BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I03

Length=519
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008679872.1|  PREDICTED: 40S ribosomal protein S8-like           266   1e-85   
ref|XP_006344091.1|  PREDICTED: 40S ribosomal protein S8-like           258   1e-83   Solanum tuberosum [potatoes]
ref|XP_002452585.1|  hypothetical protein SORBIDRAFT_04g028530          256   3e-83   Sorghum bicolor [broomcorn]
ref|NP_001046866.1|  Os02g0489400                                       256   6e-83   
ref|XP_004975334.1|  PREDICTED: 40S ribosomal protein S8-like           256   7e-83   Setaria italica
ref|XP_004953910.1|  PREDICTED: 40S ribosomal protein S8-like           256   7e-83   Setaria italica
gb|AFW66128.1|  putative ribosomal protein S8e family protein           253   8e-83   
ref|NP_001105391.1|  40S ribosomal protein S8                           255   1e-82   Zea mays [maize]
ref|XP_004240435.1|  PREDICTED: 40S ribosomal protein S8-2              255   1e-82   Solanum lycopersicum
ref|XP_008679876.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     256   2e-82   Zea mays [maize]
ref|XP_007149668.1|  hypothetical protein PHAVU_005G089100g             254   2e-82   Phaseolus vulgaris [French bean]
dbj|BAA07207.1|  ribosomal protein S8                                   254   2e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010060252.1|  PREDICTED: 40S ribosomal protein S8                254   2e-82   Eucalyptus grandis [rose gum]
ref|XP_006352667.1|  PREDICTED: 40S ribosomal protein S8-like           254   2e-82   Solanum tuberosum [potatoes]
ref|XP_009771719.1|  PREDICTED: 40S ribosomal protein S8                254   3e-82   Nicotiana sylvestris
ref|XP_004242427.1|  PREDICTED: 40S ribosomal protein S8                254   3e-82   Solanum lycopersicum
ref|XP_006452497.1|  hypothetical protein CICLE_v10009415mg             254   3e-82   Citrus clementina [clementine]
gb|KDP45274.1|  hypothetical protein JCGZ_15139                         254   3e-82   Jatropha curcas
gb|KHG04827.1|  40S ribosomal S8                                        254   3e-82   Gossypium arboreum [tree cotton]
gb|KHG08050.1|  40S ribosomal S8                                        254   3e-82   Gossypium arboreum [tree cotton]
ref|XP_011025495.1|  PREDICTED: 40S ribosomal protein S8-like           254   3e-82   Populus euphratica
ref|XP_007049644.1|  40S ribosomal protein S8 isoform 1                 254   3e-82   Theobroma cacao [chocolate]
gb|KJB84080.1|  hypothetical protein B456_N005000                       254   3e-82   Gossypium raimondii
gb|KJB62959.1|  hypothetical protein B456_009G445800                    254   3e-82   Gossypium raimondii
ref|XP_006437243.1|  hypothetical protein CICLE_v10032694mg             254   3e-82   Citrus clementina [clementine]
ref|XP_006484807.1|  PREDICTED: 40S ribosomal protein S8-like           254   4e-82   Citrus sinensis [apfelsine]
gb|KDP39216.1|  hypothetical protein JCGZ_00973                         254   4e-82   Jatropha curcas
ref|XP_002534344.1|  40S ribosomal protein S8, putative                 254   4e-82   Ricinus communis
gb|KDO36309.1|  hypothetical protein CISIN_1g045444mg                   254   4e-82   Citrus sinensis [apfelsine]
ref|XP_011008256.1|  PREDICTED: 40S ribosomal protein S8-like           254   4e-82   Populus euphratica
gb|KJB22170.1|  hypothetical protein B456_004G033000                    253   5e-82   Gossypium raimondii
gb|KHG18510.1|  40S ribosomal S8                                        253   6e-82   Gossypium arboreum [tree cotton]
ref|XP_010252680.1|  PREDICTED: 40S ribosomal protein S8                253   6e-82   Nelumbo nucifera [Indian lotus]
gb|KJB81679.1|  hypothetical protein B456_013G156600                    253   6e-82   Gossypium raimondii
ref|XP_011069406.1|  PREDICTED: 40S ribosomal protein S8                253   7e-82   Sesamum indicum [beniseed]
gb|KCW58021.1|  hypothetical protein EUGRSUZ_H00750                     253   7e-82   Eucalyptus grandis [rose gum]
ref|XP_007146564.1|  hypothetical protein PHAVU_006G051300g             253   7e-82   Phaseolus vulgaris [French bean]
ref|XP_010069614.1|  PREDICTED: 40S ribosomal protein S8-like           253   7e-82   Eucalyptus grandis [rose gum]
ref|NP_001132384.1|  uncharacterized protein LOC100193830               253   7e-82   Zea mays [maize]
ref|XP_007134162.1|  hypothetical protein PHAVU_010G024600g             253   7e-82   Phaseolus vulgaris [French bean]
gb|KJB81683.1|  hypothetical protein B456_013G156600                    254   7e-82   Gossypium raimondii
ref|XP_002269042.2|  PREDICTED: 40S ribosomal protein S8                253   8e-82   Vitis vinifera
emb|CDP15136.1|  unnamed protein product                                255   9e-82   Coffea canephora [robusta coffee]
gb|KHN25148.1|  40S ribosomal protein S8                                253   9e-82   Glycine soja [wild soybean]
gb|KJB84081.1|  hypothetical protein B456_N005000                       254   1e-81   Gossypium raimondii
ref|XP_003547779.1|  PREDICTED: 40S ribosomal protein S8                253   1e-81   Glycine max [soybeans]
gb|KJB13805.1|  hypothetical protein B456_002G095300                    252   1e-81   Gossypium raimondii
gb|KJB81680.1|  hypothetical protein B456_013G156600                    250   1e-81   Gossypium raimondii
ref|XP_008657369.1|  PREDICTED: uncharacterized protein LOC100193...    253   1e-81   Zea mays [maize]
ref|XP_002313320.1|  40S ribosomal protein S8                           252   2e-81   Populus trichocarpa [western balsam poplar]
ref|XP_002299926.1|  40S ribosomal protein S8                           252   2e-81   Populus trichocarpa [western balsam poplar]
ref|XP_006373483.1|  hypothetical protein POPTR_0017s14180g             252   2e-81   Populus trichocarpa [western balsam poplar]
ref|XP_007020644.1|  40S ribosomal protein S8 isoform 1                 252   2e-81   
ref|XP_006373482.1|  hypothetical protein POPTR_0017s14180g             252   3e-81   Populus trichocarpa [western balsam poplar]
ref|XP_011021175.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     251   3e-81   Populus euphratica
ref|XP_011021176.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     251   3e-81   Populus euphratica
gb|KHG09566.1|  40S ribosomal protein S8                                248   9e-81   Gossypium arboreum [tree cotton]
ref|XP_010278451.1|  PREDICTED: 40S ribosomal protein S8-like           250   1e-80   Nelumbo nucifera [Indian lotus]
ref|XP_002446216.1|  hypothetical protein SORBIDRAFT_06g004770          250   1e-80   Sorghum bicolor [broomcorn]
gb|KJB22659.1|  hypothetical protein B456_004G059300                    250   2e-80   Gossypium raimondii
ref|NP_200732.2|  40S ribosomal protein S8-2                            247   1e-79   Arabidopsis thaliana [mouse-ear cress]
emb|CDY45095.1|  BnaA02g04810D                                          248   1e-79   Brassica napus [oilseed rape]
gb|EAY93669.1|  hypothetical protein OsI_15456                          246   3e-79   Oryza sativa Indica Group [Indian rice]
ref|NP_001052526.1|  Os04g0349500                                       246   3e-79   
gb|AFK40150.1|  unknown                                                 246   4e-79   Lotus japonicus
ref|XP_009126438.1|  PREDICTED: 40S ribosomal protein S8-1-like         245   1e-78   Brassica rapa
ref|XP_002864608.1|  40S ribosomal protein S8                           244   2e-78   
ref|XP_010454644.1|  PREDICTED: 40S ribosomal protein S8-2              244   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010483522.1|  PREDICTED: 40S ribosomal protein S8-2-like         244   3e-78   Camelina sativa [gold-of-pleasure]
gb|KJB81681.1|  hypothetical protein B456_013G156600                    241   4e-78   Gossypium raimondii
emb|CAA03954.1|  ribosomal protein S8                                   239   7e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003574981.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     243   8e-78   Brachypodium distachyon [annual false brome]
ref|XP_010235437.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     243   9e-78   Brachypodium distachyon [annual false brome]
gb|ABL85034.1|  ribosomal subunit 8E protein                            243   1e-77   Brachypodium sylvaticum
ref|XP_003557224.1|  PREDICTED: 40S ribosomal protein S8                243   1e-77   Brachypodium distachyon [annual false brome]
gb|EYU27406.1|  hypothetical protein MIMGU_mgv1a013520mg                242   2e-77   Erythranthe guttata [common monkey flower]
gb|ACN31997.1|  unknown                                                 241   4e-77   Zea mays [maize]
ref|XP_010097296.1|  40S ribosomal protein S8                           241   5e-77   
gb|EMT18438.1|  40S ribosomal protein S8                                240   1e-76   
gb|KJB62960.1|  hypothetical protein B456_009G445800                    239   1e-76   Gossypium raimondii
gb|ACJ83894.1|  unknown                                                 239   2e-76   Medicago truncatula
emb|CBI39377.3|  unnamed protein product                                239   3e-76   Vitis vinifera
dbj|BAJ89904.1|  predicted protein                                      239   4e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB13806.1|  hypothetical protein B456_002G095300                    238   6e-76   Gossypium raimondii
gb|KHG07290.1|  40S ribosomal S8                                        234   3e-75   Gossypium arboreum [tree cotton]
gb|KJB22660.1|  hypothetical protein B456_004G059300                    236   5e-75   Gossypium raimondii
ref|XP_009610547.1|  PREDICTED: 40S ribosomal protein S8                236   6e-75   Nicotiana tomentosiformis
ref|XP_009783183.1|  PREDICTED: 40S ribosomal protein S8                235   7e-75   Nicotiana sylvestris
gb|AFW61714.1|  putative ribosomal protein S8e family protein           233   7e-75   
gb|EMS65111.1|  40S ribosomal protein S8                                237   8e-75   Triticum urartu
ref|XP_004244061.1|  PREDICTED: 40S ribosomal protein S8-like           235   1e-74   Solanum lycopersicum
ref|NP_001274851.1|  uncharacterized protein LOC102577693               234   2e-74   Solanum tuberosum [potatoes]
gb|KHF98591.1|  40S ribosomal S8                                        233   4e-74   Gossypium arboreum [tree cotton]
ref|XP_006652189.1|  PREDICTED: 40S ribosomal protein S8-like           233   6e-74   
ref|XP_008792950.1|  PREDICTED: 40S ribosomal protein S8                233   7e-74   Phoenix dactylifera
ref|XP_009416597.1|  PREDICTED: 40S ribosomal protein S8                233   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008778380.1|  PREDICTED: 40S ribosomal protein S8-like           232   2e-73   Phoenix dactylifera
ref|XP_009778867.1|  PREDICTED: 40S ribosomal protein S8-like           232   2e-73   Nicotiana sylvestris
gb|AFW61715.1|  putative ribosomal protein S8e family protein           232   2e-73   
ref|XP_006648644.1|  PREDICTED: 40S ribosomal protein S8-like           231   2e-73   
ref|XP_009403610.1|  PREDICTED: 40S ribosomal protein S8-like           231   3e-73   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHM99496.1|  40S ribosomal protein S8                                231   3e-73   Glycine soja [wild soybean]
ref|XP_003532158.1|  PREDICTED: 40S ribosomal protein S8-like           231   3e-73   Glycine max [soybeans]
ref|XP_009413565.1|  PREDICTED: 40S ribosomal protein S8-like           231   4e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006601753.1|  PREDICTED: uncharacterized protein LOC100500...    230   5e-73   
ref|XP_006833291.1|  hypothetical protein AMTR_s00109p00031400          230   6e-73   Amborella trichopoda
ref|NP_001240243.1|  uncharacterized protein LOC100813170               230   6e-73   Glycine max [soybeans]
ref|XP_004510234.1|  PREDICTED: 40S ribosomal protein S8-like           229   1e-72   Cicer arietinum [garbanzo]
ref|XP_009406344.1|  PREDICTED: 40S ribosomal protein S8-like           229   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009378162.1|  PREDICTED: 40S ribosomal protein S8-like           229   1e-72   Pyrus x bretschneideri [bai li]
ref|XP_009349000.1|  PREDICTED: 40S ribosomal protein S8-like           229   2e-72   Pyrus x bretschneideri [bai li]
