: COP9 signalosome complex subunit 1    77.4    3e-13   
ref|XP_009510932.1|  PREDICTED: COP9 signalosome complex subunit 1    77.4    3e-13   
ref|XP_006869548.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    3e-13   
ref|XP_009250455.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    3e-13   
gb|EQB76941.1|  COP9 signalosome complex subunit 1                    77.4    3e-13   
ref|XP_007886740.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    3e-13   
ref|XP_007886741.1|  PREDICTED: COP9 signalosome complex subunit ...  77.4    3e-13   
ref|NP_004118.3|  COP9 signalosome complex subunit 1 isoform 2        77.4    3e-13   



>ref|XP_009782446.1| PREDICTED: COP9 signalosome complex subunit 1 [Nicotiana sylvestris]
Length=440

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = +2

Query  68   DDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNT  247
            D+  G + DEI++NG  ++S RHRPIISGEQLDIE Y ALYSGRTKIMRLLFIADRC N 
Sbjct  4    DEDLGQIADEIYANGD-ENSQRHRPIISGEQLDIELYAALYSGRTKIMRLLFIADRCGNA  62

Query  248  SMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLE  427
            SMQLEALRMAYDEIKKGENTQLFREV+QKI+GRLGPNYGPD  W+D+VDRRAE RKEKLE
Sbjct  63   SMQLEALRMAYDEIKKGENTQLFREVLQKIDGRLGPNYGPDPAWSDAVDRRAELRKEKLE  122

Query  428  NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK
Sbjct  123  NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  159



>ref|XP_009620565.1| PREDICTED: COP9 signalosome complex subunit 1 [Nicotiana tomentosiformis]
Length=440

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 142/157 (90%), Gaps = 1/157 (1%)
 Frame = +2

Query  68   DDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNT  247
            D+  G + DEI++NG  ++S RHRPIISGEQLDIE Y ALYSGRTKIMRLLFIADRC N 
Sbjct  4    DEDLGQIADEIYANGD-ENSQRHRPIISGEQLDIELYAALYSGRTKIMRLLFIADRCGNA  62

Query  248  SMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLE  427
            SMQ+EALRMAYDEIKKGENTQLFREV+QKI+GRLGPNYG D  W+D+VDRRAE RKEKLE
Sbjct  63   SMQVEALRMAYDEIKKGENTQLFREVIQKIDGRLGPNYGTDPAWSDAVDRRAELRKEKLE  122

Query  428  NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK
Sbjct  123  NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  159



>ref|XP_004229835.1| PREDICTED: COP9 signalosome complex subunit 1 [Solanum lycopersicum]
Length=440

 Score =   273 bits (699),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = +2

Query  68   DDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNT  247
            D+  G + +EI++NG  ++  RHRPIISGEQLDIEAY ALYSGRTKIMRLLFIADRC N 
Sbjct  4    DEDLGLIAEEIYANGD-ENKQRHRPIISGEQLDIEAYAALYSGRTKIMRLLFIADRCGNA  62

Query  248  SMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLE  427
            SMQLEALRMAYDEIKKGENTQLFREVVQKI+GRLG NYGPD  W DSVDRRA+ RKEKLE
Sbjct  63   SMQLEALRMAYDEIKKGENTQLFREVVQKIDGRLGTNYGPDPAWADSVDRRADLRKEKLE  122

Query  428  NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +ELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK
Sbjct  123  SELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  159



>emb|CDP08878.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 145/166 (87%), Gaps = 5/166 (3%)
 Frame = +2

Query  56   MEAEDDQFGSMMDE--IHSNGG---VDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLL  220
            MEAEDD    MMDE  I++NGG     ++ R RPIISGEQLD+EAY ALYSGRTKIMRLL
Sbjct  1    MEAEDDIGRHMMDENEIYANGGDGAGAETQRQRPIISGEQLDVEAYAALYSGRTKIMRLL  60

Query  221  FIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRR  400
            FIA+RC+N SMQLEALRMAYDEIKKGENT +FR+VVQKI+GRLGPNYGPD  W D+VDRR
Sbjct  61   FIAERCDNVSMQLEALRMAYDEIKKGENTHIFRDVVQKIDGRLGPNYGPDPAWADAVDRR  120

Query  401  AEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            AEQR+EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHG L EAFK
Sbjct  121  AEQRREKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALAEAFK  166



>emb|CAY85529.1| Cop11 protein [Carica papaya]
Length=440

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = +2

Query  68   DDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNT  247
            D+  G + +EI++NG  ++  RHRPIISGEQLDIEAY ALYSGRTKIMRLLFIADRC N 
Sbjct  4    DEDLGLIAEEIYANGD-ENKQRHRPIISGEQLDIEAYAALYSGRTKIMRLLFIADRCGNA  62

Query  248  SMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLE  427
            SMQLEALRMAYDEIKKGENTQLFREVVQKI+GRLG NYGPD  W DSVDRRA+ RKEKLE
Sbjct  63   SMQLEALRMAYDEIKKGENTQLFREVVQKIDGRLGTNYGPDPAWADSVDRRADLRKEKLE  122

Query  428  NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +ELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK
Sbjct  123  SELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  159



>ref|XP_006445146.1| hypothetical protein CICLE_v10020177mg [Citrus clementina]
 ref|XP_006491018.1| PREDICTED: COP9 signalosome complex subunit 1-like [Citrus sinensis]
 gb|ESR58386.1| hypothetical protein CICLE_v10020177mg [Citrus clementina]
 gb|KDO86017.1| hypothetical protein CISIN_1g013559mg [Citrus sinensis]
Length=441

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME ED+Q  SMM+EI SNGG ++S+R RPIISGEQLD+EAY +LY GRTKI RL+FIAD 
Sbjct  1    MEPEDEQSNSMMEEICSNGG-EESARTRPIISGEQLDVEAYASLYQGRTKITRLMFIADH  59

Query  236  CNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRK  415
            C+  SMQLEALRMAYDEIKKGENTQLFREVV+KI+GRLGPNY  D  W DSVDRRAEQRK
Sbjct  60   CDIASMQLEALRMAYDEIKKGENTQLFREVVKKIDGRLGPNYAMDEAWCDSVDRRAEQRK  119

Query  416  EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  120  EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFK  160



>ref|XP_006339459.1| PREDICTED: COP9 signalosome complex subunit 1-like [Solanum tuberosum]
Length=440

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = +2

Query  68   DDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNT  247
            D+  G + DEI++NG  +++ RHRPIIS EQLD+EAY ALYSGRTKIMRL FIADRC N 
Sbjct  4    DEDLGLIADEIYANGD-ENTQRHRPIISSEQLDVEAYAALYSGRTKIMRLHFIADRCGNA  62

Query  248  SMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLE  427
            SMQLEALRMAYDEIKKGENTQLFREVVQKI+GRLG NYGPD  W DSVDRRA+ RKEKLE
Sbjct  63   SMQLEALRMAYDEIKKGENTQLFREVVQKIDGRLGTNYGPDPAWADSVDRRADLRKEKLE  122

Query  428  NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +ELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK
Sbjct  123  SELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  159



>ref|XP_011091695.1| PREDICTED: COP9 signalosome complex subunit 1-like [Sesamum indicum]
 ref|XP_011091700.1| PREDICTED: COP9 signalosome complex subunit 1-like [Sesamum indicum]
Length=445

 Score =   269 bits (687),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 145/164 (88%), Gaps = 3/164 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMM--DEIHSNGG-VDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFI  226
            MEAE+D  G+++  D+I+ NGG   +S RHRPIISGEQLDIEAY ALY+GRTKI RLLFI
Sbjct  1    MEAEEDAAGTIIEDDDIYVNGGEAGESQRHRPIISGEQLDIEAYAALYTGRTKISRLLFI  60

Query  227  ADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAE  406
            A++C   SMQLEALRMAYDEIKKGENTQLFREV+ KI+GRLGP+YGPD  W D+VDRRAE
Sbjct  61   AEKCGVPSMQLEALRMAYDEIKKGENTQLFREVIGKIDGRLGPDYGPDNAWADAVDRRAE  120

Query  407  QRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             RKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK
Sbjct  121  LRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  164



>gb|EYU32064.1| hypothetical protein MIMGU_mgv1a006374mg [Erythranthe guttata]
Length=446

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 142/165 (86%), Gaps = 4/165 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDE--IHSNGGVD--DSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLF  223
            MEAEDD  G+++DE  I  NGG D   S RHRPIISGEQLD+EAY ALY+GRTK+ RLLF
Sbjct  1    MEAEDDTAGTIIDEDEICINGGNDAQSSQRHRPIISGEQLDVEAYAALYTGRTKVTRLLF  60

Query  224  IADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRA  403
            IA++C   SMQLEALRMAYDEIKKGENTQLFR+V+ KI GRLGPNYGPD  W D+VDRRA
Sbjct  61   IAEKCGVPSMQLEALRMAYDEIKKGENTQLFRDVLAKIAGRLGPNYGPDNAWADAVDRRA  120

Query  404  EQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            E R+EKLENELNAYRTNLIKESIRMGYNDFGDFYY HGQLGEAFK
Sbjct  121  ELRREKLENELNAYRTNLIKESIRMGYNDFGDFYYLHGQLGEAFK  165



>ref|XP_003521302.1| PREDICTED: COP9 signalosome complex subunit 1-like [Glycine max]
Length=444

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 145/163 (89%), Gaps = 2/163 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRH--RPIISGEQLDIEAYDALYSGRTKIMRLLFIA  229
            M+ +D+  G M+DEI++NGG DD  +   R I+SG+Q+DIEAY ALYSGRTKIMRLLFIA
Sbjct  1    MDGDDETSGPMIDEIYANGGGDDGDKRSRRAIMSGDQVDIEAYAALYSGRTKIMRLLFIA  60

Query  230  DRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQ  409
            D+ NN + QLEALRMAYDEIKKGENTQLFREVVQKI+GRLGPNYG DA W D++DRRAEQ
Sbjct  61   DKMNNAASQLEALRMAYDEIKKGENTQLFREVVQKIDGRLGPNYGMDAAWCDAIDRRAEQ  120

Query  410  RKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +KEKLENELNAYRTNLIKESIRMGYNDFG+FYYAHGQLG+AFK
Sbjct  121  KKEKLENELNAYRTNLIKESIRMGYNDFGEFYYAHGQLGDAFK  163



>emb|CBI50749.1| Cop11 protein [Citrus x paradisi]
Length=440

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = +2

Query  68   DDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNT  247
            D+  G + +EI++NG  +   RHRPIISGEQLDIEAY ALYSGRTKIMRLLFIADRC N 
Sbjct  4    DEDLGLIAEEIYANGD-EKKQRHRPIISGEQLDIEAYAALYSGRTKIMRLLFIADRCGNA  62

Query  248  SMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLE  427
            SMQLEALRM YDEIKKGENTQLFREVVQKI+G LG NYGPD  W DSVDRRA+ RKEKLE
Sbjct  63   SMQLEALRMGYDEIKKGENTQLFREVVQKIDGPLGTNYGPDPAWADSVDRRADLRKEKLE  122

Query  428  NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +ELNAYRTNLIKESIRM YNDFGDFYYAHGQLGEAF+
Sbjct  123  SELNAYRTNLIKESIRMAYNDFGDFYYAHGQLGEAFR  159



>ref|XP_007134963.1| hypothetical protein PHAVU_010G090500g [Phaseolus vulgaris]
 gb|ESW06957.1| hypothetical protein PHAVU_010G090500g [Phaseolus vulgaris]
Length=444

 Score =   264 bits (674),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRH--RPIISGEQLDIEAYDALYSGRTKIMRLLFIA  229
            M+ +D+  G M+DEI++NGG DD  +   R I+SG+QLD+EAY ALYSGRTKIMRL+FIA
Sbjct  1    MDGDDETSGPMIDEIYANGGGDDGDQRSRRAIMSGDQLDVEAYAALYSGRTKIMRLIFIA  60

Query  230  DRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQ  409
            D+ NN + QLEALRMAYDEIKKGENTQLFREVVQKI+GRLG NYG D  W D+VDRRAEQ
Sbjct  61   DKMNNAATQLEALRMAYDEIKKGENTQLFREVVQKIDGRLGANYGMDTAWCDAVDRRAEQ  120

Query  410  RKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK
Sbjct  121  KKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  163



>ref|XP_010255512.1| PREDICTED: COP9 signalosome complex subunit 1 [Nelumbo nucifera]
Length=440

 Score =   263 bits (673),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            MEAE++  G+M+++I+SNGGV+   R +PIIS EQ+D+EAY +LYSGRTKI RLLFIAD+
Sbjct  1    MEAEEEGAGTMIEDIYSNGGVE--KRTKPIISSEQMDVEAYASLYSGRTKITRLLFIADQ  58

Query  236  CNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRK  415
            C N SMQLEALRMAYDEIKKGENTQLFREVVQKI+GRLGP Y  D  W D+VDRRAEQRK
Sbjct  59   CGNQSMQLEALRMAYDEIKKGENTQLFREVVQKIDGRLGPAYRMDQAWADNVDRRAEQRK  118

Query  416  EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            EKLENELN+YRTNLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  119  EKLENELNSYRTNLIKESIRMGYNDFGDFYYAHGALGDAFK  159



>gb|EPS64067.1| hypothetical protein M569_10712, partial [Genlisea aurea]
Length=440

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMM--DEIHSNGGVD--DSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLF  223
            ME E+D  G+++  +EI+ NGGV   +SSR+RPIISGEQLDIEAY ALY+GRTKI RL+F
Sbjct  1    METEEDAAGTIVADEEIYGNGGVHVGESSRNRPIISGEQLDIEAYAALYTGRTKISRLIF  60

Query  224  IADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRA  403
            IA++C   SMQLEALRMAYDEIKKGENTQLFREVV KI+ RLGP+YGPD  W D+VDRRA
Sbjct  61   IAEKCGVPSMQLEALRMAYDEIKKGENTQLFREVVAKIDMRLGPDYGPDNSWADAVDRRA  120

Query  404  EQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            E +KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQL EAFK
Sbjct  121  ELKKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLPEAFK  165



>ref|XP_002511799.1| cop9 signalosome complex subunit, putative [Ricinus communis]
 gb|EEF50468.1| cop9 signalosome complex subunit, putative [Ricinus communis]
Length=433

 Score =   260 bits (665),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = +2

Query  92   DEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALR  271
            DEI++NGG + +SR+RPIISGEQLDIEAY  LY+GRTKI RLLFIAD C+N +MQLEALR
Sbjct  5    DEIYANGG-ESTSRNRPIISGEQLDIEAYAGLYTGRTKITRLLFIADHCDNPTMQLEALR  63

Query  272  MAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRT  451
            MAY+EIKKGENTQLFREVVQKI+GRLGPNY  D  W D+VDRRAEQRKE+LENELNAYRT
Sbjct  64   MAYEEIKKGENTQLFREVVQKIDGRLGPNYSMDNTWCDTVDRRAEQRKERLENELNAYRT  123

Query  452  NLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            NLIKESIRMGYNDFGDFYYAHG LGEAFK
Sbjct  124  NLIKESIRMGYNDFGDFYYAHGALGEAFK  152



>ref|XP_002272895.1| PREDICTED: COP9 signalosome complex subunit 1 [Vitis vinifera]
 emb|CBI38768.3| unnamed protein product [Vitis vinifera]
Length=441

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 139/158 (88%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   EDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNN  244
            E+   G+M+DEI+SNGG  D+ R+RPIISGE LDIEAY +LYSGRTKI RLLFIADRC N
Sbjct  5    EESSAGAMIDEIYSNGG--DAKRNRPIISGEALDIEAYASLYSGRTKITRLLFIADRCEN  62

Query  245  TSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKL  424
              MQ+EA RMAYDEIKKGENTQL+REVVQKI+GRLGP YG D  WT+SV+RRA+QRKEKL
Sbjct  63   RQMQMEAYRMAYDEIKKGENTQLYREVVQKIDGRLGPQYGLDLVWTESVERRADQRKEKL  122

Query  425  ENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            ENELNAYRTNLIKESIRMGYNDFGDFYYAHG L +AFK
Sbjct  123  ENELNAYRTNLIKESIRMGYNDFGDFYYAHGLLADAFK  160



>gb|KJB41228.1| hypothetical protein B456_007G095800 [Gossypium raimondii]
Length=485

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 146/172 (85%), Gaps = 11/172 (6%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNG--GVDDSS---------RHRPIISGEQLDIEAYDALYSGRT  202
            M+ EDD   S+M+E+++NG  GVDD+          ++RPIISGEQLDIEAY ALYSGRT
Sbjct  1    MDGEDDAPKSLMEEMYANGIEGVDDAPSSSTSTTIRKNRPIISGEQLDIEAYAALYSGRT  60

Query  203  KIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWT  382
            KIMRL+F+AD C+N+ MQLEALRMAYDE+KKGENTQLFREVVQKI+GRLGPNY  DA W 
Sbjct  61   KIMRLIFLADHCDNSGMQLEALRMAYDELKKGENTQLFREVVQKIDGRLGPNYSTDATWC  120

Query  383  DSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
              VDR+A+QRK+KLE+ELNAYRTNLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  121  AMVDRKADQRKDKLESELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFK  172



>emb|CAN74681.1| hypothetical protein VITISV_025856 [Vitis vinifera]
Length=451

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 139/158 (88%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   EDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNN  244
            E+   G+M+DEI+SNGG  D+ R+RPIISGE LDIEAY +LYSGRTKI RLLFIADRC N
Sbjct  5    EESSAGAMIDEIYSNGG--DAXRNRPIISGEALDIEAYASLYSGRTKITRLLFIADRCEN  62

Query  245  TSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKL  424
              MQ+EA RMAYDEIKKGENTQL+REVVQKI+GRLGP YG D  WT+SV+RRA+QRKEKL
Sbjct  63   RQMQMEAYRMAYDEIKKGENTQLYREVVQKIDGRLGPQYGLDLVWTESVERRADQRKEKL  122

Query  425  ENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            ENELNAYRTNLIKESIRMGYNDFGDFYYAHG L +AFK
Sbjct  123  ENELNAYRTNLIKESIRMGYNDFGDFYYAHGLLADAFK  160



>gb|KJB41227.1| hypothetical protein B456_007G095800 [Gossypium raimondii]
Length=453

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 146/172 (85%), Gaps = 11/172 (6%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNG--GVDDSS---------RHRPIISGEQLDIEAYDALYSGRT  202
            M+ EDD   S+M+E+++NG  GVDD+          ++RPIISGEQLDIEAY ALYSGRT
Sbjct  1    MDGEDDAPKSLMEEMYANGIEGVDDAPSSSTSTTIRKNRPIISGEQLDIEAYAALYSGRT  60

Query  203  KIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWT  382
            KIMRL+F+AD C+N+ MQLEALRMAYDE+KKGENTQLFREVVQKI+GRLGPNY  DA W 
Sbjct  61   KIMRLIFLADHCDNSGMQLEALRMAYDELKKGENTQLFREVVQKIDGRLGPNYSTDATWC  120

Query  383  DSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
              VDR+A+QRK+KLE+ELNAYRTNLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  121  AMVDRKADQRKDKLESELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFK  172



>gb|KHG02078.1| COP9 signalosome complex subunit 1 -like protein [Gossypium arboreum]
Length=434

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 146/172 (85%), Gaps = 11/172 (6%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNG--GVDDSS---------RHRPIISGEQLDIEAYDALYSGRT  202
            M+ EDD   S+M+E+++NG  GVDD+          ++RPIISGEQLDIEAY ALYSGRT
Sbjct  1    MDGEDDAPKSLMEEMYANGIEGVDDAPSSSTSTTIRKNRPIISGEQLDIEAYAALYSGRT  60

Query  203  KIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWT  382
            KIMRL+F+AD C+N+ MQLEALRMAYDE+KKGENTQLFREVVQKI+GRLGPNY  DA W 
Sbjct  61   KIMRLIFLADHCDNSGMQLEALRMAYDELKKGENTQLFREVVQKIDGRLGPNYSMDATWC  120

Query  383  DSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
              VDR+A+QRK+KLE+ELNAYRTNLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  121  AMVDRKADQRKDKLESELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFK  172



>gb|KDP28684.1| hypothetical protein JCGZ_14455 [Jatropha curcas]
Length=433

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = +2

Query  92   DEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALR  271
            DEI++NGG D SSR RP+ISGEQLDIEAY  LY+GRTKI RLLFIAD C+N +MQLEALR
Sbjct  5    DEIYANGG-DASSRTRPVISGEQLDIEAYAGLYTGRTKITRLLFIADHCDNPAMQLEALR  63

Query  272  MAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRT  451
            MAYDEIKKGENTQLFREVVQKI+GRLG NY  D+ W ++VDRRAEQRKE+LENELNAYRT
Sbjct  64   MAYDEIKKGENTQLFREVVQKIDGRLGHNYAMDSAWCETVDRRAEQRKERLENELNAYRT  123

Query  452  NLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            NLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  124  NLIKESIRMGYNDFGDFYYAHGALGDAFK  152



>ref|XP_010692381.1| PREDICTED: COP9 signalosome complex subunit 1 [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 3/159 (2%)
 Frame = +2

Query  65   EDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRC-N  241
            E+   G MMDEI++NG  D+  RHRPIISGEQLD+EAY +LYSGRTKI+RLLFIADRC N
Sbjct  5    EETSSGQMMDEIYANG--DEKQRHRPIISGEQLDVEAYASLYSGRTKIIRLLFIADRCDN  62

Query  242  NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEK  421
            N++M+LEALRMAYDEIKKGE++ LF+E  Q+I+G LGP+YG D+ W ++V+RRAEQRKEK
Sbjct  63   NSTMRLEALRMAYDEIKKGEDSHLFKEAAQRIDGSLGPSYGVDSSWIEAVERRAEQRKEK  122

Query  422  LENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            LENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLG+AFK
Sbjct  123  LENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGDAFK  161



>gb|KHN27284.1| COP9 signalosome complex subunit 1 [Glycine soja]
Length=405

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 145/163 (89%), Gaps = 2/163 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSR--HRPIISGEQLDIEAYDALYSGRTKIMRLLFIA  229
            M+ +D+  G M+DEI++NGG DD  +   R I+SG+Q+DIEAY ALYSGRTKIMRLLFIA
Sbjct  1    MDGDDETSGPMIDEIYANGGGDDGDKGSRRAIMSGDQVDIEAYAALYSGRTKIMRLLFIA  60

Query  230  DRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQ  409
            D+ NN + QLEALRMAYDEIKKGENTQLFREVVQKI+GRLGPNYG DA W D++DRRAEQ
Sbjct  61   DKMNNAATQLEALRMAYDEIKKGENTQLFREVVQKIDGRLGPNYGMDAAWCDAIDRRAEQ  120

Query  410  RKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +KEKLENELNAYRTNLIKESIRMGYNDFG+FYYAHGQLG+AFK
Sbjct  121  KKEKLENELNAYRTNLIKESIRMGYNDFGEFYYAHGQLGDAFK  163



>ref|XP_010091550.1| COP9 signalosome complex subunit 1 [Morus notabilis]
 gb|EXB44735.1| COP9 signalosome complex subunit 1 [Morus notabilis]
Length=457

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 142/166 (86%), Gaps = 5/166 (3%)
 Frame = +2

Query  56   MEAEDDQFGSMM--DEIHSNG--GVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLF  223
            ME ED+  G  M  +EI++NG    ++  R RPIISGEQLD+EAY +LY+GRTKI RLLF
Sbjct  1    MEGEDEPSGGPMIDEEIYANGIGAGEEEKRSRPIISGEQLDVEAYASLYTGRTKITRLLF  60

Query  224  IADRC-NNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRR  400
            IAD C NN +MQLEALRMAYDEIKKGENTQLFREVVQKI+GRLGPNY  D+ W D+VDRR
Sbjct  61   IADHCGNNQAMQLEALRMAYDEIKKGENTQLFREVVQKIDGRLGPNYTMDSAWCDTVDRR  120

Query  401  AEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            AEQ+KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  121  AEQKKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFK  166



>ref|XP_008438090.1| PREDICTED: COP9 signalosome complex subunit 1 [Cucumis melo]
Length=450

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 140/168 (83%), Gaps = 7/168 (4%)
 Frame = +2

Query  56   MEAEDDQFGSMM---DEIHSNGGV-DDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLF  223
            M+ ED+  GS     DEIH+NG   DD +R+RPII+GEQLDIEAY +LYSGRTKI RL+F
Sbjct  1    MQGEDEPSGSATMVEDEIHANGTTSDDHNRNRPIITGEQLDIEAYASLYSGRTKITRLIF  60

Query  224  IADRC---NNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVD  394
            IAD C    N +MQLEALRMAYDEIKKGEN  LFREVV KI+GRLGPNYG DA W + V+
Sbjct  61   IADHCGAETNQTMQLEALRMAYDEIKKGENALLFREVVPKIDGRLGPNYGMDAAWCEMVE  120

Query  395  RRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            RRAEQRK+KLENELNAYRTNLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  121  RRAEQRKDKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFK  168



>ref|XP_008375905.1| PREDICTED: COP9 signalosome complex subunit 1-like [Malus domestica]
Length=445

 Score =   253 bits (646),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 140/164 (85%), Gaps = 3/164 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMD-EIHSNG-GVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIA  229
            ME +DD  G M+D EI++NG   D+  R RPIIS EQLDIEAY +LYSGRTKIMRLLFIA
Sbjct  1    MEGDDDTSGPMIDDEIYANGVDGDNEKRSRPIISSEQLDIEAYASLYSGRTKIMRLLFIA  60

Query  230  DRC-NNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAE  406
             R  +N +M+LEALRMAYDEIKKGENTQL REVVQKI GRLGP YG D  W D+VDRRAE
Sbjct  61   QRSQSNEAMELEALRMAYDEIKKGENTQLHREVVQKIAGRLGPEYGMDVAWCDTVDRRAE  120

Query  407  QRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            Q+KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLG+AFK
Sbjct  121  QKKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGDAFK  164



>ref|XP_009349943.1| PREDICTED: COP9 signalosome complex subunit 1-like [Pyrus x bretschneideri]
Length=445

 Score =   253 bits (646),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMD-EIHSNG-GVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIA  229
            ME++D+  G M+D EI++NG   DD  R RPIIS EQLDIEAY +LYSGRTKI+RLLFIA
Sbjct  1    MESDDETSGPMIDDEIYANGVDGDDEKRSRPIISSEQLDIEAYASLYSGRTKIIRLLFIA  60

Query  230  DRC-NNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAE  406
            +R  +N +M+LEALRMAYDEIKKGENTQL REVVQKI GRLGP YG D  W D+VDRRAE
Sbjct  61   ERSQSNQAMELEALRMAYDEIKKGENTQLHREVVQKIGGRLGPEYGMDVAWCDAVDRRAE  120

Query  407  QRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            Q+KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLG+AFK
Sbjct  121  QKKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGDAFK  164



>ref|XP_004133880.1| PREDICTED: COP9 signalosome complex subunit 1-like [Cucumis sativus]
 ref|XP_004155810.1| PREDICTED: COP9 signalosome complex subunit 1-like [Cucumis sativus]
 gb|KGN56548.1| hypothetical protein Csa_3G123210 [Cucumis sativus]
Length=450

 Score =   253 bits (646),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 140/168 (83%), Gaps = 7/168 (4%)
 Frame = +2

Query  56   MEAEDDQFGSMM---DEIHSNGGV-DDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLF  223
            M+ ED+  GS     DEIH+NG   DD +R+RPII+GEQLDIEAY +LYSGRTKI RL+F
Sbjct  1    MQGEDEPSGSATMVEDEIHANGTTSDDHNRNRPIITGEQLDIEAYASLYSGRTKITRLIF  60

Query  224  IADRC---NNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVD  394
            IAD C    N +MQLEALRMAYDEIKKGEN  LFREVV KI+GRLGPNYG DA W + V+
Sbjct  61   IADHCGAETNHTMQLEALRMAYDEIKKGENALLFREVVPKIDGRLGPNYGMDAAWCEMVE  120

Query  395  RRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            RRAEQRK+KLENELNAYRTNLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  121  RRAEQRKDKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFK  168



>ref|XP_003528882.1| PREDICTED: COP9 signalosome complex subunit 1-like [Glycine max]
Length=446

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 140/165 (85%), Gaps = 4/165 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSS----RHRPIISGEQLDIEAYDALYSGRTKIMRLLF  223
            M+ +D+  G M+DEI++NGG           R I+SG+QLDIEAY ALYSGRTKIMRLLF
Sbjct  1    MDGDDETSGPMIDEIYANGGGVGDDGDKRSRRAIMSGDQLDIEAYAALYSGRTKIMRLLF  60

Query  224  IADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRA  403
             AD+ NN + QLEALRMAYDEIKKGENTQLFREVVQKI+GRLGPNY  DA W D+VDRRA
Sbjct  61   FADKMNNAATQLEALRMAYDEIKKGENTQLFREVVQKIDGRLGPNYDMDAAWCDTVDRRA  120

Query  404  EQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            EQ+KEKLENELNAYRTNLIKESIRMG+NDFGDFYYAHGQLG+AFK
Sbjct  121  EQKKEKLENELNAYRTNLIKESIRMGFNDFGDFYYAHGQLGDAFK  165



>ref|XP_007051916.1| COP9 signalosome complex subunit 1 [Theobroma cacao]
 gb|EOX96073.1| COP9 signalosome complex subunit 1 [Theobroma cacao]
Length=541

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 142/173 (82%), Gaps = 11/173 (6%)
 Frame = +2

Query  53   FMEAEDDQFGSMMDEIHSNG--GVDDSS---------RHRPIISGEQLDIEAYDALYSGR  199
             M+ EDD    MM+E+++NG  GVD++          ++RPIISGEQLDIEAY  LY+GR
Sbjct  73   IMDGEDDASNPMMEEMYANGIGGVDETPSSSSSTTTRKNRPIISGEQLDIEAYAGLYTGR  132

Query  200  TKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGW  379
            TKIMRL+FIAD C+N  MQLEALRMAY+EIKKGENTQLFRE VQKI+GRLGPNY  DA W
Sbjct  133  TKIMRLIFIADHCDNPGMQLEALRMAYEEIKKGENTQLFREAVQKIDGRLGPNYMMDASW  192

Query  380  TDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
               +D++AEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  193  CTMIDKKAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFK  245



>ref|XP_009343538.1| PREDICTED: COP9 signalosome complex subunit 1 [Pyrus x bretschneideri]
Length=445

