BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I04

Length=310
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP30246.1|  hypothetical protein JCGZ_17028                       57.0    8e-08   Jatropha curcas
ref|XP_010090189.1|  hypothetical protein L484_011178                 52.4    7e-06   Morus notabilis
ref|XP_007155053.1|  hypothetical protein PHAVU_003G169100g           50.8    1e-05   Phaseolus vulgaris [French bean]
ref|XP_006453085.1|  hypothetical protein CICLE_v10009567mg           50.8    1e-05   
ref|XP_004150208.1|  PREDICTED: uncharacterized protein LOC101204493  50.8    2e-05   
ref|XP_010687917.1|  PREDICTED: 36.4 kDa proline-rich protein         49.7    7e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|AAL35979.1|AF104392_1  extensin-like protein                       48.5    1e-04   Cucumis sativus [cucumbers]
gb|KJB53996.1|  hypothetical protein B456_009G015500                  47.4    2e-04   Gossypium raimondii
ref|XP_004251730.1|  PREDICTED: 36.4 kDa proline-rich protein         48.1    2e-04   
gb|KJB23625.1|  hypothetical protein B456_004G107700                  46.6    3e-04   Gossypium raimondii
ref|XP_006345219.1|  PREDICTED: 36.4 kDa proline-rich protein-like    47.4    4e-04   Solanum tuberosum [potatoes]



>gb|KDP30246.1| hypothetical protein JCGZ_17028 [Jatropha curcas]
Length=218

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  40   MEVSKVTALLLISMLFISSATPILACGSCGKPSH  141
            ME SK++ALLLI MLFISSA PIL CGSCGKP H
Sbjct  1    MESSKISALLLICMLFISSAAPILGCGSCGKPRH  34



>ref|XP_010090189.1| hypothetical protein L484_011178 [Morus notabilis]
 gb|EXB39018.1| hypothetical protein L484_011178 [Morus notabilis]
Length=248

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  40   MEVSKVTALLLISMLFISSATPILACGSCGKPS  138
            ME SK  ALLLI MLF+SS TPIL CGSCGKPS
Sbjct  1    MEFSKSYALLLICMLFVSSVTPILGCGSCGKPS  33



>ref|XP_007155053.1| hypothetical protein PHAVU_003G169100g [Phaseolus vulgaris]
 gb|ESW27047.1| hypothetical protein PHAVU_003G169100g [Phaseolus vulgaris]
Length=210

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  40   MEVSKVTALLLISMLFISSATPILACGSCGKP  135
            ME SK+ A L +SMLFISSATPIL CG CGKP
Sbjct  1    MESSKIHAYLFLSMLFISSATPILGCGYCGKP  32



>ref|XP_006453085.1| hypothetical protein CICLE_v10009567mg [Citrus clementina]
 ref|XP_006474415.1| PREDICTED: 36.4 kDa proline-rich protein-like [Citrus sinensis]
 gb|ESR66325.1| hypothetical protein CICLE_v10009567mg [Citrus clementina]
 gb|KDO73488.1| hypothetical protein CISIN_1g029294mg [Citrus sinensis]
 gb|KDO73489.1| hypothetical protein CISIN_1g029294mg [Citrus sinensis]
Length=195

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  40   MEVSKVTALLLISMLFISSATPILACGSCGKP  135
            M+ SK++ALL+I MLFIS+ATPIL CG+CGKP
Sbjct  1    MDSSKLSALLIICMLFISTATPILGCGTCGKP  32



>ref|XP_004150208.1| PREDICTED: uncharacterized protein LOC101204493, partial [Cucumis 
sativus]
 ref|XP_004173104.1| PREDICTED: uncharacterized LOC101204493, partial [Cucumis sativus]
Length=235

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  19   FLLHH*TMEVSKVTALLLISMLFISSATPILACGSC-GKPSH  141
            FL +H  ME SK+ +L LI MLFISSA+PIL CGSC GKP  
Sbjct  14   FLHNHSKMEPSKIYSLFLICMLFISSASPILGCGSCSGKPPR  55



>ref|XP_010687917.1| PREDICTED: 36.4 kDa proline-rich protein [Beta vulgaris subsp. 
vulgaris]
Length=274

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  40   MEVSKVTALLLISMLFISSATPILACGSCGKPSH  141
            M+ SK +ALL I MLFISS TPIL CG CG+P+H
Sbjct  1    MDSSKSSALLFICMLFISSVTPILGCGYCGEPTH  34



>gb|AAL35979.1|AF104392_1 extensin-like protein, partial [Cucumis sativus]
Length=219

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +1

Query  28   HH*TMEVSKVTALLLISMLFISSATPILACGSC-GKPSH  141
            +H  ME SK+ +L LI MLFISSA+PIL CGSC GKP  
Sbjct  1    NHSKMEPSKIYSLFLICMLFISSASPILGCGSCSGKPPR  39



>gb|KJB53996.1| hypothetical protein B456_009G015500 [Gossypium raimondii]
Length=194

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  49   SKVTALLLISMLFISSATPILACGSCGKPSH  141
            +K++ALLLI MLFISS TPIL CGSCGK  H
Sbjct  5    TKMSALLLICMLFISSVTPILGCGSCGKAPH  35



>ref|XP_004251730.1| PREDICTED: 36.4 kDa proline-rich protein [Solanum lycopersicum]
Length=262

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  40   MEVSKVTALLLISMLFISSATPILACGSCG  129
            ME SK+T+LL ISMLF+SS TPIL CG CG
Sbjct  1    MEFSKITSLLFISMLFLSSFTPILGCGYCG  30



>gb|KJB23625.1| hypothetical protein B456_004G107700 [Gossypium raimondii]
Length=172

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  40   MEVSKVTALLLISMLFISSATPILACGSCG  129
            ME +K++ L LI MLFISSATPIL CGSCG
Sbjct  1    MESTKISPLFLICMLFISSATPILGCGSCG  30



>ref|XP_006345219.1| PREDICTED: 36.4 kDa proline-rich protein-like [Solanum tuberosum]
Length=241

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  40   MEVSKVTALLLISMLFISSATPILACGSCG  129
            ME SK+T+LL ISMLF+SS TPIL CG CG
Sbjct  1    MEFSKITSLLFISMLFLSSLTPILGCGYCG  30



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558850726180