gb|AFK47179.1|  unknown                                                 229   2e-72   Medicago truncatula
ref|XP_009373606.1|  PREDICTED: 40S ribosomal protein S8                229   2e-72   Pyrus x bretschneideri [bai li]
gb|ACJ86093.1|  unknown                                                 229   2e-72   Medicago truncatula
ref|XP_011095494.1|  PREDICTED: 40S ribosomal protein S8                229   3e-72   Sesamum indicum [beniseed]
ref|NP_001236970.1|  uncharacterized protein LOC100500112               228   4e-72   
ref|XP_010541736.1|  PREDICTED: 40S ribosomal protein S8-1-like         228   6e-72   Tarenaya hassleriana [spider flower]
ref|XP_009371092.1|  PREDICTED: 40S ribosomal protein S8-like           228   8e-72   Pyrus x bretschneideri [bai li]
emb|CDY60374.1|  BnaCnng36150D                                          227   1e-71   Brassica napus [oilseed rape]
ref|XP_008799563.1|  PREDICTED: 40S ribosomal protein S8-like           224   2e-71   
ref|XP_004148331.1|  PREDICTED: 40S ribosomal protein S8-like           226   2e-71   Cucumis sativus [cucumbers]
ref|XP_008337490.1|  PREDICTED: 40S ribosomal protein S8                226   3e-71   Malus domestica [apple tree]
ref|XP_010905161.1|  PREDICTED: 40S ribosomal protein S8-like           226   3e-71   Elaeis guineensis
ref|XP_006409551.1|  hypothetical protein EUTSA_v10022838mg             226   4e-71   Eutrema salsugineum [saltwater cress]
ref|XP_002529032.1|  40S ribosomal protein S8, putative                 225   5e-71   Ricinus communis
ref|XP_010913108.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     226   5e-71   Elaeis guineensis
ref|XP_006286561.1|  hypothetical protein CARUB_v10001914mg             226   5e-71   Capsella rubella
ref|XP_010907235.1|  PREDICTED: 40S ribosomal protein S8-like           226   6e-71   Elaeis guineensis
gb|ABR13294.1|  putative 40S ribosomal protein S8                       223   6e-71   Prunus dulcis [sweet almond]
ref|XP_009131790.1|  PREDICTED: 40S ribosomal protein S8-1              226   6e-71   Brassica rapa
ref|XP_006400597.1|  hypothetical protein EUTSA_v10014589mg             226   6e-71   Eutrema salsugineum [saltwater cress]
ref|XP_003520991.1|  PREDICTED: 40S ribosomal protein S8-like           225   7e-71   Glycine max [soybeans]
ref|XP_010646836.1|  PREDICTED: 40S ribosomal protein S8                225   7e-71   
ref|XP_008809644.1|  PREDICTED: 40S ribosomal protein S8                225   8e-71   Phoenix dactylifera
ref|XP_010693327.1|  PREDICTED: 40S ribosomal protein S8-like           225   9e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004290159.1|  PREDICTED: 40S ribosomal protein S8-like           225   9e-71   Fragaria vesca subsp. vesca
ref|XP_010913109.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     225   1e-70   Elaeis guineensis
ref|XP_002275094.1|  PREDICTED: 40S ribosomal protein S8                224   1e-70   Vitis vinifera
gb|EYU33688.1|  hypothetical protein MIMGU_mgv1a013525mg                224   1e-70   Erythranthe guttata [common monkey flower]
ref|XP_009619873.1|  PREDICTED: 40S ribosomal protein S8-like           224   1e-70   Nicotiana tomentosiformis
ref|XP_009361080.1|  PREDICTED: 40S ribosomal protein S8-like           224   1e-70   Pyrus x bretschneideri [bai li]
sp|O81361.1|RS8_PRUAR  RecName: Full=40S ribosomal protein S8           224   1e-70   Prunus armeniaca
ref|XP_009770276.1|  PREDICTED: 40S ribosomal protein S8-like           224   1e-70   Nicotiana sylvestris
ref|XP_003551567.1|  PREDICTED: 40S ribosomal protein S8                224   2e-70   Glycine max [soybeans]
gb|EYU33690.1|  hypothetical protein MIMGU_mgv1a013952mg                224   2e-70   Erythranthe guttata [common monkey flower]
ref|XP_008366424.1|  PREDICTED: 40S ribosomal protein S8                224   2e-70   Malus domestica [apple tree]
ref|XP_010675861.1|  PREDICTED: 40S ribosomal protein S8                224   2e-70   Beta vulgaris subsp. vulgaris [field beet]
gb|ACU19111.1|  unknown                                                 224   2e-70   Glycine max [soybeans]
ref|XP_008222788.1|  PREDICTED: 40S ribosomal protein S8                224   2e-70   Prunus mume [ume]
gb|ACU16398.1|  unknown                                                 225   3e-70   Glycine max [soybeans]
ref|XP_010270147.1|  PREDICTED: 40S ribosomal protein S8-like           224   3e-70   Nelumbo nucifera [Indian lotus]
ref|XP_008466734.1|  PREDICTED: 40S ribosomal protein S8-2              224   3e-70   Cucumis melo [Oriental melon]
ref|XP_002873989.1|  ribosomal protein S8                               224   3e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_007223947.1|  hypothetical protein PRUPE_ppa011148mg             224   3e-70   Prunus persica
emb|CDP03936.1|  unnamed protein product                                223   3e-70   Coffea canephora [robusta coffee]
gb|AGV54796.1|  40S ribosomal protein S8                                223   3e-70   Phaseolus vulgaris [French bean]
ref|XP_009765854.1|  PREDICTED: 40S ribosomal protein S8-like           223   4e-70   Nicotiana sylvestris
ref|XP_008227073.1|  PREDICTED: 40S ribosomal protein S8-like           223   5e-70   Prunus mume [ume]
ref|XP_010535902.1|  PREDICTED: 40S ribosomal protein S8-1-like         223   5e-70   Tarenaya hassleriana [spider flower]
ref|XP_009594581.1|  PREDICTED: 40S ribosomal protein S8-2-like         223   5e-70   Nicotiana tomentosiformis
ref|XP_007211997.1|  hypothetical protein PRUPE_ppa011067mg             223   6e-70   
ref|XP_010327196.1|  PREDICTED: 40S ribosomal protein S8                223   6e-70   Solanum lycopersicum
ref|XP_006352532.1|  PREDICTED: 40S ribosomal protein S8                223   7e-70   
gb|AFK37035.1|  unknown                                                 223   7e-70   Lotus japonicus
ref|XP_008451649.1|  PREDICTED: 40S ribosomal protein S8-like           223   7e-70   Cucumis melo [Oriental melon]
ref|NP_001275100.1|  putative 40S ribosomal protein S8-like protein     223   7e-70   Solanum tuberosum [potatoes]
ref|XP_008364326.1|  PREDICTED: 40S ribosomal protein S8-like           223   7e-70   
ref|XP_004492266.1|  PREDICTED: 40S ribosomal protein S8-like           223   8e-70   Cicer arietinum [garbanzo]
gb|AFK33351.1|  unknown                                                 223   8e-70   Lotus japonicus
ref|XP_006281069.1|  hypothetical protein CARUB_v10027092mg             223   8e-70   Capsella rubella
gb|KFK31870.1|  hypothetical protein AALP_AA6G169300                    222   9e-70   Arabis alpina [alpine rockcress]
ref|XP_003626942.1|  Ribosomal protein S8                               233   9e-70   
ref|XP_010519957.1|  PREDICTED: 40S ribosomal protein S8-1              222   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_009405538.1|  PREDICTED: 40S ribosomal protein S8-like           222   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006856815.1|  hypothetical protein AMTR_s00055p00155570          222   1e-69   Amborella trichopoda
ref|XP_004160707.1|  PREDICTED: 40S ribosomal protein S8-like           222   2e-69   
ref|XP_004149800.1|  PREDICTED: 40S ribosomal protein S8-like           222   2e-69   Cucumis sativus [cucumbers]
gb|KFK26269.1|  hypothetical protein AALP_AA8G225000                    222   2e-69   Arabis alpina [alpine rockcress]
emb|CDY35814.1|  BnaC09g37460D                                          223   2e-69   Brassica napus [oilseed rape]
emb|CDX92472.1|  BnaA10g15110D                                          222   2e-69   
ref|XP_009596732.1|  PREDICTED: 40S ribosomal protein S8                221   4e-69   Nicotiana tomentosiformis
ref|XP_010243157.1|  PREDICTED: 40S ribosomal protein S8-like iso...    220   4e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010243156.1|  PREDICTED: 40S ribosomal protein S8-like iso...    221   5e-69   Nelumbo nucifera [Indian lotus]
ref|XP_009120819.1|  PREDICTED: 40S ribosomal protein S8-1              221   5e-69   Brassica rapa
ref|XP_004247043.1|  PREDICTED: 40S ribosomal protein S8                220   6e-69   Solanum lycopersicum
gb|ACU16800.1|  unknown                                                 221   6e-69   Glycine max [soybeans]
ref|XP_006346168.1|  PREDICTED: 40S ribosomal protein S8-like           220   7e-69   Solanum tuberosum [potatoes]
ref|XP_010420870.1|  PREDICTED: 40S ribosomal protein S8-1-like         220   7e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010493138.1|  PREDICTED: 40S ribosomal protein S8-1              220   7e-69   Camelina sativa [gold-of-pleasure]
gb|EYU39185.1|  hypothetical protein MIMGU_mgv1a013531mg                219   8e-69   Erythranthe guttata [common monkey flower]
ref|XP_011461093.1|  PREDICTED: 40S ribosomal protein S8                219   2e-68   Fragaria vesca subsp. vesca
gb|EYU39184.1|  hypothetical protein MIMGU_mgv1a013531mg                219   2e-68   Erythranthe guttata [common monkey flower]
emb|CDX88842.1|  BnaA03g08070D                                          219   2e-68   
ref|XP_009602561.1|  PREDICTED: 40S ribosomal protein S8-like           219   2e-68   Nicotiana tomentosiformis
ref|XP_010520566.1|  PREDICTED: 40S ribosomal protein S8-1-like         218   6e-68   Tarenaya hassleriana [spider flower]
gb|ACI15738.1|  putative 40S ribosomal protein S8-like protein          217   9e-68   Picrorhiza kurrooa
ref|NP_197529.1|  40S ribosomal protein S8-1                            216   3e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AET01418.2|  40S ribosomal protein S8                                218   3e-67   Medicago truncatula
emb|CEG02139.1|  Ribosomal protein S8e/ribosomal biogenesis NSA2        216   3e-67   Ostreococcus tauri
gb|ABK21933.1|  unknown                                                 215   9e-67   Picea sitchensis
gb|ABK22298.1|  unknown                                                 215   9e-67   Picea sitchensis
gb|ABK21921.1|  unknown                                                 214   9e-67   Picea sitchensis
gb|ABR16896.1|  unknown                                                 213   4e-66   Picea sitchensis
ref|XP_001422585.1|  Ribosomal protein S8, component of cytosolic...    213   5e-66   Ostreococcus lucimarinus CCE9901
gb|KHG14255.1|  40S ribosomal S8                                        212   7e-66   Gossypium arboreum [tree cotton]
emb|CBI26725.3|  unnamed protein product                                211   3e-65   Vitis vinifera
ref|XP_011089042.1|  PREDICTED: 40S ribosomal protein S8-like           210   6e-65   Sesamum indicum [beniseed]
gb|EPS68663.1|  hypothetical protein M569_06106                         209   2e-64   Genlisea aurea
gb|EPS68749.1|  hypothetical protein M569_06019                         214   3e-64   Genlisea aurea
ref|XP_001761026.1|  predicted protein                                  207   7e-64   
ref|XP_005844426.1|  hypothetical protein CHLNCDRAFT_139122             207   1e-63   Chlorella variabilis
ref|XP_011397165.1|  40S ribosomal protein S8                           205   2e-63   Auxenochlorella protothecoides
ref|XP_005648786.1|  40S ribosomal protein S8                           206   2e-63   Coccomyxa subellipsoidea C-169
ref|XP_001773385.1|  predicted protein                                  206   2e-63   
ref|XP_001777813.1|  predicted protein                                  205   4e-63   
gb|KJB81682.1|  hypothetical protein B456_013G156600                    204   5e-63   Gossypium raimondii
ref|XP_007049645.1|  40S ribosomal protein S8 isoform 3                 204   5e-63   
ref|XP_001777587.1|  predicted protein                                  205   5e-63   
ref|XP_001780988.1|  predicted protein                                  205   6e-63   
ref|XP_003059699.1|  predicted protein                                  204   1e-62   Micromonas pusilla CCMP1545
gb|KDD75705.1|  ribosomal protein S8e                                   207   4e-62   Helicosporidium sp. ATCC 50920
ref|XP_010926672.1|  PREDICTED: 40S ribosomal protein S8-like iso...    202   7e-62   
ref|XP_010926670.1|  PREDICTED: 40S ribosomal protein S8-like iso...    200   3e-61   
ref|XP_008647178.1|  PREDICTED: 40S ribosomal protein S8-like           197   2e-60   
ref|XP_005702569.1|  40S ribosomal protein S8e                          197   4e-60   Galdieria sulphuraria
ref|XP_006369983.1|  hypothetical protein POPTR_0001s37140g             197   5e-60   