 Score =   251 bits (641),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 140/164 (85%), Gaps = 3/164 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMD-EIHSNG-GVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIA  229
            ME +DD  G M+D EI++NG   D+  R RPI+S EQLDIEAY +LYSGRTKIMRLLFIA
Sbjct  1    MEGDDDTSGPMIDDEIYANGVDGDNEKRSRPIMSSEQLDIEAYASLYSGRTKIMRLLFIA  60

Query  230  DRC-NNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAE  406
             R  +N +M+LEALRMAYDEIKKGENTQL REVVQKI GRLGP YG D  W D+VDRRAE
Sbjct  61   QRSQSNEAMELEALRMAYDEIKKGENTQLHREVVQKIVGRLGPEYGMDVAWCDTVDRRAE  120

Query  407  QRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            Q+KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLG+AFK
Sbjct  121  QKKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGDAFK  164



>ref|XP_004510858.1| PREDICTED: COP9 signalosome complex subunit 1-like [Cicer arietinum]
Length=443

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSR-HRPIISGEQLDIEAYDALYSGRTKIMRLLFIAD  232
            M+ +D+  G M+DEI++NGG +   R  R I+SG+QLDIEAY ALYSGRTKIMRLLFIA+
Sbjct  1    MDGDDETSGPMIDEIYANGGEESDQRSRRAIMSGDQLDIEAYAALYSGRTKIMRLLFIAN  60

Query  233  RCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
               N ++QL+ALRMAYDEIKKGENTQLFREVVQKINGRLG NY  D  W + VDRRAEQ+
Sbjct  61   NTKNPTVQLDALRMAYDEIKKGENTQLFREVVQKINGRLGSNYEMDLSWCEVVDRRAEQK  120

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            KE+LENELNAYRTNLIKESIRMGYNDFGDFYY+HGQLG+AFK
Sbjct  121  KERLENELNAYRTNLIKESIRMGYNDFGDFYYSHGQLGDAFK  162



>ref|XP_002320757.1| COP9 signalosome complex subunit 1 family protein [Populus trichocarpa]
 gb|EEE99072.1| COP9 signalosome complex subunit 1 family protein [Populus trichocarpa]
Length=436

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 4/153 (3%)
 Frame = +2

Query  92   DEIHSNGGVDDSS-RHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRC---NNTSMQL  259
            DEI++NGG D S+ R RPIIS EQLDIEAY  LY+GRTKI RLLFIADRC   NNT+M++
Sbjct  5    DEIYANGGADVSNNRKRPIISSEQLDIEAYAGLYTGRTKITRLLFIADRCGQNNNTAMKM  64

Query  260  EALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELN  439
            EALRMAY+EIKKGENTQLFR+VVQKI+GRLG NYG D+ W + VDRRA+QRKEKLENELN
Sbjct  65   EALRMAYEEIKKGENTQLFRDVVQKIDGRLGSNYGMDSAWCEMVDRRADQRKEKLENELN  124

Query  440  AYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            AYRTNLIKESIRMGYNDFGD+YYAHG L +AFK
Sbjct  125  AYRTNLIKESIRMGYNDFGDYYYAHGYLADAFK  157



>ref|XP_008232739.1| PREDICTED: COP9 signalosome complex subunit 1 [Prunus mume]
Length=445

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMD-EIHSNG-GVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIA  229
            ME +D+  G M+D EI++NG G DD  R RPIIS EQLD+EAY +LYSGRTKIMRL+FIA
Sbjct  1    MEGDDETSGPMIDDEIYANGVGGDDEKRSRPIISSEQLDVEAYASLYSGRTKIMRLIFIA  60

Query  230  DRC-NNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAE  406
            ++  +N +M+LEALRMAYDEIKKGENTQLFR+VVQ I GRLGP+Y  D  W + VDRRA+
Sbjct  61   NKSKSNQAMELEALRMAYDEIKKGENTQLFRDVVQMIGGRLGPDYAMDLAWCEMVDRRAD  120

Query  407  QRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            Q+KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLG+AFK
Sbjct  121  QKKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGDAFK  164



>ref|XP_007220993.1| hypothetical protein PRUPE_ppa005760mg [Prunus persica]
 gb|EMJ22192.1| hypothetical protein PRUPE_ppa005760mg [Prunus persica]
Length=445

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMD-EIHSNG-GVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIA  229
            ME +D+  G M+D EI++NG G DD  R RPIIS EQLD+EAY +LYSGRTKIMRL+FIA
Sbjct  1    MEGDDETSGPMIDDEIYANGVGGDDEKRSRPIISSEQLDVEAYASLYSGRTKIMRLIFIA  60

Query  230  DRC-NNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAE  406
            ++  +N +M+LEALRMAYDEIKKGENTQLFR+VVQ I GRLGP+Y  D  W + VDRRA+
Sbjct  61   NKSKSNHAMELEALRMAYDEIKKGENTQLFRDVVQMIGGRLGPDYAMDLAWCEMVDRRAD  120

Query  407  QRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            Q+KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLG+AFK
Sbjct  121  QKKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGDAFK  164



>ref|XP_011023415.1| PREDICTED: COP9 signalosome complex subunit 1-like [Populus euphratica]
Length=436

 Score =   246 bits (627),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 4/153 (3%)
 Frame = +2

Query  92   DEIHSNGGVDDS-SRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRC---NNTSMQL  259
            DEI++NG  D S SR+RPIIS EQLDIEAY  LY+GRTKI RLLFIAD+C   NNT MQ+
Sbjct  5    DEIYANGEADSSNSRNRPIISSEQLDIEAYAGLYTGRTKITRLLFIADQCGQNNNTVMQM  64

Query  260  EALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELN  439
            EALRMAY+EIKKGENTQLFR+VV KI+GRLG NYG D+ W + VDRRA+QRKEKLENELN
Sbjct  65   EALRMAYEEIKKGENTQLFRDVVHKIDGRLGDNYGMDSAWCEMVDRRADQRKEKLENELN  124

Query  440  AYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            AYRTNLIKESIRMGYNDFGD+YYAHG L EAFK
Sbjct  125  AYRTNLIKESIRMGYNDFGDYYYAHGSLAEAFK  157



>ref|XP_002301330.1| COP9 signalosome complex subunit 1 family protein [Populus trichocarpa]
 gb|EEE80603.1| COP9 signalosome complex subunit 1 family protein [Populus trichocarpa]
Length=436

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 4/153 (3%)
 Frame = +2

Query  92   DEIHSNGGVDDS-SRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRC---NNTSMQL  259
            DEI++NG  + S SR+RPIIS EQLDIEAY  LY+GRTKI RLLFIAD+C   NNT+MQ+
Sbjct  5    DEIYANGEAESSNSRNRPIISSEQLDIEAYAGLYTGRTKITRLLFIADQCGQNNNTAMQM  64

Query  260  EALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELN  439
            EALRMAY+EIKKGENTQLFR+VV KI+GRLG NYG D+ W + VDRRA+QRKEKLENELN
Sbjct  65   EALRMAYEEIKKGENTQLFRDVVHKIDGRLGDNYGMDSAWCEMVDRRADQRKEKLENELN  124

Query  440  AYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            AYRTNLIKESIRMGYNDFGD+YYAHG L +AFK
Sbjct  125  AYRTNLIKESIRMGYNDFGDYYYAHGSLADAFK  157



>ref|XP_011035139.1| PREDICTED: COP9 signalosome complex subunit 1-like isoform X2 
[Populus euphratica]
Length=361

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 4/153 (3%)
 Frame = +2

Query  92   DEIHSNGGVDDSS-RHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRC---NNTSMQL  259
            DEI++NGG D S+ R+RPIIS EQLDIEAY  LY+GRTKI RLLFIADR    NNT+M++
Sbjct  5    DEIYANGGADVSNNRNRPIISSEQLDIEAYAGLYTGRTKITRLLFIADRFGQNNNTAMKM  64

Query  260  EALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELN  439
            EALRMAY+EIKKGENTQLFR+VV KI+GRLG NYG D+ W + VDRRA+QRKEKLENELN
Sbjct  65   EALRMAYEEIKKGENTQLFRDVVHKIDGRLGDNYGMDSAWCEMVDRRADQRKEKLENELN  124

Query  440  AYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            AYRTNLIKESIRMGYNDFGD+YYAHG L +AFK
Sbjct  125  AYRTNLIKESIRMGYNDFGDYYYAHGYLADAFK  157



>gb|KFK35313.1| hypothetical protein AALP_AA5G268100 [Arabis alpina]
Length=442

 Score =   240 bits (613),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +D+  G MM+E+++NGG + S+R RPIISGE LDIEAY ALY GRTKIMRLLFIA+ 
Sbjct  1    MERDDEASGPMMEEMYTNGGEETSNR-RPIISGEPLDIEAYAALYKGRTKIMRLLFIANH  59

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++QLEALRMAYDEIKKGENTQLFR+VV KING+LG  YG D+ W +SVDRRAEQ+
Sbjct  60   CGGNQTIQLEALRMAYDEIKKGENTQLFRDVVSKINGKLGDKYGMDSNWCESVDRRAEQK  119

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDFYYA G  G+AFK
Sbjct  120  KVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGLPGDAFK  161



>ref|XP_010523727.1| PREDICTED: COP9 signalosome complex subunit 1 [Tarenaya hassleriana]
Length=441

 Score =   240 bits (612),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 137/162 (85%), Gaps = 3/162 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME ++D  G+MM E+  NGG   ++R RPIISGE LDIEAY ALYSGRTKIMRLLFIAD 
Sbjct  1    MERDEDAVGTMM-EMCPNGGEVTAAR-RPIISGEPLDIEAYAALYSGRTKIMRLLFIADH  58

Query  236  C-NNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C +N +MQLEA+RMAYDEIKKGENTQLFR+VV KINGRLG  Y  D+ W +SVDRRA+QR
Sbjct  59   CGDNQTMQLEAVRMAYDEIKKGENTQLFRDVVNKINGRLGDKYDMDSAWCESVDRRADQR  118

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDFYYA G LGEAFK
Sbjct  119  KGKLENELSSYRTNLIKESIRMGYNDFGDFYYARGFLGEAFK  160



>ref|XP_011035131.1| PREDICTED: COP9 signalosome complex subunit 1-like isoform X1 
[Populus euphratica]
Length=436

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 4/153 (3%)
 Frame = +2

Query  92   DEIHSNGGVDDSS-RHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRC---NNTSMQL  259
            DEI++NGG D S+ R+RPIIS EQLDIEAY  LY+GRTKI RLLFIADR    NNT+M++
Sbjct  5    DEIYANGGADVSNNRNRPIISSEQLDIEAYAGLYTGRTKITRLLFIADRFGQNNNTAMKM  64

Query  260  EALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELN  439
            EALRMAY+EIKKGENTQLFR+VV KI+GRLG NYG D+ W + VDRRA+QRKEKLENELN
Sbjct  65   EALRMAYEEIKKGENTQLFRDVVHKIDGRLGDNYGMDSAWCEMVDRRADQRKEKLENELN  124

Query  440  AYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            AYRTNLIKESIRMGYNDFGD+YYAHG L +AFK
Sbjct  125  AYRTNLIKESIRMGYNDFGDYYYAHGYLADAFK  157



>ref|XP_004306835.1| PREDICTED: COP9 signalosome complex subunit 1 [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 140/165 (85%), Gaps = 4/165 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMD-EIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIAD  232
            M+A+D+   +M+D EI++NGG +D  R+RPIISGE LD+EAY +LY GRTKI RLLFIA+
Sbjct  1    MDADDETTAAMIDDEIYANGGGEDEKRNRPIISGEPLDVEAYASLYGGRTKISRLLFIAE  60

Query  233  R---CNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRA  403
            +   C N +M+LEALRMAYDE+KKGENTQ FR+V QKI+GRLG  Y  D  W +SVDRRA
Sbjct  61   QSRGCRNEAMELEALRMAYDEVKKGENTQWFRDVAQKIDGRLGLEYQMDLAWCESVDRRA  120

Query  404  EQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            EQ++EKLENELNAYRTNLIKESIRMGYNDFGDF+Y+HGQLG+AFK
Sbjct  121  EQKREKLENELNAYRTNLIKESIRMGYNDFGDFHYSHGQLGDAFK  165



>ref|XP_006291146.1| hypothetical protein CARUB_v10017264mg [Capsella rubella]
 ref|XP_006291147.1| hypothetical protein CARUB_v10017264mg [Capsella rubella]
 gb|EOA24044.1| hypothetical protein CARUB_v10017264mg [Capsella rubella]
 gb|EOA24045.1| hypothetical protein CARUB_v10017264mg [Capsella rubella]
Length=441

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 136/162 (84%), Gaps = 3/162 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +D+  G MM E+ +NG  + S+R RPIISGE LDIEAY ALY GRTKIMRLLFIA+ 
Sbjct  1    MERDDEASGPMM-EMCTNGSEETSNR-RPIISGEPLDIEAYSALYKGRTKIMRLLFIANH  58

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++QLEALRMAYDEIKKGENTQLFREVV KING+LG  YG D+ W +SVDRRAEQ+
Sbjct  59   CGGNLTIQLEALRMAYDEIKKGENTQLFREVVSKINGKLGDTYGMDSAWCESVDRRAEQK  118

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDFYYA G LG+AFK
Sbjct  119  KAKLENELSSYRTNLIKESIRMGYNDFGDFYYACGLLGDAFK  160



>ref|XP_002876595.1| FUSCA protein FUS6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52854.1| FUSCA protein FUS6 [Arabidopsis lyrata subsp. lyrata]
Length=440

 Score =   238 bits (606),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 136/162 (84%), Gaps = 3/162 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME EDD  G MM E+ +NG V+++S  RPIISGE LDIEAY ALY GRTKIMRLLFIA+ 
Sbjct  1    MEREDDASGPMM-EMCTNG-VEETSNRRPIISGEPLDIEAYAALYKGRTKIMRLLFIANH  58

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++QLEALRMAYDEIKKGENTQLFREVV KI GRLG  YG D+ W ++VDRRAEQ+
Sbjct  59   CGGNHAIQLEALRMAYDEIKKGENTQLFREVVNKIGGRLGDKYGMDSSWCEAVDRRAEQK  118

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDFYYA G LG+AFK
Sbjct  119  KGKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFK  160



>gb|KHG16839.1| COP9 signalosome complex subunit 1 -like protein [Gossypium arboreum]
Length=432

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 133/160 (83%), Gaps = 9/160 (6%)
 Frame = +2

Query  86   MMDEIHSNG--GVDDSS-------RHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRC  238
            MM+E+ +NG  GVD S        ++RPI+SGE LDIEAY  LY+GRTKI RL+FIA+ C
Sbjct  11   MMEEMQANGTGGVDGSPLTSTSRRKNRPIVSGEPLDIEAYAGLYTGRTKIKRLMFIANHC  70

Query  239  NNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKE  418
            +N  MQLEALRMA DEIK+GENT L+REVVQKI+GRLGPNY  DA W  +++R+AEQRKE
Sbjct  71   DNPGMQLEALRMANDEIKRGENTHLYREVVQKIDGRLGPNYAMDAAWCSTIERKAEQRKE  130

Query  419  KLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            KLE+ELNAYRTNLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  131  KLESELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFK  170



>gb|KEH18953.1| COP9 signalosome complex subunit 1 [Medicago truncatula]
Length=445

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 3/164 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVD-DSSR--HRPIISGEQLDIEAYDALYSGRTKIMRLLFI  226
            M+A+D+    M+DEI++NGG D D++R   R I+SG+QLDIEAY +LYSGRTKIMRLLFI
Sbjct  1    MDADDETLNPMIDEIYTNGGEDTDNNRTNRRAIMSGDQLDIEAYSSLYSGRTKIMRLLFI  60

Query  227  ADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAE  406
            A++  N ++QL+ALR+AY EIKKGENTQLFREVV KI+GRLG  Y  D GW D V+R+ E
Sbjct  61   ANKSKNATVQLDALRLAYHEIKKGENTQLFREVVAKIDGRLGEGYEMDLGWCDGVERKME  120

Query  407  QRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            Q+KE+LENELNAYRTNLIKESIRMGYNDFGDFYY+HG LG+AFK
Sbjct  121  QKKERLENELNAYRTNLIKESIRMGYNDFGDFYYSHGLLGDAFK  164



>gb|KJB49394.1| hypothetical protein B456_008G117100 [Gossypium raimondii]
Length=451

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 133/159 (84%), Gaps = 9/159 (6%)
 Frame = +2

Query  89   MDEIHSNG--GVDD-------SSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCN  241
            M+E+ +NG  GVD+       + ++RPI+SGE LDIEAY  LY+GRTKI RL+FIA+ C+
Sbjct  12   MEEMQANGTGGVDELPLTSTSTRKNRPIVSGEPLDIEAYAGLYTGRTKIKRLMFIANHCD  71

Query  242  NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEK  421
            N  MQLEALRMAYDEIKKGENT L+REVVQKI+GRLGPNY  DA W  +++R+AE RKEK
Sbjct  72   NPGMQLEALRMAYDEIKKGENTHLYREVVQKIDGRLGPNYAMDAAWCSTIERKAELRKEK  131

Query  422  LENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            LE+ELNAYRTNLIKESIRMGYNDFGDFYYAHG LG+AFK
Sbjct  132  LESELNAYRTNLIKESIRMGYNDFGDFYYAHGALGDAFK  170



>emb|CDY65304.1| BnaCnng46520D [Brassica napus]
Length=443

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 136/162 (84%), Gaps = 2/162 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +D+  G MM E+ +NGG +++S  RPII+GE LDIEAY A+Y GRTKIMRL+F+A+ 
Sbjct  1    MERDDESNGPMM-ELCTNGGGEETSNRRPIITGEPLDIEAYAAMYKGRTKIMRLIFVANH  59

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N +MQLEALRMAYDE+KKGENTQLFR+VV KINGRLG  YG D+ W +++DRRAEQR
Sbjct  60   CGGNQTMQLEALRMAYDEVKKGENTQLFRDVVNKINGRLGDKYGMDSAWCEAIDRRAEQR  119

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDFYYA G L EAFK
Sbjct  120  KGKLENELSSYRTNLIKESIRMGYNDFGDFYYACGLLNEAFK  161



>ref|XP_011093171.1| PREDICTED: COP9 signalosome complex subunit 1 isoform X2 [Sesamum 
indicum]
Length=406

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            M AE D  G +++E   +  V +  RHRP++  E LDIEAY ALY+GRTKI RLLFIA+ 
Sbjct  1    MAAEGDAVGPVIEEDDISVDVGEKGRHRPVMVVEHLDIEAYAALYTGRTKISRLLFIAEN  60

Query  236  CNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRK  415
            C   SM+LEALRMAYDEI+KGE+TQLFREVV KI+GRLGP+YG D  W D VDRRAE RK
Sbjct  61   CGVASMELEALRMAYDEIRKGEDTQLFREVVAKIDGRLGPDYGSDNAWADDVDRRAELRK  120

Query  416  EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            EKLENELNA  TNLIKESIRMGYNDFGDFYYAHGQL EAFK
Sbjct  121  EKLENELNASMTNLIKESIRMGYNDFGDFYYAHGQLEEAFK  161



>gb|ACJ85006.1| unknown [Medicago truncatula]
 gb|AFK36196.1| unknown [Medicago truncatula]
Length=445

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 136/164 (83%), Gaps = 3/164 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVD---DSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFI  226
            M+A+D+    M+DEI++NGG D   + +  R I+SG+QLDIEAY +LYSGRTKIMRLLFI
Sbjct  1    MDADDETLNPMIDEIYTNGGEDTDNNRTNRRAIMSGDQLDIEAYSSLYSGRTKIMRLLFI  60

Query  227  ADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAE  406
            A++  N  +QL+ALR+AY EIKKGENTQLFREVV KI+GRLG  Y  D GW D V+R+ E
Sbjct  61   ANKSKNAIVQLDALRLAYHEIKKGENTQLFREVVAKIDGRLGEGYEMDLGWCDGVERKME  120

Query  407  QRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            Q+KE+LENELNAYRTNLIKESIRMGYNDFGDFYY+HG LG+AFK
Sbjct  121  QKKERLENELNAYRTNLIKESIRMGYNDFGDFYYSHGLLGDAFK  164



>emb|CDY52333.1| BnaA09g38820D [Brassica napus]
Length=444

 Score =   235 bits (599),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +D+  G MM E+ +NGG +++S  RPII+GE LDIEAY A+Y GRTKIMRLLFIA+ 
Sbjct  1    MERDDESNGPMM-ELCTNGGGEETSNRRPIITGEPLDIEAYAAMYKGRTKIMRLLFIANH  59

Query  236  CN--NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQ  409
            C   N +MQLEALRMAYDE+KKGENTQLFR+VV KINGRLG  YG D+ W + +DRRAEQ
Sbjct  60   CGGGNQTMQLEALRMAYDEVKKGENTQLFRDVVSKINGRLGDKYGMDSAWCEMIDRRAEQ  119

Query  410  RKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            RK KLENEL++YRTNLIKESIRMG+NDFGDFYYA G L EAFK
Sbjct  120  RKGKLENELSSYRTNLIKESIRMGHNDFGDFYYACGLLNEAFK  162



>ref|XP_011093170.1| PREDICTED: COP9 signalosome complex subunit 1 isoform X1 [Sesamum 
indicum]
Length=441

 Score =   235 bits (599),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            M AE D  G +++E   +  V +  RHRP++  E LDIEAY ALY+GRTKI RLLFIA+ 
Sbjct  1    MAAEGDAVGPVIEEDDISVDVGEKGRHRPVMVVEHLDIEAYAALYTGRTKISRLLFIAEN  60

Query  236  CNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRK  415
            C   SM+LEALRMAYDEI+KGE+TQLFREVV KI+GRLGP+YG D  W D VDRRAE RK
Sbjct  61   CGVASMELEALRMAYDEIRKGEDTQLFREVVAKIDGRLGPDYGSDNAWADDVDRRAELRK  120

Query  416  EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            EKLENELNA  TNLIKESIRMGYNDFGDFYYAHGQL EAFK
Sbjct  121  EKLENELNASMTNLIKESIRMGYNDFGDFYYAHGQLEEAFK  161



>ref|XP_009116776.1| PREDICTED: COP9 signalosome complex subunit 1-like [Brassica 
rapa]
Length=442

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +D+  G MM E+ +NGG +++S  RPII+GE LDIEAY A+Y GRTKIMRLLFIA+ 
Sbjct  1    MERDDESNGPMM-EMCTNGGGEETSNRRPIITGEPLDIEAYAAMYKGRTKIMRLLFIANH  59

Query  236  CN--NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQ  409
            C   N +MQLEALRMAYDE+KKGENTQLFR+VV KINGRLG  YG D+ W + +DRRAEQ
Sbjct  60   CGGGNQTMQLEALRMAYDEVKKGENTQLFRDVVSKINGRLGDKYGMDSAWCEMIDRRAEQ  119

Query  410  RKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            RK KLENEL++YRTNLIKESIRMG+NDFGDFYYA G L EAFK
Sbjct  120  RKGKLENELSSYRTNLIKESIRMGHNDFGDFYYACGLLNEAFK  162



>ref|XP_006402517.1| hypothetical protein EUTSA_v10005978mg [Eutrema salsugineum]
 gb|ESQ43970.1| hypothetical protein EUTSA_v10005978mg [Eutrema salsugineum]
Length=441

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 137/162 (85%), Gaps = 3/162 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +++  G MM E+ +NGG + S+R RPIISGE LDIEAY ALY GRTKIMRLLFIA+ 
Sbjct  1    MERDEETSGPMM-EMCTNGGEETSNR-RPIISGEPLDIEAYAALYKGRTKIMRLLFIANH  58

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++QLEALRMAYDEIKKGENTQLFR+VV KINGRLG  YG D+ W +++DRRAEQ+
Sbjct  59   CGGNHTIQLEALRMAYDEIKKGENTQLFRDVVNKINGRLGDKYGMDSTWCETIDRRAEQK  118

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDFYYA G LG+AFK
Sbjct  119  KGKLENELSSYRTNLIKESIRMGYNDFGDFYYACGLLGDAFK  160



>ref|XP_008362845.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome complex subunit 
1-like, partial [Malus domestica]
Length=269

 Score =   228 bits (580),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 132/164 (80%), Gaps = 3/164 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMD-EIHSNGGV-DDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIA  229
            ME++D+  G M+D EI++NG    D  R RPII+ EQ DI+AY +LYSGRTKIM L+F  
Sbjct  1    MESDDETSGPMIDDEIYTNGVYGHDEKRSRPIINSEQFDIKAYASLYSGRTKIMHLIFTV  60

Query  230  DRC-NNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAE  406
            +R  +N +M+LEALRMAYDEIKK ENTQL REVVQKI GRLG  YG D  W D+VDRRAE
Sbjct  61   ERSQSNQAMELEALRMAYDEIKKXENTQLHREVVQKIGGRLGXEYGMDVAWCDAVDRRAE  120

Query  407  QRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            Q+K KLENELNAY TNLIKESIR GYNDFGDFYYAHGQLG+AFK
Sbjct  121  QKKXKLENELNAYXTNLIKESIRXGYNDFGDFYYAHGQLGDAFK  164



>emb|CDX67853.1| BnaA07g18930D [Brassica napus]
Length=453

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +++  G MM E+ +NGG +++S  RPIISGE LDIEAY  LY GRTKIMRLLFIA  
Sbjct  1    MERDEESSGPMM-EVCTNGGGEETSNRRPIISGEPLDIEAYATLYKGRTKIMRLLFIASH  59

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N +MQLEALRMAYDEIKKGENTQLFR+VV +INGRLG  Y  D+ W +SVDRRAEQ+
Sbjct  60   CGGNQTMQLEALRMAYDEIKKGENTQLFRDVVNRINGRLGDKYNMDSAWCESVDRRAEQK  119

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K +LENEL++YRTNLIKESIRMG+NDFGDFYYA G L EAFK
Sbjct  120  KGRLENELSSYRTNLIKESIRMGHNDFGDFYYACGLLNEAFK  161



>emb|CDY45683.1| BnaCnng13480D [Brassica napus]
Length=453

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +++  G MM E+ +NGG +++S  RPIISGE LDIEAY +LY GRTKIMRLLFIA  
Sbjct  1    MERDEESSGPMM-EMCTNGGGEETSNRRPIISGEPLDIEAYASLYKGRTKIMRLLFIASH  59

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N +MQLEALRMAYDEIKKGENTQLFR+VV +INGRLG  Y  D+ W +SVDRRAEQ+
Sbjct  60   CGGNQTMQLEALRMAYDEIKKGENTQLFRDVVNRINGRLGDKYKMDSAWCESVDRRAEQK  119

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K +LENEL++YRTNLIKESIRMG+NDFGDFYYA G L +AFK
Sbjct  120  KGRLENELSSYRTNLIKESIRMGHNDFGDFYYACGLLSDAFK  161



>ref|XP_010469035.1| PREDICTED: COP9 signalosome complex subunit 1 [Camelina sativa]
Length=442

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +D+  G MM E+ +NGG + S+R   IISGE LDIEAY  LY GRTKI+RLLFIA+ 
Sbjct  1    MERDDEASGPMM-EMCTNGGEETSNRRPTIISGEPLDIEAYATLYKGRTKIIRLLFIANN  59

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++QLEALRMAYDEIKKGENTQLFREVV KING+LG  Y  D+ W +SV+RRAEQ+
Sbjct  60   CGGNHTIQLEALRMAYDEIKKGENTQLFREVVSKINGKLGDKYVMDSAWCESVERRAEQK  119

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDFYYA G LG+AFK
Sbjct  120  KTKLENELSSYRTNLIKESIRMGYNDFGDFYYACGSLGDAFK  161



>emb|CAB71044.1| FUSCA PROTEIN FUS6 [Arabidopsis thaliana]
Length=440

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 3/162 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +++  G MM E+ +NGG + S+R RPIISGE LDIEAY ALY GRTKIMRLLFIA+ 
Sbjct  1    MERDEEASGPMM-EMCTNGGEETSNR-RPIISGEPLDIEAYAALYKGRTKIMRLLFIANH  58

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++Q +ALRMAYDEIKKGENTQLFREVV KI  RLG  YG D  W ++VDRRAEQ+
Sbjct  59   CGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQK  118

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDFYYA G LG+AFK
Sbjct  119  KVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFK  160



>ref|NP_567109.1| COP9 signalosome complex subunit 1 [Arabidopsis thaliana]
 sp|P45432.2|CSN1_ARATH RecName: Full=COP9 signalosome complex subunit 1; Short=CSN complex 
subunit 1; AltName: Full=Constitutive photomorphogenesis 
protein 11; AltName: Full=Protein FUSCA 6 [Arabidopsis thaliana]
 gb|AAK26005.1|AF360295_1 putative FUSCA protein FUS6 [Arabidopsis thaliana]
 gb|AAL58100.1|AF395057_1 CSN complex subunit 1 [Arabidopsis thaliana]
 gb|AAK93733.1| putative FUSCA protein FUS6 [Arabidopsis thaliana]
 gb|AEE80160.1| COP9 signalosome complex subunit 1 [Arabidopsis thaliana]
Length=441

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 3/162 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +++  G MM E+ +NGG + S+R RPIISGE LDIEAY ALY GRTKIMRLLFIA+ 
Sbjct  1    MERDEEASGPMM-EMCTNGGEETSNR-RPIISGEPLDIEAYAALYKGRTKIMRLLFIANH  58

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++Q +ALRMAYDEIKKGENTQLFREVV KI  RLG  YG D  W ++VDRRAEQ+
Sbjct  59   CGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQK  118

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDFYYA G LG+AFK
Sbjct  119  KVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFK  160



>ref|XP_010413455.1| PREDICTED: COP9 signalosome complex subunit 1-like [Camelina 
sativa]
Length=442

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +D+  G MM E+ +NGG + S+R   IISGE LDIEAY  LY GRTKI+RLLFIA+ 
Sbjct  1    MERDDEASGPMM-EMCTNGGEETSNRRPTIISGEPLDIEAYATLYKGRTKIIRLLFIANY  59

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++QLEALRMAYDEIKKGENTQLFREVV KING+LG  Y  D+ W +SV+RRAEQ+
Sbjct  60   CGGNHTIQLEALRMAYDEIKKGENTQLFREVVSKINGKLGDKYVMDSAWCESVERRAEQK  119

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDFYYA G LG+AFK
Sbjct  120  KTKLENELSSYRTNLIKESIRMGYNDFGDFYYACGSLGDAFK  161



>gb|AAA32792.1| FUS6 [Arabidopsis thaliana]
Length=441

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 3/162 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +++  G MM E+ +NGG + S+R RPIISGE LDIEAY ALY GRTKIMRLLFIA+ 
Sbjct  1    MERDEEAGGPMM-EMCTNGGEETSNR-RPIISGEPLDIEAYAALYKGRTKIMRLLFIANH  58

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++Q +ALRMAYDEIKKGENTQLFREVV KI  RLG  YG D  W ++VDRRAEQ+
Sbjct  59   CGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQK  118

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDFYYA G LG+AFK
Sbjct  119  KVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFK  160



>ref|XP_009104291.1| PREDICTED: COP9 signalosome complex subunit 1 [Brassica rapa]
Length=442

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 129/158 (82%), Gaps = 1/158 (1%)
 Frame = +2

Query  68   DDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCN-N  244
            D++    M E+ +NGG +++S  RPIISGE LDIEAY  LY GRTKIMRLLFIA  C  N
Sbjct  4    DEEASEPMMEMCTNGGGEETSNRRPIISGEPLDIEAYATLYKGRTKIMRLLFIASHCGGN  63

Query  245  TSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKL  424
             +MQLEALRMAYDEIKKGENTQLFR+VV +INGRLG  Y  D+ W +SVDRRAEQ+K +L
Sbjct  64   QTMQLEALRMAYDEIKKGENTQLFRDVVNRINGRLGDKYNMDSAWCESVDRRAEQKKGRL  123

Query  425  ENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            ENEL++YRTNLIKESIRMG+NDFGDFYYA G L EAFK
Sbjct  124  ENELSSYRTNLIKESIRMGHNDFGDFYYACGLLNEAFK  161



>ref|XP_010512447.1| PREDICTED: COP9 signalosome complex subunit 1-like [Camelina 
sativa]
Length=442

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +D+  G MM ++ +NGG + S+R   IISGE LDIEAY  LY GRTKIMRLLFIA+ 
Sbjct  1    MERDDEASGPMM-KMCTNGGDETSNRRPTIISGEPLDIEAYATLYKGRTKIMRLLFIANY  59

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++QLEALRMAYDEIKKGENTQLFREVV KING+LG  Y  D+ W +SV+RRAEQ+
Sbjct  60   CGGNQTIQLEALRMAYDEIKKGENTQLFREVVSKINGKLGDKYVMDSAWCESVERRAEQK  119

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTNLIKESIRMGYNDFGDF+YA G LG+AFK
Sbjct  120  KLKLENELSSYRTNLIKESIRMGYNDFGDFFYACGSLGDAFK  161



>dbj|BAC42193.1| putative FUSCA protein FUS6 [Arabidopsis thaliana]
Length=441

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 131/162 (81%), Gaps = 3/162 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME  ++  G MM E+ +NGG + S+R RPIISGE LDIEAY ALY GRTKIMRLLFIA+ 
Sbjct  1    MERGEEASGPMM-EMCTNGGEETSNR-RPIISGEPLDIEAYAALYKGRTKIMRLLFIANH  58

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++Q +ALRMAYDEIKKGENTQLFREVV KI  RLG  YG D  W ++VDRRAEQ+
Sbjct  59   CGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQK  118

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K KLENEL++YRTN IKESIRMGYNDFGDFYYA G LG+AFK
Sbjct  119  KVKLENELSSYRTNFIKESIRMGYNDFGDFYYACGMLGDAFK  160



>ref|XP_010055224.1| PREDICTED: COP9 signalosome complex subunit 1 [Eucalyptus grandis]
 gb|KCW71692.1| hypothetical protein EUGRSUZ_E00211 [Eucalyptus grandis]
Length=440

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 126/155 (81%), Gaps = 6/155 (4%)
 Frame = +2

Query  92   DEIHSNGGVDDSS-RHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEAL  268
            DEI+ NGG +    R +PIISGEQLD+E Y +LY  RTK+ RLLFIADRC+N +M LEAL
Sbjct  5    DEIYENGGGEQPPPRSKPIISGEQLDVETYASLYRDRTKVARLLFIADRCDNGAMPLEAL  64

Query  269  RM-----AYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENE  433
            RM     AYDEIKKGENTQLFREVV KI G LG  Y  DA W ++VDRRAEQ+KEKLENE
Sbjct  65   RMEALRMAYDEIKKGENTQLFREVVNKIGGMLGDKYEMDAAWCETVDRRAEQKKEKLENE  124

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            LN+YRTNLIKESIRMGYNDFGDF+YAHG LG+AFK
Sbjct  125  LNSYRTNLIKESIRMGYNDFGDFHYAHGALGDAFK  159



>ref|XP_006857876.1| hypothetical protein AMTR_s00069p00104060 [Amborella trichopoda]
 gb|ERN19343.1| hypothetical protein AMTR_s00069p00104060 [Amborella trichopoda]
Length=387

 Score =   220 bits (561),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 124/158 (78%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   EDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNN  244
            E D    M+D   SNG   D  R + I+SGE LD+EAY +LYSGRTKI+RL+FIA+ C N
Sbjct  3    EADGLAEMIDAPCSNGV--DQKRPKAIMSGEHLDVEAYASLYSGRTKILRLIFIAEHCGN  60

Query  245  TSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKL  424
               Q+EA+RMAYDE+KKGENTQL REV +KING LGP YG D  W  SV+RRAEQRKEKL
Sbjct  61   PVTQIEAVRMAYDELKKGENTQLLREVAEKINGNLGPEYGVDYAWIHSVERRAEQRKEKL  120

Query  425  ENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            ENEL+ Y+TN+IKESIRMGYNDFGDF+YA G LG+AFK
Sbjct  121  ENELSGYKTNMIKESIRMGYNDFGDFHYARGLLGDAFK  158



>gb|ADE77099.1| unknown [Picea sitchensis]
Length=433

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +2

Query  104  SNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYD  283
            + G V      + +IS EQ+D+EAY +LYSGRTKIMRL+FIAD C N SM++EALRMAYD
Sbjct  7    TEGNVVGEGNKKSVISSEQMDVEAYGSLYSGRTKIMRLIFIADHCGNESMRMEALRMAYD  66

Query  284  EIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIK  463
            EIKKG+NTQLF+EV  KI G+LG +Y  D  W DSV+RRAEQRK+KLENELN Y+TNLIK
Sbjct  67   EIKKGDNTQLFKEVTHKIGGKLGSDYALDQDWIDSVERRAEQRKDKLENELNGYKTNLIK  126

Query  464  ESIRMGYNDFGDFYYAHGQLGEAFK  538
            ESIRMGYNDFGDFYYAHG L +AFK
Sbjct  127  ESIRMGYNDFGDFYYAHGLLADAFK  151



>ref|XP_010919243.1| PREDICTED: COP9 signalosome complex subunit 1-like [Elaeis guineensis]
Length=447

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  RPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLF  316
            + ++ GEQ+D+EAY +LY+GRTK++RLLFIADRC N  MQLEALR+AYDEIKKGE++QL+
Sbjct  32   KAVMGGEQMDVEAYGSLYTGRTKVIRLLFIADRCGNEGMQLEALRLAYDEIKKGEDSQLY  91

Query  317  REVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFG  496
            R+V  KI GRLGP Y  D  W D +DRRAEQRK+KLENELN Y+TNLIKESIRMGYND G
Sbjct  92   RDVASKIAGRLGPQYDLDQAWADGIDRRAEQRKDKLENELNGYKTNLIKESIRMGYNDLG  151

Query  497  DFYYAHGQLGEAFK  538
            DFYYAHGQLG+AFK
Sbjct  152  DFYYAHGQLGDAFK  165



>ref|XP_008799523.1| PREDICTED: COP9 signalosome complex subunit 1 [Phoenix dactylifera]
Length=446

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  RPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLF  316
            + ++ GEQ+D+EAY +LY+GRTK+ RLLFIADRC N  MQLEALR+AYDEIKKGE++QL+
Sbjct  32   KAVMGGEQMDVEAYASLYTGRTKVTRLLFIADRCGNEGMQLEALRLAYDEIKKGEDSQLY  91

Query  317  REVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFG  496
            RE   KI GRLGP Y  D  W DS+DRRAEQRK+KLENEL+ Y+TNLIKESIRMGYND G
Sbjct  92   REAASKIAGRLGPQYTLDQAWADSIDRRAEQRKDKLENELSGYKTNLIKESIRMGYNDLG  151

Query  497  DFYYAHGQLGEAFK  538
            DFYYAHGQLG+AFK
Sbjct  152  DFYYAHGQLGDAFK  165



>ref|XP_009384079.1| PREDICTED: COP9 signalosome complex subunit 1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 123/161 (76%), Gaps = 8/161 (5%)
 Frame = +2

Query  80   GSMMDE-IHSNGGVDDSSRHRPIISG-------EQLDIEAYDALYSGRTKIMRLLFIADR  235
              M DE + SNGG  D  R  P  SG       EQ+D+EAY ALY+GRT++ RLLFIA+R
Sbjct  11   APMGDESMCSNGGAVDDPRRPPASSGKAAAGGGEQMDLEAYVALYTGRTRVSRLLFIAER  70

Query  236  CNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRK  415
            C N  MQLEALRMA+DEIKKGE++ L+REV+ KI GRLGP Y  D  W D VDRRAE RK
Sbjct  71   CGNEGMQLEALRMAHDEIKKGEDSHLYREVIAKIGGRLGPLYALDQTWVDMVDRRAEARK  130

Query  416  EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            EKLENELN+Y+TNLIKESIRMG+ND  DF+YAHGQLG+AFK
Sbjct  131  EKLENELNSYKTNLIKESIRMGFNDLADFFYAHGQLGDAFK  171



>ref|XP_009384078.1| PREDICTED: COP9 signalosome complex subunit 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=479

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 123/161 (76%), Gaps = 8/161 (5%)
 Frame = +2

Query  80   GSMMDE-IHSNGGVDDSSRHRPIISG-------EQLDIEAYDALYSGRTKIMRLLFIADR  235
              M DE + SNGG  D  R  P  SG       EQ+D+EAY ALY+GRT++ RLLFIA+R
Sbjct  11   APMGDESMCSNGGAVDDPRRPPASSGKAAAGGGEQMDLEAYVALYTGRTRVSRLLFIAER  70

Query  236  CNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRK  415
            C N  MQLEALRMA+DEIKKGE++ L+REV+ KI GRLGP Y  D  W D VDRRAE RK
Sbjct  71   CGNEGMQLEALRMAHDEIKKGEDSHLYREVIAKIGGRLGPLYALDQTWVDMVDRRAEARK  130

Query  416  EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            EKLENELN+Y+TNLIKESIRMG+ND  DF+YAHGQLG+AFK
Sbjct  131  EKLENELNSYKTNLIKESIRMGFNDLADFFYAHGQLGDAFK  171



>tpg|DAA42931.1| TPA: hypothetical protein ZEAMMB73_064772 [Zea mays]
Length=312

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +S EQLD+EAY A YSGRT+++RLLF+ADRC   +MQLEALRMAYDEIK+GE+ QL R+V
Sbjct  32   VSAEQLDVEAYAAQYSGRTRLVRLLFVADRCGVEAMQLEALRMAYDEIKRGEDVQLHRDV  91

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
            V KI GRLGP YG D  W  SV RRA+QRKEKLE+ELN YRTNLIKESIRMGYND GDF+
Sbjct  92   VTKIGGRLGPRYGLDQAWVFSVSRRADQRKEKLESELNGYRTNLIKESIRMGYNDIGDFF  151

Query  506  YAHGQLGEAFK  538
            YAHGQL +AFK
Sbjct  152  YAHGQLSDAFK  162



>ref|XP_010933872.1| PREDICTED: COP9 signalosome complex subunit 1-like [Elaeis guineensis]
Length=448

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 4/162 (2%)
 Frame = +2

Query  65   EDDQFGSMMDE-IHSNGGVDDSSRHRPI---ISGEQLDIEAYDALYSGRTKIMRLLFIAD  232
            E+   G M DE +  NGG D   + R I   +  EQ+D+EAY +LY GRTK+MRLLF+A+
Sbjct  5    EEGVAGPMGDEAMFLNGGDDGRQQWRRIKAAMGSEQIDVEAYASLYIGRTKVMRLLFMAE  64

Query  233  RCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            RC N  MQLEALR+AYDEIKKG ++ L+REV  KI GRLGP Y  D  W D++DRRAEQR
Sbjct  65   RCGNEGMQLEALRLAYDEIKKGGDSHLYREVAGKIAGRLGPQYTLDQAWADAIDRRAEQR  124

Query  413  KEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            K+KL+NELN YRTNLIKESIRMGYND GDFYYAHGQLG+AFK
Sbjct  125  KDKLDNELNGYRTNLIKESIRMGYNDLGDFYYAHGQLGDAFK  166



>ref|XP_004985986.1| PREDICTED: COP9 signalosome complex subunit 1-like [Setaria italica]
Length=442

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +2

Query  149  SGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVV  328
            S EQLD+EAY A YSGRT++ RL+FIADRC   +MQLEALRMAYDEIK+GE+ QL R+V 
Sbjct  31   SAEQLDVEAYAAQYSGRTRLARLIFIADRCGVEAMQLEALRMAYDEIKRGEDVQLHRDVA  90

Query  329  QKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
             KINGRLGP YG D  W D+V RRAEQRKEKLENELN YRTNLIKESIRMGYND GDF+Y
Sbjct  91   VKINGRLGPRYGLDQAWVDTVARRAEQRKEKLENELNGYRTNLIKESIRMGYNDIGDFFY  150

Query  509  AHGQLGEAFK  538
            AHGQL +AFK
Sbjct  151  AHGQLSDAFK  160



>gb|EYU30315.1| hypothetical protein MIMGU_mgv1a017887mg [Erythranthe guttata]
Length=136

 Score =   202 bits (513),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 4/136 (3%)
 Frame = +2

Query  56   MEAEDDQFGSMMDE--IHSNGGVD--DSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLF  223
            MEAEDD  G+++DE  I  NGG D   S RHRPI+SGEQLD+EAY ALY+GRTKI RL+F
Sbjct  1    MEAEDDTAGTIIDEDEICINGGNDAQSSQRHRPIMSGEQLDVEAYAALYTGRTKITRLIF  60

Query  224  IADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRA  403
            IA++C   SMQLEALRMAYDEIKKGENTQLFR+V+ KI GRLGPNYGPD  W D+VDRRA
Sbjct  61   IAEKCGVQSMQLEALRMAYDEIKKGENTQLFRDVLAKIAGRLGPNYGPDNAWADAVDRRA  120

Query  404  EQRKEKLENELNAYRT  451
            E R+EKLENELNAYR 
Sbjct  121  ELRREKLENELNAYRV  136



>ref|XP_008795398.1| PREDICTED: COP9 signalosome complex subunit 1-like [Phoenix dactylifera]
Length=448

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 124/157 (79%), Gaps = 4/157 (3%)
 Frame = +2

Query  80   GSMMDE-IHSNGGVDDSSRHRPI---ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNT  247
            G M DE +  NGG D   + R I   + GEQ+D+EAY +LY+GRTK++RLLFIADR  N 
Sbjct  10   GPMGDEAMFLNGGDDGHQQQRGIKAAMGGEQMDVEAYASLYTGRTKVVRLLFIADRFGND  69

Query  248  SMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLE  427
             +QLEALR+AYDEIKKGE+++L+REV  KI  RLGP Y  D  W D+V RRAEQRK+KL+
Sbjct  70   GIQLEALRLAYDEIKKGEDSRLYREVAGKIACRLGPQYALDQAWADAVARRAEQRKDKLD  129

Query  428  NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            NELN YRTNLIKESIRMGYND GDFYYAHGQLG+AFK
Sbjct  130  NELNVYRTNLIKESIRMGYNDLGDFYYAHGQLGDAFK  166



>ref|XP_002465983.1| hypothetical protein SORBIDRAFT_01g049510 [Sorghum bicolor]
 gb|EER92981.1| hypothetical protein SORBIDRAFT_01g049510 [Sorghum bicolor]
Length=443

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +S EQLD+EAY A YSGRT++ RLLFIADRC   +MQLEALRMAYDEIK+GE+ QL R+V
Sbjct  30   VSAEQLDVEAYAAQYSGRTRLARLLFIADRCGVEAMQLEALRMAYDEIKRGEDVQLHRDV  89

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
              KI GRLGP +G D  W D+V RRA+QRKEKLENELN YRTNLIKESIRMGYND GDF+
Sbjct  90   AAKIGGRLGPRFGLDQAWVDTVTRRADQRKEKLENELNGYRTNLIKESIRMGYNDIGDFF  149

Query  506  YAHGQLGEAFK  538
            YAHGQL +AFK
Sbjct  150  YAHGQLSDAFK  160



>ref|NP_001149716.1| fusca homolog [Zea mays]
 gb|ACG36499.1| COP9 signalosome complex subunit 1 [Zea mays]
Length=445

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +S EQLD+EAY A YSGRT+++RLLF+ADRC   +MQLEALRMAYDEIK+GE+ QL R+V
Sbjct  32   VSAEQLDVEAYAAQYSGRTRLVRLLFVADRCGVEAMQLEALRMAYDEIKRGEDVQLHRDV  91

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
            V KI GRLGP YG D  W  SV RRA+QRKEKLE+ELN YRTNLIKESIRMGYND GDF+
Sbjct  92   VTKIGGRLGPRYGLDQAWVFSVSRRADQRKEKLESELNGYRTNLIKESIRMGYNDIGDFF  151

Query  506  YAHGQLGEAFK  538
            YAHGQL +AFK
Sbjct  152  YAHGQLSDAFK  162



>tpg|DAA42932.1| TPA: COP9 signalosome complex subunit 1 [Zea mays]
Length=445

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +S EQLD+EAY A YSGRT+++RLLF+ADRC   +MQLEALRMAYDEIK+GE+ QL R+V
Sbjct  32   VSAEQLDVEAYAAQYSGRTRLVRLLFVADRCGVEAMQLEALRMAYDEIKRGEDVQLHRDV  91

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
            V KI GRLGP YG D  W  SV RRA+QRKEKLE+ELN YRTNLIKESIRMGYND GDF+
Sbjct  92   VTKIGGRLGPRYGLDQAWVFSVSRRADQRKEKLESELNGYRTNLIKESIRMGYNDIGDFF  151

Query  506  YAHGQLGEAFK  538
            YAHGQL +AFK
Sbjct  152  YAHGQLSDAFK  162



>ref|XP_004492680.1| PREDICTED: probable methyltransferase PMT15-like [Cicer arietinum]
Length=1073

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = +2

Query  137  RPIISGEQLDIEAYDALYSGRTKIMRLLFIADRC-NNTSMQLEALRMAYDEIKKGENTQL  313
            RPIISG+QLDIEAY +LYSG TKI RL+FIAD C +N +M+LEALRMA+DEIKKGENTQL
Sbjct  657  RPIISGDQLDIEAYASLYSGHTKISRLIFIADHCGDNLTMRLEALRMAFDEIKKGENTQL  716

Query  314  FREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDF  493
             REV  KI+GRLG +Y  D  W D +DRRAEQ+KEKLENELN+ RTNLIKESIRMGY+DF
Sbjct  717  MREVANKIDGRLGSDYTLDEAWCDDIDRRAEQKKEKLENELNSSRTNLIKESIRMGYHDF  776

Query  494  GDFYYAHGQLGEAFK  538
            GDFYYAHGQLGEA+K
Sbjct  777  GDFYYAHGQLGEAYK  791



>gb|AAG17476.1|AF106844_1 rCOP11 protein [Oryza sativa Indica Group]
Length=441

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +S EQLD+EAY A Y+GRT++ RLLFIA+RC   +++LEALRMAYDEIK+GE+T   REV
Sbjct  29   VSAEQLDVEAYAAQYTGRTRLARLLFIAERCGVEAVELEALRMAYDEIKRGEDTMFHREV  88

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
              KINGRLGP Y  D  WTDSV+RRAEQRKEKLE+ELN YRTNLIKESIRMGYND GDF+
Sbjct  89   TNKINGRLGPKYALDQAWTDSVNRRAEQRKEKLESELNGYRTNLIKESIRMGYNDIGDFF  148

Query  506  YAHGQLGEAFK  538
            YAHG L +AFK
Sbjct  149  YAHGHLSDAFK  159



>ref|NP_001048760.1| Os03g0116500 [Oryza sativa Japonica Group]
 gb|ABF93653.1| COP9 signalosome complex subunit 1, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10674.1| Os03g0116500 [Oryza sativa Japonica Group]
 gb|EAY88282.1| hypothetical protein OsI_09737 [Oryza sativa Indica Group]
 gb|EAZ25359.1| hypothetical protein OsJ_09174 [Oryza sativa Japonica Group]
 dbj|BAG95264.1| unnamed protein product [Oryza sativa Japonica Group]
Length=441

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +S EQLD+EAY A Y+GRT++ RLLFIA+RC   +++LEALRMAYDEIK+GE+T   REV
Sbjct  29   VSAEQLDVEAYAAQYTGRTRLARLLFIAERCGVEAVELEALRMAYDEIKRGEDTMFHREV  88

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
              KINGRLGP Y  D  WTDSV+RRAEQRKEKLE+ELN YRTNLIKESIRMGYND GDF+
Sbjct  89   TNKINGRLGPKYALDQAWTDSVNRRAEQRKEKLESELNGYRTNLIKESIRMGYNDIGDFF  148

Query  506  YAHGQLGEAFK  538
            YAHG L +AFK
Sbjct  149  YAHGHLSDAFK  159



>gb|AAF40112.1|AF160800_1 constitutive photomorphogenic 11 [Oryza sativa Indica Group]
Length=441

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +S EQLD+EAY A Y+GRT++ RLLFIA+RC   +++LEALRMAYDEIK+GE+T   REV
Sbjct  29   VSAEQLDVEAYAAQYTGRTRLARLLFIAERCGVEAVELEALRMAYDEIKRGEDTMFHREV  88

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
              KINGRLGP Y  D  WTDSV+RRAEQRKEKLE+ELN YRTNLIKESIRMGYND GDF+
Sbjct  89   TNKINGRLGPKYALDQAWTDSVNRRAEQRKEKLESELNGYRTNLIKESIRMGYNDIGDFF  148

Query  506  YAHGQLGEAFK  538
            YAHG L +AFK
Sbjct  149  YAHGHLSDAFK  159



>pdb|4LCT|A Chain A, Crystal Structure And Versatile Functional Roles Of 
The Cop9 Signalosome Subunit 1
 pdb|4LCT|B Chain B, Crystal Structure And Versatile Functional Roles Of 
The Cop9 Signalosome Subunit 1
 pdb|4LCT|C Chain C, Crystal Structure And Versatile Functional Roles Of 
The Cop9 Signalosome Subunit 1
 pdb|4LCT|D Chain D, Crystal Structure And Versatile Functional Roles Of 
The Cop9 Signalosome Subunit 1
Length=348

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCN-NTSMQLEALRMAYDEIKKGENTQLFREVVQ  331
            E LDIEAY ALY GRTKIMRLLFIA+ C  N ++Q +ALRMAYDEIKKGENTQLFREVV 
Sbjct  1    EPLDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGENTQLFREVVN  60

Query  332  KINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYA  511
            KI  RLG  YG D  W ++VDRRAEQ+K KLENEL++YRTNLIKESIRMGYNDFGDFYYA
Sbjct  61   KIGNRLGEKYGMDLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYA  120

Query  512  HGQLGEAFK  538
             G LG+AFK
Sbjct  121  CGMLGDAFK  129



>ref|XP_009382294.1| PREDICTED: COP9 signalosome complex subunit 1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=504

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 113/152 (74%), Gaps = 7/152 (5%)
 Frame = +2

Query  104  SNGGVDDSSRHRPI-------ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLE  262
            SNGG  D  R  P          GE +D+EAY ALY+GRTK+ RLLFIA+RC N +MQLE
Sbjct  72   SNGGAVDEPRRPPTSRAGKGAAGGELMDVEAYAALYTGRTKVARLLFIAERCGNEAMQLE  131

Query  263  ALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNA  442
            ALRMA+DEIKK E++ L REV  KI GRLGP Y  D  W D+VDRRA+ RKEKLENELN 
Sbjct  132  ALRMAHDEIKKAEDSHLHREVTAKIGGRLGPRYALDQSWADTVDRRADVRKEKLENELNG  191

Query  443  YRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            Y+TNLIKESIRMGYND  DF+Y HGQLG+A K
Sbjct  192  YKTNLIKESIRMGYNDLADFFYDHGQLGDALK  223



>ref|XP_009382292.1| PREDICTED: COP9 signalosome complex subunit 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=506

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 113/152 (74%), Gaps = 7/152 (5%)
 Frame = +2

Query  104  SNGGVDDSSRHRPI-------ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLE  262
            SNGG  D  R  P          GE +D+EAY ALY+GRTK+ RLLFIA+RC N +MQLE
Sbjct  72   SNGGAVDEPRRPPTSRAGKGAAGGELMDVEAYAALYTGRTKVARLLFIAERCGNEAMQLE  131

Query  263  ALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNA  442
            ALRMA+DEIKK E++ L REV  KI GRLGP Y  D  W D+VDRRA+ RKEKLENELN 
Sbjct  132  ALRMAHDEIKKAEDSHLHREVTAKIGGRLGPRYALDQSWADTVDRRADVRKEKLENELNG  191

Query  443  YRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            Y+TNLIKESIRMGYND  DF+Y HGQLG+A K
Sbjct  192  YKTNLIKESIRMGYNDLADFFYDHGQLGDALK  223



>ref|XP_006649270.1| PREDICTED: COP9 signalosome complex subunit 1-like [Oryza brachyantha]
Length=441

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +S EQLD+EAY A Y+GRT++ RLLFIA+RC   +++LEALRMAYDEIK+GE+T   R+V
Sbjct  29   VSAEQLDVEAYAAQYAGRTRLARLLFIAERCGVEAVELEALRMAYDEIKRGEDTLFHRDV  88

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
              KINGRLGP Y  D  W DS++RRAEQRKEKLE+ELN YRTNLIKESIRMGYND GDF+
Sbjct  89   ALKINGRLGPQYALDQAWVDSINRRAEQRKEKLESELNGYRTNLIKESIRMGYNDIGDFF  148

Query  506  YAHGQLGEAFK  538
            YAHGQL +AFK
Sbjct  149  YAHGQLSDAFK  159



>gb|AFW89801.1| hypothetical protein ZEAMMB73_510109 [Zea mays]
Length=171

 Score =   193 bits (491),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +S EQLD+EAY A YSGRT++ R +F+ADRC   ++QLEALRMAYDEIK+GE+ QL R+V
Sbjct  30   VSPEQLDVEAYAAQYSGRTRLARGVFVADRCGVEAIQLEALRMAYDEIKRGEDVQLDRDV  89

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
              KI GRLGP YG D  W D++ RRA+QR EKLENELN YRTNLIKESIRMGYND GDF+
Sbjct  90   AAKIGGRLGPRYGLDQAWVDTITRRADQRNEKLENELNGYRTNLIKESIRMGYNDIGDFF  149

Query  506  YAHGQLGEA  532
            YAHGQL +A
Sbjct  150  YAHGQLSKA  158



>ref|XP_009411462.1| PREDICTED: COP9 signalosome complex subunit 1 [Musa acuminata 
subsp. malaccensis]
Length=454

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 123/173 (71%), Gaps = 12/173 (7%)
 Frame = +2

Query  56   MEAEDD-QFGSMM--DEIHSNGGVDDSSRHRPII---------SGEQLDIEAYDALYSGR  199
            ME +D+  F +    + +++NG   D  R  P            G+ +D+EAY ALY+GR
Sbjct  1    MEGDDEATFAAATGYEAMYANGDAGDDPRLPPTPRSGKAAVGSGGDLMDVEAYAALYTGR  60

Query  200  TKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGW  379
            TK+ RLLFIA+RC N  MQLEA R+A+DEIKKGE++ L+RE + KI  RLGP Y  D  W
Sbjct  61   TKVARLLFIAERCGNEGMQLEAFRLAHDEIKKGEDSHLYREAMAKIGDRLGPRYAIDQVW  120

Query  380  TDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             D+VDRRAE RKEKLENELN Y+TNLIKESIRMGYND  DF+YAHGQLG+AFK
Sbjct  121  ADAVDRRAEVRKEKLENELNIYKTNLIKESIRMGYNDLADFFYAHGQLGDAFK  173



>ref|XP_003623834.1| COP9 signalosome complex subunit [Medicago truncatula]
 gb|AES80052.1| COP9 signalosome complex subunit 1 [Medicago truncatula]
Length=443

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 127/159 (80%), Gaps = 2/159 (1%)
 Frame = +2

Query  68   DDQFGSMMDEIHSNGGVDDSSRHRPIISG-EQLDIEAYDALYSGRTKIMRLLFIADRCN-  241
            DD   S ++   +    ++ + HR IIS  +QLDIEAY +LYSGRT+I RLLFIAD C  
Sbjct  4    DDSSSSALETFANVDDDNNQTNHRQIISASDQLDIEAYISLYSGRTRISRLLFIADHCGG  63

Query  242  NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEK  421
            N +MQLEALR+A+DEIKKGE+T L RE+V+KINGRLG  Y  D  W D+++++AE +KEK
Sbjct  64   NNTMQLEALRLAFDEIKKGEDTFLMREIVKKINGRLGSGYALDEAWCDAIEKKAELKKEK  123

Query  422  LENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L++ELN+YRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK
Sbjct  124  LDSELNSYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  162



>gb|ABN08825.1| Proteasome component region PCI [Medicago truncatula]
Length=452

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 127/159 (80%), Gaps = 2/159 (1%)
 Frame = +2

Query  68   DDQFGSMMDEIHSNGGVDDSSRHRPIISG-EQLDIEAYDALYSGRTKIMRLLFIADRCN-  241
            DD   S ++   +    ++ + HR IIS  +QLDIEAY +LYSGRT+I RLLFIAD C  
Sbjct  4    DDSSSSALETFANVDDDNNQTNHRQIISASDQLDIEAYISLYSGRTRISRLLFIADHCGG  63

Query  242  NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEK  421
            N +MQLEALR+A+DEIKKGE+T L RE+V+KINGRLG  Y  D  W D+++++AE +KEK
Sbjct  64   NNTMQLEALRLAFDEIKKGEDTFLMREIVKKINGRLGSGYALDEAWCDAIEKKAELKKEK  123

Query  422  LENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L++ELN+YRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK
Sbjct  124  LDSELNSYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  162



>ref|XP_003558971.1| PREDICTED: COP9 signalosome complex subunit 1 [Brachypodium distachyon]
Length=443

 Score =   193 bits (491),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +S EQLD+EAY A YSGRT+++RLLFIA+RC   +++LEALRMA+DE +K ++T L+R+ 
Sbjct  29   LSAEQLDVEAYAAQYSGRTRLLRLLFIAERCGVEAVELEALRMAFDEARKRDDTLLYRDA  88