ref|XP_005708143.1|  40S ribosomal protein S8                           195   1e-59   Galdieria sulphuraria
tpg|DAA42540.1|  TPA: putative ribosomal protein S8e family protein     197   2e-59   
ref|XP_002945874.1|  component of cytosolic 80S ribosome and 40S ...    196   2e-59   Volvox carteri f. nagariensis
ref|XP_001696201.1|  ribosomal protein S8, component of cytosolic...    196   2e-59   Chlamydomonas reinhardtii
ref|XP_002963298.1|  hypothetical protein SELMODRAFT_80565              195   3e-59   
ref|XP_002505425.1|  predicted protein                                  193   2e-58   Micromonas commoda
gb|ABA01100.1|  40S ribosomal protein S8                                193   2e-58   Chlamydomonas incerta
gb|AFW73090.1|  putative ribosomal protein S8e family protein           199   2e-58   
ref|XP_003604700.1|  Ribosomal protein S8                               194   7e-58   
gb|EPZ31448.1|  40S ribosomal protein S8-B                              190   2e-57   Rozella allomycis CSF55
gb|AFW85401.1|  putative ribosomal protein S8e family protein           190   2e-57   
ref|XP_001622696.1|  hypothetical protein NEMVEDRAFT_v1g195152          190   2e-57   Nematostella vectensis
gb|AAT08014.1|  putative 40S ribosomal protein S8                       191   3e-57   Zea mays [maize]
ref|XP_008660669.1|  PREDICTED: 40S ribosomal protein S8-like           188   4e-57   
dbj|BAM17705.1|  ribosomal protein S8                                   189   7e-57   Papilio xuthus [Chinese swallowtail]
gb|AFW85400.1|  putative ribosomal protein S8e family protein           194   9e-57   
dbj|BAM18930.1|  ribosomal protein S8                                   188   1e-56   Papilio polytes
gb|AFW66137.1|  putative ribosomal protein S8e family protein           184   3e-56   
gb|EHJ65952.1|  40S ribosomal protein S8                                190   4e-56   
ref|XP_002602335.1|  hypothetical protein BRAFLDRAFT_268377             187   5e-56   Branchiostoma floridae
gb|AES86897.2|  40S ribosomal S8-like protein                           187   5e-56   Medicago truncatula
ref|XP_005717008.1|  40S ribosomal protein S8                           186   6e-56   Chondrus crispus [carageen]
gb|AEL28852.1|  ribosomal protein S8                                    186   7e-56   Heliconius melpomene cythera
emb|CEG65019.1|  Putative 40S ribosomal protein S8                      186   1e-55   Rhizopus microsporus
emb|CEG73596.1|  Putative 40S ribosomal protein S8                      186   1e-55   Rhizopus microsporus
gb|AJG43845.1|  ribosomal protein rps8                                  186   1e-55   Bicyclus anynana
gb|KGG52480.1|  40S ribosomal protein S8                                186   1e-55   Mitosporidium daphniae
ref|XP_008676011.1|  PREDICTED: 40S ribosomal protein S8-like           189   2e-55   
emb|CEG71688.1|  Putative 40S ribosomal protein S8                      185   2e-55   Rhizopus microsporus
gb|ACY95327.1|  ribosomal protein S8                                    185   2e-55   Manduca sexta [Carolina sphinx]
ref|NP_001037263.1|  ribosomal protein S8                               185   2e-55   Bombyx mori [silk moth]
ref|XP_003448492.1|  PREDICTED: 40S ribosomal protein S8-like           185   2e-55   Oreochromis niloticus
ref|NP_001128155.1|  40S ribosomal protein S8                           185   3e-55   Danio rerio [leopard danio]
ref|XP_006114784.1|  PREDICTED: 40S ribosomal protein S8                185   3e-55   Pelodiscus sinensis [Chinese softshell turtle]
gb|ADT80672.1|  ribosomal protein S8                                    184   4e-55   Euphydryas aurinia [marsh fritillary]
ref|XP_002129681.1|  PREDICTED: 40S ribosomal protein S8                184   5e-55   Ciona intestinalis [sea vase]
ref|XP_005815191.1|  PREDICTED: 40S ribosomal protein S8-like iso...    184   5e-55   Xiphophorus maculatus
gb|EIE77931.1|  40S ribosomal protein S8                                184   5e-55   Rhizopus delemar RA 99-880
ref|XP_006006303.1|  PREDICTED: 40S ribosomal protein S8                184   5e-55   
gb|ABZ04260.1|  ribosomal protein rps8                                  184   5e-55   Lineus viridis
gb|EQB77469.1|  40S ribosomal protein S8                                184   5e-55   Camelus ferus
sp|Q8WQI5.1|RS8_SPOFR  RecName: Full=40S ribosomal protein S8           184   6e-55   Spodoptera frugiperda
ref|XP_002142692.1|  40S ribosomal protein S8                           184   6e-55   Cryptosporidium muris RN66
gb|KFH71035.1|  40S ribosomal protein S8                                184   6e-55   Mortierella verticillata NRRL 6337
ref|XP_006634805.1|  PREDICTED: 40S ribosomal protein S8-like           185   6e-55   
ref|XP_003975488.1|  PREDICTED: 40S ribosomal protein S8-like           184   6e-55   Takifugu rubripes [tiger puffer]
ref|XP_005924603.1|  PREDICTED: 40S ribosomal protein S8-like           184   7e-55   Haplochromis burtoni
dbj|BAC56421.1|  similar to ribosomal protein S8                        182   7e-55   Bos taurus [bovine]
dbj|BAB26839.1|  unnamed protein product                                181   7e-55   Mus musculus [mouse]
ref|XP_005729057.1|  PREDICTED: 40S ribosomal protein S8-like           184   7e-55   Pundamilia nyererei
dbj|BAE27059.1|  unnamed protein product                                181   8e-55   Mus musculus [mouse]
gb|EHH27002.1|  hypothetical protein EGK_17096                          181   8e-55   Macaca mulatta [rhesus macaque]
ref|XP_003742816.1|  PREDICTED: 40S ribosomal protein S8-like           184   9e-55   Galendromus occidentalis
ref|NP_001187073.1|  40S ribosomal protein S8                           184   9e-55   
dbj|BAB28317.1|  unnamed protein product                                181   1e-54   
dbj|BAD26659.1|  Ribosomal protein S8                                   183   1e-54   
ref|XP_007567486.1|  PREDICTED: 40S ribosomal protein S8                183   1e-54   
dbj|BAE30490.1|  unnamed protein product                                181   1e-54   
ref|XP_004740538.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     183   1e-54   
ref|XP_668115.1|  ribosomal protein S8                                  183   1e-54   
ref|XP_003801270.1|  PREDICTED: 40S ribosomal protein S8                181   1e-54   
ref|XP_008290025.1|  PREDICTED: 40S ribosomal protein S8                183   1e-54   
gb|ABJ98605.1|  40S ribosomal protein S8                                182   1e-54   
emb|CCA22399.1|  40S ribosomal protein S82 putative                     183   2e-54   
ref|XP_004078646.1|  PREDICTED: 40S ribosomal protein S8                183   2e-54   
ref|XP_765516.1|  40S ribosomal protein S8e                             182   2e-54   
ref|XP_001376099.1|  PREDICTED: 40S ribosomal protein S8                183   2e-54   
emb|CEJ01458.1|  Putative 40S ribosomal protein S8                      184   2e-54   
ref|XP_007977188.1|  PREDICTED: 40S ribosomal protein S8 isoform X2     182   2e-54   
ref|XP_004639262.1|  PREDICTED: 40S ribosomal protein S8                183   2e-54   
ref|XP_006881181.1|  PREDICTED: 40S ribosomal protein S8-like           182   2e-54   
ref|XP_004699536.1|  PREDICTED: 40S ribosomal protein S8                182   2e-54   
ref|XP_001496811.2|  PREDICTED: 40S ribosomal protein S8                182   2e-54   
gb|ABY87394.1|  ribosomal protein S8                                    182   2e-54   
emb|CEP18703.1|  hypothetical protein                                   182   2e-54   
ref|XP_008432867.1|  PREDICTED: 40S ribosomal protein S8                182   2e-54   
ref|XP_006745357.1|  PREDICTED: 40S ribosomal protein S8-like           182   2e-54   
gb|EJU03954.1|  40S ribosomal protein S8                                182   2e-54   
ref|XP_004461309.1|  PREDICTED: 40S ribosomal protein S8                182   3e-54   
ref|XP_005678610.1|  PREDICTED: 40S ribosomal protein S8                182   3e-54   
gb|AGR33944.1|  subunit ribosomal protein 8                             182   3e-54   
gb|ELU12655.1|  hypothetical protein CAPTEDRAFT_218947                  182   3e-54   
dbj|BAF45896.1|  ribosomal protein S8                                   182   3e-54   
ref|XP_001085841.1|  PREDICTED: 40S ribosomal protein S8-like iso...    182   3e-54   
gb|AAN05595.1|  ribosomal protein S8                                    182   3e-54   
ref|XP_006178510.1|  PREDICTED: 40S ribosomal protein S8                182   3e-54   
ref|XP_005318007.1|  PREDICTED: 40S ribosomal protein S8                182   3e-54   
ref|NP_001003.1|  40S ribosomal protein S8                              182   3e-54   
gb|EDL32455.1|  mCG7626                                                 182   3e-54   
gb|AAH86899.1|  Ribosomal protein S8                                    182   3e-54   
ref|NP_001239055.1|  40S ribosomal protein S8                           182   3e-54   
ref|XP_006911473.1|  PREDICTED: 40S ribosomal protein S8                182   3e-54   
ref|NP_001016566.1|  ribosomal protein S8                               182   3e-54   
gb|AGH70192.1|  40S ribosomal protein S8                                182   4e-54   
ref|XP_010746502.1|  PREDICTED: 40S ribosomal protein S8                182   4e-54   
gb|KIJ26939.1|  hypothetical protein M422DRAFT_76964                    182   4e-54   
ref|XP_010221385.1|  PREDICTED: 40S ribosomal protein S8                183   5e-54   
ref|XP_005303088.1|  PREDICTED: 40S ribosomal protein S8                182   5e-54   
ref|XP_006273333.1|  PREDICTED: 40S ribosomal protein S8                182   5e-54   
ref|NP_001232282.1|  putative 40S ribosomal protein S8                  182   5e-54   
ref|XP_008107755.1|  PREDICTED: 40S ribosomal protein S8                182   5e-54   
gb|ACH44381.1|  putative 40S ribosomal protein S8                       182   5e-54   
ref|XP_004401278.1|  PREDICTED: 40S ribosomal protein S8-like           182   5e-54   
ref|XP_008514229.1|  PREDICTED: 40S ribosomal protein S8                182   5e-54   
ref|XP_004555428.1|  PREDICTED: 40S ribosomal protein S8-like           183   6e-54   
gb|AFM88001.1|  40S ribosomal protein S8                                181   6e-54   
ref|XP_008847068.1|  PREDICTED: 40S ribosomal protein S8                181   6e-54   
emb|CEI89824.1|  Putative 40S ribosomal protein S8                      182   6e-54   
ref|XP_009039782.1|  hypothetical protein AURANDRAFT_30589              181   6e-54   
ref|XP_627792.1|  40S ribosomal protein S8                              181   6e-54   
gb|EKD00868.1|  40S ribosomal protein S8                                181   7e-54   
gb|ADO27837.1|  40S ribosomal protein s8                                181   7e-54   
gb|KII92951.1|  hypothetical protein PLICRDRAFT_89444                   181   8e-54   
sp|Q9ZT56.1|RS8_GRIJA  RecName: Full=40S ribosomal protein S8           181   8e-54   
ref|XP_002738428.1|  PREDICTED: 40S ribosomal protein S8-like           181   8e-54   
gb|AAV84252.1|  ribosomal protein S8                                    181   9e-54   
ref|XP_004629680.1|  PREDICTED: 40S ribosomal protein S8-like           181   9e-54   
ref|XP_002158630.1|  PREDICTED: 40S ribosomal protein S8-like iso...    181   1e-53   
ref|NP_999958.1|  40S ribosomal protein S8                              181   1e-53   
ref|XP_004879528.1|  PREDICTED: 40S ribosomal protein S8 isoform X1     181   1e-53   
ref|XP_010714500.1|  PREDICTED: 40S ribosomal protein S8                182   1e-53   
ref|XP_008333134.1|  PREDICTED: 40S ribosomal protein S8                181   1e-53   
gb|EMC77472.1|  40S ribosomal protein S8                                178   1e-53   
ref|XP_004516802.1|  PREDICTED: 40S ribosomal protein S8-like           184   1e-53   
ref|XP_010407761.1|  PREDICTED: 40S ribosomal protein S8                184   1e-53   
emb|CAH57693.1|  40S ribosomal protein S8                               181   1e-53   
gb|ACQ57870.1|  40S ribosomal protein S8                                181   1e-53   
gb|AFJ45046.1|  ribosomal protein S8                                    180   1e-53   
ref|XP_007397269.1|  hypothetical protein PHACADRAFT_258531             181   1e-53   
gb|KIK09143.1|  hypothetical protein K443DRAFT_447984                   181   1e-53   
ref|XP_009637143.1|  PREDICTED: 40S ribosomal protein S8                181   1e-53   
ref|XP_004678985.1|  PREDICTED: 40S ribosomal protein S8                181   1e-53   
gb|KIM21886.1|  hypothetical protein M408DRAFT_333202                   181   2e-53   
ref|XP_005881305.1|  PREDICTED: 40S ribosomal protein S8                180   2e-53   
ref|XP_009679268.1|  PREDICTED: 40S ribosomal protein S8                181   2e-53   
gb|ACH44382.1|  putative 40S ribosomal protein S8                       180   2e-53   
emb|CAD91426.1|  ribosomal protein S8                                   180   2e-53   
gb|ADX97198.1|  40S ribosomal protein s8                                180   2e-53   
ref|NP_001080843.1|  40S ribosomal protein S8                           180   2e-53   
gb|AFM89547.1|  40S ribosomal protein S8                                181   2e-53   
gb|AFM90620.1|  40S ribosomal protein S8                                180   2e-53   
ref|XP_007873882.1|  30S ribosomal protein S8e                          180   2e-53   
ref|XP_011444203.1|  PREDICTED: 40S ribosomal protein S8-like           180   2e-53   
gb|KFO20861.1|  40S ribosomal protein S8                                181   2e-53   
dbj|GAN00733.1|  40S ribosomal protein S8                               180   2e-53   
ref|XP_005856295.1|  small subunit ribosomal protein S8e                179   2e-53   
gb|AFM90919.1|  40S ribosomal protein S8                                180   2e-53   
gb|AFM90684.1|  40S ribosomal protein S8                                180   2e-53   
ref|NP_001279579.1|  ribosomal protein S8                               180   2e-53   
ref|XP_005559137.1|  PREDICTED: 40S ribosomal protein S8-like           180   2e-53   
gb|EFB13159.1|  hypothetical protein PANDA_016005                       180   2e-53   
ref|XP_009863870.1|  PREDICTED: 40S ribosomal protein S8                180   2e-53   
ref|XP_010355633.1|  PREDICTED: 40S ribosomal protein S8-like           180   2e-53   
gb|EPB83635.1|  40S ribosomal protein S8                                180   2e-53   
ref|XP_007245170.1|  PREDICTED: 40S ribosomal protein S8-like           180   2e-53   
ref|XP_010126964.1|  PREDICTED: 40S ribosomal protein S8                180   3e-53   
ref|XP_010292800.1|  PREDICTED: 40S ribosomal protein S8                180   3e-53   
ref|XP_010206685.1|  PREDICTED: 40S ribosomal protein S8                180   3e-53   
ref|XP_005815192.1|  PREDICTED: 40S ribosomal protein S8-like iso...    179   3e-53   
ref|XP_003291144.1|  40S ribosomal protein S8                           180   3e-53   
ref|XP_003029339.1|  40S ribosomal protein S8                           180   3e-53   
ref|XP_007380781.1|  ribosomal protein S8e                              179   3e-53   
gb|ERE86265.1|  40S ribosomal protein S8-like protein                   181   3e-53   
gb|EWM25134.1|  40s ribosomal protein s8                                180   3e-53   
gb|ELR57442.1|  40S ribosomal protein S8                                179   3e-53   
ref|XP_010021976.1|  PREDICTED: 40S ribosomal protein S8                180   3e-53   
gb|EOA94872.1|  40S ribosomal protein S8                                179   3e-53   
ref|XP_009991314.1|  PREDICTED: 40S ribosomal protein S8                180   4e-53   
ref|XP_010186644.1|  PREDICTED: 40S ribosomal protein S8                181   4e-53   
gb|AFJ45049.1|  ribosomal protein S8                                    179   4e-53   
gb|EXX59184.1|  ribosomal 40S subunit protein S8B                       177   4e-53   
ref|XP_009323882.1|  PREDICTED: 40S ribosomal protein S8                180   4e-53   
ref|XP_009970295.1|  PREDICTED: 40S ribosomal protein S8                180   4e-53   
ref|XP_002708870.1|  PREDICTED: 40S ribosomal protein S8                179   4e-53   
gb|AHW80321.1|  ribosomal protein                                       179   4e-53   
ref|XP_009958964.1|  PREDICTED: 40S ribosomal protein S8                179   4e-53   
ref|XP_008592200.1|  PREDICTED: 40S ribosomal protein S8                179   4e-53   
gb|EHH14717.1|  hypothetical protein EGK_00685                          179   4e-53   
ref|XP_010077725.1|  PREDICTED: 40S ribosomal protein S8                179   5e-53   
ref|XP_009075517.1|  PREDICTED: 40S ribosomal protein S8                180   5e-53   
ref|XP_009571612.1|  PREDICTED: 40S ribosomal protein S8                180   5e-53   
ref|XP_004621641.1|  PREDICTED: 40S ribosomal protein S8                181   5e-53   
ref|XP_001384365.1|  40S ribosomal protein S8                           179   5e-53   
ref|XP_010152828.1|  PREDICTED: 40S ribosomal protein S8                179   5e-53   
ref|XP_007061727.1|  PREDICTED: 40S ribosomal protein S8                179   5e-53   
ref|XP_008489142.1|  PREDICTED: 40S ribosomal protein S8                179   5e-53   
ref|XP_009943981.1|  PREDICTED: 40S ribosomal protein S8                180   5e-53   
ref|XP_005501192.1|  PREDICTED: 40S ribosomal protein S8                180   5e-53   
gb|EXX59187.1|  ribosomal 40S subunit protein S8B                       177   5e-53   
ref|XP_010172079.1|  PREDICTED: 40S ribosomal protein S8                179   5e-53   
ref|XP_009477726.1|  PREDICTED: 40S ribosomal protein S8                179   5e-53   
ref|XP_009813094.1|  PREDICTED: 40S ribosomal protein S8                179   5e-53   
ref|XP_009510045.1|  PREDICTED: 40S ribosomal protein S8                179   5e-53   
ref|NP_001291143.1|  40S ribosomal protein S8                           179   5e-53   
ref|NP_001086481.1|  MGC83421 protein                                   179   6e-53   
ref|XP_009691025.1|  40S ribosomal protein S8                           178   6e-53   
ref|XP_007001047.1|  hypothetical protein TREMEDRAFT_55820              179   6e-53   
dbj|BAC40485.1|  unnamed protein product                                179   6e-53   
ref|XP_005830461.1|  small subunit ribosomal protein S8e, cytopla...    179   6e-53   
gb|AFJ45047.1|  ribosomal protein S8                                    178   6e-53   
gb|ACD65100.1|  putative 40S ribosomal protein RPS8                     177   6e-53   
ref|XP_009699114.1|  PREDICTED: 40S ribosomal protein S8                179   6e-53   
ref|XP_004670569.1|  PREDICTED: 40S ribosomal protein S8                179   6e-53   
ref|XP_009285726.1|  PREDICTED: 40S ribosomal protein S8                179   6e-53   
ref|XP_010370237.1|  PREDICTED: 40S ribosomal protein S8                179   7e-53   
gb|EJT52835.1|  40S ribosomal protein S8                                179   7e-53   
ref|XP_005423220.1|  PREDICTED: 40S ribosomal protein S8                180   7e-53   
ref|XP_010298650.1|  PREDICTED: 40S ribosomal protein S8                179   7e-53   
ref|XP_005398849.1|  PREDICTED: 40S ribosomal protein S8                179   7e-53   
ref|XP_009557252.1|  PREDICTED: 40S ribosomal protein S8                181   8e-53   
gb|EDL05106.1|  mCG10837                                                179   8e-53   
ref|XP_008947226.1|  PREDICTED: 40S ribosomal protein S8                179   8e-53   
ref|XP_006070233.1|  PREDICTED: 40S ribosomal protein S8-like           177   9e-53   
gb|EXX59185.1|  ribosomal 40S subunit protein S8B                       177   9e-53   
gb|ELK26051.1|  40S ribosomal protein S8                                182   9e-53   
ref|XP_009087131.1|  PREDICTED: 40S ribosomal protein S8                179   9e-53   
ref|XP_005482384.1|  PREDICTED: 40S ribosomal protein S8                180   9e-53   
ref|XP_002117056.1|  expressed hypothetical protein                     178   9e-53   
gb|EMD32142.1|  hypothetical protein CERSUDRAFT_88417                   178   1e-52   
gb|EAX07023.1|  ribosomal protein S8, isoform CRA_a                     179   1e-52   
gb|ABR87484.1|  small subunit ribosomal protein 8                       178   1e-52   
ref|XP_003928219.1|  PREDICTED: 40S ribosomal protein S8                178   1e-52   
gb|AFM85641.1|  40S ribosomal protein S8                                178   1e-52   
gb|ABR87482.1|  small subunit ribosomal protein 8                       178   1e-52   
gb|AFM86309.1|  40S ribosomal protein S8                                178   1e-52   
gb|KHN77159.1|  40S ribosomal protein S8                                178   1e-52   
gb|ERG83269.1|  40s ribosomal protein s8                                178   1e-52   
ref|XP_001487630.1|  hypothetical protein PGUG_01007                    178   1e-52   
ref|XP_010005007.1|  PREDICTED: 40S ribosomal protein S8                179   1e-52   
ref|XP_951769.1|  40S ribosomal protein S8                              177   1e-52   
gb|ABR87471.1|  small subunit ribosomal protein 8                       178   1e-52   
gb|EXX59183.1|  ribosomal 40S subunit protein S8B                       178   1e-52   
ref|XP_005238555.1|  PREDICTED: 40S ribosomal protein S8                180   1e-52   
gb|AFJ45055.1|  ribosomal protein S8                                    177   1e-52   
gb|AFW62789.1|  putative ribosomal protein S8e family protein           179   1e-52   
gb|ABR87472.1|  small subunit ribosomal protein 8                       177   1e-52   
ref|XP_009900328.1|  PREDICTED: 40S ribosomal protein S8                178   1e-52   
ref|XP_004995866.1|  40S ribosomal protein S8                           177   1e-52   
ref|XP_007361817.1|  ribosomal protein S8e                              178   1e-52   
gb|AFM90761.1|  40S ribosomal protein S8                                178   2e-52   
gb|KDQ27658.1|  hypothetical protein PLEOSDRAFT_1089421                 178   2e-52   
ref|XP_001880116.1|  40S ribosomal protein S8                           178   2e-52   
ref|XP_009883160.1|  PREDICTED: 40S ribosomal protein S8                179   2e-52   
gb|AFJ45048.1|  ribosomal protein S8                                    177   2e-52   
gb|AGR33967.1|  subunit ribosomal protein 8                             177   2e-52   
gb|ABR87473.1|  small subunit ribosomal protein 8                       177   2e-52   
gb|ABR87480.1|  small subunit ribosomal protein 8                       177   2e-52   
emb|CCQ18591.1|  40S ribosomal protein S8                               177   2e-52   
gb|EIE86971.1|  40S ribosomal protein S8                                177   2e-52   
emb|CDQ93715.1|  unnamed protein product                                178   2e-52   
ref|XP_007311714.1|  40S ribosomal protein S8                           177   2e-52   
ref|XP_004197370.1|  Piso0_004620                                       177   2e-52   
gb|ABR87483.1|  small subunit ribosomal protein 8                       177   2e-52   
gb|ABR87470.1|  small subunit ribosomal protein 8                       177   2e-52   
ref|XP_007266897.1|  40S ribosomal protein S8                           177   2e-52   
ref|XP_010132709.1|  PREDICTED: 40S ribosomal protein S8                178   3e-52   
ref|XP_006461206.1|  hypothetical protein AGABI2DRAFT_136253            177   3e-52   
gb|ESW98222.1|  40S ribosomal protein S8-A                              177   3e-52   
gb|AFM90641.1|  40S ribosomal protein S8                                177   3e-52   
emb|CDQ93059.1|  unnamed protein product                                178   3e-52   
emb|CCI48864.1|  unnamed protein product                                177   3e-52   
ref|XP_006957934.1|  ribosomal protein S8e                              177   4e-52   
ref|XP_009026500.1|  hypothetical protein HELRODRAFT_193555             177   4e-52   
gb|KIL68834.1|  hypothetical protein M378DRAFT_157968                   177   4e-52   
gb|ABR87469.1|  small subunit ribosomal protein 8                       176   4e-52   
gb|KDQ57766.1|  hypothetical protein JAAARDRAFT_35455                   177   4e-52   
gb|KIY49072.1|  hypothetical protein FISHEDRAFT_65531                   178   4e-52   
gb|ABR87478.1|  small subunit ribosomal protein 8                       176   4e-52   
gb|KDR75758.1|  hypothetical protein GALMADRAFT_226405                  177   4e-52   
ref|XP_002472702.1|  40S ribosomal protein S8                           177   4e-52   
gb|AAX48884.1|  S8                                                      177   4e-52   
gb|AGJ03580.1|  small subunit ribosomal protein 8                       176   4e-52   
ref|NP_001134368.1|  40S ribosomal protein S8                           177   5e-52   
gb|ABR87481.1|  small subunit ribosomal protein 8                       176   5e-52   