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
              +I GRLGP Y  D  W DSV RRA+QRKEKL+NELN YRTNLIKESIRMGYND GDFY
Sbjct  89   AHRIKGRLGPAYRYDQAWVDSVHRRADQRKEKLDNELNGYRTNLIKESIRMGYNDIGDFY  148

Query  506  YAHGQLGEAFK  538
            YAHGQL +AFK
Sbjct  149  YAHGQLSDAFK  159



>ref|XP_001758275.1| predicted protein [Physcomitrella patens]
 gb|EDQ77097.1| predicted protein [Physcomitrella patens]
Length=426

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  149  SGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVV  328
            + EQ+D+E+Y +LYSG TKI RL FIAD  N+ +++LEALRMA DEI+KGENT LF+E V
Sbjct  15   TPEQIDVESYASLYSGHTKIARLHFIADHSNSRNLELEALRMALDEIRKGENTVLFKECV  74

Query  329  QKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
            +KINGRLGP YG D  W D+V+RRA QR+EKLE ELN YRTNLIKESIRMGYND GDF+Y
Sbjct  75   EKINGRLGPGYGLDQEWIDTVERRAAQRQEKLEMELNGYRTNLIKESIRMGYNDLGDFHY  134

Query  509  AHGQLGEAFK  538
            A G L +AFK
Sbjct  135  ARGDLQQAFK  144



>dbj|BAJ99160.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=446

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            ++ EQLD+EAY A YSGRT++ RL+FI++RC   +++LEALRMA+DE +  E+T L+ E 
Sbjct  30   VAAEQLDVEAYAAQYSGRTRVARLIFISERCGVEAVELEALRMAHDEARAREDTTLYLEA  89

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
            V KINGRL P Y  D  W DSV+RRAEQRKEKLE ELN YRTNLIKESIRMGYND GDF+
Sbjct  90   VAKINGRLAPRYRHDQAWVDSVNRRAEQRKEKLETELNGYRTNLIKESIRMGYNDIGDFF  149

Query  506  YAHGQLGEAFK  538
            Y HG L EAFK
Sbjct  150  YGHGHLSEAFK  160



>ref|XP_001781784.1| predicted protein [Physcomitrella patens]
 gb|EDQ53432.1| predicted protein [Physcomitrella patens]
Length=426

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +2

Query  113  GVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIK  292
            G ++ +R     + EQ D+E+Y +LY+G TKI RL FIAD CN+ ++ LEALRMA DEI+
Sbjct  3    GWENQARRPTEATPEQFDVESYASLYTGHTKIARLHFIADHCNSRNLDLEALRMALDEIR  62

Query  293  KGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESI  472
            KGENT LF+E V+++NGRLG  YG D  W D+V+RRA QR+EKLE ELN Y+TNLIKESI
Sbjct  63   KGENTVLFKECVERLNGRLGLGYGLDQEWIDTVERRAAQRQEKLEVELNGYKTNLIKESI  122

Query  473  RMGYNDFGDFYYAHGQLGEAFK  538
            RMGYND GDF+Y+ G L +AF+
Sbjct  123  RMGYNDLGDFHYSRGDLQQAFQ  144



>ref|XP_003574218.1| PREDICTED: COP9 signalosome complex subunit 1-like [Brachypodium 
distachyon]
Length=437

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +SG+Q D+EAY A YSGRT++ RLLFIA +C +  M L+ALR+AYDE  KGE+T L  +V
Sbjct  25   VSGDQFDLEAYAAQYSGRTRVARLLFIAGKCGSEPMWLDALRLAYDESLKGEDTTLHHDV  84

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
              +I GRLGP YG D  W+D+V+RRA  RK+KL++ELN YRTNLIKESIRMGYNDFGDF+
Sbjct  85   SARIAGRLGPRYGVDLAWSDAVERRALMRKDKLDSELNGYRTNLIKESIRMGYNDFGDFH  144

Query  506  YAHGQLGEAFK  538
            YA GQL EA K
Sbjct  145  YARGQLSEALK  155



>emb|CAB91509.1| FUSCA6 protein [Arabidopsis thaliana]
Length=130

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 105/132 (80%), Gaps = 3/132 (2%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADR  235
            ME +++  G MM E+ +NGG + S+R RPIISGE LDIEAY ALY GRTKIMRLLFIA+ 
Sbjct  1    MERDEEASGPMM-EMCTNGGEETSNR-RPIISGEPLDIEAYAALYKGRTKIMRLLFIANH  58

Query  236  CN-NTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQR  412
            C  N ++Q +ALRMAYDEIKKGENTQLFREVV KI  RLG  YG D  W ++VDRRAEQ+
Sbjct  59   CGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQK  118

Query  413  KEKLENELNAYR  448
            K KLENEL++YR
Sbjct  119  KVKLENELSSYR  130



>ref|XP_002992519.1| hypothetical protein SELMODRAFT_135331, partial [Selaginella 
moellendorffii]
 gb|EFJ06457.1| hypothetical protein SELMODRAFT_135331, partial [Selaginella 
moellendorffii]
Length=442

 Score =   177 bits (450),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            + +G+Q+D+EAY  LYSGRTK+ RL FIAD   + +++LEALRMA++EI++ ENT L++E
Sbjct  25   VAAGDQVDLEAYAGLYSGRTKVTRLFFIADHAKSHNLELEALRMAHNEIRRAENTLLYKE  84

Query  323  VVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDF  502
            VV KI GRLG  Y  D  W D VDRRA QR+EKL+ ELN Y+TNLIKESIRMGYND GDF
Sbjct  85   VVDKIGGRLGAAYARDQEWVDVVDRRAVQRQEKLDMELNGYKTNLIKESIRMGYNDLGDF  144

Query  503  YYAHGQLGEAFK  538
            +Y+ G L +AFK
Sbjct  145  FYSRGDLQQAFK  156



>dbj|BAK01545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            ++SG+Q D+EAY A YSGRT++ RLLFIA++C +  M+L+ALR+AYD   KGE+T L R+
Sbjct  23   LVSGDQFDVEAYAAQYSGRTRVARLLFIAEKCGSEQMRLDALRLAYDWALKGEDTALHRD  82

Query  323  VVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDF  502
            +  +I GRLG  Y  D  W+D+V+RRA  RK+KL++ELN YRTNLIKESIRMGYND GDF
Sbjct  83   ISVRIAGRLGSRYAVDQAWSDAVERRALLRKDKLDSELNVYRTNLIKESIRMGYNDLGDF  142

Query  503  YYAHGQLGEAFK  538
            +YA G L EAFK
Sbjct  143  HYAQGHLSEAFK  154



>ref|XP_002990169.1| hypothetical protein SELMODRAFT_235966 [Selaginella moellendorffii]
 gb|EFJ08729.1| hypothetical protein SELMODRAFT_235966 [Selaginella moellendorffii]
Length=435

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            + +G+Q+D+EAY  LYSGRTK+ RL FIAD   + +++LEALRMA++EI++ ENT L++E
Sbjct  18   VAAGDQVDLEAYAGLYSGRTKVTRLFFIADHAKSHNLELEALRMAHNEIRRAENTLLYKE  77

Query  323  VVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDF  502
            VV KI GRLG  Y  D  W D VDRRA QR+EKL+ ELN Y+TNLIKESIRMGYND GDF
Sbjct  78   VVDKIGGRLGAAYARDQEWVDVVDRRAVQRQEKLDMELNGYKTNLIKESIRMGYNDLGDF  137

Query  503  YYAHGQLGEAFK  538
            +Y+ G L +AFK
Sbjct  138  FYSRGDLQQAFK  149



>gb|EMT23876.1| hypothetical protein F775_13561 [Aegilops tauschii]
Length=454

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 5/137 (4%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            ++SG+Q D+EAY A YSGRT++ RLLFIA++C +  M+L+ALR+AYD   KGE+T L R+
Sbjct  23   LVSGDQFDVEAYAAQYSGRTRVARLLFIAEKCGSEQMRLDALRLAYDWALKGEDTALHRD  82

Query  323  VVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYR-----TNLIKESIRMGYN  487
            V  KI GRLGP Y  D  W+D+V+RRA  RK+KL++ELN YR     TNLIKESIRMGYN
Sbjct  83   VSAKIAGRLGPRYAADQPWSDAVERRALLRKDKLDSELNVYRSFYPQTNLIKESIRMGYN  142

Query  488  DFGDFYYAHGQLGEAFK  538
            D GDF+YA G L +AFK
Sbjct  143  DLGDFHYAQGHLSDAFK  159



>gb|EMS50485.1| COP9 signalosome complex subunit 1 [Triticum urartu]
Length=475

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 106/158 (67%), Gaps = 26/158 (16%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            ++SG+QLD+EAY A YSGRT++ RLLFIA++C +  M+L+ALR+AYD   KGE+T L R+
Sbjct  23   LVSGDQLDVEAYAAQYSGRTRVGRLLFIAEKCGSEQMRLDALRLAYDWALKGEDTALHRD  82

Query  323  VVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYR------------------  448
            V  KI GRLGP Y  D  W+D+V+RRA  RK+KL++ELN YR                  
Sbjct  83   VSAKIAGRLGPRYTADQPWSDAVERRALLRKDKLDSELNVYRDCIWSPFLLDAMSDALAC  142

Query  449  --------TNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
                    TNLIKESIRMGYND GDF+YA G L +AFK
Sbjct  143  VLKSLYLQTNLIKESIRMGYNDLGDFHYAQGHLSDAFK  180



>ref|XP_001702205.1| hypothetical protein CHLREDRAFT_194712 [Chlamydomonas reinhardtii]
 gb|EDO97136.1| predicted protein [Chlamydomonas reinhardtii]
Length=416

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = +2

Query  149  SGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVV  328
            +G   D+EAY A Y+G  K+ RLLFIA+R +   ++LEALRMA+DE+KK ENT  ++EVV
Sbjct  16   AGSSFDLEAYIANYTGHAKVDRLLFIAERSSGKPLELEALRMAHDELKKTENTARYQEVV  75

Query  329  QKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
             +I+GRLG  Y PD  W ++ +RR+ Q+ E+LE+EL +++  L+KESIRMG++D GD+ Y
Sbjct  76   ARIDGRLGSAYTPDRAWVENTERRSAQKGERLESELQSFKAALMKESIRMGHSDLGDWAY  135

Query  509  AHGQLGEAFK  538
              G L  AFK
Sbjct  136  ERGDLQTAFK  145



>ref|XP_002499830.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61088.1| predicted protein [Micromonas sp. RCC299]
Length=509

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +2

Query  161  LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKIN  340
            +D+EA  A Y     + RL+FIADR ++ +++L+ALR A+D +K+G++T+ +  VV+KI 
Sbjct  8    VDVEAITAGYGPHAAVPRLMFIADRSDDEALKLDALRAAHDILKQGDDTRAYAAVVEKIA  67

Query  341  GRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQ  520
            GRLGP++  D  W D  DRRA +++E L+ ELN Y+TN+IKESIRMG+ND GDFY+A G 
Sbjct  68   GRLGPSHELDKEWVDETDRRAAKKQEVLDAELNGYKTNMIKESIRMGHNDLGDFYHARGD  127

Query  521  LGEAFK  538
            L  AFK
Sbjct  128  LNAAFK  133



>ref|XP_005847304.1| hypothetical protein CHLNCDRAFT_35625 [Chlorella variabilis]
 gb|EFN55202.1| hypothetical protein CHLNCDRAFT_35625 [Chlorella variabilis]
Length=441

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQK  334
            E  D+EAY A YSG  +I RLLF AD+     ++LEAL++A D +K+ ++TQ + EV+++
Sbjct  15   EAFDLEAYAANYSGHARISRLLFAADQSAGKPLELEALKLAADALKRTDDTQRYAEVIER  74

Query  335  INGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAH  514
            I GR GP Y  D+ W +  +R +EQ++++LE+EL  Y++NLIKESIRMG+N  GDF+Y+ 
Sbjct  75   IGGRAGPQYALDSEWIERTERASEQKQDRLESELGVYKSNLIKESIRMGHNQLGDFFYSR  134

Query  515  GQLGEAFK  538
            G L  AFK
Sbjct  135  GDLQSAFK  142



>ref|XP_002953121.1| hypothetical protein VOLCADRAFT_63341 [Volvox carteri f. nagariensis]
 gb|EFJ45720.1| hypothetical protein VOLCADRAFT_63341 [Volvox carteri f. nagariensis]
Length=466

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = +2

Query  170  EAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRL  349
            +AY + Y+G  KI RLLFIADR     ++LEALRMA+DE+KK ENT  ++EVV KINGRL
Sbjct  6    QAYISNYTGHAKIDRLLFIADRTAGKPLELEALRMAHDELKKTENTHRYQEVVTKINGRL  65

Query  350  GPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGE  529
            G  Y  D  W D+ +RR+  + E+LE+EL +++  L+KESIRMG++D GD+ Y  G L  
Sbjct  66   GSCYNMDRSWVDATERRSAAKGERLESELQSFKAALMKESIRMGHSDLGDWAYDRGDLQT  125

Query  530  AFK  538
            AFK
Sbjct  126  AFK  128



>gb|EMT19620.1| hypothetical protein F775_30940 [Aegilops tauschii]
Length=375

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  272  MAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRT  451
            MA+DE +  E+T L+ + V KIN RLGP Y  D  W DSV+RRAEQRKEKLE ELN YRT
Sbjct  1    MAHDEARAREDTVLYLDAVLKINSRLGPRYRHDQAWVDSVNRRAEQRKEKLETELNGYRT  60

Query  452  NLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            NLIKESIRMGYND GDF+YAHG L EAFK
Sbjct  61   NLIKESIRMGYNDIGDFFYAHGHLSEAFK  89



>ref|XP_004338219.1| PCI domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR16206.1| PCI domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=442

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
             S +  D+E Y + YSG TKI R +FIA+R  +  ++LEA R+A +EIKK  NT L+REV
Sbjct  22   FSYKDFDLEGYLSNYSGHTKIFRAIFIAERSKD--LELEATRIALEEIKKTHNTALYREV  79

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
            V K   + G  +  D  W DSV+++A+Q+ ++LE ELN YRTNLIKESIRMG+ND GDF+
Sbjct  80   VDKAIEKHGGLFTKDQAWIDSVEKKAQQQNDRLEQELNGYRTNLIKESIRMGHNDLGDFH  139

Query  506  YAHGQLGEAFK  538
            Y  G L  A K
Sbjct  140  YDRGDLQSALK  150



>ref|XP_005647635.1| PCI-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23091.1| PCI-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=444

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  161  LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKIN  340
            +DIEAY + Y+G  KI RL+FIA++ +++++ L ALR+A D++K+G+N   + EV+ KIN
Sbjct  11   IDIEAYASNYTGNAKINRLIFIAEKTSDSALALSALRLAADDLKRGQNVGKYNEVISKIN  70

Query  341  GRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQ  520
             RLGP+Y  D  W D+V+ RA   + KLE+EL+ Y+TNLIKESIRMG++D  DF+++ G 
Sbjct  71   NRLGPDYHYDRDWADAVEARASATQYKLESELSGYKTNLIKESIRMGHHDIADFFFSRGD  130

Query  521  LGEAFK  538
            L  AFK
Sbjct  131  LQSAFK  136



>gb|EWM28121.1| fusca protein fus6 [Nannochloropsis gaditana]
Length=551

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 85/133 (64%), Gaps = 4/133 (3%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEI--KKGENTQLFR  319
            I     DI+ Y A Y+G TK+ RLLFIA  C   S +L+A R+A D +   +  N QL+R
Sbjct  49   IDAPNFDIDTYAARYAGYTKLRRLLFIAQHCK--SRELDAYRLALDALTQPRSLNIQLYR  106

Query  320  EVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGD  499
            +V+  + GRLGP Y  DA W + +D+RA  +KE+LE++L   RT + KESIR+GY D G+
Sbjct  107  KVMGLVAGRLGPAYSLDATWAEEIDKRAAMQKERLESDLQTSRTGMAKESIRLGYQDLGE  166

Query  500  FYYAHGQLGEAFK  538
            F+YA G L  A K
Sbjct  167  FHYARGDLDNALK  179



>gb|EWM28122.1| fusca protein fus6 [Nannochloropsis gaditana]
Length=539

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 84/127 (66%), Gaps = 4/127 (3%)
 Frame = +2

Query  164  DIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEI--KKGENTQLFREVVQKI  337
            DI+ Y A Y+G TK+ RLLFIA  C   S +L+A R+A D +   +  N QL+R+V+  +
Sbjct  43   DIDTYAARYAGYTKLRRLLFIAQHCK--SRELDAYRLALDALTQPRSLNIQLYRKVMGLV  100

Query  338  NGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHG  517
             GRLGP Y  DA W + +D+RA  +KE+LE++L   RT + KESIR+GY D G+F+YA G
Sbjct  101  AGRLGPAYSLDATWAEEIDKRAAMQKERLESDLQTSRTGMAKESIRLGYQDLGEFHYARG  160

Query  518  QLGEAFK  538
             L  A K
Sbjct  161  DLDNALK  167



>gb|EMT16886.1| hypothetical protein F775_12844 [Aegilops tauschii]
Length=307

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  272  MAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRT  451
            MAYDE K  E+T  +RE   +INGRLGP +  D  W DSV+ RAEQRKE LE EL  Y+T
Sbjct  1    MAYDEAKAREDTAFYREAALRINGRLGPTHLLDQDWVDSVNHRAEQRKENLETELEVYKT  60

Query  452  NLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             L  ESIR+ YND GDFYY+HG+L EAFK
Sbjct  61   CLHGESIRICYNDLGDFYYSHGRLTEAFK  89



>ref|XP_003062080.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH53792.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=402

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 86/127 (68%), Gaps = 1/127 (1%)
 Frame = +2

Query  161  LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIK-KGENTQLFREVVQKI  337
            +D+E   + Y+    I RLLFIA++  + + +LE+L++A + +K K  +T  +  VV+++
Sbjct  1    IDVETIASSYAPPAAIARLLFIAEKTTSDATRLESLKLAINLLKTKTSDTATYARVVERV  60

Query  338  NGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHG  517
            +GRLG +Y  D GW +  D+ +  R+  LE EL+AY+TN IKES+RMG+ND GDF+++ G
Sbjct  61   DGRLGDDYALDKGWIEETDKASANRQAVLERELSAYKTNSIKESVRMGHNDLGDFHHSRG  120

Query  518  QLGEAFK  538
             L  AFK
Sbjct  121  ALAAAFK  127



>ref|XP_002673052.1| predicted protein [Naegleria gruberi]
 gb|EFC40308.1| predicted protein [Naegleria gruberi]
Length=416

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 86/132 (65%), Gaps = 16/132 (12%)
 Frame = +2

Query  161  LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKIN  340
             D++ Y A YSG TK+ RL+FI++  N+  ++ +AL   ++ +K G+NT L++E+V+K  
Sbjct  4    FDLDQYIASYSGLTKVKRLVFISE--NSKDLRGKALSKLFELLKSGKNTALYKELVEK--  59

Query  341  GRLGPNYGPDAG------WTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDF  502
                  YG DAG      W   VDR A +++EKLE ELNA++TNLIKESIR G+N+ GDF
Sbjct  60   ------YGKDAGQTLDSEWITQVDRSATKQQEKLEVELNAHKTNLIKESIRTGHNELGDF  113

Query  503  YYAHGQLGEAFK  538
            +   G L E+ K
Sbjct  114  HLERGNLQESLK  125



>emb|CBN79714.1| conserved unknown protein [Ectocarpus siliculosus]
Length=488

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 79/125 (63%), Gaps = 2/125 (2%)
 Frame = +2

Query  164  DIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKING  343
            D++AY + Y G TK+ RL +IA RC   ++  +  R A   +++G NTQ +R++  +   
Sbjct  3    DLDAYISRYGGYTKLRRLDWIAQRC--PALAPDCYRAALTLLRQGINTQSYRDISTRAVV  60

Query  344  RLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQL  523
             +GP +  D  W + VDRR +Q  ++LE ELN+Y+ NLIKESIRMGYN+ GD  Y  G L
Sbjct  61   LMGPEHAVDTEWAEQVDRRYQQSVDRLEAELNSYKINLIKESIRMGYNELGDLSYRRGDL  120

Query  524  GEAFK  538
             +A K
Sbjct  121  KQALK  125



>gb|KIY96361.1| COP9 signalosome complex subunit 1, partial [Monoraphidium neglectum]
Length=348

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 70/100 (70%), Gaps = 4/100 (4%)
 Frame = +2

Query  251  MQLEALRMAYDEIKKGE----NTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKE  418
            M+LEAL++A DE+K+      NT  + +V+ +I GRLGP Y  D    DS ++ A  RKE
Sbjct  1    MELEALKIAADELKQTLRETFNTARYEDVMTRIGGRLGPAYTLDQSLLDSTEKAAAARKE  60

Query  419  KLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +LE+EL+  ++NLIKESIR+G+ND GDFYY  G L +AFK
Sbjct  61   RLESELHGSKSNLIKESIRLGHNDLGDFYYNRGSLSDAFK  100



>gb|ERZ96782.1| hypothetical protein GLOINDRAFT_12251 [Rhizophagus irregularis 
DAOM 181602]
Length=402

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 77/131 (59%), Gaps = 7/131 (5%)
 Frame = +2

Query  161  LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIK-KGENTQLFREVVQKI  337
            LD++ Y + Y G TK+ RLLFIA RC   S+Q++A R+A  E++    +   +     K+
Sbjct  24   LDLDTYISNYKGHTKVDRLLFIAKRC--PSLQIDAYRLALQELRDHSLDHARYISAATKL  81

Query  338  NGRLG----PNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
            N  L     P++  D  W DS  +RA+   E+LE EL  Y+ NLIKESIRMG+ND GD Y
Sbjct  82   NEVLTAQGYPSFSIDNTWVDSTQKRAKSLLERLEVELKNYKNNLIKESIRMGHNDLGDHY  141

Query  506  YAHGQLGEAFK  538
            Y  G L  A K
Sbjct  142  YNCGNLTNALK  152



>gb|EXX71082.1| proteasome regulatory particle lid subunit RPN7 [Rhizophagus 
irregularis DAOM 197198w]
Length=435

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 77/131 (59%), Gaps = 7/131 (5%)
 Frame = +2

Query  161  LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIK-KGENTQLFREVVQKI  337
            LD++ Y + Y G TK+ RLLFIA RC   S+Q++A R+A  E++    +   +     K+
Sbjct  24   LDLDTYISNYKGHTKVDRLLFIAKRC--PSLQIDAYRLALQELRDHSLDHARYISAATKL  81

Query  338  NGRLG----PNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
            N  L     P++  D  W DS  +RA+   E+LE EL  Y+ NLIKESIRMG+ND GD Y
Sbjct  82   NEVLTAQGYPSFSIDNTWVDSTQKRAKSLLERLEVELKNYKNNLIKESIRMGHNDLGDHY  141

Query  506  YAHGQLGEAFK  538
            Y  G L  A K
Sbjct  142  YNCGNLTNALK  152



>gb|EXX71081.1| proteasome regulatory particle lid subunit RPN7 [Rhizophagus 
irregularis DAOM 197198w]
Length=439

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 77/131 (59%), Gaps = 7/131 (5%)
 Frame = +2

Query  161  LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIK-KGENTQLFREVVQKI  337
            LD++ Y + Y G TK+ RLLFIA RC   S+Q++A R+A  E++    +   +     K+
Sbjct  24   LDLDTYISNYKGHTKVDRLLFIAKRC--PSLQIDAYRLALQELRDHSLDHARYISAATKL  81

Query  338  NGRLG----PNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
            N  L     P++  D  W DS  +RA+   E+LE EL  Y+ NLIKESIRMG+ND GD Y
Sbjct  82   NEVLTAQGYPSFSIDNTWVDSTQKRAKSLLERLEVELKNYKNNLIKESIRMGHNDLGDHY  141

Query  506  YAHGQLGEAFK  538
            Y  G L  A K
Sbjct  142  YNCGNLTNALK  152



>ref|XP_009529697.1| hypothetical protein PHYSODRAFT_346736 [Phytophthora sojae]
 gb|EGZ15948.1| hypothetical protein PHYSODRAFT_346736 [Phytophthora sojae]
Length=403

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 74/128 (58%), Gaps = 9/128 (7%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQK  334
            E  D+EAY A YSGR +  RLLF+   C    +Q EA R    E+K   N  L+ E+   
Sbjct  6    EGFDVEAYAAKYSGRNRTERLLFLTKTC--PELQAEAKRALLRELKGSLNMGLYAEI---  60

Query  335  INGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAH  514
                LG     +A + D+V   A Q+ E+LE ELN+Y++ +IKESIRMG+ND GDFYY  
Sbjct  61   ----LGEKVQEEASFIDNVKHNAAQQHERLEQELNSYKSTMIKESIRMGHNDLGDFYYEM  116

Query  515  GQLGEAFK  538
            G L  A K
Sbjct  117  GDLPAALK  124



>dbj|GAM24105.1| hypothetical protein SAMD00019534_072800, partial [Acytostelium 
subglobosum LB1]
Length=437

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 84/154 (55%), Gaps = 16/154 (10%)
 Frame = +2

Query  98   IHSNGGVDDSS-----RHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQL-  259
            I +  G+DD S       +  +S    D+E Y   Y+G TKI RLLFI D    TS +L 
Sbjct  3    IDNEAGIDDMSVETGATAKASVSSNVFDLENYINQYTGFTKIYRLLFIMD----TSTELG  58

Query  260  -EALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENEL  436
             EAL     EIK   N  L+ ++  +I     PN  PD  W +S  ++ +Q+ E++E EL
Sbjct  59   GEALERVTKEIKCSPNLDLYAQLCSRI-----PNSKPDTAWVESTHKKNQQQLERIEQEL  113

Query  437  NAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            NA + N+IKESIR+ +N+ GDFY+  G    A K
Sbjct  114  NAAKANMIKESIRVAHNELGDFYHNIGDFTNALK  147



>ref|XP_005784981.1| hypothetical protein EMIHUDRAFT_429574 [Emiliania huxleyi CCMP1516]
 gb|EOD32552.1| hypothetical protein EMIHUDRAFT_429574 [Emiliania huxleyi CCMP1516]
Length=423

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 82/125 (66%), Gaps = 6/125 (5%)
 Frame = +2

Query  164  DIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKING  343
            ++E+Y A Y+G T++ RL FIA   +  +++ EALR+A ++ ++G NT L+    Q++  
Sbjct  9    EMESYIAAYAGHTRLKRLQFIAQ--HEPTLRAEALRIAVEQARQGVNTALY----QELCA  62

Query  344  RLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQL  523
              G     D  W DSV+++A  R +KLE++L +++T+L+KESIRMG++D GDF+ + G  
Sbjct  63   TEGCPVARDDAWVDSVEKKASARLDKLESDLASHKTSLVKESIRMGHSDLGDFHASRGDF  122

Query  524  GEAFK  538
              A K
Sbjct  123  ATALK  127



>ref|XP_005782292.1| hypothetical protein EMIHUDRAFT_468481 [Emiliania huxleyi CCMP1516]
 gb|EOD29863.1| hypothetical protein EMIHUDRAFT_468481 [Emiliania huxleyi CCMP1516]
Length=337

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 82/125 (66%), Gaps = 6/125 (5%)
 Frame = +2

Query  164  DIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKING  343
            ++E+Y A Y+G T++ RL FIA   +  +++ EALR+A ++ ++G NT L+    Q++  
Sbjct  37   EMESYIAAYAGHTRLKRLQFIAQ--HEPTLRAEALRIAVEQARQGINTALY----QELCA  90

Query  344  RLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQL  523
              G     D  W DSV+++A  R +KLE++L +++T+L+KESIRMG++D GDF+ + G  
Sbjct  91   TEGCPVARDDAWVDSVEKKASARLDKLESDLASHKTSLVKESIRMGHSDLGDFHASRGDF  150

Query  524  GEAFK  538
              A K
Sbjct  151  ATALK  155



>ref|XP_008904528.1| hypothetical protein PPTG_10821 [Phytophthora parasitica INRA-310]
 gb|ETI48086.1| hypothetical protein F443_07818 [Phytophthora parasitica P1569]
 gb|ETK88002.1| hypothetical protein L915_07669 [Phytophthora parasitica]
 gb|ETL41421.1| hypothetical protein L916_07599 [Phytophthora parasitica]
 gb|ETM47805.1| hypothetical protein L914_07564 [Phytophthora parasitica]
 gb|ETN10091.1| hypothetical protein PPTG_10821 [Phytophthora parasitica INRA-310]
 gb|ETO76782.1| hypothetical protein F444_07885 [Phytophthora parasitica P1976]
 gb|ETP17878.1| hypothetical protein F441_07808 [Phytophthora parasitica CJ01A1]
 gb|ETP45897.1| hypothetical protein F442_07778 [Phytophthora parasitica P10297]
Length=402

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 75/128 (59%), Gaps = 9/128 (7%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQK  334
            E  D+EAY A YSGR +  RLLF+   C   +++ E+ R    E+K   N  L+ E+   
Sbjct  5    EGFDVEAYAAKYSGRNRTERLLFLTQAC--PALEAESKRALLRELKGSLNMGLYAEL---  59

Query  335  INGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAH  514
                LG     +A + D+V   A Q+ E+LE ELN+Y++ +IKESIRMG+ND GDFYY  
Sbjct  60   ----LGEKVKDEANFIDNVKHNAAQQHERLEQELNSYKSTMIKESIRMGHNDLGDFYYEL  115

Query  515  GQLGEAFK  538
            G L  A K
Sbjct  116  GDLASALK  123



>gb|ETL94579.1| hypothetical protein L917_07486 [Phytophthora parasitica]
Length=402

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 75/128 (59%), Gaps = 9/128 (7%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQK  334
            E  D+EAY A YSGR +  RLLF+   C   +++ E+ R    E+K   N  L+ E+   
Sbjct  5    EGFDVEAYAAKYSGRNRTERLLFLTQAC--PALEAESKRALLRELKGSLNMGLYAEL---  59

Query  335  INGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAH  514
                LG     +A + D+V   A Q+ E+LE ELN+Y++ +IKESIRMG+ND GDFYY  
Sbjct  60   ----LGEKVKDEANFIDNVKHNAAQQHERLEQELNSYKSTMIKESIRMGHNDLGDFYYEL  115

Query  515  GQLGEAFK  538
            G L  A K
Sbjct  116  GDLASALK  123



>gb|KFH69103.1| hypothetical protein MVEG_05904 [Mortierella verticillata NRRL 
6337]
Length=553

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 88/166 (53%), Gaps = 22/166 (13%)
 Frame = +2

Query  101  HSNGGVDDSSRHRP-------IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQL  259
            H   G+D ++  R        + +   LD++ Y A Y G TKI RL FIADRC   S+Q+
Sbjct  61   HDAAGLDSTASKRKRFVKVVEVDAPNNLDLDTYIANYKGHTKINRLEFIADRC--PSLQV  118

Query  260  EALRMAYDEIKKGENTQLFREV--------VQKINGRLGPNYG-----PDAGWTDSVDRR  400
            EALRMA  E+K  +   + R V          K++G+ G N G      D  W D+  +R
Sbjct  119  EALRMAVAEMKNNQTLNVQRYVNLAKKLQDAVKLHGQSGANVGNDLLAMDKAWVDNQAQR  178

Query  401  AEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            A+Q  ++LE EL  Y+ N IKESIRMG  D G+ YY  G L  A +
Sbjct  179  AKQYADQLEAELKNYKRNAIKESIRMGNTDLGNHYYECGDLTGAHR  224



>ref|XP_001628909.1| predicted protein [Nematostella vectensis]
 gb|EDO36846.1| predicted protein [Nematostella vectensis]
Length=466

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 84/137 (61%), Gaps = 7/137 (5%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            I+ G  LD++ Y + Y+G TK+ RLLF+A  C   S+++++LR+A   +K+  N QL+++
Sbjct  35   IVEGATLDLDVYASNYTGLTKLNRLLFVAKHC--PSLEIDSLRIAIIFVKQTFNVQLYQD  92

Query  323  VVQKI---NGRLGPNYGP--DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYN  487
            ++QK+     R      P  +  W ++  ++A  + EKL+ +L  Y++N IKESIR G++
Sbjct  93   IIQKLIEACSRQSDMETPSVETTWVETTSKKAALKLEKLDTDLKNYKSNSIKESIRRGHD  152

Query  488  DFGDFYYAHGQLGEAFK  538
            D GD Y+  G L  A K
Sbjct  153  DLGDHYFECGDLNNALK  169



>ref|XP_011124184.1| hypothetical protein AOL_s00097g49 [Arthrobotrys oligospora ATCC 
24927]
 gb|EGX47003.1| hypothetical protein AOL_s00097g49 [Arthrobotrys oligospora ATCC 
24927]
Length=478

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 75/129 (58%), Gaps = 4/129 (3%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E Y   YSGR K+ RLLFI + C    + +EAL+ A   +K   + +L+R+ VQ +
Sbjct  44   RFDLEQYIGNYSGRMKVTRLLFIGNHC--PPLAVEALKTAISIVKADRDVRLYRQAVQSL  101

Query  338  NGRLG--PNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYA  511
                   P+   D  W +   R  +Q+ ++LE EL +Y+ N+IKESIR+G+ D GD +Y 
Sbjct  102  QVYAANDPDAKLDEEWIEKTTREVKQKTDRLEAELKSYKNNMIKESIRIGHKDLGDHFYT  161

Query  512  HGQLGEAFK  538
             G L  A++
Sbjct  162  TGDLASAYR  170



>ref|XP_002908960.1| COP9 signalosome complex subunit 1, putative [Phytophthora infestans 
T30-4]
 gb|EEY57774.1| COP9 signalosome complex subunit 1, putative [Phytophthora infestans 
T30-4]
Length=402

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 73/126 (58%), Gaps = 9/126 (7%)
 Frame = +2

Query  161  LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKIN  340
             D+EAY A YSGR +  RLLF+   C   +++ EA R    E+K   N  L+ E+     
Sbjct  7    FDVEAYAAKYSGRNRTERLLFLTQTC--PALESEAKRALLRELKGSLNMGLYAEM-----  59

Query  341  GRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQ  520
              L      +A + D+V   A Q+ E+LE ELN+Y++ +IKESIRMG+ND GDFYY  G 
Sbjct  60   --LADKAKDEASFIDNVKHNAAQQHERLEQELNSYKSTMIKESIRMGHNDLGDFYYNLGD  117

Query  521  LGEAFK  538
            L  A K
Sbjct  118  LASALK  123



>gb|EKC21956.1| COP9 signalosome complex subunit 1 [Crassostrea gigas]
Length=448

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 84/154 (55%), Gaps = 16/154 (10%)
 Frame = +2

Query  119  DDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKG  298
            D+    R ++    LD+E Y A YSG  K+ RLLFIAD C    +++EALRMA   +   
Sbjct  27   DNVEEDRYVVENTTLDLEQYAAQYSGLAKLNRLLFIADHC--PMLRVEALRMALAYVMNT  84

Query  299  ENTQLFREVVQKINGRLGPNYG-PDA-------------GWTDSVDRRAEQRKEKLENEL  436
             NT L++++ +K+   +  +   PDA              W ++  ++A  + EKL+ +L
Sbjct  85   YNTSLYQQIHRKLQEAVTSSSSLPDAVAGAIHNVPSLDTQWIETTSKKAALKLEKLDTDL  144

Query  437  NAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
              Y++N IKESIR G++D GD Y  +G L  A K
Sbjct  145  KNYKSNSIKESIRRGHDDLGDHYLDYGDLSNALK  178



>ref|XP_011440531.1| PREDICTED: COP9 signalosome complex subunit 1-like [Crassostrea 
gigas]
Length=447

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 84/154 (55%), Gaps = 16/154 (10%)
 Frame = +2

Query  119  DDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKG  298
            D+    R ++    LD+E Y A YSG  K+ RLLFIAD C    +++EALRMA   +   
Sbjct  27   DNVEEDRYVVENTTLDLEQYAAQYSGLAKLNRLLFIADHC--PMLRVEALRMALAYVMNT  84

Query  299  ENTQLFREVVQKINGRLGPNYG-PDA-------------GWTDSVDRRAEQRKEKLENEL  436
             NT L++++ +K+   +  +   PDA              W ++  ++A  + EKL+ +L
Sbjct  85   YNTSLYQQIHRKLQEAVTSSSSLPDAVAGAIHNVPSLDTQWIETTSKKAALKLEKLDTDL  144

Query  437  NAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
              Y++N IKESIR G++D GD Y  +G L  A K
Sbjct  145  KNYKSNSIKESIRRGHDDLGDHYLDYGDLSNALK  178



>ref|XP_004344506.2| proteasome component region PCI [Capsaspora owczarzaki ATCC 30864]
 gb|KJE96582.1| proteasome component region PCI [Capsaspora owczarzaki ATCC 30864]
Length=466

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 80/139 (58%), Gaps = 8/139 (6%)
 Frame = +2

Query  140  PIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFR  319
            P+    +LD+E Y + Y+G  +I+RLLFIA  C +  ++++ALR A  ++KK  NT+L+ 
Sbjct  34   PLRLHPRLDLEIYASNYTGHARIIRLLFIAATCPD--LRVDALRSAMHDLKKTLNTKLYE  91

Query  320  EVVQKINGRLG------PNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMG  481
             V + +           P    D+ W D+  R+A+   E+L+ +L  +R   IKESIRMG
Sbjct  92   AVGEDLRVAAAAANVSRPEDRVDSAWVDATFRKAQNLFERLDTDLRGHRNTFIKESIRMG  151

Query  482  YNDFGDFYYAHGQLGEAFK  538
              D GD +Y  G+L EA K
Sbjct  152  NTDLGDHFYDRGELSEAVK  170



>gb|EKC37296.1| COP9 signalosome complex subunit 1 [Crassostrea gigas]
Length=468

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 84/154 (55%), Gaps = 16/154 (10%)
 Frame = +2

Query  119  DDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKG  298
            D+    R ++    LD+E Y A YSG  K+ RLLFIAD C    +++EALRMA   +   
Sbjct  11   DNVEEDRYVVENTTLDLEQYAAQYSGLAKLNRLLFIADHC--PMLRVEALRMALAYVMNT  68

Query  299  ENTQLFREVVQKINGRLGPNYG-PDA-------------GWTDSVDRRAEQRKEKLENEL  436
             NT L++++ +K+   +  +   PDA              W ++  ++A  + EKL+ +L
Sbjct  69   YNTSLYQQIHRKLQEAVTSSSSLPDAVAGAIHNVPSLDTQWIETTSKKAALKLEKLDTDL  128

Query  437  NAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
              Y++N IKESIR G++D GD Y  +G L  A K
Sbjct  129  KNYKSNSIKESIRRGHDDLGDHYLDYGDLSNALK  162



>ref|XP_011421157.1| PREDICTED: COP9 signalosome complex subunit 1-like isoform X2 
[Crassostrea gigas]
Length=476

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 84/154 (55%), Gaps = 16/154 (10%)
 Frame = +2

Query  119  DDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKG  298
            D+    R ++    LD+E Y A YSG  K+ RLLFIAD C    +++EALRMA   +   
Sbjct  20   DNVEEDRYVVENTTLDLEQYAAQYSGLAKLNRLLFIADHC--PMLRVEALRMALAYVMNT  77

Query  299  ENTQLFREVVQKINGRLGPNYG-PDA-------------GWTDSVDRRAEQRKEKLENEL  436
             NT L++++ +K+   +  +   PDA              W ++  ++A  + EKL+ +L
Sbjct  78   YNTSLYQQIHRKLQEAVTSSSSLPDAVAGAIHNVPSLDTQWIETTSKKAALKLEKLDTDL  137

Query  437  NAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
              Y++N IKESIR G++D GD Y  +G L  A K
Sbjct  138  KNYKSNSIKESIRRGHDDLGDHYLDYGDLSNALK  171



>ref|XP_011421153.1| PREDICTED: COP9 signalosome complex subunit 1-like isoform X1 
[Crassostrea gigas]
Length=477

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 84/154 (55%), Gaps = 16/154 (10%)
 Frame = +2

Query  119  DDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKG  298
            D+    R ++    LD+E Y A YSG  K+ RLLFIAD C    +++EALRMA   +   
Sbjct  20   DNVEEDRYVVENTTLDLEQYAAQYSGLAKLNRLLFIADHC--PMLRVEALRMALAYVMNT  77

Query  299  ENTQLFREVVQKINGRLGPNYG-PDA-------------GWTDSVDRRAEQRKEKLENEL  436
             NT L++++ +K+   +  +   PDA              W ++  ++A  + EKL+ +L
Sbjct  78   YNTSLYQQIHRKLQEAVTSSSSLPDAVAGAIHNVPSLDTQWIETTSKKAALKLEKLDTDL  137

Query  437  NAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
              Y++N IKESIR G++D GD Y  +G L  A K
Sbjct  138  KNYKSNSIKESIRRGHDDLGDHYLDYGDLSNALK  171



>gb|KDO34257.1| hypothetical protein SPRG_19085 [Saprolegnia parasitica CBS 223.65]
Length=417

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 76/143 (53%), Gaps = 15/143 (10%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLE------------ALRMAYDEI---  289
            E  D+EA  + Y+G  ++  LLFI +      M  E            ALRM   E+   
Sbjct  4    ETFDLEAVASKYAGVNRVRHLLFIVEYGKTCVMDPESKRAVCLQYAKDALRMLLAELETT  63

Query  290  KKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKES  469
            K   NT L+RE+  K    L  ++  DA + D+  R    R E+LE ELN+Y+++LIKES
Sbjct  64   KTAANTVLYRELTTKYADLLPLDFKVDAAFVDAATRANNSRHERLEQELNSYKSSLIKES  123

Query  470  IRMGYNDFGDFYYAHGQLGEAFK  538
            IR+G+ND G+FYY  G L  A +
Sbjct  124  IRIGHNDLGEFYYRMGDLPSALR  146



>gb|EFA79052.1| COP9 signalosome complex subunit 1 [Polysphondylium pallidum 
PN500]
Length=455

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 77/131 (59%), Gaps = 7/131 (5%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            +S    D++ Y + Y+G TKI RL+FI +   +   + EA+  A  EIK G+N +L+  +
Sbjct  28   VSSNVFDLDNYISGYTGFTKIHRLMFIGEVSGD--FEAEAIDRAQREIKSGQNVELYGHL  85

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
            + KI         PD  W DS ++R  Q+ EKLE +LNA ++N++K++IR+ +N+ GD Y
Sbjct  86   ISKITS-----LKPDFQWVDSTNKRNAQQLEKLEQDLNAAKSNMVKDAIRIAHNELGDHY  140

Query  506  YAHGQLGEAFK  538
            Y  G    A K
Sbjct  141  YRMGDFPNALK  151



>ref|NP_001040322.1| G protein pathway suppressor 1 [Bombyx mori]
 gb|ABD36305.1| G protein pathway suppressor 1 [Bombyx mori]
Length=480

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 77/143 (54%), Gaps = 13/143 (9%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            ++    LD+E Y A Y+G  K+ RL+F+AD C   S++LEAL+MA   +    N  L+  
Sbjct  28   VVENPTLDLETYAASYTGFAKLYRLMFVADHC--PSLRLEALKMAISYVMTTYNVNLYHT  85

Query  323  VVQKINGRLGPNYGPDAG-----------WTDSVDRRAEQRKEKLENELNAYRTNLIKES  469
            + +K++  +     PD             W +S  ++A  + EKL+ +L  Y+TN IKES
Sbjct  86   LHKKLSEAVASAGLPDIAGSQDIPVLDTIWVESKTKKAAIKLEKLDTDLKNYKTNSIKES  145

Query  470  IRMGYNDFGDFYYAHGQLGEAFK  538
            IR G++D GD Y   G L  A K
Sbjct  146  IRRGHDDLGDHYLDCGDLTSALK  168



>ref|XP_009844457.1| hypothetical protein H257_17375 [Aphanomyces astaci]
 gb|ETV66028.1| hypothetical protein H257_17375 [Aphanomyces astaci]
Length=454

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 78/146 (53%), Gaps = 18/146 (12%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLE--------------ALRMAYDEIK  292
            E  D++A+ A Y+G  ++  L++I +   N     E              ALR+   +++
Sbjct  4    ESFDLDAFAAKYAGENRVRHLMYIVEYGINPQHVFENHDNRELVVQLAKDALRLLLSDVE  63

Query  293  KGE----NTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLI  460
              +    NT L+R++  K    L  +Y PD  + D+  R    R E+LE ELN+Y++++I
Sbjct  64   ASKTTTVNTTLYRDLTTKFKEYLPLDYHPDVTFVDTATRANAARHERLEQELNSYKSSMI  123

Query  461  KESIRMGYNDFGDFYYAHGQLGEAFK  538
            KESIR+GYND G+FYY  G L  A +
Sbjct  124  KESIRIGYNDLGEFYYRTGDLANALR  149



>ref|XP_009017274.1| hypothetical protein HELRODRAFT_111705 [Helobdella robusta]
 gb|ESO04695.1| hypothetical protein HELRODRAFT_111705 [Helobdella robusta]
Length=494

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 20/156 (13%)
 Frame = +2

Query  125  SSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGEN  304
            S ++R II    LD+E   + Y G  KI RLL IA+ C  TS+++EALR+A   +    N
Sbjct  34   SDQNRRIIETSNLDLEQVASSYKGLAKIYRLLHIAEYC--TSLKIEALRLALTHVLTTCN  91

Query  305  TQLFREVVQKINGRLGPNYGP------------------DAGWTDSVDRRAEQRKEKLEN  430
            TQ+++ + + +   +G    P                  DA W +S +++A  + EKL+ 
Sbjct  92   TQMYQTIHRMLQEAVGSQSRPADPANVGSAPVQQLVPPFDAVWLESTNKKAAMKLEKLDI  151

Query  431  ELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  152  DLKNYKSNSIKESIRRGHDDLGDHYLECGDLCNALK  187



>ref|XP_011111513.1| hypothetical protein H072_5664 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40486.1| hypothetical protein H072_5664 [Dactylellina haptotyla CBS 200.50]
Length=484

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 94/181 (52%), Gaps = 36/181 (20%)
 Frame = +2

Query  71   DQFGSMMDEIHSNGG---VDDSSRHRPIISGEQ---------------LDIEAYDALYSG  196
            DQF SM+DE  ++ G    DD  ++   +SG+Q                D+E Y A Y+G
Sbjct  3    DQF-SMLDEGGASSGNAQYDDFDQN---LSGQQPAAAAAAIMVSDLPRFDLEQYIANYAG  58

Query  197  RTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGP---  367
            R K  RL+FI + C    +  EAL+ A   IK  ++ +L+R+ VQ +       Y P   
Sbjct  59   RMKTTRLMFIGNHC--PPLATEALKTAIGIIKNDKDVRLYRQAVQTLQV-----YAPNDA  111

Query  368  ----DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAF  535
                D  W +   R  +Q+ ++LE EL +Y+ N+IKESIR+G+ D GD +Y  G L  A+
Sbjct  112  DAKLDEDWIERTTREVKQKTDRLEAELKSYKNNMIKESIRIGHKDLGDHFYTTGDLPSAY  171

Query  536  K  538
            +
Sbjct  172  R  172



>ref|XP_008611944.1| hypothetical protein SDRG_07865 [Saprolegnia diclina VS20]
 gb|EQC34538.1| hypothetical protein SDRG_07865 [Saprolegnia diclina VS20]
Length=431

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 76/143 (53%), Gaps = 15/143 (10%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLE------------ALRMAYDEI---  289
            E  D+EA  + Y+G  ++  LLFI +      +  E            ALRM   E+   
Sbjct  4    ETFDLEAVASKYAGVNRVRHLLFIVEYGKTCVLDPESKRAVCLQYAKDALRMLLAELETT  63

Query  290  KKGENTQLFREVVQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKES  469
            K   NT L+RE+  K    L  ++  DA + D+  R    R E+LE ELN+Y+++LIKES
Sbjct  64   KTAANTTLYRELTTKYADLLPLDFKVDAAFVDAATRANNSRHERLEQELNSYKSSLIKES  123

Query  470  IRMGYNDFGDFYYAHGQLGEAFK  538
            IR+G+ND G+FYY  G L  A +
Sbjct  124  IRIGHNDLGEFYYRMGDLPSALR  146



>ref|XP_006682569.1| hypothetical protein BATDEDRAFT_14705 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76688.1| hypothetical protein BATDEDRAFT_14705 [Batrachochytrium dendrobatidis 
JAM81]
Length=472

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 81/141 (57%), Gaps = 7/141 (5%)
 Frame = +2

Query  131  RHRPIISGEQLDIEAYDALYSGRT-KIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENT  307
            + R I++   +D+E++ A Y  RT +I RL+FIADRC    +Q++AL+ A  E+ +  N 
Sbjct  53   KTRVIVTSTSMDLESHIANYKSRTTRIDRLIFIADRC--PVLQVDALQFAAKELLETVNV  110

Query  308  QLFREVVQKINGRLGP----NYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIR  475
              +  V+ K+N  L          D  W +     + ++ ++LE EL  YR N IKESIR
Sbjct  111  DKYLIVLGKLNDYLTSLQRLPMNVDEKWVEQTRLASRKKTDQLEYELRTYRANSIKESIR  170

Query  476  MGYNDFGDFYYAHGQLGEAFK  538
            MG++DFGD +YA G L  A K
Sbjct  171  MGHSDFGDHFYALGDLQNALK  191



>gb|KFM79956.1| COP9 signalosome complex subunit 1, partial [Stegodyphus mimosarum]
Length=481

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 82/153 (54%), Gaps = 15/153 (10%)
 Frame = +2

Query  119  DDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKG  298
            D S     I+    LD+EAY + YSG  K+ RLL+IAD C   ++++EAL+MA   ++  
Sbjct  29   DTSEEEVYIVENPTLDLEAYSSSYSGLAKLYRLLYIADHC--PTLRIEALKMALSYVQNT  86

Query  299  ENTQLFREVVQK------------INGRLGPNYGP-DAGWTDSVDRRAEQRKEKLENELN  439
             N  +++ + +K            + G L     P D  W ++  ++A  + EKL+ +L 
Sbjct  87   YNVSMYQMIHRKLLEAAGNSNLPDVTGGLNAGVLPLDTQWIETKSKKAALKLEKLDTDLK  146

Query  440  AYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             Y++N IKESIR G++D GD Y   G L  A K
Sbjct  147  NYKSNSIKESIRRGHDDLGDHYLDCGDLSNALK  179



>ref|XP_003838129.1| similar to COP9 signalosome complex subunit 1 [Leptosphaeria 
maculans JN3]
 emb|CBX94650.1| similar to COP9 signalosome complex subunit 1 [Leptosphaeria 
maculans JN3]
Length=472

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 81/140 (58%), Gaps = 5/140 (4%)
 Frame = +2

Query  128  SRHRPIISG-EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGEN  304
            S+  PI++   + D+E+Y A Y+G T+I RL  I    ++  + ++A R+A  E KKG+N
Sbjct  15   SKGEPIVTDLPKFDLESYIANYAGFTRIDRLQHIGS--HSPYLAVDAYRLAIAEAKKGKN  72

Query  305  TQLFREVVQKINGRLG--PNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRM  478
              L+  +V++ +G     P    D  W +   R  +Q +E+LE+EL +Y+ NLIKESIRM
Sbjct  73   VGLYTTLVEQFSGIAPQDPAALTDTAWAEKKTREVQQEQERLEHELKSYKNNLIKESIRM  132

Query  479  GYNDFGDFYYAHGQLGEAFK  538
            G  D G FYY  G    A K
Sbjct  133  GNEDLGHFYYDTGDYQNAHK  152



>gb|EHJ77730.1| G protein pathway suppressor 1 [Danaus plexippus]
Length=474

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 77/146 (53%), Gaps = 16/146 (11%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            ++    LD+E Y A Y+G  K+ RL+F+AD C   S++LEAL+MA   +    N  L++ 
Sbjct  19   VVDNPTLDLETYAASYTGFAKLYRLMFVADHC--PSLRLEALKMAISYVMTTYNVSLYQT  76

Query  323  VVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENELNAYRTNLI  460
            + +K+   +     PD                W +S  ++A  + EKL+ +L  Y+TN I
Sbjct  77   LHKKLAEAVATVGLPDVAVQMGSQDIPVLDSMWVESKTKKAAIKLEKLDTDLKNYKTNSI  136

Query  461  KESIRMGYNDFGDFYYAHGQLGEAFK  538
            KESIR G++D GD Y   G L  A K
Sbjct  137  KESIRRGHDDLGDHYLDCGDLTSALK  162



>ref|XP_008544126.1| PREDICTED: COP9 signalosome complex subunit 1 [Microplitis demolitor]
 ref|XP_008544128.1| PREDICTED: COP9 signalosome complex subunit 1 [Microplitis demolitor]
Length=481

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 82/155 (53%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  22   NDNTEEEPYIVENPTLDLEVYANSYTGLAKLYRLIYIADHC--PSLRIEALKMAITHVMT  79

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L++ + +K+   LG    PD                W ++  ++A  + EK + +
Sbjct  80   TYNVSLYQLLHKKLLQALGTPGLPDVAAQSTSQDIPTLNQMWVENKSKKAALKLEKFDTD  139

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  YR+N IKESIR G++D GD Y   G LG A K
Sbjct  140  LKNYRSNSIKESIRRGHDDLGDHYLDCGDLGNALK  174



>emb|CDX79636.1| BnaC03g19720D [Brassica napus]
Length=472

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +2

Query  149  SGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVV  328
            SGE L IEAY A Y GRTKI+RLLFIA   +  S Q++AL+M Y EIKKG N  LFR+V 
Sbjct  216  SGEPLSIEAYAARYKGRTKIIRLLFIAKHLDQESCQIQALKMPYYEIKKGNNVLLFRDVG  275

Query  329  QKINGRLGPNYGPDAGWTDSVDRRAEQ  409
            ++   +LG +Y  D  W ++VD R ++
Sbjct  276  ERCKYKLGSDYMLDLAWIEAVDTRWQE  302



>ref|XP_009065339.1| hypothetical protein LOTGIDRAFT_184282 [Lottia gigantea]
 gb|ESO84218.1| hypothetical protein LOTGIDRAFT_184282 [Lottia gigantea]
Length=484

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 78/151 (52%), Gaps = 16/151 (11%)
 Frame = +2

Query  128  SRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENT  307
            + H  ++    LD+E Y A Y+G  K+ RL+F+AD C   S+++EALRMA        N 
Sbjct  31   ASHNYVVENPTLDLEQYSAQYTGLAKLHRLMFVADHC--PSLRVEALRMALSYSMTTYNA  88

Query  308  QLFREVVQK--------------INGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAY  445
             L++ + QK              + G +      D  W ++  ++A  + EKL+ +L  Y
Sbjct  89   NLYQVIHQKTQEAITASSVLPDAVAGAILNTPALDTQWIETTAKKAALKLEKLDTDLKNY  148

Query  446  RTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            ++N IKESIR G++D GD Y   G L  A K
Sbjct  149  KSNSIKESIRRGHDDLGDHYLDCGDLSNALK  179



>ref|XP_006814658.1| PREDICTED: COP9 signalosome complex subunit 1-like isoform X3 
[Saccoglossus kowalevskii]
Length=450

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 18/156 (12%)
 Frame = +2

Query  119  DDSSRHRPIISGE--QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIK  292
            D+ + H  + + E   +D+EAY A YSG  KI RLLFIA  C   S ++EAL+M+    +
Sbjct  8    DNENSHELVYAVENPTMDLEAYAAQYSGLAKINRLLFIAVHC--PSFRIEALKMSLSYSQ  65

Query  293  KGENTQLFREVVQK--------------INGRLGPNYGPDAGWTDSVDRRAEQRKEKLEN  430
               NTQ+++ + +K              I G +      D  W ++ +++A  + EKL+ 
Sbjct  66   STYNTQMYQHIHRKLQEASASSSALPDAIAGLVHSIPALDTQWVETTNKKAAMKLEKLDT  125

Query  431  ELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +L  Y+ N IKESIR G++D GD Y   G L  A K
Sbjct  126  DLKNYKGNSIKESIRRGHDDLGDHYLDQGDLSNALK  161



>gb|EWC47867.1| hypothetical protein DRE_02749 [Drechslerella stenobrocha 248]
Length=477

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 77/139 (55%), Gaps = 10/139 (7%)
 Frame = +2

Query  140  PIISGE--QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQL  313
            PI+  +  + D+E Y A YSGR ++ RLLFI   C    + LEAL+ A   +K   + +L
Sbjct  33   PIVVTDLPRFDLEQYTANYSGRMQVTRLLFIGSHC--IPLALEALKTAIALLKSVGDIRL  90

Query  314  FREVVQKINGRLGPNYGPDAG----WTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMG  481
            +R+    +     PN  PDA     W +   R    R ++LE EL +Y+ N+IKESIR+G
Sbjct  91   YRQATTTLQA-YAPN-DPDAKIDEDWIERTTRDIRHRTDRLEAELKSYKNNMIKESIRIG  148

Query  482  YNDFGDFYYAHGQLGEAFK  538
            + D G+ +Y  G L  A++
Sbjct  149  HRDLGEHFYRIGDLASAYR  167



>ref|XP_002733264.2| PREDICTED: COP9 signalosome complex subunit 1-like isoform X1 
[Saccoglossus kowalevskii]
Length=468

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 18/156 (12%)
 Frame = +2

Query  119  DDSSRHRPIISGE--QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIK  292
            D+ + H  + + E   +D+EAY A YSG  KI RLLFIA  C   S ++EAL+M+    +
Sbjct  8    DNENSHELVYAVENPTMDLEAYAAQYSGLAKINRLLFIAVHC--PSFRIEALKMSLSYSQ  65

Query  293  KGENTQLFREVVQK--------------INGRLGPNYGPDAGWTDSVDRRAEQRKEKLEN  430
               NTQ+++ + +K              I G +      D  W ++ +++A  + EKL+ 
Sbjct  66   STYNTQMYQHIHRKLQEASASSSALPDAIAGLVHSIPALDTQWVETTNKKAAMKLEKLDT  125

Query  431  ELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +L  Y+ N IKESIR G++D GD Y   G L  A K
Sbjct  126  DLKNYKGNSIKESIRRGHDDLGDHYLDQGDLSNALK  161



>ref|XP_006814657.1| PREDICTED: COP9 signalosome complex subunit 1-like isoform X2 
[Saccoglossus kowalevskii]
Length=466

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 18/156 (12%)
 Frame = +2

Query  119  DDSSRHRPIISGE--QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIK  292
            D+ + H  + + E   +D+EAY A YSG  KI RLLFIA  C   S ++EAL+M+    +
Sbjct  8    DNENSHELVYAVENPTMDLEAYAAQYSGLAKINRLLFIAVHC--PSFRIEALKMSLSYSQ  65

Query  293  KGENTQLFREVVQK--------------INGRLGPNYGPDAGWTDSVDRRAEQRKEKLEN  430
               NTQ+++ + +K              I G +      D  W ++ +++A  + EKL+ 
Sbjct  66   STYNTQMYQHIHRKLQEASASSSALPDAIAGLVHSIPALDTQWVETTNKKAAMKLEKLDT  125

Query  431  ELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +L  Y+ N IKESIR G++D GD Y   G L  A K
Sbjct  126  DLKNYKGNSIKESIRRGHDDLGDHYLDQGDLSNALK  161



>ref|XP_011311032.1| PREDICTED: COP9 signalosome complex subunit 1 [Fopius arisanus]
 ref|XP_011311033.1| PREDICTED: COP9 signalosome complex subunit 1 [Fopius arisanus]
 ref|XP_011311034.1| PREDICTED: COP9 signalosome complex subunit 1 [Fopius arisanus]
Length=481

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 81/156 (52%), Gaps = 18/156 (12%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  22   NDNTEEEPYIVENPTLDLEVYANSYTGLAKLYRLIYIADHC--PSLRIEALKMAITHVLT  79

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG---------------WTDSVDRRAEQRKEKLEN  430
              N  L++ + +K+   L     PD                 W +S  ++A  + EK + 
Sbjct  80   TYNVSLYQVLHKKLLHALNTPGLPDVAAQSTSAQDMPVLNQIWVESRSKKAALKLEKFDT  139

Query  431  ELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +L  YR+N IKESIR G++D GD Y   G LG A K
Sbjct  140  DLKNYRSNSIKESIRRGHDDLGDHYLDCGDLGNALK  175



>ref|XP_003746672.1| PREDICTED: COP9 signalosome complex subunit 1-like [Metaseiulus 
occidentalis]
Length=515

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 81/164 (49%), Gaps = 20/164 (12%)
 Frame = +2

Query  101  HSNGGVDDSSRHRP----IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEAL  268
            H    V D +  RP     +     D+E Y A Y G  K+ RLLFIADRC    M++EAL
Sbjct  16   HQEPMVVDEAEERPEEVVSVQSPTFDLEIYAAQYVGYAKLNRLLFIADRC--PPMRIEAL  73