>ref|XP_008679872.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=301

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 138/160 (86%), Gaps = 4/160 (3%)
 Frame = +1

Query  1    LGF*RLAKLHP*RCSA----EEGEEALLFADMGISRDSMHKRRATGGKQKAWRKKRKYEL  168
            LGF  L  +   R +A    E+ EE L    MGISRDSMHKRRATGGKQKAWRKKRKYEL
Sbjct  50   LGFPSLTSVPNRRAAARTDKEQAEEELCQGTMGISRDSMHKRRATGGKQKAWRKKRKYEL  109

Query  169  GRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNN  348
            GRQ ANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNN
Sbjct  110  GRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNN  169

Query  349  ELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKKGP  468
            ELVRTQTLVKSAIVQVDAAPFKQWYL HY VDIGRKKK P
Sbjct  170  ELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKKTP  209



>ref|XP_006344091.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=223

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/128 (98%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQK WRKKRKYELGRQSANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQSANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKG  465
            DIGRKKKG
Sbjct  121  DIGRKKKG  128



>ref|XP_002452585.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
 gb|EES05561.1| hypothetical protein SORBIDRAFT_04g028530 [Sorghum bicolor]
Length=221

 Score =   256 bits (655),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKK P
Sbjct  121  DIGRKKKAP  129



>ref|NP_001046866.1| Os02g0489400 [Oryza sativa Japonica Group]
 sp|P49199.2|RS8_ORYSJ RecName: Full=40S ribosomal protein S8 [Oryza sativa Japonica 
Group]
 pdb|3J60|I Chain I, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD21871.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAD21876.1| putative 40S ribosomal protein S8 [Oryza sativa Japonica Group]
 dbj|BAF08780.1| Os02g0489400 [Oryza sativa Japonica Group]
 dbj|BAG95703.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73196.1| hypothetical protein OsI_07259 [Oryza sativa Indica Group]
 gb|EEE57012.1| hypothetical protein OsJ_06781 [Oryza sativa Japonica Group]
Length=220

 Score =   256 bits (654),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKK P
Sbjct  121  DIGRKKKAP  129



>ref|XP_004975334.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   256 bits (653),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKK P
Sbjct  121  DIGRKKKAP  129



>ref|XP_004953910.1| PREDICTED: 40S ribosomal protein S8-like [Setaria italica]
Length=221

 Score =   256 bits (653),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKK P
Sbjct  121  DIGRKKKAP  129



>gb|AFW66128.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66141.1| putative ribosomal protein S8e family protein [Zea mays]
Length=153

 Score =   253 bits (646),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKK P
Sbjct  121  DIGRKKKTP  129



>ref|NP_001105391.1| 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679873.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679875.1| PREDICTED: 40S ribosomal protein S8 [Zea mays]
 ref|XP_008679877.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Zea mays]
 sp|Q08069.2|RS8_MAIZE RecName: Full=40S ribosomal protein S8 [Zea mays]
 gb|AAB06330.1| ribosomal protein S8 [Zea mays]
 gb|ACF80433.1| unknown [Zea mays]
 gb|ACG24637.1| 40S ribosomal protein S8 [Zea mays]
 gb|AFW66125.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66129.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66130.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66138.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66142.1| putative ribosomal protein S8e family protein [Zea mays]
Length=221

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKK P
Sbjct  121  DIGRKKKTP  129



>ref|XP_004240435.1| PREDICTED: 40S ribosomal protein S8-2 [Solanum lycopersicum]
Length=220

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQK WRKKRKYELGRQ ANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  442  DIGRKKKG  465
            DIGRKKKG
Sbjct  121  DIGRKKKG  128



>ref|XP_008679876.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Zea mays]
Length=258

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKK P
Sbjct  121  DIGRKKKTP  129



>ref|XP_007149668.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
 gb|ESW21662.1| hypothetical protein PHAVU_005G089100g [Phaseolus vulgaris]
Length=217

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQSANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQSANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKGP  468
            +IGRKKK  
Sbjct  121  EIGRKKKAA  129



>dbj|BAA07207.1| ribosomal protein S8 [Oryza sativa Japonica Group]
Length=220

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKK P
Sbjct  121  DIGRKKKEP  129



>ref|XP_010060252.1| PREDICTED: 40S ribosomal protein S8 [Eucalyptus grandis]
 gb|KCW66870.1| hypothetical protein EUGRSUZ_F00627 [Eucalyptus grandis]
Length=219

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_006352667.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=221

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQK WRKKRKYELGRQ ANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKG  465
            DIGRKKKG
Sbjct  121  DIGRKKKG  128



>ref|XP_009771719.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKG  465
            DIGRKKKG
Sbjct  121  DIGRKKKG  128



>ref|XP_004242427.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=220

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQK WRKKRKYELGRQ ANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKG  465
            DIGRKKKG
Sbjct  121  DIGRKKKG  128



>ref|XP_006452497.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
 ref|XP_006474961.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
 gb|ESR65737.1| hypothetical protein CICLE_v10009415mg [Citrus clementina]
Length=223

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KDP45274.1| hypothetical protein JCGZ_15139 [Jatropha curcas]
Length=221

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KHG04827.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KHG08050.1| 40S ribosomal S8 [Gossypium arboreum]
Length=218

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_011025495.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=219

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_007049644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOX93801.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=219

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KJB84080.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=219

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KJB62959.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=218

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_006437243.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
 gb|ESR50483.1| hypothetical protein CICLE_v10032694mg [Citrus clementina]
Length=223

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_006484807.1| PREDICTED: 40S ribosomal protein S8-like [Citrus sinensis]
Length=223

 Score =   254 bits (649),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KDP39216.1| hypothetical protein JCGZ_00973 [Jatropha curcas]
Length=219

 Score =   254 bits (648),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_002534344.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF28038.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=221

 Score =   254 bits (648),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ+ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KDO36309.1| hypothetical protein CISIN_1g045444mg, partial [Citrus sinensis]
 gb|KDO60870.1| hypothetical protein CISIN_1g044642mg, partial [Citrus sinensis]
Length=217

 Score =   254 bits (648),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_011008256.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
 ref|XP_011015899.1| PREDICTED: 40S ribosomal protein S8-like [Populus euphratica]
Length=220

 Score =   254 bits (648),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KJB22170.1| hypothetical protein B456_004G033000 [Gossypium raimondii]
Length=216

 Score =   253 bits (647),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KHG18510.1| 40S ribosomal S8 [Gossypium arboreum]
Length=216

 Score =   253 bits (647),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_010252680.1| PREDICTED: 40S ribosomal protein S8 [Nelumbo nucifera]
Length=220

 Score =   253 bits (647),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KJB81679.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=217

 Score =   253 bits (646),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_011069406.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   253 bits (647),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KCW58021.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=221

 Score =   253 bits (647),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYN+SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_007146564.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
 gb|ESW18558.1| hypothetical protein PHAVU_006G051300g [Phaseolus vulgaris]
Length=218

 Score =   253 bits (646),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_010069614.1| PREDICTED: 40S ribosomal protein S8-like [Eucalyptus grandis]
 gb|KCW58022.1| hypothetical protein EUGRSUZ_H00750 [Eucalyptus grandis]
Length=222

 Score =   253 bits (647),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYN+SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNSSNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|NP_001132384.1| uncharacterized protein LOC100193830 [Zea mays]
 gb|ACF81204.1| unknown [Zea mays]
Length=221

 Score =   253 bits (646),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKK P
Sbjct  121  DIGRKKKVP  129



>ref|XP_007134162.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
 gb|ESW06156.1| hypothetical protein PHAVU_010G024600g [Phaseolus vulgaris]
Length=218

 Score =   253 bits (646),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGL  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KJB81683.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=245

 Score =   254 bits (649),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_002269042.2| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
 emb|CAN64937.1| hypothetical protein VITISV_011515 [Vitis vinifera]
Length=221

 Score =   253 bits (646),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>emb|CDP15136.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   255 bits (651),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 127/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  79   DMGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRAL  258
            +MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ+ANTKLSS+KTVRRIRVRGGNVKWRAL
Sbjct  54   NMGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSDKTVRRIRVRGGNVKWRAL  113

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY 
Sbjct  114  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  173

Query  439  VDIGRKKKG  465
            VDIGRKKK 
Sbjct  174  VDIGRKKKA  182



>gb|KHN25148.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   253 bits (646),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGRKKK
Sbjct  121  EIGRKKK  127



>gb|KJB84081.1| hypothetical protein B456_N005000 [Gossypium raimondii]
Length=259

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +1

Query  79   DMGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRAL  258
            D GISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRAL
Sbjct  40   DSGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRAL  99

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY 
Sbjct  100  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  159

Query  439  VDIGRKKK  462
            VDIGRKKK
Sbjct  160  VDIGRKKK  167



>ref|XP_003547779.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
Length=219

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGRKKK
Sbjct  121  EIGRKKK  127



>gb|KJB13805.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
 gb|KJB13807.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=219

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            D+GRKKK
Sbjct  121  DLGRKKK  127



>gb|KJB81680.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=155

 Score =   250 bits (638),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_008657369.1| PREDICTED: uncharacterized protein LOC100193830 isoform X1 [Zea 
mays]
Length=223

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKK P
Sbjct  121  DIGRKKKVP  129



>ref|XP_002313320.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92635.1| unknown [Populus trichocarpa]
 gb|EEE87275.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=219

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_002299926.1| 40S ribosomal protein S8 [Populus trichocarpa]
 gb|ABK92677.1| unknown [Populus trichocarpa]
 gb|EEE84731.1| 40S ribosomal protein S8 [Populus trichocarpa]
Length=220

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_006373483.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51280.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=220

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_007020644.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 ref|XP_007020645.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12169.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
 gb|EOY12170.1| 40S ribosomal protein S8 isoform 1 [Theobroma cacao]
Length=220

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_006373482.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
 gb|ERP51279.1| hypothetical protein POPTR_0017s14180g [Populus trichocarpa]
Length=219

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_011021175.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Populus euphratica]
Length=218

 Score =   251 bits (642),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_011021176.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Populus euphratica]
Length=217

 Score =   251 bits (642),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/127 (97%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|KHG09566.1| 40S ribosomal protein S8 [Gossypium arboreum]
Length=163

 Score =   248 bits (634),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRR+TGGKQKAWRKKRK+ELGRQ  NTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRSTGGKQKAWRKKRKHELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSE+VTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY +
Sbjct  61   LDTGNYSWGSESVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGI  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_010278451.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=219

 Score =   250 bits (639),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_002446216.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
 gb|EES10544.1| hypothetical protein SORBIDRAFT_06g004770 [Sorghum bicolor]
Length=220

 Score =   250 bits (638),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/126 (96%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKK  459
            DIGRKK
Sbjct  121  DIGRKK  126



>gb|KJB22659.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=219

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRR+TGGKQKAWRKKRKYELGRQ  NTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRSTGGKQKAWRKKRKYELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSE+VTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY +
Sbjct  61   LDTGNYSWGSESVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGI  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|NP_200732.2| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
 sp|Q9FIF3.1|RS82_ARATH RecName: Full=40S ribosomal protein S8-2 [Arabidopsis thaliana]
 dbj|BAB09769.1| 40S ribosomal protein S8 [Arabidopsis thaliana]
 gb|AAO42849.1| At5g59240 [Arabidopsis thaliana]
 dbj|BAE99897.1| 40S ribosomal protein S8 - like [Arabidopsis thaliana]
 gb|AED97161.1| 40S ribosomal protein S8-2 [Arabidopsis thaliana]
Length=210

 Score =   247 bits (631),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTRILDV YNASNNELVRTQTLVKSAIVQVDAAPFKQ YLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQGYLQHYGV  120

Query  442  DIGRKKKG  465
            DIGRKKKG
Sbjct  121  DIGRKKKG  128



>emb|CDY45095.1| BnaA02g04810D [Brassica napus]
Length=244

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  70   LFADMGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKW  249
            L A MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKW
Sbjct  15   LKATMGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKW  74

Query  250  RALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQ  429
            RALRLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQ
Sbjct  75   RALRLDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQ  134

Query  430  HYAVDIGRKKK  462
            HY V++GRKKK
Sbjct  135  HYGVEVGRKKK  145



>gb|EAY93669.1| hypothetical protein OsI_15456 [Oryza sativa Indica Group]
Length=221

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|NP_001052526.1| Os04g0349500 [Oryza sativa Japonica Group]
 emb|CAE05511.1| OSJNBa0038P21.4 [Oryza sativa Japonica Group]
 dbj|BAF14440.1| Os04g0349500 [Oryza sativa Japonica Group]
 gb|EAZ30323.1| hypothetical protein OsJ_14370 [Oryza sativa Japonica Group]
 dbj|BAG90858.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNLKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>gb|AFK40150.1| unknown [Lotus japonicus]
Length=217

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQK WRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSE VTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSETVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGRKKK
Sbjct  121  EIGRKKK  127