Query  269  RMAYDEIKKGENTQLFREVVQKINGRLG-------PNYG-----P--DAGWTDSVDRRAE  406
            R+A D +K   N   ++ + +K+   L        P+       P  D  W DS  ++  
Sbjct  74   RLAMDHVKGTLNVNKYQVIFKKLCEALQDARSQGFPDSADVQDLPQIDTQWVDSRLKQVA  133

Query  407  QRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             + EKL+N+L  Y+ N IKESIR G +D GD Y   G L  A +
Sbjct  134  VKTEKLDNDLKNYKANSIKESIRRGTDDLGDHYLDCGDLNNALR  177



>ref|XP_003293224.1| COP9 signalosome complex subunit 1 [Dictyostelium purpureum]
 gb|EGC30252.1| COP9 signalosome complex subunit 1 [Dictyostelium purpureum]
Length=446

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 78/131 (60%), Gaps = 7/131 (5%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            IS E  D+EAY   Y+G TKI RLLFIA+ C    +++EA + A  E++K  N +L+  +
Sbjct  19   ISNE-FDLEAYINNYTGFTKIYRLLFIAESCK--PLEVEAFKQALKEVQKTPNLELYNTI  75

Query  326  VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
            V K +G L      D  + ++++++     +KLE +LN  ++N+IK++IR   ND G+FY
Sbjct  76   VSKSHGILEI----DPSYIEALNKKNASHLDKLELDLNTAKSNMIKDAIRFAQNDLGEFY  131

Query  506  YAHGQLGEAFK  538
            Y  G    A K
Sbjct  132  YKLGDTQNAIK  142



>gb|EFX74404.1| hypothetical protein DAPPUDRAFT_307307 [Daphnia pulex]
 gb|EFX74405.1| hypothetical protein DAPPUDRAFT_324380 [Daphnia pulex]
Length=481

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 79/144 (55%), Gaps = 16/144 (11%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLF--  316
            I+    LDIE + + Y G  K+ RL+FIAD C   S+++E L+MA   +++  N  L+  
Sbjct  34   IVENPTLDIETFTSSYHGMAKLSRLMFIADHC--PSLRIETLKMAIVAVQESYNVTLYQL  91

Query  317  --REVVQKINGRLG--------PNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKE  466
              R++ + I G           P+Y  D  W +S  ++A  + EKL+ +L  Y+ N IKE
Sbjct  92   LHRKLQEAITGLTPAQVQALELPSY--DLAWAESKMKKAALKLEKLDTDLKNYKANSIKE  149

Query  467  SIRMGYNDFGDFYYAHGQLGEAFK  538
            SIR G++D GD Y  +G +  A K
Sbjct  150  SIRRGHDDLGDHYLDYGDMSNALK  173



>ref|XP_968588.1| PREDICTED: COP9 signalosome complex subunit 1 [Tribolium castaneum]
 gb|EFA00464.1| hypothetical protein TcasGA2_TC003322 [Tribolium castaneum]
Length=487

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 76/146 (52%), Gaps = 16/146 (11%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            I+    LD+E Y   YSG  K+ RL+FI D C   S++LEAL+MA   +    N  L++ 
Sbjct  35   IVENPSLDLEVYANSYSGLAKLYRLIFIIDHC--PSLRLEALKMAISYVMTTYNVNLYQV  92

Query  323  VVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENELNAYRTNLI  460
            + QK+         PD                W ++  ++A  + EKL+N+L +Y++N I
Sbjct  93   LHQKLAEVTTQMSVPDVAATSTSQDIPVIDNLWMETRSKKAALKLEKLDNDLKSYKSNSI  152

Query  461  KESIRMGYNDFGDFYYAHGQLGEAFK  538
            KESIR G++D G+ Y   G L  A K
Sbjct  153  KESIRRGHDDLGEHYLDCGDLSNALK  178



>ref|XP_011503070.1| PREDICTED: COP9 signalosome complex subunit 1 [Ceratosolen solmsi 
marchali]
Length=481

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 80/155 (52%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C   ++++EAL+MA   +  
Sbjct  22   NDNTEEEPYIVENPTLDLEVYANSYAGLAKLFRLMYIADHC--PTLRIEALKMAITYVMT  79

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   L     PD                W DS  ++A  + EK + +
Sbjct  80   TYNVSLYLILHKKLAQALSAPGLPDVAAQSTSQDIPIVDQIWVDSRSKKAALKLEKFDTD  139

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  Y++N IKESIR G++D GD Y   G LG A K
Sbjct  140  LKNYKSNSIKESIRRGHDDLGDHYLDCGDLGNALK  174



>ref|XP_003382062.1| COP9 signalosome complex subunit 1 [Trichinella spiralis]
 gb|EFV61886.1| COP9 signalosome complex subunit 1 [Trichinella spiralis]
Length=275

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 77/138 (56%), Gaps = 12/138 (9%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQK  334
            E+ D+E Y  +YSG  ++ RLLFIA+RC ++  Q  AL +A  ++K   N  L+  +  K
Sbjct  38   ERFDLEEYIKVYSGYAELHRLLFIANRCPSSRAQ--ALLLALQKVKLTSNYHLYSVIHGK  95

Query  335  IN---------GRLGPNYGP-DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGY  484
            +          G       P DA W +   R+A+ + EKL+ ELN YR N IKESIR G+
Sbjct  96   LTELSKKRSFLGETAITVPPFDADWFEVQKRKAKAKFEKLDQELNVYRCNSIKESIRRGF  155

Query  485  NDFGDFYYAHGQLGEAFK  538
               G+ +   G+LG+A+K
Sbjct  156  LYLGEHHLEMGELGKAYK  173



>ref|XP_787846.3| PREDICTED: COP9 signalosome complex subunit 1 [Strongylocentrotus 
purpuratus]
Length=458

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 81/156 (52%), Gaps = 16/156 (10%)
 Frame = +2

Query  113  GVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIK  292
            G D     R  +    LD+EAY   Y G  KI RLLF+A  C   + ++E+LRMA +  +
Sbjct  22   GSDSQEELRYSVENPTLDVEAYAVSYMGLAKINRLLFVALHC--PAFKIESLRMALNYTQ  79

Query  293  KGENTQLFREVVQKI-----NGRLGPNY---------GPDAGWTDSVDRRAEQRKEKLEN  430
               NT +++ V +K+     N  + P+            D  W ++ +++A  + EKL+ 
Sbjct  80   TTYNTHMYQLVHRKLTDAVSNASVLPDAVAGVVHNIPSLDTQWIETTNKKAALKLEKLDT  139

Query  431  ELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  140  DLKNYKSNSIKESIRRGHDDLGDHYLDQGDLSNALK  175



>ref|XP_002591224.1| hypothetical protein BRAFLDRAFT_116394 [Branchiostoma floridae]
 gb|EEN47235.1| hypothetical protein BRAFLDRAFT_116394 [Branchiostoma floridae]
Length=486

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 81/150 (54%), Gaps = 22/150 (15%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            ++    LD+E+Y A Y+G  ++ RL+FIAD C    +++EALRMA   +++  N  L+++
Sbjct  35   VVESCSLDLESYAAQYTGLARLERLVFIADHC--PPLKVEALRMALHYVQRTYNVHLYQQ  92

Query  323  VVQKING-----------------RLG-PNYGPDAGWTDSVDRRAEQRKEKLENELNAYR  448
            V +K+                    LG P Y  D  W ++  ++A  + EKL+ +L  Y+
Sbjct  93   VHRKLQEAASSGVVANMPDAVAGLTLGVPPY--DTDWVETTAKKAALKLEKLDTDLKNYK  150

Query  449  TNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             N IKESIR G++D GD Y   G L  A K
Sbjct  151  GNSIKESIRRGHDDLGDHYLDCGDLSNALK  180



>ref|XP_639011.1| COP9 signalosome complex subunit 1 [Dictyostelium discoideum 
AX4]
 sp|Q54QX3.1|CSN1_DICDI RecName: Full=COP9 signalosome complex subunit 1; Short=Signalosome 
subunit 1 [Dictyostelium discoideum]
 gb|EAL65671.1| COP9 signalosome complex subunit 1 [Dictyostelium discoideum 
AX4]
 gb|ABC46693.1| COP9 signalosome complex subunit 1 [Dictyostelium discoideum]
Length=458

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 75/127 (59%), Gaps = 6/127 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E Y   YSG TKI RL+FIAD C    +++EA  MA  E++K  N +L+  ++ K 
Sbjct  29   EFDLETYINNYSGFTKIHRLIFIADNC--KQLEVEAYNMALKEVQKTPNLELYNTIINKS  86

Query  338  NGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHG  517
            +G L      D  + +++ ++   + +KLE +LN  ++N++K+SIR   ND G+FYY  G
Sbjct  87   HGILEL----DPVYIENLSKKNSLQLDKLEQDLNTAKSNMVKDSIRFAQNDLGEFYYKIG  142

Query  518  QLGEAFK  538
                A K
Sbjct  143  DHQNALK  149



>ref|XP_007289108.1| 26S proteasome subunit RPN7 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD20537.1| 26S proteasome subunit RPN7 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=465

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 74/129 (57%), Gaps = 4/129 (3%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV--VQ  331
            + D+E+Y A Y GRT++ RLLFI    ++T + +EAL++A  E KKG++   + +     
Sbjct  28   KFDLESYLANYQGRTRVERLLFIG--ASSTVLGVEALKLAIKEAKKGKDVNRYLQAQNTL  85

Query  332  KINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYA  511
            ++ G   P    D  W +   +  +    +LE EL  Y+ NLIKESIRMG+ D G  Y A
Sbjct  86   RVVGPFEPEASRDLPWVEKQGKINQAETTRLEAELKGYKNNLIKESIRMGHEDLGKHYQA  145

Query  512  HGQLGEAFK  538
             G L +AF+
Sbjct  146  IGDLHKAFE  154



>ref|XP_003746673.1| PREDICTED: COP9 signalosome complex subunit 1-like [Metaseiulus 
occidentalis]
Length=483

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 76/140 (54%), Gaps = 16/140 (11%)
 Frame = +2

Query  161  LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI-  337
             ++E Y A Y+G  K+ RLLFIADRC    M++EALR+A D +    N   ++EV +K+ 
Sbjct  43   FELEMYAAQYTGLAKLNRLLFIADRC--PPMRIEALRLALDHVMGTLNVNKYQEVFRKLC  100

Query  338  ------NGRLGPNYG-------PDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRM  478
                  N +  P+          DA W DS  ++   + EKL+N+L  Y+ N IKESIR 
Sbjct  101  DALQAANAQGVPDVADTYELPQVDAHWVDSRLKQVALKTEKLDNDLKNYKANSIKESIRR  160

Query  479  GYNDFGDFYYAHGQLGEAFK  538
            G +D G+ Y   G L  A +
Sbjct  161  GTDDLGEHYLDCGDLNNALR  180



>ref|XP_008865767.1| hypothetical protein H310_03609 [Aphanomyces invadans]
 gb|ETW05990.1| hypothetical protein H310_03609 [Aphanomyces invadans]
Length=718

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 85/167 (51%), Gaps = 18/167 (11%)
 Frame = +2

Query  92   DEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLE---  262
            D++H  G V+    +   +  E  D++ + + Y+G  +I  ++FI D   N  +  E   
Sbjct  254  DDVHFRGFVEPYIENGHAMGLEAFDLDVFASKYAGVNRIRHVMFIMDHGFNPQVVFEDDN  313

Query  263  -----------ALRMAYDEIKKGE----NTQLFREVVQKINGRLGPNYGPDAGWTDSVDR  397
                       ALR     ++  +    NT L+RE+  K    L  +Y PDA + ++  R
Sbjct  314  KRDAATQLAKNALRFLLSNLEATKATTVNTTLYRELTTKFKEFLPMDYHPDATFLENAVR  373

Query  398  RAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
                R E+LE ELN+Y+ ++IKESIR+G+ND G+FYY  G L  + +
Sbjct  374  ANASRHERLEQELNSYKCSMIKESIRIGHNDLGEFYYRTGDLANSLR  420



>dbj|GAM38706.1| hypothetical protein TCE0_033f09652 [Talaromyces cellulolyticus]
Length=470

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 75/133 (56%), Gaps = 8/133 (6%)
 Frame = +2

Query  152  GEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQ  331
              + D+E+Y A Y GRT+  RL F+  +C+ T + L+ALR+A  E K G++ + + + V+
Sbjct  36   APKFDLESYIANYKGRTRFERL-FLIGKCS-TVLSLDALRLAVAEAKSGKDVERYEQAVE  93

Query  332  KINGRLGPNYGPDAG----WTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGD  499
             +  +    + PDA     W D   +      +KLE+EL  Y+ NLIKESIRMG +D   
Sbjct  94   AL--KQAAPHDPDAVLDQRWVDVTKQTVRAETDKLEHELKGYKNNLIKESIRMGTDDLAS  151

Query  500  FYYAHGQLGEAFK  538
             Y+A G L  A K
Sbjct  152  HYHAVGDLASASK  164



>gb|KIK48588.1| hypothetical protein CY34DRAFT_798102 [Suillus luteus UH-Slu-Lm8-n1]
Length=484

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 77/146 (53%), Gaps = 12/146 (8%)
 Frame = +2

Query  131  RHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQ  310
            R RP+      D++AY + YSGRT   RL+ I   C   + Q  AL++A+ +I++  +  
Sbjct  22   RIRPVDDAHPFDLDAYISGYSGRTAFDRLVHIISTCPTLAPQ--ALKLAFAQIEELRDPT  79

Query  311  LFREVVQKING-------RLGPN---YGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLI  460
            L++ V+   +        +L P       +  W + V ++ +  + KLE EL  Y  N+I
Sbjct  80   LYQTVMNAYDAVADLPEVQLPPTSELCSVNTAWCEEVTKKNQAERTKLEVELKTYSNNMI  139

Query  461  KESIRMGYNDFGDFYYAHGQLGEAFK  538
            KESIRMG+ D GDFY A G   +A K
Sbjct  140  KESIRMGHRDLGDFYRATGDYIQALK  165



>gb|KDR21197.1| COP9 signalosome complex subunit 1 [Zootermopsis nevadensis]
Length=510

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 85/165 (52%), Gaps = 27/165 (16%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+EAY   Y+G  ++ RL++IAD C   ++++EAL+MA   +  
Sbjct  30   NDNNEEEPYIVENPSLDLEAYANSYAGLARLYRLIYIADHC--PTLRIEALKMAISYVMC  87

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG------------------------WTDSVDRRA  403
              N  L++++ +K+   +G +  PD                          W +S  ++A
Sbjct  88   TYNVSLYQQLHKKLQEAVGISNLPDVAGGGGGGSGSGVQSTSQDIPTLDLLWVESKSKKA  147

Query  404  EQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
              + EKL+ +L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  148  ALKLEKLDTDLKNYKSNSIKESIRRGHDDLGDHYLDCGDLSNALK  192



>ref|XP_003700110.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome complex subunit 
1-like [Megachile rotundata]
Length=490

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 79/155 (51%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C    +++EAL+MA   +  
Sbjct  25   NDNAEEEPYIVENPTLDLEVYANSYTGLAKLYRLIYIADHC--PMLRIEALKMAISYVMT  82

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   +G    PD                W DS  ++A  + EK + +
Sbjct  83   TYNVSLYVILHKKLVQAVGTPGLPDVAAQSTSQDMLTLDQAWVDSHSKKAALKLEKFDTD  142

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  YR+N IKESIR G++D GD Y   G L  A K
Sbjct  143  LKNYRSNSIKESIRRGHDDLGDHYLDCGDLVHALK  177



>ref|XP_007267270.1| hypothetical protein FOMMEDRAFT_87024 [Fomitiporia mediterranea 
MF3/22]
 gb|EJD01854.1| hypothetical protein FOMMEDRAFT_87024 [Fomitiporia mediterranea 
MF3/22]
Length=476

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 69/129 (53%), Gaps = 5/129 (4%)
 Frame = +2

Query  161  LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKIN  340
             D+ AY+A Y+ RT I RLL+I + C   S+  EA ++A   IK G + QL++  +   N
Sbjct  11   FDLGAYNASYNNRTAIYRLLYILELC--PSLAKEAFQLAVQRIKAGRDPQLYQNALNLYN  68

Query  341  GRL---GPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYA  511
              L         DA W + V       + KLE EL  Y +N+IKESIRM + D G+FY A
Sbjct  69   TSLPEGSEGEEVDAAWLEKVVASNTSERNKLEVELKTYTSNMIKESIRMAHRDLGNFYRA  128

Query  512  HGQLGEAFK  538
             G  G A K
Sbjct  129  TGDDGAALK  137



>gb|KFB48458.1| AGAP004953-PA-like protein [Anopheles sinensis]
Length=446

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 77/147 (52%), Gaps = 17/147 (12%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            I+    +D+E     Y+G  K+ RL+++AD C   S++LEALRMA + +    N  L++ 
Sbjct  19   IVENPSIDLELLANQYTGLAKLHRLIYVADHC--PSLRLEALRMAINYVTTTYNVTLYQH  76

Query  323  VVQKINGRLGPNYGPD---------------AGWTDSVDRRAEQRKEKLENELNAYRTNL  457
            + +K+   +   + PD               A W ++  +++  + EKL+ +L  Y+ N 
Sbjct  77   LHKKLADNVSALFLPDVTSQSGGSQEIPTFDAAWVETKSKKSALKLEKLDCDLKNYKANS  136

Query  458  IKESIRMGYNDFGDFYYAHGQLGEAFK  538
            IKESIR G++D GD Y   G L  A K
Sbjct  137  IKESIRRGHDDLGDHYLNCGDLSNALK  163



>ref|XP_008469553.1| PREDICTED: COP9 signalosome complex subunit 1b-like [Diaphorina 
citri]
Length=358

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 86/156 (55%), Gaps = 18/156 (12%)
 Frame = +2

Query  119  DDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKG  298
            D++ +   I+    LD+E+Y   Y+G  ++ RL+++AD C   +++ EALRMA   + + 
Sbjct  131  DNNEQEMIIVKKLPLDLESYANSYTGLARLFRLIYVADHC--PALRHEALRMAIQYVMQT  188

Query  299  ENTQLFREVVQKIN--------------GRLGPNYGP--DAGWTDSVDRRAEQRKEKLEN  430
             N  L+ ++ +K++              G +GP   P  D    ++ +++A  + EKL+N
Sbjct  189  YNVNLYIQLHRKLSESLSTGALPDVASSGNMGPQDIPTLDPLLIETKNKKAAMKLEKLDN  248

Query  431  ELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            +L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  249  DLKNYKSNSIKESIRRGHDDLGDHYLDCGDLSNALK  284



>gb|KDN34252.1| hypothetical protein RSAG8_12661, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=242

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 86/166 (52%), Gaps = 13/166 (8%)
 Frame = +2

Query  71   DQFGSMMDEIHSNGGVDDSSR-----HRPIISGEQ--LDIEAYDALYSGRTKIMRLLFIA  229
            D +G M + + SNGG   S        R II  +Q   D++ Y + Y G+  I RL F+A
Sbjct  10   DAYGDM-EGVVSNGGPSTSVEAQKPVKRNIIVDDQHPFDLDLYISSYKGQAAIKRLRFVA  68

Query  230  DRCNNTSMQLEALRMAYDEIKKGE-NTQLFREVVQKING--RLGPNYGPDAGWTDSVDRR  400
               N+T++Q +ALR+A +++K    +  L+ ++V + N    +      D  W   V   
Sbjct  69   --ANSTTLQADALRLAIEQVKAANIDVNLYHQLVTEYNALPSVHKQITLDQDWMTKVKAA  126

Query  401  AEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             +   ++L+ EL  Y TNLIKES RM Y D G+FY + G  G A K
Sbjct  127  KDAEGDRLQVELKTYTTNLIKESTRMAYRDLGNFYRSLGDTGNALK  172



>ref|XP_006300166.1| hypothetical protein CARUB_v10016397mg [Capsella rubella]
 gb|EOA33064.1| hypothetical protein CARUB_v10016397mg [Capsella rubella]
Length=281

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +2

Query  149  SGEQLDIEAYDALYSGRTKIMRLLFIADRCN-NTSMQLEALRMAYDEIKKGENTQLFREV  325
            S E L IEAY ALY GRTKIMRLLF A+ C  N ++QLEALR AYDEIKKGENT LFR+V
Sbjct  19   SEELLYIEAYAALYRGRTKIMRLLFFANHCEENRTVQLEALRRAYDEIKKGENTYLFRDV  78

Query  326  V  328
            V
Sbjct  79   V  79



>emb|CCA73886.1| related to COP9 signalosome complex subunit 1 [Piriformospora 
indica DSM 11827]
Length=477

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 71/129 (55%), Gaps = 5/129 (4%)
 Frame = +2

Query  161  LDIEAYDALY-SGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
             D+EAY + Y   R  I RL FIA+ C    +   AL  A +   +G+++ L++ VV   
Sbjct  45   FDLEAYISNYDHDRASIKRLFFIANAC--PQLAPLALSRAVEYALEGKDSTLYQNVVSTY  102

Query  338  NGRLGPNYGPDAG--WTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYA  511
            N  +GP +G      W D   +R+   ++KLE EL  Y  N+IKESIRMG+N+ G FY A
Sbjct  103  NNIVGPQHGVQLNQEWLDRTAQRSHAERDKLEVELKMYTGNMIKESIRMGHNELGHFYRA  162

Query  512  HGQLGEAFK  538
            HG    A +
Sbjct  163  HGDHATALR  171



>gb|ENN72798.1| hypothetical protein YQE_10602, partial [Dendroctonus ponderosae]
Length=503

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 94/181 (52%), Gaps = 20/181 (11%)
 Frame = +2

Query  50   NFMEAEDDQ-FGSMMDEIHSNGGVDDSSRHRP---IISGEQLDIEAYDALYSGRTKIMRL  217
            NF+ A +   FG+ ++ +  +   +D+  +     ++    +D+EAY   Y+G  K+ RL
Sbjct  4    NFLGAVNRMLFGNAVEPMQVDAPPEDNDNNEDTFFVVENPSIDLEAYANSYTGLAKLYRL  63

Query  218  LFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAG-------  376
            +FI D C   S++LEAL++A   +    N  L++ + Q++  +      PD         
Sbjct  64   IFIVDHC--PSLRLEALKIAIAYVMNTYNVNLYQVLHQRLADQNTNANVPDVAAPSPWQG  121

Query  377  -------WTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAF  535
                   W +++ +++  + EKL+N+L  YR+N IKESIR G++D GD Y   G L  A 
Sbjct  122  IPAVDNLWIETMLKKSALKLEKLDNDLKNYRSNSIKESIRRGHDDLGDHYLNSGDLSNAL  181

Query  536  K  538
            K
Sbjct  182  K  182



>gb|ELU09497.1| hypothetical protein CAPTEDRAFT_174845 [Capitella teleta]
Length=469

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 78/147 (53%), Gaps = 17/147 (12%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            ++    LD+E Y   Y G  K+ RLLF+A+ C    +++EALRMA   +    N+ +++E
Sbjct  19   LVENTNLDLETYAGSYRGLAKLHRLLFVAEHC--PPLRVEALRMALSHVMTTYNSNMYQE  76

Query  323  VVQK----INGR--LGPNY---------GPDAGWTDSVDRRAEQRKEKLENELNAYRTNL  457
            + +     I GR  + P+            D  W +S  ++A  + EKL+ +L  Y++N 
Sbjct  77   IHKSLQDAITGRQSILPDTLVGIVHNVPSLDTQWIESTAKKAALKLEKLDTDLKNYKSNS  136

Query  458  IKESIRMGYNDFGDFYYAHGQLGEAFK  538
            IKESIR G++D GD Y   G L  A K
Sbjct  137  IKESIRRGHDDLGDHYLDCGDLSNALK  163



>gb|KIN06127.1| hypothetical protein OIDMADRAFT_38484 [Oidiodendron maius Zn]
Length=460

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 79/142 (56%), Gaps = 7/142 (5%)
 Frame = +2

Query  128  SRHRPIISGEQ---LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKG  298
            ++  P+++  +    D+E+Y   Y GRTK+ RLL I    ++T +  EAL+ A +E K G
Sbjct  16   TKKSPLVTASEPPKFDLESYVQNYQGRTKLERLLHIG--ASSTFLGAEALKSAVNEAKAG  73

Query  299  ENTQLFREV--VQKINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESI  472
            ++ +L+ E   + ++     P    D  W  +VDR  +    +LE EL  Y+ NLIKESI
Sbjct  74   KDIRLYAEAWSLLEVIAPSEPEAVRDDAWISTVDRHNQAETARLEAELKGYKNNLIKESI  133

Query  473  RMGYNDFGDFYYAHGQLGEAFK  538
            RMG  D G  Y + G L +AF+
Sbjct  134  RMGNEDLGKHYQSIGDLPKAFE  155



>ref|XP_002483342.1| COP9 signalosome subunit 1 (CsnA), putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED16108.1| COP9 signalosome subunit 1 (CsnA), putative [Talaromyces stipitatus 
ATCC 10500]
Length=471

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 94/173 (54%), Gaps = 14/173 (8%)
 Frame = +2

Query  32   SKSVSLNFMEAEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIM  211
            S S+ L   +A D   G   + I ++G   + + +  +    + D+E+Y A Y GRT+  
Sbjct  2    SSSIKLVSSKASDGYIG---ENIQADG---NENTYIKVDEAPKFDLESYIANYKGRTRFD  55

Query  212  RLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDAG----W  379
            RL F+  +C+ T +  +ALR+A  E K G++ + + + VQ ++ ++ PN  PDA     W
Sbjct  56   RL-FLIGKCS-TILSADALRLAVGEAKSGKDVERYVQAVQALS-QVAPN-DPDAVLDQRW  111

Query  380  TDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             D   +      +KLE+EL  Y+ NLIKESIRMG +D    Y++ G L  A K
Sbjct  112  VDITRQAVRAETDKLEHELKGYKNNLIKESIRMGTDDLASHYHSIGDLAAASK  164



>gb|KIP03274.1| hypothetical protein PHLGIDRAFT_77841 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=495

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 82/163 (50%), Gaps = 17/163 (10%)
 Frame = +2

Query  89   MDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEAL  268
            +D++H+       SR  PI      D + Y ++YSGR  + RLLF+  +C   S+ ++A 
Sbjct  3    IDDVHTTRTQASHSRVLPIDENHPFDFDQYTSIYSGRGLVERLLFLIPQC--PSLAVQAT  60

Query  269  RMAYDEIKKGENTQLFREVVQKINGRLGPNYGPDA-------------GWTDSVDRRAEQ  409
            ++A   +K   +T L++ ++   +   G    PDA              W + V+RR ++
Sbjct  61   QLAMKHLKTMRDTFLYQRLLTAYDQASG--NSPDAPLPPVNDVINIDPAWIEDVNRRNQE  118

Query  410  RKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             + KLE EL  Y +N+IKESIRM + D  + Y A G    A K
Sbjct  119  DRTKLEVELKTYSSNMIKESIRMAHRDLAEHYRAVGDYQSALK  161



>ref|XP_315051.4| AGAP004953-PA [Anopheles gambiae str. PEST]
 gb|EAA10359.4| AGAP004953-PA [Anopheles gambiae str. PEST]
Length=486

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 77/147 (52%), Gaps = 17/147 (12%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            I+    +D+E     Y+G  K+ RL+++AD C   +++LEALRMA + +    N  L++ 
Sbjct  32   IVENPSIDLEQLANQYTGLAKLHRLIYVADHC--PTLRLEALRMAINYVTTTYNVTLYQH  89

Query  323  VVQKINGRLGPNYGPD---------------AGWTDSVDRRAEQRKEKLENELNAYRTNL  457
            + +K+   +   + PD               A W +S  +++  + EKL+ +L  Y+ N 
Sbjct  90   LHKKLADNVSTLFLPDVASQSTGSQEIPSFDATWVESKSKKSALKLEKLDCDLKNYKANS  149

Query  458  IKESIRMGYNDFGDFYYAHGQLGEAFK  538
            IKESIR G++D GD Y   G L  A K
Sbjct  150  IKESIRRGHDDLGDHYLNCGDLSNALK  176



>ref|XP_007281056.1| cop9 signalosome subunit 1 [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ELA29914.1| cop9 signalosome subunit 1 [Colletotrichum gloeosporioides Nara 
gc5]
Length=466

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 72/131 (55%), Gaps = 7/131 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            +LD++ Y   Y+GRT+  RL  I   C    + ++AL+ A  E K+G++ Q +RE  + I
Sbjct  32   KLDLDLYIQNYTGRTRFERLFLIGRTC--VPLCVDALKAAVAEAKQGQDVQRYREAFEHI  89

Query  338  N--GRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYA  511
            +      P    D  W D+ DR  + +   LENEL  Y+ NLIKESIRMG  D G  + A
Sbjct  90   HIAAPSEPEAVFDQEWVDNTDRANKAKTHNLENELKGYKMNLIKESIRMGNEDLGRHFEA  149

Query  512  HGQL---GEAF  535
             G L   GEA+
Sbjct  150  TGDLNSAGEAY  160



>ref|XP_007601931.1| 26S proteasome subunit RPN7 [Colletotrichum fioriniae PJ7]
 gb|EXF74426.1| 26S proteasome subunit RPN7 [Colletotrichum fioriniae PJ7]
Length=471

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 73/131 (56%), Gaps = 7/131 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQ--  331
            +LD++ Y   Y+GRT+  RL  I   C    + ++AL+ A  E KKG++TQ +R+VV+  
Sbjct  35   KLDLDLYIQNYTGRTRFERLFLIGRTC--VPLCVDALKAAVAEAKKGQDTQRYRDVVELI  92

Query  332  KINGRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYA  511
            ++   L P    D  W +  +R    +   LE EL  Y+ NLIKESIRMG  D G  + +
Sbjct  93   QVAAPLEPEATFDQSWVELTERANNTKTHALEGELKGYKMNLIKESIRMGNEDLGRHFES  152

Query  512  HGQL---GEAF  535
             G L   GEA+
Sbjct  153  IGDLNSAGEAY  163



>gb|EQB45604.1| 26S proteasome subunit RPN7 [Colletotrichum gloeosporioides Cg-14]
Length=466

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 72/131 (55%), Gaps = 7/131 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            +LD++ Y   Y+GRT+  RL  I   C    + ++AL+ A  E K+G++ Q +RE  + I
Sbjct  32   KLDLDLYIQNYTGRTRFERLFLIGRTC--VPLCVDALKAAVAEAKQGQDIQRYREAFEHI  89

Query  338  N--GRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYA  511
            +      P    D  W D+ DR  + +   LENEL  Y+ NLIKESIRMG  D G  + A
Sbjct  90   HIAAPSEPEAVFDQEWVDNTDRANKAKTHNLENELKGYKMNLIKESIRMGNEDLGRHFEA  149