>ref|XP_009126438.1| PREDICTED: 40S ribosomal protein S8-1-like [Brassica rapa]
Length=226

 Score =   245 bits (626),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKGWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_002864608.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40867.1| 40S ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=210

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTRILDV YNASNNELVRTQTLVKSAIV VDAAPFKQ YLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVAYNASNNELVRTQTLVKSAIVLVDAAPFKQGYLQHYGV  120

Query  442  DIGRKKKG  465
            DIGRKKKG
Sbjct  121  DIGRKKKG  128



>ref|XP_010454644.1| PREDICTED: 40S ribosomal protein S8-2 [Camelina sativa]
Length=218

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDV YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010483522.1| PREDICTED: 40S ribosomal protein S8-2-like [Camelina sativa]
Length=220

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDV YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>gb|KJB81681.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=153

 Score =   241 bits (616),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGI  120

Query  442  DI  447
            DI
Sbjct  121  DI  122



>emb|CAA03954.1| ribosomal protein S8 [Hordeum vulgare subsp. vulgare]
Length=126

 Score =   239 bits (611),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEA TRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNFSWGSEATTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKK  459
            +IGRKK
Sbjct  121  EIGRKK  126



>ref|XP_003574981.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Brachypodium 
distachyon]
Length=229

 Score =   243 bits (620),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010235437.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Brachypodium 
distachyon]
Length=226

 Score =   243 bits (620),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>gb|ABL85034.1| ribosomal subunit 8E protein [Brachypodium sylvaticum]
Length=223

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLAHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|XP_003557224.1| PREDICTED: 40S ribosomal protein S8 [Brachypodium distachyon]
Length=226

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>gb|EYU27406.1| hypothetical protein MIMGU_mgv1a013520mg [Erythranthe guttata]
Length=218

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKMKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>gb|ACN31997.1| unknown [Zea mays]
 gb|AFW66127.1| putative ribosomal protein S8e family protein [Zea mays]
 gb|AFW66131.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66132.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
 gb|AFW66139.1| putative ribosomal protein S8e family protein isoform 1 [Zea 
mays]
 gb|AFW66140.1| putative ribosomal protein S8e family protein isoform 2 [Zea 
mays]
Length=214

 Score =   241 bits (614),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY VDIGRKKK
Sbjct  61   WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKK  120

Query  463  GP  468
             P
Sbjct  121  TP  122



>ref|XP_010097296.1| 40S ribosomal protein S8 [Morus notabilis]
 gb|EXB67448.1| 40S ribosomal protein S8 [Morus notabilis]
Length=215

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/120 (98%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRRATGGK+KAWRKKRKYELGRQSANTKLSS+KTVRRIRVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRATGGKKKAWRKKRKYELGRQSANTKLSSDKTVRRIRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY VDIGRKKK
Sbjct  61   WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK  120



>gb|EMT18438.1| 40S ribosomal protein S8 [Aegilops tauschii]
Length=225

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>gb|KJB62960.1| hypothetical protein B456_009G445800 [Gossypium raimondii]
Length=211

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/120 (98%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY VDIGRKKK
Sbjct  61   WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK  120



>gb|ACJ83894.1| unknown [Medicago truncatula]
Length=216

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 123/127 (97%), Gaps = 1/127 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK K+WRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGK-KSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  59

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            L TGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  60   LGTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  119

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  120  EVGRKKK  126



>emb|CBI39377.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   239 bits (609),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY VDIGRKKK
Sbjct  61   WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK  120



>dbj|BAJ89904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   239 bits (609),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEA TRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNFSWGSEATTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>gb|KJB13806.1| hypothetical protein B456_002G095300 [Gossypium raimondii]
Length=212

 Score =   238 bits (606),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY VD+GRKKK
Sbjct  61   WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDLGRKKK  120



>gb|KHG07290.1| 40S ribosomal S8 [Gossypium arboreum]
 gb|KHG09567.1| 40S ribosomal protein S8 [Gossypium arboreum]
Length=156

 Score =   234 bits (597),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRR+TGGKQKAWRKKRK+ELGRQ  NTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRSTGGKQKAWRKKRKHELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            WGSE+VTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY +DIGRKKK
Sbjct  61   WGSESVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGIDIGRKKK  120



>gb|KJB22660.1| hypothetical protein B456_004G059300 [Gossypium raimondii]
Length=212

 Score =   236 bits (601),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRR+TGGKQKAWRKKRKYELGRQ  NTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRSTGGKQKAWRKKRKYELGRQPGNTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            WGSE+VTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY +DIGRKKK
Sbjct  61   WGSESVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGIDIGRKKK  120



>ref|XP_009610547.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=224

 Score =   236 bits (601),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 127/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTK+S+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISANKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKKGP
Sbjct  121  DIGRKKKGP  129



>ref|XP_009783183.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana sylvestris]
Length=224

 Score =   235 bits (600),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 127/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTK+S+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISTNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKGP  468
            DIGRKKKGP
Sbjct  121  DIGRKKKGP  129



>gb|AFW61714.1| putative ribosomal protein S8e family protein [Zea mays]
Length=154

 Score =   233 bits (594),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKR+AT GKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+ VRGG VKWRAL+
Sbjct  1    MGISRDSMHKRQATSGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVYVRGGYVKWRALQ  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDT NYSWGSEA+TRKT ILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTCNYSWGSEALTRKTGILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>gb|EMS65111.1| 40S ribosomal protein S8 [Triticum urartu]
Length=274

 Score =   237 bits (605),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  76   ADMGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRA  255
            A  GISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRA
Sbjct  48   AGAGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRA  107

Query  256  LRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY  435
            LRLDTGN+SWGSEAVTRKTR+LDVVYN+SNNELVRTQTLVK+AIVQVDAAPFKQWYL HY
Sbjct  108  LRLDTGNFSWGSEAVTRKTRLLDVVYNSSNNELVRTQTLVKNAIVQVDAAPFKQWYLTHY  167

Query  436  AVDIGR  453
             V+IGR
Sbjct  168  GVEIGR  173



>ref|XP_004244061.1| PREDICTED: 40S ribosomal protein S8-like [Solanum lycopersicum]
Length=221

 Score =   235 bits (599),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSN-KTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRRATGGKQK WRKKRKYELGRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKQKTWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY 
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYG  120

Query  439  VDIGR  453
            V+IGR
Sbjct  121  VEIGR  125



>ref|NP_001274851.1| uncharacterized protein LOC102577693 [Solanum tuberosum]
 gb|ABA46755.1| unknown [Solanum tuberosum]
Length=224

 Score =   234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLS+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSNNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY  
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGA  120

Query  442  DIGRKKKGP  468
            DIGRKKKGP
Sbjct  121  DIGRKKKGP  129



>gb|KHF98591.1| 40S ribosomal S8 [Gossypium arboreum]
Length=219

 Score =   233 bits (595),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSVHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKGP  468
            D+GRKKK P
Sbjct  121  DLGRKKKTP  129



>ref|XP_006652189.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=214

 Score =   233 bits (594),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/117 (97%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGR  453
            WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY VDIGR
Sbjct  61   WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGR  117



>ref|XP_008792950.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=222

 Score =   233 bits (594),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWY+QHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYIQHYGV  120

Query  442  DIGRKKKGP  468
            +IGRKKK P
Sbjct  121  EIGRKKKTP  129



>ref|XP_009416597.1| PREDICTED: 40S ribosomal protein S8 [Musa acuminata subsp. malaccensis]
Length=223

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LD GNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY V
Sbjct  61   LDHGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKGP  468
            +IGRKKK P
Sbjct  121  EIGRKKKAP  129



>ref|XP_008778380.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=222

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKGP  468
            +IGRKKK P
Sbjct  121  EIGRKKKAP  129



>ref|XP_009778867.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=223

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKG  465
            DIGRKKKG
Sbjct  121  DIGRKKKG  128



>gb|AFW61715.1| putative ribosomal protein S8e family protein [Zea mays]
Length=241

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  73   FADMGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWR  252
            F   GISRDSMHKR+AT GKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+ VRGG VKWR
Sbjct  33   FLHAGISRDSMHKRQATSGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVYVRGGYVKWR  92

Query  253  ALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQH  432
            AL+LDT NYSWGSEA+TRKT ILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL H
Sbjct  93   ALQLDTCNYSWGSEALTRKTGILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTH  152

Query  433  YAVDIGRKKK  462
            Y VDIGRKKK
Sbjct  153  YGVDIGRKKK  162



>ref|XP_006648644.1| PREDICTED: 40S ribosomal protein S8-like [Oryza brachyantha]
Length=213

 Score =   231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRR+TGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRSTGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGR  453
            WGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY VDIGR
Sbjct  61   WGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGR  117



>ref|XP_009403610.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=220

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LD+GNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHY V
Sbjct  61   LDSGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGV  120

Query  442  DIGRKKKGP  468
            +IGRKKK P
Sbjct  121  EIGRKKKAP  129



>gb|KHM99496.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   231 bits (589),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/127 (96%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_003532158.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
Length=219

 Score =   231 bits (589),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+K+WRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_009413565.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=222

 Score =   231 bits (588),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LD+GNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWY QHY +
Sbjct  61   LDSGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYFQHYGI  120

Query  442  DIGRKKKGP  468
            +IGRKKK P
Sbjct  121  EIGRKKKAP  129



>ref|XP_006601753.1| PREDICTED: uncharacterized protein LOC100500112 isoform X1 [Glycine 
max]
 gb|KHN21285.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   230 bits (587),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ+ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVK+AIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKNAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGRKKK
Sbjct  121  EIGRKKK  127



>ref|XP_006833291.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
 gb|ERM98569.1| hypothetical protein AMTR_s00109p00031400 [Amborella trichopoda]
Length=218

 Score =   230 bits (587),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGI  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|NP_001240243.1| uncharacterized protein LOC100813170 [Glycine max]
 gb|ACU18370.1| unknown [Glycine max]
 gb|KHN10948.1| 40S ribosomal protein S8 [Glycine soja]
Length=217

 Score =   230 bits (587),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 126/127 (99%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ+ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGRKKK
Sbjct  121  EIGRKKK  127



>ref|XP_004510234.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=217

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGRKKK
Sbjct  121  EIGRKKK  127



>ref|XP_009406344.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=221

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LD GNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY V
Sbjct  61   LDHGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKGP  468
            +IGRKKK P
Sbjct  121  EIGRKKKAP  129



>ref|XP_009378162.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGRKKK
Sbjct  121  EIGRKKK  127



>ref|XP_009349000.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=221

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGRKKK
Sbjct  121  EIGRKKK  127



>gb|AFK47179.1| unknown [Medicago truncatula]
 gb|KEH18114.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=215

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRR TGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_009373606.1| PREDICTED: 40S ribosomal protein S8 [Pyrus x bretschneideri]
Length=221

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGRKKK
Sbjct  121  EIGRKKK  127



>gb|ACJ86093.1| unknown [Medicago truncatula]
 gb|AFK33939.1| unknown [Medicago truncatula]
 gb|KEH22555.1| 40S ribosomal S8-like protein [Medicago truncatula]
Length=217

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+K+WRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_011095494.1| PREDICTED: 40S ribosomal protein S8 [Sesamum indicum]
Length=219

 Score =   229 bits (583),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|NP_001236970.1| uncharacterized protein LOC100500112 [Glycine max]
 gb|ACU14990.1| unknown [Glycine max]
Length=217

 Score =   228 bits (582),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ+ANTKLSSNKT+RRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQAANTKLSSNKTIRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR LDVVYNASNNELVRTQTLVK+AIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRTLDVVYNASNNELVRTQTLVKNAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGRKKK
Sbjct  121  EIGRKKK  127



>ref|XP_010541736.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=222

 Score =   228 bits (581),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYELGR +ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKGP  468
            +IGRKKK P
Sbjct  121  EIGRKKKTP  129



>ref|XP_009371092.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=220

 Score =   228 bits (580),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKK  459
            +IGRKK
Sbjct  121  EIGRKK  126



>emb|CDY60374.1| BnaCnng36150D, partial [Brassica napus]
Length=228

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   ADMGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRA  255
            A MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWRA
Sbjct  1    ATMGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRA  60

Query  256  LRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY  435
            LRLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY
Sbjct  61   LRLDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHY  120

Query  436  AVDIGRKKK  462
             V++GRKKK
Sbjct  121  GVEVGRKKK  129



>ref|XP_008799563.1| PREDICTED: 40S ribosomal protein S8-like [Phoenix dactylifera]
Length=146

 Score =   224 bits (571),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_004148331.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 ref|XP_004162922.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN61144.1| hypothetical protein Csa_2G059750 [Cucumis sativus]
Length=219

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRR TGGK+KAWRKKRKYELGRQ ANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_008337490.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=221

 Score =   226 bits (576),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGR+KK
Sbjct  121  EIGRRKK  127



>ref|XP_010905161.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=224

 Score =   226 bits (576),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_006409551.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
 gb|ESQ51004.1| hypothetical protein EUTSA_v10022838mg [Eutrema salsugineum]
Length=225

 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_002529032.1| 40S ribosomal protein S8, putative [Ricinus communis]
 gb|EEF33343.1| 40S ribosomal protein S8, putative [Ricinus communis]
Length=219

 Score =   225 bits (574),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010913108.1| PREDICTED: 40S ribosomal protein S8 isoform X1 [Elaeis guineensis]
Length=224

 Score =   226 bits (575),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_006286561.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
 gb|EOA19459.1| hypothetical protein CARUB_v10001914mg [Capsella rubella]
Length=221

 Score =   226 bits (575),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_010907235.1| PREDICTED: 40S ribosomal protein S8-like [Elaeis guineensis]
Length=223

 Score =   226 bits (575),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>gb|ABR13294.1| putative 40S ribosomal protein S8 [Prunus dulcis]
Length=140

 Score =   223 bits (567),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +1

Query  64   ALLFADMGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNV  243
            +L    MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNV
Sbjct  22   SLQSGTMGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNV  81

Query  244  KWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW  420
            KWRALRLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW
Sbjct  82   KWRALRLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQW  140



>ref|XP_009131790.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=226

 Score =   226 bits (575),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_006400597.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
 gb|ESQ42050.1| hypothetical protein EUTSA_v10014589mg [Eutrema salsugineum]
Length=226

 Score =   226 bits (575),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_003520991.1| PREDICTED: 40S ribosomal protein S8-like [Glycine max]
 gb|KHN05782.1| 40S ribosomal protein S8 [Glycine soja]
Length=220

 Score =   225 bits (574),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010646836.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=220

 Score =   225 bits (574),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATG K+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGSKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|XP_008809644.1| PREDICTED: 40S ribosomal protein S8 [Phoenix dactylifera]
Length=223

 Score =   225 bits (574),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+Q+DAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQIDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010693327.1| PREDICTED: 40S ribosomal protein S8-like [Beta vulgaris subsp. 
vulgaris]
Length=217

 Score =   225 bits (573),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            D+GR
Sbjct  121  DVGR  124



>ref|XP_004290159.1| PREDICTED: 40S ribosomal protein S8-like [Fragaria vesca subsp. 
vesca]
Length=224

 Score =   225 bits (573),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTK+SSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPF+QWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFRQWYLQHYNV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|XP_010913109.1| PREDICTED: 40S ribosomal protein S8 isoform X2 [Elaeis guineensis]
Length=222

 Score =   225 bits (573),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_002275094.1| PREDICTED: 40S ribosomal protein S8 [Vitis vinifera]
Length=219

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGL  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>gb|EYU33688.1| hypothetical protein MIMGU_mgv1a013525mg [Erythranthe guttata]
Length=218

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRR TGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            DI RKKK
Sbjct  121  DISRKKK  127



>ref|XP_009619873.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=220

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 123/128 (96%), Gaps = 1/128 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSN-KTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RLDTGNYSWGSEA+TRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY 
Sbjct  61   RLDTGNYSWGSEAITRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  439  VDIGRKKK  462
            VDIGRKKK
Sbjct  121  VDIGRKKK  128



>ref|XP_009361080.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009348460.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>sp|O81361.1|RS8_PRUAR RecName: Full=40S ribosomal protein S8 [Prunus armeniaca]
 gb|AAC24583.1| 40S ribosomal protein S8 [Prunus armeniaca]
Length=221

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_009770276.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=220

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 123/128 (96%), Gaps = 1/128 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSN-KTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RLDTGNYSWGSEA+TRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY 
Sbjct  61   RLDTGNYSWGSEAITRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  439  VDIGRKKK  462
            VDIGRKKK
Sbjct  121  VDIGRKKK  128



>ref|XP_003551567.1| PREDICTED: 40S ribosomal protein S8 [Glycine max]
 gb|KHN28407.1| 40S ribosomal protein S8 [Glycine soja]
Length=219

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAATRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            ++GR
Sbjct  121  EVGR  124



>gb|EYU33690.1| hypothetical protein MIMGU_mgv1a013952mg [Erythranthe guttata]
Length=205

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRR TGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKKG  465
            DI RKKK 
Sbjct  121  DISRKKKA  128



>ref|XP_008366424.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_009364625.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009364657.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
 ref|XP_009335423.1| PREDICTED: 40S ribosomal protein S8-like [Pyrus x bretschneideri]
Length=222

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010675861.1| PREDICTED: 40S ribosomal protein S8 [Beta vulgaris subsp. vulgaris]
Length=217

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>gb|ACU19111.1| unknown [Glycine max]
Length=220

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_008222788.1| PREDICTED: 40S ribosomal protein S8 [Prunus mume]
Length=221

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>gb|ACU16398.1| unknown [Glycine max]
Length=256

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAATRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            ++GR
Sbjct  121  EVGR  124



>ref|XP_010270147.1| PREDICTED: 40S ribosomal protein S8-like [Nelumbo nucifera]
Length=221

 Score =   224 bits (570),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGL  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|XP_008466734.1| PREDICTED: 40S ribosomal protein S8-2 [Cucumis melo]
Length=220

 Score =   224 bits (570),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|XP_002873989.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50248.1| ribosomal protein S8 [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   224 bits (570),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_007223947.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
 gb|EMJ25146.1| hypothetical protein PRUPE_ppa011148mg [Prunus persica]
Length=222

 Score =   224 bits (570),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>emb|CDP03936.1| unnamed protein product [Coffea canephora]
Length=213

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            WGSEAVTRKTRILDV+YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY VDIGRKKK
Sbjct  61   WGSEAVTRKTRILDVMYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK  120

Query  463  GP  468
            GP
Sbjct  121  GP  122



>gb|AGV54796.1| 40S ribosomal protein S8 [Phaseolus vulgaris]
Length=218

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELG   ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGPPPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQ Y +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQPYGL  120

Query  442  DIGRKKK  462
            DIGRKKK
Sbjct  121  DIGRKKK  127



>ref|XP_009765854.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana sylvestris]
Length=221

 Score =   223 bits (569),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 124/128 (97%), Gaps = 1/128 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSN-KTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKL +N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVTNAKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY 
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  439  VDIGRKKK  462
            VDIGRKKK
Sbjct  121  VDIGRKKK  128



>ref|XP_008227073.1| PREDICTED: 40S ribosomal protein S8-like [Prunus mume]
Length=225

 Score =   223 bits (568),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010535902.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=220

 Score =   223 bits (568),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYELGR +ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAIVQVD APFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDVAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_009594581.1| PREDICTED: 40S ribosomal protein S8-2-like [Nicotiana tomentosiformis]
Length=221

 Score =   223 bits (568),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 124/128 (97%), Gaps = 1/128 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSN-KTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKL +N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVTNAKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY 
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  439  VDIGRKKK  462
            VDIGRKKK
Sbjct  121  VDIGRKKK  128



>ref|XP_007211997.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 ref|XP_007211998.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13196.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
 gb|EMJ13197.1| hypothetical protein PRUPE_ppa011067mg [Prunus persica]
Length=225

 Score =   223 bits (568),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_010327196.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=221

 Score =   223 bits (568),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 124/128 (97%), Gaps = 1/128 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSN-KTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRRATGGK+KAWRKKRKYE+GRQSANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY 
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  439  VDIGRKKK  462
            V+IGRKKK
Sbjct  121  VEIGRKKK  128



>ref|XP_006352532.1| PREDICTED: 40S ribosomal protein S8 [Solanum tuberosum]
Length=221

 Score =   223 bits (567),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 124/128 (97%), Gaps = 1/128 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSN-KTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRRATGGK+KAWRKKRKYE+GRQSANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY 
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  439  VDIGRKKK  462
            V+IGRKKK
Sbjct  121  VEIGRKKK  128



>gb|AFK37035.1| unknown [Lotus japonicus]
Length=218

 Score =   223 bits (567),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSE VTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSETVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            D+GR
Sbjct  121  DLGR  124



>ref|XP_008451649.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis melo]
Length=219

 Score =   223 bits (567),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRR TGGK+KAWRKKRKYELGRQ ANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|NP_001275100.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
 gb|ABB72814.1| putative 40S ribosomal protein S8-like protein [Solanum tuberosum]
Length=221

 Score =   223 bits (567),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 1/128 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSN-KTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRRATGGK+K+WRKKRKYE+GRQSANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYEMGRQSANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY 
Sbjct  61   RLDTGNYSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYG  120

Query  439  VDIGRKKK  462
            V+IGRKKK
Sbjct  121  VEIGRKKK  128



>ref|XP_008364326.1| PREDICTED: 40S ribosomal protein S8-like [Malus domestica]
 ref|XP_008345024.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
 ref|XP_008355313.1| PREDICTED: 40S ribosomal protein S8 [Malus domestica]
Length=222

 Score =   223 bits (567),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSE VTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSETVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_004492266.1| PREDICTED: 40S ribosomal protein S8-like [Cicer arietinum]
Length=218

 Score =   223 bits (567),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK AIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKGAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>gb|AFK33351.1| unknown [Lotus japonicus]
Length=218

 Score =   223 bits (567),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWR+KRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRRKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSE VTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSETVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            D+GR
Sbjct  121  DLGR  124



>ref|XP_006281069.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
 gb|EOA13967.1| hypothetical protein CARUB_v10027092mg [Capsella rubella]
Length=220

 Score =   223 bits (567),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKKWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSE VTRKTRILDV YNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSETVTRKTRILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>gb|KFK31870.1| hypothetical protein AALP_AA6G169300 [Arabis alpina]
Length=219

 Score =   222 bits (566),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLS NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_003626942.1| Ribosomal protein S8 [Medicago truncatula]
Length=605

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  73   FADMGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWR  252
            F  MGISRDSMHKRR TGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWR
Sbjct  388  FFKMGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWR  447

Query  253  ALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQH  432
            ALRLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQH
Sbjct  448  ALRLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQH  507

Query  433  YAVDIGRKKK  462
            Y VDIGRKKK
Sbjct  508  YGVDIGRKKK  517


 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 114/159 (72%), Gaps = 30/159 (19%)
 Frame = +1

Query  76   ADMGISRDSMHKRRATGGKQKAWRKKRK------------------------------YE  165
            A   ISRDS  KR ATGGK+K   KKRK                              YE
Sbjct  70   ACACISRDSRDKRLATGGKRKTCIKKRKFLVRLLFYNFVTLLWNLRFLMNMELGLAYRYE  129

Query  166  LGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASN  345
            LGRQ ANTKLSSNKTVR IRVRGGN+K RALRLDTGN SWGSEAVTRK+R+L+VVYNASN
Sbjct  130  LGRQPANTKLSSNKTVRSIRVRGGNLKCRALRLDTGNISWGSEAVTRKSRLLNVVYNASN  189

Query  346  NELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            NELVRTQTLVKSAIVQVDAAPFKQWYLQHY V+IG KKK
Sbjct  190  NELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGNKKK  228



>ref|XP_010519957.1| PREDICTED: 40S ribosomal protein S8-1 [Tarenaya hassleriana]
Length=222

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GR +ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRVAANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>ref|XP_009405538.1| PREDICTED: 40S ribosomal protein S8-like [Musa acuminata subsp. 
malaccensis]
Length=224

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDA PFK WYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDATPFKHWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_006856815.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
 gb|ERN18282.1| hypothetical protein AMTR_s00055p00155570 [Amborella trichopoda]
Length=218

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/123 (94%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+K+WRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN SWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNCSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIG  450
            D+G
Sbjct  121  DLG  123



>ref|XP_004160707.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
Length=221

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAV+RKTRILDVVYNASNNELVRTQTLVKSA+VQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVSRKTRILDVVYNASNNELVRTQTLVKSAVVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|XP_004149800.1| PREDICTED: 40S ribosomal protein S8-like [Cucumis sativus]
 gb|KGN47709.1| hypothetical protein Csa_6G382970 [Cucumis sativus]
Length=222

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSS+K++RRIRVRGGNVKWRA R
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSDKSIRRIRVRGGNVKWRAFR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAV+RKTRILDVVYNASNNELVRTQTLVKSA+VQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVSRKTRILDVVYNASNNELVRTQTLVKSAVVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>gb|KFK26269.1| hypothetical protein AALP_AA8G225000 [Arabis alpina]
Length=223

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLS NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSGNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>emb|CDY35814.1| BnaC09g37460D [Brassica napus]
Length=258

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +1

Query  70   LFADMGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKW  249
            + A MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKW
Sbjct  29   IIATMGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKW  88

Query  250  RALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQ  429
            RALRLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQ
Sbjct  89   RALRLDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQ  148

Query  430  HYAVDIGR  453
            HY V++GR
Sbjct  149  HYGVEVGR  156



>emb|CDX92472.1| BnaA10g15110D [Brassica napus]
Length=246

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +1

Query  73   FADMGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWR  252
             A MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWR
Sbjct  17   IATMGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWR  76

Query  253  ALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQH  432
            ALRLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQH
Sbjct  77   ALRLDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQH  136