Query  512  HGQL---GEAF  535
             G L   GEA+
Sbjct  150  TGDLNSAGEAY  160



>ref|XP_005704355.1| COP9 signalosome complex subunit 1 [Galdieria sulphuraria]
 gb|EME27835.1| COP9 signalosome complex subunit 1 [Galdieria sulphuraria]
Length=435

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 75/126 (60%), Gaps = 4/126 (3%)
 Frame = +2

Query  164  DIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIK-KGENTQLFREVVQKIN  340
            D++ Y + Y GR KI+RLL IA   ++  ++ EAL +A DE K +  + QL++ +++K+ 
Sbjct  8    DLDTYASRYYGRGKILRLLHIAS--HSVQLRKEALLLALDETKAETRDVQLYKRLLEKLK  65

Query  341  GRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQ  520
                 +   D  W  +V R   +  E+LE EL  YR N+IK+SIRM Y D GDF Y+ G 
Sbjct  66   ETGQVSILQDE-WETTVVREDSKEVERLETELQRYRHNMIKDSIRMAYGDLGDFQYSKGN  124

Query  521  LGEAFK  538
            L EA +
Sbjct  125  LEEALR  130



>gb|KIN98194.1| hypothetical protein M404DRAFT_859808 [Pisolithus tinctorius 
Marx 270]
Length=520

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 73/151 (48%), Gaps = 16/151 (11%)
 Frame = +2

Query  128  SRHRPIIS---GEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKG  298
            SR RP+ +       D++AY A Y+GRT I RL+ I   C   S+   AL +A+  + + 
Sbjct  12   SRRRPVFTIDDDHPFDLDAYIAPYTGRTVIDRLIAIIVHCP--SIAPHALTLAFQHLHRL  69

Query  299  ENTQLFREVVQKINGRLGPNYGP-----------DAGWTDSVDRRAEQRKEKLENELNAY  445
             +  L   V+      LG   G            D  W + V +R    + KLE EL  Y
Sbjct  70   RDPSLVNTVIGAYENVLGTQEGKGLPPVADVVSVDVEWVEEVTKRNVAERTKLEVELKTY  129

Query  446  RTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
              N+IKESIRM + D GDF+ + G+ G A K
Sbjct  130  TNNMIKESIRMAHRDLGDFFRSTGEFGLALK  160



>ref|XP_011337550.1| PREDICTED: COP9 signalosome complex subunit 1 isoform X2 [Cerapachys 
biroi]
Length=483

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 80/155 (52%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P ++    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  25   NDNAEEEPYVVENPTLDLEVYANSYTGLAKLYRLIYIADHC--PSLRIEALKMAIAYVMT  82

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   +G    PD                W ++  ++A  + EK + +
Sbjct  83   TYNVSLYIALHKKLVQAMGTPGLPDVAAQSTSQDVLTMDQTWVETRSKKAALKLEKFDTD  142

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  143  LKNYKSNSIKESIRRGHDDLGDHYLNCGDLVHALK  177



>ref|XP_011337549.1| PREDICTED: COP9 signalosome complex subunit 1 isoform X1 [Cerapachys 
biroi]
 gb|EZA54973.1| COP9 signalosome complex subunit [Cerapachys biroi]
Length=485

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 80/155 (52%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P ++    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  25   NDNAEEEPYVVENPTLDLEVYANSYTGLAKLYRLIYIADHC--PSLRIEALKMAIAYVMT  82

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   +G    PD                W ++  ++A  + EK + +
Sbjct  83   TYNVSLYIALHKKLVQAMGTPGLPDVAAQSTSQDVLTMDQTWVETRSKKAALKLEKFDTD  142

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  143  LKNYKSNSIKESIRRGHDDLGDHYLNCGDLVHALK  177



>gb|ETN67188.1| G protein pathway suppressor 1 [Anopheles darlingi]
Length=461

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 77/147 (52%), Gaps = 17/147 (12%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            I+    +D+E     Y+G  K+ RL++IA+ C    ++LEALRMA + +    N  L++ 
Sbjct  32   IVENPSIDLEQLANQYTGLAKLHRLIYIAEHC--PGLRLEALRMAINYVTTTYNVTLYQH  89

Query  323  VVQKINGRLGPNYGPD---------------AGWTDSVDRRAEQRKEKLENELNAYRTNL  457
            + +K+   +G  + PD               A W ++  +++  + EKL+ +L  Y+ N 
Sbjct  90   LHKKLAESVGALFLPDVASQPSGSQEIPTFDAAWVETKSKKSALKLEKLDCDLKNYKANS  149

Query  458  IKESIRMGYNDFGDFYYAHGQLGEAFK  538
            IKESIR G++D GD Y   G L  A K
Sbjct  150  IKESIRRGHDDLGDHYLNCGDLSNALK  176



>gb|ESZ92994.1| hypothetical protein SBOR_6615 [Sclerotinia borealis F-4157]
Length=495

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 82/152 (54%), Gaps = 6/152 (4%)
 Frame = +2

Query  89   MDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEAL  268
            ++ I S+  V  S +   +    + D+E+Y A Y GRT++ RL  I     +T + ++AL
Sbjct  49   LEAIMSSIYVPVSRKAHVVTDPPKFDLESYIANYKGRTRLERLYLIG--VTSTFLGVDAL  106

Query  269  RMAYDEIKKGENTQLFREVVQKINGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENELN  439
            +M   E K+G++  ++ +    +  ++ P+      D  WTD+ ++       +LE +L 
Sbjct  107  KMLIKEAKQGKDVTIYMDAWAALT-KIAPDEPEVFRDDKWTDATNKANAAEAARLETQLK  165

Query  440  AYRTNLIKESIRMGYNDFGDFYYAHGQLGEAF  535
             Y+ NLIKESIRMG  D G  Y A GQLG AF
Sbjct  166  GYKNNLIKESIRMGNEDLGKHYEATGQLGFAF  197



>ref|XP_011252985.1| PREDICTED: COP9 signalosome complex subunit 1 [Camponotus floridanus]
Length=484

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 80/155 (52%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  25   NDNAEEEPYIVENPTLDLEVYANSYTGLAKLHRLVYIADHC--PSLRIEALKMAITYVMT  82

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   +G    PD                W ++  ++A  + EK + +
Sbjct  83   TYNVSLYIMLHKKLVEAMGTPGLPDVAAQSTSQDVLTMDQTWVETRSKKAALKLEKFDTD  142

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  143  LKNYKSNSIKESIRRGHDDLGDHYLNCGDLVHALK  177



>emb|CCX10685.1| Similar to COP9 signalosome complex subunit 1; acc. no. Q5BD89 
[Pyronema omphalodes CBS 100304]
Length=477

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 75/136 (55%), Gaps = 7/136 (5%)
 Frame = +2

Query  143  IISG-EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFR  319
            +++G    D+E Y + YSGRT++ RLL I    ++  + +EAL+ A   +K  ++   ++
Sbjct  21   VVTGTPHFDLETYISNYSGRTQVDRLLHIGQ--HSVPLSVEALKFAIKYLKNSQDVHKYK  78

Query  320  EVVQKINGRLGPN---YGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYND  490
            + +  +  ++ PN      DA W      + E     +E  L +Y+ NLIKESIRMG++D
Sbjct  79   QAITLLK-KIAPNDPDAKVDADWVSRTAHKVETETATMEAALKSYKHNLIKESIRMGHDD  137

Query  491  FGDFYYAHGQLGEAFK  538
             G  YYA G +  AFK
Sbjct  138  LGGHYYACGDMQNAFK  153



>ref|XP_011146522.1| PREDICTED: COP9 signalosome complex subunit 1 isoform X3 [Harpegnathos 
saltator]
 gb|EFN79800.1| COP9 signalosome complex subunit 1 [Harpegnathos saltator]
Length=484

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 80/155 (52%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  25   NDNAEEEPYIVENPTLDLEVYANSYTGLAKLYRLIYIADHC--PSLRIEALKMAITYVMT  82

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   +G    PD                W ++  ++A  + EK + +
Sbjct  83   TYNVSLYVILHKKLLQAVGTPGLPDVAAQSTSQDLLTMDQTWVETRSKKAALKLEKFDTD  142

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  143  LKNYKSNSIKESIRRGHDDLGDHYLNCGDLVHALK  177



>ref|XP_011146521.1| PREDICTED: COP9 signalosome complex subunit 1 isoform X2 [Harpegnathos 
saltator]
Length=494

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 80/155 (52%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  35   NDNAEEEPYIVENPTLDLEVYANSYTGLAKLYRLIYIADHC--PSLRIEALKMAITYVMT  92

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   +G    PD                W ++  ++A  + EK + +
Sbjct  93   TYNVSLYVILHKKLLQAVGTPGLPDVAAQSTSQDLLTMDQTWVETRSKKAALKLEKFDTD  152

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  153  LKNYKSNSIKESIRRGHDDLGDHYLNCGDLVHALK  187



>ref|XP_011146519.1| PREDICTED: COP9 signalosome complex subunit 1 isoform X1 [Harpegnathos 
saltator]
 ref|XP_011146520.1| PREDICTED: COP9 signalosome complex subunit 1 isoform X1 [Harpegnathos 
saltator]
Length=509

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 80/155 (52%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  50   NDNAEEEPYIVENPTLDLEVYANSYTGLAKLYRLIYIADHC--PSLRIEALKMAITYVMT  107

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   +G    PD                W ++  ++A  + EK + +
Sbjct  108  TYNVSLYVILHKKLLQAVGTPGLPDVAAQSTSQDLLTMDQTWVETRSKKAALKLEKFDTD  167

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  168  LKNYKSNSIKESIRRGHDDLGDHYLNCGDLVHALK  202



>ref|XP_007706832.1| hypothetical protein COCCADRAFT_567 [Bipolaris zeicola 26-R-13]
 gb|EUC38849.1| hypothetical protein COCCADRAFT_567 [Bipolaris zeicola 26-R-13]
Length=468

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 73/130 (56%), Gaps = 6/130 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y A Y+G T+I RL  I    ++  + ++A RMA  E KKG+N  L+  +V+  
Sbjct  27   KFDLESYIANYTGYTRIDRLHHIG--AHSPYLAVDAYRMAIAETKKGKNVALYTRLVEDF  84

Query  338  NGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
            +  + PN      D  W +   R   +  ++LE+EL +Y+ NLIKESIRMG  D G FYY
Sbjct  85   SS-IAPNDSAALVDTTWAEKKTREVREEHDRLEHELKSYKNNLIKESIRMGNEDLGHFYY  143

Query  509  AHGQLGEAFK  538
              G    A K
Sbjct  144  DIGDFSNAQK  153



>gb|EUN27903.1| hypothetical protein COCVIDRAFT_97010 [Bipolaris victoriae FI3]
Length=468

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 73/130 (56%), Gaps = 6/130 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y A Y+G T+I RL  I    ++  + ++A RMA  E KKG+N  L+  +V+  
Sbjct  27   KFDLESYIANYTGYTRIDRLHHIG--AHSPYLAVDAYRMAIAETKKGKNVALYTRLVEDF  84

Query  338  NGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
            +  + PN      D  W +   R   +  ++LE+EL +Y+ NLIKESIRMG  D G FYY
Sbjct  85   SS-IAPNDSAALVDTTWAEKKTREVREEHDRLEHELKSYKNNLIKESIRMGNEDLGHFYY  143

Query  509  AHGQLGEAFK  538
              G    A K
Sbjct  144  DIGDFSNAQK  153



>ref|XP_003031510.1| hypothetical protein SCHCODRAFT_77341 [Schizophyllum commune 
H4-8]
 gb|EFI96607.1| hypothetical protein SCHCODRAFT_77341 [Schizophyllum commune 
H4-8]
Length=496

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 73/146 (50%), Gaps = 15/146 (10%)
 Frame = +2

Query  140  PIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFR  319
            P+      D+E+Y + Y+GRT I RL+ I   C   ++  EA + A + + +  + QL++
Sbjct  20   PVDDAHPFDLESYISNYTGRTAIFRLIHIISHC--PTLAPEAYKAAVEHVYQSRDPQLYQ  77

Query  320  EVV---QKINGRLGPNYGP----------DAGWTDSVDRRAEQRKEKLENELNAYRTNLI  460
            +V+   + +    G    P          D  W D  + R    + KLE EL +Y  N+I
Sbjct  78   QVLSAYETVAASAGTPDAPFPKPEDIMPLDPKWIDETNARNANERVKLEVELKSYTNNMI  137

Query  461  KESIRMGYNDFGDFYYAHGQLGEAFK  538
            KESIRMG+ D G+FY A G    A K
Sbjct  138  KESIRMGHRDLGNFYRAVGDPATALK  163



>gb|EQL36724.1| hypothetical protein BDFG_01694 [Blastomyces dermatitidis ATCC 
26199]
Length=513

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 73/130 (56%), Gaps = 6/130 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y + YSGRTK  RL  I   C+ T + +EAL+MA  + K G++   + + V+ +
Sbjct  52   KFDLESYISNYSGRTKFARLYLIG-ACS-TFLSVEALKMAVADAKGGKDVNSYTDAVEAL  109

Query  338  NGRLGPN---YGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
              R+ P       DA W D   +  +   ++LE+EL  Y+ NLIKESIRMG  D G  Y+
Sbjct  110  -ARVAPQDPEAKLDAAWVDHTSKVVKAETDRLEHELKGYKNNLIKESIRMGNEDLGHHYH  168

Query  509  AHGQLGEAFK  538
              G L  A K
Sbjct  169  RIGDLPNASK  178



>gb|EGE83463.1| COP9 signalosome subunit 1 [Blastomyces dermatitidis ATCC 18188]
Length=513

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 73/130 (56%), Gaps = 6/130 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y + YSGRTK  RL  I   C+ T + +EAL+MA  + K G++   + + V+ +
Sbjct  52   KFDLESYISNYSGRTKFARLYLIG-ACS-TFLSVEALKMAVADAKGGKDVNSYTDAVEAL  109

Query  338  NGRLGPN---YGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
              R+ P       DA W D   +  +   ++LE+EL  Y+ NLIKESIRMG  D G  Y+
Sbjct  110  -ARVAPQDPEAKLDAAWVDHTSKVVKAETDRLEHELKGYKNNLIKESIRMGNEDLGHHYH  168

Query  509  AHGQLGEAFK  538
              G L  A K
Sbjct  169  RIGDLPNASK  178



>ref|XP_001861384.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS35568.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=237

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 78/146 (53%), Gaps = 17/146 (12%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            ++    LD+E  +  Y+G  K+ RL++IAD C   +++LE+L+MA + +    N  L++ 
Sbjct  32   VVENPSLDLEVANQ-YTGLAKLHRLIYIADHC--PALRLESLKMAINYVTTTYNVTLYQH  88

Query  323  VVQKINGRLGPNYGPD--------------AGWTDSVDRRAEQRKEKLENELNAYRTNLI  460
            + +K+    G +  PD              + W ++  +++  + EKL+ +L  Y+ N I
Sbjct  89   LHKKLADLSGGSTLPDVAAQSSSQDVPSFDSAWVETKSKKSALKLEKLDCDLKNYKANSI  148

Query  461  KESIRMGYNDFGDFYYAHGQLGEAFK  538
            KESIR G++D GD Y   G L  A K
Sbjct  149  KESIRRGHDDLGDHYLNCGDLSNALK  174



>gb|KFZ12912.1| hypothetical protein V502_06860 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=467

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 75/130 (58%), Gaps = 6/130 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            +LD+E Y   Y+G TK  RLLFI    ++T ++ EAL+ A  E KKG N   +    Q+ 
Sbjct  21   KLDLETYIQNYTGTTKFERLLFIG--LHSTVLRAEALKAAVAEAKKGRNVAHYN-AAQEA  77

Query  338  NGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
              R+ P+      DA W  S++++ +    +LE EL  Y+ NLIKESIR+G  D G FY 
Sbjct  78   YSRVAPDEPEAQHDAQWATSMEKQNKVEGARLEAELKGYKNNLIKESIRIGNEDCGKFYQ  137

Query  509  AHGQLGEAFK  538
            + G L +A++
Sbjct  138  SIGNLQKAYE  147



>ref|XP_007689963.1| hypothetical protein COCMIDRAFT_7059 [Bipolaris oryzae ATCC 44560]
 gb|EUC43498.1| hypothetical protein COCMIDRAFT_7059 [Bipolaris oryzae ATCC 44560]
Length=468

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 73/130 (56%), Gaps = 6/130 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y A Y+G T+I RL  I    ++  + ++A R+A  E KKG+N  L+  +V+  
Sbjct  27   KFDLESYIANYTGYTRIDRLHHIG--AHSPYLAVDAYRLAIAETKKGKNVALYTRLVEDF  84

Query  338  NGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
            +  + PN      D  W +   R   +  ++LE+EL +Y+ NLIKESIRMG  D G FYY
Sbjct  85   SS-IAPNDSAALMDTAWAEKKTREVREEHDRLEHELKSYKNNLIKESIRMGNEDLGHFYY  143

Query  509  AHGQLGEAFK  538
              G    A K
Sbjct  144  DIGDFSNAQK  153



>gb|ELR06053.1| hypothetical protein GMDG_07764 [Pseudogymnoascus destructans 
20631-21]
Length=466

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 6/130 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            +LD+E+Y   Y+G TK  RLLFI    ++T ++ EAL+ A  E KKG N   +  V Q+ 
Sbjct  20   KLDLESYIQNYTGTTKFERLLFIG--LHSTVLRAEALKAAVAEAKKGRNVAHYN-VAQEA  76

Query  338  NGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
               + P+      DA W  S++++ +    +LE EL  Y+ NLIKESIR+G  D G FY 
Sbjct  77   YSHVAPDEPEAQHDAQWVASMEKQNKVDGARLEAELKGYKNNLIKESIRIGNEDCGKFYQ  136

Query  509  AHGQLGEAFK  538
            + G L +A++
Sbjct  137  STGNLQKAYE  146



>ref|XP_003492343.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome complex subunit 
1-like [Bombus impatiens]
Length=487

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 79/155 (51%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C    +++EAL+MA   +  
Sbjct  25   NDNAEEEPYIVENPTLDLEVYANSYNGLAKLYRLIYIADHC--PMLRIEALKMAISYVMT  82

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   +G    PD                W ++  ++A  + EK + +
Sbjct  83   TYNVSLYVILHKKLVQAVGTPGLPDVAAQSTSQDMLTLDQAWVETRSKKAALKLEKFDTD  142

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  YR+N IKESIR G++D GD Y   G L  A K
Sbjct  143  LKNYRSNSIKESIRRGHDDLGDHYLDCGDLVHALK  177



>ref|XP_003397875.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome complex subunit 
1-like [Bombus terrestris]
Length=487

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 80/155 (52%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C    +++EAL+MA   +  
Sbjct  25   NDNAEEEPYIVENPTLDLEVYANSYNGLAKLYRLIYIADHC--PMLRIEALKMAISYVMT  82

Query  296  GENTQLF----REVVQKINGRLGPNYGP----------DAGWTDSVDRRAEQRKEKLENE  433
              N  L+    +++VQ +     P+             D  W ++  ++A  + EK + +
Sbjct  83   TYNVSLYIILHKKLVQAVGTPGLPDVAAQSTSQDMLTLDQAWVETRSKKAALKLEKFDTD  142

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  YR+N IKESIR G++D GD Y   G L  A K
Sbjct  143  LKNYRSNSIKESIRRGHDDLGDHYLDCGDLVHALK  177



>gb|EFN70555.1| COP9 signalosome complex subunit 1b [Camponotus floridanus]
Length=635

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 80/155 (52%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  176  NDNAEEEPYIVENPTLDLEVYANSYTGLAKLHRLVYIADHC--PSLRIEALKMAITYVMT  233

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   +G    PD                W ++  ++A  + EK + +
Sbjct  234  TYNVSLYIMLHKKLVEAMGTPGLPDVAAQSTSQDVLTMDQTWVETRSKKAALKLEKFDTD  293

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  294  LKNYKSNSIKESIRRGHDDLGDHYLNCGDLVHALK  328



>ref|XP_007698377.1| hypothetical protein COCSADRAFT_35685 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD65648.1| hypothetical protein COCSADRAFT_35685 [Bipolaris sorokiniana 
ND90Pr]
Length=468

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 73/130 (56%), Gaps = 6/130 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y A Y+G T+I RL  I    ++  + ++A R+A  E KKG+N  L+  +V+  
Sbjct  27   KFDLESYIANYTGYTRIDRLHHIG--AHSPYLAVDAYRLAIAETKKGKNVALYTRLVEDF  84

Query  338  NGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
            +  + PN      D  W +   R   +  ++LE+EL +Y+ NLIKESIRMG  D G FYY
Sbjct  85   SS-IAPNDSAALVDTTWAEKKTREVREEHDRLEHELKSYKNNLIKESIRMGNEDLGHFYY  143

Query  509  AHGQLGEAFK  538
              G    A K
Sbjct  144  DIGDFSNAQK  153



>ref|XP_003305532.1| hypothetical protein PTT_18397 [Pyrenophora teres f. teres 0-1]
 gb|EFQ86389.1| hypothetical protein PTT_18397 [Pyrenophora teres f. teres 0-1]
Length=470

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 73/129 (57%), Gaps = 4/129 (3%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y A YSG T+I RL  I    ++  + ++A R+A  E K+G+N  L+  +V+++
Sbjct  27   KFDLESYIANYSGYTRIDRLHHIG--AHSPYLAVDAYRLAIAEAKRGKNVDLYTALVEEL  84

Query  338  N--GRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYA  511
            +      P    D  W +   R   +  ++LE+EL +Y+ NLIKESIRMG  D G FYY 
Sbjct  85   SNIAPKDPAALIDTAWVEKKSREVREEHDRLEHELKSYKNNLIKESIRMGNEDLGHFYYD  144

Query  512  HGQLGEAFK  538
             G    A K
Sbjct  145  TGDFPNAQK  153



>ref|XP_001937413.1| COP9 signalosome subunit 1 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU50000.1| COP9 signalosome subunit 1 [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=472

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 72/129 (56%), Gaps = 4/129 (3%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y A YSG T+I RL  I    ++T + ++A R+A  E K+G+N  L+  +  ++
Sbjct  29   KFDLESYIANYSGYTRIDRLHHIG--AHSTYLAVDAYRLAIAEAKRGKNVDLYTTLADEL  86

Query  338  N--GRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYA  511
            +      P    D  W +   R   +  ++LE+EL +Y+ NLIKESIRMG  D G FYY 
Sbjct  87   SNIAPKDPAAHIDTAWAEKKSREVREEHDRLEHELKSYKNNLIKESIRMGNEDLGHFYYD  146

Query  512  HGQLGEAFK  538
             G    A K
Sbjct  147  TGDFPNAQK  155



>gb|KFY85144.1| hypothetical protein V500_08674 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=917

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            +    +LD+E Y   Y+G TK  RLLFI    ++T ++ EAL+ A  E KKG N   +  
Sbjct  16   VTEPPKLDLETYIQNYTGTTKFERLLFIG--LHSTVLRTEALKAAVAEAKKGRNVAHYN-  72

Query  323  VVQKINGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDF  493
              Q+   R+ P+      DA W  S++++ +    +LE EL  Y+ NLIKESIR+G  D 
Sbjct  73   AAQEAYSRVAPDEPEAQHDAQWVTSMEKQNKVEGARLEAELKGYKNNLIKESIRIGNEDC  132

Query  494  GDFYYAHGQLGEAFK  538
            G FY + G L +A++
Sbjct  133  GKFYQSIGNLQKAYE  147



>ref|XP_008076949.1| Winged helix DNA-binding protein [Glarea lozoyensis ATCC 20868]
 gb|EPE36131.1| Winged helix DNA-binding protein [Glarea lozoyensis ATCC 20868]
Length=465

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 75/129 (58%), Gaps = 4/129 (3%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y   Y GRT++ RL++I     +T + +EAL++A  E K G++ + + E    +
Sbjct  28   KFDLESYIQNYQGRTRLDRLIYIG--VCSTFLGVEALKLAVREAKAGKDIRKYFEAQAHL  85

Query  338  N--GRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYA  511
               G   P    D  W D V ++ +   ++LE EL  Y+ NL+KESIRMG  D G  Y+A
Sbjct  86   ETIGPEEPEAVRDKSWIDRVSKQNDAETKRLEEELKGYKNNLVKESIRMGNEDLGKHYHA  145

Query  512  HGQLGEAFK  538
             G+L +AF+
Sbjct  146  IGELPKAFE  154



>emb|CEL53360.1| COP9 signalosome complex subunit 1 OS=Arabidopsis thaliana GN=CSN1 
PE=1 SV=2 [Rhizoctonia solani AG-1 IB]
Length=488

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 86/171 (50%), Gaps = 12/171 (7%)
 Frame = +2

Query  56   MEAEDDQFGSMMDEIHSNGGVDDSSR-----HRPIISGEQ--LDIEAYDALYSGRTKIMR  214
            ME     +   M+ I SN G   S+       R I   +Q   D+E + + Y G+  I R
Sbjct  1    MEVPYSDYQDEMEGIVSNPGPSASTEAQKPVKRNITVDDQHPFDLELFISSYKGQAAIKR  60

Query  215  LLFIADRCNNTSMQLEALRMAYDEIKKGE-NTQLFREVVQKING--RLGPNYGPDAGWTD  385
            L FIA   ++T++Q +ALR+A +++K    +  L+ ++V + N    +     PD  W  
Sbjct  61   LRFIA--AHSTTLQADALRLAIEQVKAANIDVNLYHQLVIEYNALPSVHKQITPDQDWMA  118

Query  386  SVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             V    +   ++L+ EL  Y TNLIKES RM Y D G+FY + G  G A K
Sbjct  119  KVKGTKDAEGDRLQVELKTYTTNLIKESTRMAYRDLGNFYRSLGDTGSALK  169



>ref|XP_008031050.1| hypothetical protein SETTUDRAFT_166034 [Setosphaeria turcica 
Et28A]
 gb|EOA81643.1| hypothetical protein SETTUDRAFT_166034 [Setosphaeria turcica 
Et28A]
Length=468

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 73/131 (56%), Gaps = 8/131 (6%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y A Y+G T+I RL  I    ++  + ++A R+A  E KKG+N  L+  +V+  
Sbjct  27   KFDLESYIANYTGYTRIDRLYHIG--AHSPYLAVDAYRLAIAEAKKGKNVGLYTRLVEDF  84

Query  338  NGRLGPNYGP----DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
               + PN  P    D  W +   R   +  ++LE+EL +Y+ NLIKESIRMG  D G FY
Sbjct  85   RS-IAPN-DPAALVDTTWAEKKTREVREEHDRLEHELKSYKNNLIKESIRMGNEDLGHFY  142

Query  506  YAHGQLGEAFK  538
            Y  G    A K
Sbjct  143  YDTGDFINALK  153



>ref|XP_011055548.1| PREDICTED: COP9 signalosome complex subunit 1 [Acromyrmex echinatior]
 gb|EGI64602.1| COP9 signalosome complex subunit 1 [Acromyrmex echinatior]
Length=485

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 22/158 (14%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  25   NDNAEEEPYIVENPTLDLEVYANSYTGLAKLHRLVYIADHC--PSLRIEALKMAITYVMT  82

Query  296  GENTQLFREVVQKINGRLGPNYGP-----------------DAGWTDSVDRRAEQRKEKL  424
              N  L+  + +K+   +G  Y P                 D  W ++  ++A  + EK 
Sbjct  83   TYNVGLYVMLHKKLVEAMG--YTPGLPDIAAQSTSQDMPTMDQTWVETRSKKAALKLEKF  140

Query  425  ENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            + +L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  141  DTDLKNYKSNSIKESIRRGHDDLGDHYLNCGDLVHALK  178



>ref|XP_006617842.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome complex subunit 
1-like [Apis dorsata]
Length=484

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 78/155 (50%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C    +++EAL+MA   +  
Sbjct  25   NDNAEEEPYIVENPTLDLEVYANSYTGLAKLYRLIYIADHC--PMLRIEALKMAISYVMT  82

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   +G    PD                W +   ++A  + EK + +
Sbjct  83   TYNVSLYVILHKKLVQAVGTPGLPDVAAQSTSQDMLTLDQAWVEFRSKKAALKLEKFDTD  142

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  YR+N IKESIR G++D GD Y   G L  A K
Sbjct  143  LKNYRSNSIKESIRRGHDDLGDHYLDCGDLVHALK  177



>ref|XP_003690236.1| PREDICTED: COP9 signalosome complex subunit 1-like [Apis florea]
Length=468

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 78/155 (50%), Gaps = 17/155 (11%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C    +++EAL+MA   +  
Sbjct  25   NDNAEEEPYIVENPTLDLEVYANSYTGLAKLYRLIYIADHC--PMLRIEALKMAISYVMT  82

Query  296  GENTQLFREVVQKINGRLGPNYGPDAG--------------WTDSVDRRAEQRKEKLENE  433
              N  L+  + +K+   +G    PD                W +   ++A  + EK + +
Sbjct  83   TYNVSLYVILHKKLVQAVGTPGLPDVAAQSTSQDMLTLDQAWVEFRSKKAALKLEKFDTD  142

Query  434  LNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            L  YR+N IKESIR G++D GD Y   G L  A K
Sbjct  143  LKNYRSNSIKESIRRGHDDLGDHYLDCGDLVHALK  177



>ref|XP_011160573.1| PREDICTED: COP9 signalosome complex subunit 1 [Solenopsis invicta]
Length=485

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 22/158 (14%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  25   NDNAEEEPYIVENPTLDLEVYANSYTGLAKLHRLIYIADHC--PSLRIEALKMAITYVMT  82

Query  296  GENTQLFREVVQKINGRLGPNYGP-----------------DAGWTDSVDRRAEQRKEKL  424
              N  L+  + +K+   +G  Y P                 D  W ++  ++A  + EK 
Sbjct  83   TYNVGLYIVLHKKLVEAMG--YTPGLPDIAAQSTSQDMPTMDQTWVETRSKKAALKLEKF  140

Query  425  ENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            + +L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  141  DTDLKNYKSNSIKESIRRGHDDLGDHYLNCGDLVHALK  178



>ref|XP_002150783.1| COP9 signalosome subunit 1 (CsnA), putative [Talaromyces marneffei 
ATCC 18224]
 gb|EEA22174.1| COP9 signalosome subunit 1 (CsnA), putative [Talaromyces marneffei 
ATCC 18224]
 gb|KFX45909.1| COP9 signalosome complex subunit 1 [Talaromyces marneffei PM1]
Length=470

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 73/133 (55%), Gaps = 8/133 (6%)
 Frame = +2

Query  152  GEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQ  331
              + D+E+Y A Y GRT+  RL F+  +C+ T +  +ALR+A  E K G++ + +   V+
Sbjct  36   APKFDLESYIANYKGRTRFERL-FLIGKCS-TILSHDALRLAVAEAKSGKDVERYELAVE  93

Query  332  KINGRLGPNYGPDAG----WTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGD  499
             +  +    + PDA     W D   +      +KLE+EL  Y+ NLIKESIRMG +D   
Sbjct  94   AL--KQAAPHDPDAVLDQRWVDVTKQTVRAETDKLEHELKGYKNNLIKESIRMGTDDLAS  151

Query  500  FYYAHGQLGEAFK  538
             Y+A G L  A K
Sbjct  152  HYHAVGDLASASK  164



>gb|KIK22558.1| hypothetical protein PISMIDRAFT_102310 [Pisolithus microcarpus 
441]
Length=483

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 72/150 (48%), Gaps = 16/150 (11%)
 Frame = +2

Query  131  RHRPIIS---GEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGE  301
            R RP+ +       D++AY A Y+GRT I RL+ I  +C   S+   AL +A   + +  
Sbjct  11   RRRPVFTIDDDHSFDLDAYIAPYTGRTVIDRLIAIIIQC--PSIAPHALSLAIQRVYRLR  68

Query  302  NTQLFREVVQKINGRLGPNYGP-----------DAGWTDSVDRRAEQRKEKLENELNAYR  448
            +  L   V+      LG   G            D  W + V +R    + KLE EL  Y 
Sbjct  69   DPSLLNAVISAYESVLGTQEGKGLPPVADVVSVDMEWVEDVTKRNIAERTKLEVELKTYT  128

Query  449  TNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             N+IKESIRM + D GDF+ + G+ G A K
Sbjct  129  NNMIKESIRMAHRDLGDFFRSTGEFGLALK  158



>gb|EFZ22741.1| hypothetical protein SINV_15878 [Solenopsis invicta]
Length=481

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 22/158 (14%)
 Frame = +2

Query  119  DDSSRHRP-IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKK  295
            +D++   P I+    LD+E Y   Y+G  K+ RL++IAD C   S+++EAL+MA   +  
Sbjct  21   NDNAEEEPYIVENPTLDLEVYANSYTGLAKLHRLIYIADHC--PSLRIEALKMAITYVMT  78

Query  296  GENTQLFREVVQKINGRLGPNYGP-----------------DAGWTDSVDRRAEQRKEKL  424
              N  L+  + +K+   +G  Y P                 D  W ++  ++A  + EK 
Sbjct  79   TYNVGLYIVLHKKLVEAMG--YTPGLPDIAAQSTSQDMPTMDQTWVETRSKKAALKLEKF  136

Query  425  ENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            + +L  Y++N IKESIR G++D GD Y   G L  A K
Sbjct  137  DTDLKNYKSNSIKESIRRGHDDLGDHYLNCGDLVHALK  174



>ref|XP_008848475.1| PREDICTED: COP9 signalosome complex subunit 1-like, partial [Nannospalax 
galili]
Length=315

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 81/146 (55%), Gaps = 16/146 (11%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFRE  322
            ++    LD+E Y A YSG  +I RL FIADRC    +++EAL+MA   +++  N  ++ E
Sbjct  75   VVENPTLDLEQYAASYSGLMRIERLQFIADRC--PPLRVEALKMALSFVQRTFNVDMYEE  132

Query  323  VVQKINGRL-----GPNYGPDAG---------WTDSVDRRAEQRKEKLENELNAYRTNLI  460
            + +K++         P+  P++G         W ++  ++A  + EKL+ +L  Y+ N I
Sbjct  133  IHRKLSEATRELQNAPDAIPESGVEPPPLDTAWVEATRKKALLKLEKLDTDLKNYKGNSI  192

Query  461  KESIRMGYNDFGDFYYAHGQLGEAFK  538
            KESIR G++D GD Y   G L  A K
Sbjct  193  KESIRRGHDDLGDHYLDCGDLSNALK  218



>ref|XP_005712200.1| unnamed protein product [Chondrus crispus]
 emb|CDF32535.1| unnamed protein product [Chondrus crispus]
Length=451

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = +2

Query  161  LDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKIN  340
             D++ Y A Y  R KI RL FIADR  N+ ++++ALR+A  E KKG +T L++E+ ++ +
Sbjct  8    FDLDGYAARYRARGKIQRLRFIADR--NSDLRVDALRLAVSEAKKGYDTFLYKEIFKQAD  65

Query  341  GRLGPNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQ  520
            G LG ++  D  W    ++ A ++ E L++EL   +    KE IR G+ND GDF++  G+
Sbjct  66   GALGEDFTLDEEWIMRKNQWAGKQLELLKHELEENKQQANKEVIRTGHNDLGDFFHKRGK  125

Query  521  LGEA  532
            L +A
Sbjct  126  LKQA  129



>ref|XP_007317130.1| hypothetical protein SERLADRAFT_464634 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO01318.1| hypothetical protein SERLA73DRAFT_179480 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO26957.1| hypothetical protein SERLADRAFT_464634 [Serpula lacrymans var. 
lacrymans S7.9]
Length=492

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 71/143 (50%), Gaps = 12/143 (8%)
 Frame = +2

Query  140  PIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFR  319
            P+      D+E Y + Y+GRT + RLL +   C   + Q  AL++A   I++  +  L++
Sbjct  33   PVDDAHPFDLETYISGYTGRTAVDRLLLVISTCPTIAPQ--ALKLALTHIQQLRDPALYQ  90

Query  320  EVV---QKINGRLGPNYGPDA-------GWTDSVDRRAEQRKEKLENELNAYRTNLIKES  469
              +   + +    G N  P +        W D   ++ +  + KLE EL  Y  N+IKES
Sbjct  91   SAIATYEYLASIPGVNVPPTSEIDSMRSSWMDETVKKNQAERTKLEVELKTYSNNMIKES  150

Query  470  IRMGYNDFGDFYYAHGQLGEAFK  538
            IRMG+ D GDF+ A G    A K
Sbjct  151  IRMGHRDLGDFFRATGDFPMALK  173



>gb|KEY67336.1| hypothetical protein S7711_04587 [Stachybotrys chartarum IBT 
7711]
 gb|KFA52909.1| hypothetical protein S40293_00914 [Stachybotrys chartarum IBT 
40293]
Length=469

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 80/161 (50%), Gaps = 11/161 (7%)
 Frame = +2

Query  62   AEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCN  241
            A   Q  +   ++ + GGV    R +P     +LD++ Y   Y G T+  RLL I   C 
Sbjct  2    AVSSQLTAFFHQMENLGGV--VVREQP-----KLDLDLYIQNYDGPTRFERLLLIGKCC-  53

Query  242  NTSMQLEALRMAYDEIKKGENTQLFREVVQ--KINGRLGPNYGPDAGWTDSVDRRAEQRK  415
               + ++AL+ A  E KKG N   +RE  +  +I     P    D  W D  +   +   
Sbjct  54   -VPLSVDALKAAVVESKKGRNVSQYREAWECIRIAAPNEPEAARDDAWIDKTEAANKAET  112

Query  416  EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             +LE+EL +YR NLIKESIRMG  D G  + + G+L EA +
Sbjct  113  ARLESELKSYRHNLIKESIRMGNEDLGRHFESIGKLNEAIE  153



>gb|KFY35039.1| hypothetical protein V494_06258 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=466

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 75/131 (57%), Gaps = 8/131 (6%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            +LD+E Y   Y+G TK  RLLFI    ++T ++ EAL+ A  E KKG N   +    Q+ 
Sbjct  20   KLDLETYIQNYTGTTKFERLLFIG--LHSTVLRAEALKAAVAEAKKGRNVAHYN-AAQEA  76

Query  338  NGRLGPNYGPDAG----WTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
              R+ P   P+A     W  S++++ +    +LE EL  Y+ NLIKESIR+G  D G FY
Sbjct  77   YSRVAPE-DPEAQHDDQWVTSIEKQNKVDGARLEAELKGYKNNLIKESIRIGNEDCGKFY  135

Query  506  YAHGQLGEAFK  538
             + G L +A++
Sbjct  136  QSTGNLQKAYE  146



>emb|CCI48382.1| unnamed protein product [Albugo candida]
Length=440

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 78/168 (46%), Gaps = 42/168 (25%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVV--  328
            +  D+EAY + Y+ R K+ RLLFIAD     S+Q EAL M   ++K G +  L+++V+  
Sbjct  10   DHFDLEAYASKYADRNKLQRLLFIADTI--PSVQTEALSMLERDVKSGTDMALYQQVLNR  67

Query  329  ------------------------------------QKINGRLGPN--YGPDAGWTDSVD  394
                                                 K +  +G       D    D+V 
Sbjct  68   KAQLQATESADCSKKRGRDEAEDKEENVVMEDAYRHSKTHSDIGFRGLTAQDQAHIDNVK  127

Query  395  RRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            R       +LE ELN+Y++++IKESIRMG+ND G+FYY  G L  A K
Sbjct  128  RNVSHTHARLEQELNSYKSSMIKESIRMGHNDLGEFYYHLGDLPSALK  175



>gb|KFY06820.1| hypothetical protein V492_07711 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=466

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 75/131 (57%), Gaps = 8/131 (6%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            +LD+E Y   Y+G TK  RLLFI    ++T ++ EAL+ A  E KKG N   +    Q+ 
Sbjct  20   KLDLETYIQNYTGTTKFERLLFIG--LHSTVLRAEALKAAVAEAKKGRNVAHYN-AAQEA  76

Query  338  NGRLGPNYGPDAG----WTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
              R+ P   P+A     W  S++++ +    +LE EL  Y+ NLIKESIR+G  D G FY
Sbjct  77   YSRVAPE-DPEAQHDDQWVTSIEKQNKVDGARLEAELKGYKNNLIKESIRIGNEDCGKFY  135

Query  506  YAHGQLGEAFK  538
             + G L +A++
Sbjct  136  QSTGNLQKAYE  146



>ref|XP_005109229.1| PREDICTED: COP9 signalosome complex subunit 1-like [Aplysia californica]
Length=484

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 80/152 (53%), Gaps = 22/152 (14%)
 Frame = +2

Query  143  IISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYD-EIKKGENTQLFR  319
            ++    +D+E Y + ++G  ++ RLLFIA+ CN  S+++EALRMA +  +K   NT L++
Sbjct  33   LVENASIDLEHYASQFTGLARLNRLLFIAEHCN--SLKVEALRMALNYTMKTTFNTTLYQ  90

Query  320  EVVQKI----------NGRLGPNYGPDAG---------WTDSVDRRAEQRKEKLENELNA  442
             +  K+              G N  PD           W +   ++A  + EKL+ +L  
Sbjct  91   LIHHKLEIATSGSRGGASSSGQNNLPDVASAINSVDTQWVEVTSKKAALKLEKLDTDLKN  150

Query  443  YRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            Y++N IKESIR G++D GD Y   G L  A K
Sbjct  151  YKSNSIKESIRRGHDDLGDHYLDCGDLSNALK  182



>ref|XP_005177221.1| PREDICTED: COP9 signalosome complex subunit 1b [Musca domestica]
Length=500

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 84/168 (50%), Gaps = 30/168 (18%)
 Frame = +2

Query  119  DDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKG  298
            D++  H  I+    LD+E Y   Y G  ++ RL+F+AD C   S++LEAL+MA + +   
Sbjct  27   DNNEEHHLIVENPTLDLEVYANSYVGLARLYRLIFVADVC--PSLRLEALKMAINYVMTT  84

Query  299  ENTQLFREVVQKIN---------------GRLGPNYGP-------------DAGWTDSVD  394
             N  ++R + +K+N               G   P+                D  W ++  
Sbjct  85   YNVTMYRVLHKKLNDIYVNSNGAGGANASGGPLPDIAAQPALAAQGDLPVFDQSWVETKS  144

Query  395  RRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            ++A  + EKL+++L  ++++ IKESIR G++D GD Y + G L  A K
Sbjct  145  KKAALKLEKLDSDLKNFKSSSIKESIRRGHDDLGDHYLSCGDLSNALK  192



>emb|CCI48381.1| unnamed protein product [Albugo candida]
Length=445

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 78/168 (46%), Gaps = 42/168 (25%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVV--  328
            +  D+EAY + Y+ R K+ RLLFIAD     S+Q EAL M   ++K G +  L+++V+  
Sbjct  10   DHFDLEAYASKYADRNKLQRLLFIADTI--PSVQTEALSMLERDVKSGTDMALYQQVLNR  67

Query  329  ------------------------------------QKINGRLGPN--YGPDAGWTDSVD  394
                                                 K +  +G       D    D+V 
Sbjct  68   KAQLQATESADCSKKRGRDEAEDKEENVVMEDAYRHSKTHSDIGFRGLTAQDQAHIDNVK  127

Query  395  RRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            R       +LE ELN+Y++++IKESIRMG+ND G+FYY  G L  A K
Sbjct  128  RNVSHTHARLEQELNSYKSSMIKESIRMGHNDLGEFYYHLGDLPSALK  175



>gb|KFA75238.1| hypothetical protein S40288_00264 [Stachybotrys chartarum IBT 
40288]
Length=469

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 80/161 (50%), Gaps = 11/161 (7%)
 Frame = +2

Query  62   AEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCN  241
            A   Q  +   ++ + GGV    R +P     +LD++ Y   Y G T+  RLL I   C 
Sbjct  2    AVSSQLTAFFHQMENLGGV--VVREQP-----KLDLDLYIQNYDGPTRFERLLLIGKCC-  53

Query  242  NTSMQLEALRMAYDEIKKGENTQLFREVVQ--KINGRLGPNYGPDAGWTDSVDRRAEQRK  415
               + ++AL+ A  E KKG N   +RE  +  +I     P    D  W D  +   +   
Sbjct  54   -VPLSVDALKAAIVESKKGRNVSQYREAWECIRIAAPNEPEAARDDAWIDKTEAANKAET  112

Query  416  EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             +LE+EL +YR NLIKESIRMG  D G  + + G+L EA +
Sbjct  113  ARLESELKSYRHNLIKESIRMGNEDLGRHFESIGKLNEAIE  153



>emb|CCI48385.1| unnamed protein product [Albugo candida]
Length=460

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 78/168 (46%), Gaps = 42/168 (25%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVV--  328
            +  D+EAY + Y+ R K+ RLLFIAD     S+Q EAL M   ++K G +  L+++V+  
Sbjct  10   DHFDLEAYASKYADRNKLQRLLFIADTI--PSVQTEALSMLERDVKSGTDMALYQQVLNR  67

Query  329  ------------------------------------QKINGRLGPN--YGPDAGWTDSVD  394
                                                 K +  +G       D    D+V 
Sbjct  68   KAQLQATESADCSKKRGRDEAEDKEENVVMEDAYRHSKTHSDIGFRGLTAQDQAHIDNVK  127

Query  395  RRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            R       +LE ELN+Y++++IKESIRMG+ND G+FYY  G L  A K
Sbjct  128  RNVSHTHARLEQELNSYKSSMIKESIRMGHNDLGEFYYHLGDLPSALK  175



>emb|CCI48383.1| unnamed protein product [Albugo candida]
Length=455

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 78/168 (46%), Gaps = 42/168 (25%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVV--  328
            +  D+EAY + Y+ R K+ RLLFIAD     S+Q EAL M   ++K G +  L+++V+  
Sbjct  10   DHFDLEAYASKYADRNKLQRLLFIADTI--PSVQTEALSMLERDVKSGTDMALYQQVLNR  67

Query  329  ------------------------------------QKINGRLGPN--YGPDAGWTDSVD  394
                                                 K +  +G       D    D+V 
Sbjct  68   KAQLQATESADCSKKRGRDEAEDKEENVVMEDAYRHSKTHSDIGFRGLTAQDQAHIDNVK  127

Query  395  RRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            R       +LE ELN+Y++++IKESIRMG+ND G+FYY  G L  A K
Sbjct  128  RNVSHTHARLEQELNSYKSSMIKESIRMGHNDLGEFYYHLGDLPSALK  175



>ref|XP_001889263.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR00057.1| predicted protein [Laccaria bicolor S238N-H82]
Length=471

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 75/157 (48%), Gaps = 17/157 (11%)
 Frame = +2

Query  110  GGVDDSSRHRPIIS----GEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMA  277
            GG   S R RPII         D+E Y A Y+ RT I RL+ IA  C + +M  EA ++ 
Sbjct  12   GGSGQSPR-RPIIVPVDDAHPFDLEGYIANYTDRTAIDRLIHIASICPSIAM--EAFQLC  68

Query  278  YDEIKKGENTQLFREVV----QKINGRLGPNYGP------DAGWTDSVDRRAEQRKEKLE  427
               I +  +  L++ ++    Q  N    P   P      D  W D +  + +  + KLE
Sbjct  69   VQHIHQSRDPTLYQALLTAYEQTSNALDMPLPNPLDLAQLDTKWMDEIIAKNQAERTKLE  128

Query  428  NELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             EL  Y  N+IKESIRM + D GDFY + G    + K
Sbjct  129  VELKTYSNNMIKESIRMAHRDLGDFYRSTGDYATSLK  165



>gb|EMD89882.1| hypothetical protein COCHEDRAFT_1214926 [Bipolaris maydis C5]
 gb|ENI09905.1| hypothetical protein COCC4DRAFT_125585 [Bipolaris maydis ATCC 
48331]
Length=468

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 74/130 (57%), Gaps = 6/130 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y A Y+G T+I RL  I    ++  + ++A R+A  E KKG+N  L+ ++V+  
Sbjct  27   KFDLESYIANYTGYTRIDRLYHIG--AHSPYLAVDAYRLAIAETKKGKNVGLYTKLVEDF  84

Query  338  NGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
            +  + P+      D  W +   R   +  ++LE+EL +Y+ NLIKESIRMG  D G FYY
Sbjct  85   SS-IAPDDSAALVDTTWAEKKTREVREEHDRLEHELKSYKNNLIKESIRMGNEDLGHFYY  143

Query  509  AHGQLGEAFK  538
              G    A K
Sbjct  144  DIGDFSNAQK  153



>gb|KFA65400.1| hypothetical protein S40285_00492 [Stachybotrys chlorohalonata 
IBT 40285]
Length=469

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 79/161 (49%), Gaps = 11/161 (7%)
 Frame = +2

Query  62   AEDDQFGSMMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCN  241
            A   Q  +   ++ + GGV    R +P     +LD++ Y   Y G T+  RLL I   C 
Sbjct  2    AVSSQLTAFFHQMENLGGV--VVREQP-----KLDLDLYIQNYDGPTRFERLLLIGKCC-  53

Query  242  NTSMQLEALRMAYDEIKKGENTQLFREVVQ--KINGRLGPNYGPDAGWTDSVDRRAEQRK  415
               + ++AL+ A  E KKG N   +RE  +  +I     P    D  W D  +   +   
Sbjct  54   -VPLSVDALKAAVVESKKGRNVSQYREAWECIRIAAPNEPEAARDDAWIDKTEAANKAET  112

Query  416  EKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             +LE+EL  YR NLIKESIRMG  D G  + + G+L EA +
Sbjct  113  ARLESELKGYRHNLIKESIRMGNEDLGRHFESIGKLNEAIE  153



>emb|CCI48384.1| unnamed protein product [Albugo candida]
Length=460

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 78/168 (46%), Gaps = 42/168 (25%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVV--  328
            +  D+EAY + Y+ R K+ RLLFIAD     S+Q EAL M   ++K G +  L+++V+  
Sbjct  10   DHFDLEAYASKYADRNKLQRLLFIADTI--PSVQTEALSMLERDVKSGTDMALYQQVLNR  67

Query  329  ------------------------------------QKINGRLGPN--YGPDAGWTDSVD  394
                                                 K +  +G       D    D+V 
Sbjct  68   KAQLQATESADCSKKRGRDEAEDKEENVVMEDAYRHSKTHSDIGFRGLTAQDQAHIDNVK  127

Query  395  RRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            R       +LE ELN+Y++++IKESIRMG+ND G+FYY  G L  A K
Sbjct  128  RNVSHTHARLEQELNSYKSSMIKESIRMGHNDLGEFYYHLGDLPSALK  175



>emb|CCI48386.1| unnamed protein product [Albugo candida]
Length=475

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 78/168 (46%), Gaps = 42/168 (25%)
 Frame = +2

Query  155  EQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVV--  328
            +  D+EAY + Y+ R K+ RLLFIAD     S+Q EAL M   ++K G +  L+++V+  
Sbjct  10   DHFDLEAYASKYADRNKLQRLLFIADTI--PSVQTEALSMLERDVKSGTDMALYQQVLNR  67

Query  329  ------------------------------------QKINGRLGPN--YGPDAGWTDSVD  394
                                                 K +  +G       D    D+V 
Sbjct  68   KAQLQATESADCSKKRGRDEAEDKEENVVMEDAYRHSKTHSDIGFRGLTAQDQAHIDNVK  127

Query  395  RRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
            R       +LE ELN+Y++++IKESIRMG+ND G+FYY  G L  A K
Sbjct  128  RNVSHTHARLEQELNSYKSSMIKESIRMGHNDLGEFYYHLGDLPSALK  175



>ref|XP_001262038.1| COP9 signalosome subunit 1 (CsnA), putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW20141.1| COP9 signalosome subunit 1 (CsnA), putative [Neosartorya fischeri 
NRRL 181]
Length=493

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 82/154 (53%), Gaps = 6/154 (4%)
 Frame = +2

Query  86   MMDEIHSNGGVDDSSRHRPIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEA  265
            M+D   +NG +  S+    +    + ++E+Y A Y+GRT+  RL  I   C+ T +  EA
Sbjct  26   MVDPEGTNGNMIASAPFVKVDDPPKFELESYIANYTGRTRFNRLYLIGT-CS-TYLSTEA  83

Query  266  LRMAYDEIKKGENTQLFREVVQKINGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENEL  436
            L+ A  E K G++   +++ V+ +   + PN      D  W D + R  +   ++LE+EL
Sbjct  84   LKAAVAEAKAGKDVVRYQQAVRAL-AEVSPNEPEAIEDTKWVDHMQRVVKSETDRLEHEL  142

Query  437  NAYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
              Y+ NLIKESIRMG  D G  Y+  G L  A K
Sbjct  143  RGYKNNLIKESIRMGNEDLGLHYHQIGNLVAASK  176



>gb|KFY26394.1| hypothetical protein V491_01329 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=465

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 74/130 (57%), Gaps = 6/130 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            +LD+E Y   Y+G TK  RLLFI    ++T ++ EAL+ A  E KKG N   +    Q  
Sbjct  20   KLDLETYIQNYTGTTKFERLLFIG--LHSTVLRAEALKAAVIEAKKGRNVAHYN-AAQDA  76

Query  338  NGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
              R+ P+      DA W  +++++ +    +LE EL  Y+ NLIKESIR+G  D G FY 
Sbjct  77   YSRVAPDEPEAQHDAQWVTNMEKQNKVEGARLEAELKGYKNNLIKESIRIGNEDCGKFYQ  136

Query  509  AHGQLGEAFK  538
            + G L +A++
Sbjct  137  SIGNLQKAYE  146



>emb|CCD49571.1| similar to COP9 signalosome complex subunit 1 [Botrytis cinerea 
T4]
Length=441

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 74/131 (56%), Gaps = 8/131 (6%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            + D+E+Y A Y GRT++ RL  I     +T + +EAL+M   E K+G++  ++ +    +
Sbjct  15   KFDLESYIANYKGRTRLERLYLIG--ITSTFLGVEALKMLIKEAKQGKDVTIYMDGWAAM  72

Query  338  NGRLGPNYGPDA----GWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
            + R+ PN  P+A     W D+ ++        LE +L  Y+ NLIKESIRMG  D G  Y
Sbjct  73   S-RIAPN-EPEAVRDDQWIDATNKSNAAEAASLEAQLKGYKNNLIKESIRMGNEDLGKHY  130

Query  506  YAHGQLGEAFK  538
             A GQL  AF+
Sbjct  131  EATGQLALAFE  141



>ref|XP_008596586.1| 26S proteasome subunit RPN7 [Beauveria bassiana ARSEF 2860]
 gb|EJP67487.1| 26S proteasome subunit RPN7 [Beauveria bassiana ARSEF 2860]
Length=470

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 74/133 (56%), Gaps = 8/133 (6%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            I   + D++ Y   YSGRT+  RLL I   C    +QL+AL+ A  E K G +   +++ 
Sbjct  25   IELPKFDLDLYIQNYSGRTRFDRLLLIGKSC--VPLQLDALKAAIAEAKSGRDVSRYKQA  82

Query  326  VQKINGRLGPNYGPDA----GWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDF  493
               I  +L P+  P+A     W D+ ++  +   ++LE+EL  Y+ NLIKESIRMG  D 
Sbjct  83   WDCIR-KLAPD-EPEATRDEAWIDATEKSNKAETQRLESELKGYKNNLIKESIRMGNEDL  140

Query  494  GDFYYAHGQLGEA  532
            G  + A G+L +A
Sbjct  141  GRHFEAIGKLNDA  153



>gb|KGQ09618.1| COP9 signalosome complex subunit 1 [Beauveria bassiana D1-5]
Length=489

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 74/133 (56%), Gaps = 8/133 (6%)
 Frame = +2

Query  146  ISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREV  325
            I   + D++ Y   YSGRT+  RLL I   C    +QL+AL+ A  E K G +   +++ 
Sbjct  44   IELPKFDLDLYIQNYSGRTRFDRLLLIGKSC--VPLQLDALKAAIAEAKSGRDVSRYKQA  101

Query  326  VQKINGRLGPNYGPDA----GWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDF  493
               I  +L P+  P+A     W D+ ++  +   ++LE+EL  Y+ NLIKESIRMG  D 
Sbjct  102  WDCIR-KLAPD-EPEATRDEAWIDATEKSNKAETQRLESELKGYKNNLIKESIRMGNEDL  159

Query  494  GDFYYAHGQLGEA  532
            G  + A G+L +A
Sbjct  160  GRHFEAIGKLNDA  172



>gb|EPQ63974.1| hypothetical protein BGT96224_1394 [Blumeria graminis f. sp. 
tritici 96224]
Length=450

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (56%), Gaps = 6/135 (4%)
 Frame = +2

Query  140  PIISGEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFR  319
            P     + DI++Y + Y GRT+  RL  I    N+T +++EAL+ A  E K G++ + + 
Sbjct  4    PATKLPRFDIDSYVSNYQGRTRFERLFHIGT--NSTILRVEALKAAIHEAKNGKDIKRYL  61

Query  320  EVVQKINGRLGPNYG---PDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYND  490
            +   ++  ++GPN      D  W + V    +   + LE EL  Y+ NLIKESIRMG  D
Sbjct  62   DACIELE-KVGPNEPEAMKDEMWIERVKSTNQIETQSLEAELKQYKNNLIKESIRMGNED  120

Query  491  FGDFYYAHGQLGEAF  535
             G  Y A G+LG+A+
Sbjct  121  LGKHYLAIGELGKAY  135



>gb|KFY52679.1| hypothetical protein V496_08265 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY87835.1| hypothetical protein V498_06998 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=466

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 73/130 (56%), Gaps = 6/130 (5%)
 Frame = +2

Query  158  QLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQKI  337
            +LD+E Y   Y+G TK  RLLFI    ++T ++ EAL+ A  E KKG N   +    Q  
Sbjct  20   KLDLETYIQNYTGTTKFERLLFIG--LHSTVLRAEALKSAVAEAKKGRNVAHYN-AAQDA  76

Query  338  NGRLGPNYGP---DAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYY  508
              R+ P+      D  W  S++++ +    +LE EL  Y+ NLIKESIR+G  D G FY 
Sbjct  77   YSRVAPDEPEAQHDGQWVASMEKQNKVEGARLEAELKGYKNNLIKESIRIGNEDCGRFYQ  136

Query  509  AHGQLGEAFK  538
            + G L +A++
Sbjct  137  STGNLQKAYE  146



>ref|XP_007800623.1| COP9 signalosome complex subunit 1 [Endocarpon pusillum Z07020]
 gb|ERF73620.1| COP9 signalosome complex subunit 1 [Endocarpon pusillum Z07020]
Length=495

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 80/153 (52%), Gaps = 8/153 (5%)
 Frame = +2

Query  95   EIHSNGGVDDSSRHRPIIS-GEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALR  271
            ++ ++  V  + + R +++   + D+++Y A Y+GRT+  RL  I    ++  +  EAL+
Sbjct  2    DLKADAKVPSTPKSRVVVTETPKFDLDSYIANYAGRTRYARLYLIG--TSSKVLATEALK  59

Query  272  MAYDEIKKGENTQLFREVVQKINGRLGPNYGPDA----GWTDSVDRRAEQRKEKLENELN  439
             A  E K G + Q + + V  +   L P   PD      W +  +++ +    +LE EL 
Sbjct  60   AAVAEAKAGNDVQRYMDAVAALRPHLTPG-DPDGVIDRSWVERKEKQNKAESSRLEAELK  118

Query  440  AYRTNLIKESIRMGYNDFGDFYYAHGQLGEAFK  538
             Y+ NLIKESIRMG  D G  Y+A G L  A K
Sbjct  119  GYKNNLIKESIRMGNEDLGAHYHAIGDLTSATK  151



>ref|XP_007778616.1| hypothetical protein W97_02526 [Coniosporium apollinis CBS 100218]
 gb|EON63299.1| hypothetical protein W97_02526 [Coniosporium apollinis CBS 100218]
Length=474

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 73/131 (56%), Gaps = 4/131 (3%)
 Frame = +2

Query  152  GEQLDIEAYDALYSGRTKIMRLLFIADRCNNTSMQLEALRMAYDEIKKGENTQLFREVVQ  331
              + D+E+Y + Y  RT++ RL+ I   C +T + ++A   A  E K+G++T ++  +V 
Sbjct  25   APKFDLESYISNYEDRTRLDRLITIG--CTSTYLSIDAFHAAIAEAKQGKDTDIYMSIVG  82

Query  332  KINGRLG--PNYGPDAGWTDSVDRRAEQRKEKLENELNAYRTNLIKESIRMGYNDFGDFY  505
             +   +   P   PD GW +   ++ +   ++LE+EL  Y+ NLIKESIRMG  D G  Y
Sbjct  83   CLQQIVPEDPLSMPDLGWVEQRMKQIKAETDRLEHELKQYKNNLIKESIRMGNEDLGAHY  142

Query  506  YAHGQLGEAFK  538
             + G    A+K
Sbjct  143  QSIGDFNAAYK  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800