Query  433  YAVDIGR  453
            Y V++GR
Sbjct  137  YGVEVGR  143



>ref|XP_009596732.1| PREDICTED: 40S ribosomal protein S8 [Nicotiana tomentosiformis]
Length=223

 Score =   221 bits (563),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DI  447
            DI
Sbjct  121  DI  122



>ref|XP_010243157.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Nelumbo 
nucifera]
Length=217

 Score =   220 bits (561),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLV+SAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVRSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DI  447
            DI
Sbjct  121  DI  122



>ref|XP_010243156.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Nelumbo 
nucifera]
Length=219

 Score =   221 bits (562),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLV+SAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEHVTRKTRILDVVYNASNNELVRTQTLVRSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DI  447
            DI
Sbjct  121  DI  122



>ref|XP_009120819.1| PREDICTED: 40S ribosomal protein S8-1 [Brassica rapa]
Length=227

 Score =   221 bits (562),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            ++GR
Sbjct  121  EVGR  124



>ref|XP_004247043.1| PREDICTED: 40S ribosomal protein S8 [Solanum lycopersicum]
Length=222

 Score =   220 bits (561),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+K+WRKKRKYELGRQ ANTKLS+NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLSNNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY  
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGA  120

Query  442  DI  447
            DI
Sbjct  121  DI  122



>gb|ACU16800.1| unknown [Glycine max]
Length=243

 Score =   221 bits (563),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAW KKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWGKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>ref|XP_006346168.1| PREDICTED: 40S ribosomal protein S8-like [Solanum tuberosum]
Length=220

 Score =   220 bits (561),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 1/128 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSN-KTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKL  N KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLVPNAKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RLDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY 
Sbjct  61   RLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYG  120

Query  439  VDIGRKKK  462
            V+IGRKKK
Sbjct  121  VEIGRKKK  128



>ref|XP_010420870.1| PREDICTED: 40S ribosomal protein S8-1-like [Camelina sativa]
Length=223

 Score =   220 bits (561),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            ++GR
Sbjct  121  EVGR  124



>ref|XP_010493138.1| PREDICTED: 40S ribosomal protein S8-1 [Camelina sativa]
Length=223

 Score =   220 bits (561),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNY+WGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYAWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DIGR  453
            ++GR
Sbjct  121  EVGR  124



>gb|EYU39185.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=194

 Score =   219 bits (558),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSS-NKTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRR TGGK+KAWRKKRKYELGRQ ANTKL + NKTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLDTVNKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RL+TGNYSWGSEA+TRKTR+LDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYL HY 
Sbjct  61   RLNTGNYSWGSEAITRKTRVLDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLTHYG  120

Query  439  VDIGRKKKG  465
            VDIGRKKKG
Sbjct  121  VDIGRKKKG  129



>ref|XP_011461093.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
 ref|XP_011461096.1| PREDICTED: 40S ribosomal protein S8 [Fragaria vesca subsp. vesca]
Length=225

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWY  HY V
Sbjct  61   LDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYSTHYGV  120

Query  442  DIGR  453
            +IGR
Sbjct  121  EIGR  124



>gb|EYU39184.1| hypothetical protein MIMGU_mgv1a013531mg [Erythranthe guttata]
Length=218

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 1/129 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSS-NKTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRR TGGK+KAWRKKRKYELGRQ ANTKL + NKTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRETGGKKKAWRKKRKYELGRQPANTKLDTVNKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RL+TGNYSWGSEA+TRKTR+LDVVYNASNNELVRT+TLVKSAI+QVDAAPFKQWYL HY 
Sbjct  61   RLNTGNYSWGSEAITRKTRVLDVVYNASNNELVRTKTLVKSAIIQVDAAPFKQWYLTHYG  120

Query  439  VDIGRKKKG  465
            VDIGRKKKG
Sbjct  121  VDIGRKKKG  129



>emb|CDX88842.1| BnaA03g08070D [Brassica napus]
Length=239

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = +1

Query  55   GEEALLFAD--MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRV  228
            G  +LL  D  +GISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRV
Sbjct  2    GTLSLLRLDSVLGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRV  61

Query  229  RGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAP  408
            RGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAP
Sbjct  62   RGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAP  121

Query  409  FKQWYLQHYAVDIGR  453
            FKQWYLQHY V++GR
Sbjct  122  FKQWYLQHYGVEVGR  136



>ref|XP_009602561.1| PREDICTED: 40S ribosomal protein S8-like [Nicotiana tomentosiformis]
Length=224

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/122 (95%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTK+S NKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKISGNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V
Sbjct  61   LDTGNYSWGSEATTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGV  120

Query  442  DI  447
            DI
Sbjct  121  DI  122



>ref|XP_010520566.1| PREDICTED: 40S ribosomal protein S8-1-like [Tarenaya hassleriana]
Length=224

 Score =   218 bits (555),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYELGR +ANTKLSSNKTVRR+RVRGGN+KWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYELGRVAANTKLSSNKTVRRLRVRGGNIKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEA TRK+RILDVVYNASNNELVRT+TLVKSAIVQ+DAAPFKQWYL HY V
Sbjct  61   LDTGNFSWGSEAATRKSRILDVVYNASNNELVRTKTLVKSAIVQIDAAPFKQWYLSHYGV  120

Query  442  DIGRKKK  462
            ++GRKKK
Sbjct  121  EVGRKKK  127



>gb|ACI15738.1| putative 40S ribosomal protein S8-like protein [Picrorhiza kurrooa]
Length=216

 Score =   217 bits (553),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            M  S  SMHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MSTSLLSMHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK AI+QVDAAPFKQWYLQHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKGAIIQVDAAPFKQWYLQHYGV  120

Query  442  DIGRKKK  462
            +IGRKKK
Sbjct  121  EIGRKKK  127



>ref|NP_197529.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
 sp|Q93VG5.1|RS81_ARATH RecName: Full=40S ribosomal protein S8-1 [Arabidopsis thaliana]
 gb|AAK93614.1| unknown protein [Arabidopsis thaliana]
 gb|AAK96530.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAL31236.1| AT5g20290/F5O24_180 [Arabidopsis thaliana]
 gb|AAM14111.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64526.1| 40S ribosomal protein S8-like [Arabidopsis thaliana]
 dbj|BAE98439.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92825.1| 40S ribosomal protein S8-1 [Arabidopsis thaliana]
Length=222

 Score =   216 bits (550),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYE+GRQ ANTKLSSNKTVRRIRVRGGNVKWRALR
Sbjct  1    MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEA TRKTR+LDVVYNASNNELVRT+TLVKSAIVQVDAAPFKQWYL HY V
Sbjct  61   LDTGNYSWGSEATTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGV  120

Query  442  DIGR  453
            ++GR
Sbjct  121  ELGR  124



>gb|AET01418.2| 40S ribosomal protein S8 [Medicago truncatula]
Length=288

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  88   ISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLD  267
            ISRDS  KR ATGGK+K   KKRKYELGRQ ANTKLSSNKTVR IRVRGGN+K RALRLD
Sbjct  74   ISRDSRDKRLATGGKRKTCIKKRKYELGRQPANTKLSSNKTVRSIRVRGGNLKCRALRLD  133

Query  268  TGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDI  447
            TGN SWGSEAVTRK+R+L+VVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V+I
Sbjct  134  TGNISWGSEAVTRKSRLLNVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEI  193

Query  448  GRKKK  462
            G KKK
Sbjct  194  GNKKK  198



>emb|CEG02139.1| Ribosomal protein S8e/ribosomal biogenesis NSA2 [Ostreococcus 
tauri]
Length=217

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYELGRQ ANTKLSSN TVR++R RGGNVK RALR
Sbjct  1    MGISRDSLHKRRATGGKQKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNVKHRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSE  TRKTRILDVVYNASNNELVRT+TLVKSA+V VDAAPF+ WY QHY  
Sbjct  61   LDTGNYSWGSENCTRKTRILDVVYNASNNELVRTKTLVKSAVVAVDAAPFRAWYAQHYGK  120

Query  442  DIGRKKK  462
             IG K K
Sbjct  121  KIGIKVK  127



>gb|ABK21933.1| unknown [Picea sitchensis]
Length=221

 Score =   215 bits (547),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HK+RATGGK+K WRKKRKYELGRQ + TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>gb|ABK22298.1| unknown [Picea sitchensis]
Length=222

 Score =   215 bits (547),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HK+RATGGK+K WRKKRKYELGRQ + TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>gb|ABK21921.1| unknown [Picea sitchensis]
Length=221

 Score =   214 bits (546),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HK+RATGGK+K WRKKRKYELGRQ + TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHY +
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>gb|ABR16896.1| unknown [Picea sitchensis]
Length=221

 Score =   213 bits (542),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HK+RATGGK+K WRKKRKYELGRQ + TKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSLHKKRATGGKKKVWRKKRKYELGRQPSMTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSE VTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPF+QWY QHY +
Sbjct  61   LDTGNYSWGSEPVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFRQWYEQHYGL  120

Query  442  DIGR  453
            DIGR
Sbjct  121  DIGR  124



>ref|XP_001422585.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP00902.1| Ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=220

 Score =   213 bits (542),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYELGRQ ANTKLSSN TVR++R RGGN+K RALR
Sbjct  1    MGISRDSLHKRRATGGKQKPWRKKRKYELGRQPANTKLSSNVTVRQVRCRGGNIKHRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN++WGSE  TRKTRILDVVYNASNNELVRT+TLVKSA++ VDAAPF+ WY QHY  
Sbjct  61   LDTGNFAWGSENCTRKTRILDVVYNASNNELVRTKTLVKSAVIAVDAAPFRAWYAQHYGK  120

Query  442  DIGRKKK  462
             IG K K
Sbjct  121  KIGIKVK  127



>gb|KHG14255.1| 40S ribosomal S8 [Gossypium arboreum]
Length=210

 Score =   212 bits (540),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRRATGGK+KAWRKKRKYELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRATGGKKKAWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGR  453
            WGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY +DIGR
Sbjct  61   WGSEALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR  117



>emb|CBI26725.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   211 bits (536),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = +1

Query  103  MHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYS  282
            MHKRRATGGK+KAWRKKRKYELGRQ A+TKLSSNKTVRR+RVRGGNVKWRALRLDTGNYS
Sbjct  1    MHKRRATGGKKKAWRKKRKYELGRQPASTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYS  60

Query  283  WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGR  453
            WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAI+QVDAAPFKQWYLQHY +DIGR
Sbjct  61   WGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIIQVDAAPFKQWYLQHYGLDIGR  117



>ref|XP_011089042.1| PREDICTED: 40S ribosomal protein S8-like [Sesamum indicum]
Length=220

 Score =   210 bits (534),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 117/123 (95%), Gaps = 1/123 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSS-NKTVRRIRVRGGNVKWRAL  258
            MGISRDSMHKRRATGGK+K+WRKKRKYELGRQ ANTKL +  KTVRRIRVRGGNVKWRAL
Sbjct  1    MGISRDSMHKRRATGGKKKSWRKKRKYELGRQPANTKLDTLQKTVRRIRVRGGNVKWRAL  60

Query  259  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYA  438
            RL+TGNYSWGSEA+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY 
Sbjct  61   RLNTGNYSWGSEAITRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYG  120

Query  439  VDI  447
            VDI
Sbjct  121  VDI  123



>gb|EPS68663.1| hypothetical protein M569_06106, partial [Genlisea aurea]
Length=217

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 120/127 (94%), Gaps = 1/127 (1%)
 Frame = +1

Query  85   GISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKL-SSNKTVRRIRVRGGNVKWRALR  261
            GISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKL ++ KTVRR+RVRGGNVKWRALR
Sbjct  1    GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLDTTQKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            L+TGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIV VDAAPFKQWY  HY V
Sbjct  61   LNTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVMVDAAPFKQWYSTHYGV  120

Query  442  DIGRKKK  462
            +IG+KKK
Sbjct  121  EIGKKKK  127



>gb|EPS68749.1| hypothetical protein M569_06019 [Genlisea aurea]
Length=411

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +1

Query  85   GISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKL-SSNKTVRRIRVRGGNVKWRALR  261
            GISRDSMHKRRATGGK+KAWRKKRKYELGRQ ANTKL ++ KTVRRIRVRGGNVKWRALR
Sbjct  194  GISRDSMHKRRATGGKKKAWRKKRKYELGRQPANTKLDTTTKTVRRIRVRGGNVKWRALR  253

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            L+TGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIV VDA PFKQWYL HY V
Sbjct  254  LNTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVMVDATPFKQWYLTHYGV  313

Query  442  DIGRKKKGP  468
            DIG+K+K P
Sbjct  314  DIGKKRKLP  322



>ref|XP_001761026.1| predicted protein [Physcomitrella patens]
 gb|EDQ74093.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   207 bits (527),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS HKRRATGGK+K+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AIVQVDAAPF+ WY QHY V
Sbjct  61   LDTGNYSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIVQVDAAPFRTWYSQHYGV  120

Query  442  DIG  450
            +IG
Sbjct  121  EIG  123



>ref|XP_005844426.1| hypothetical protein CHLNCDRAFT_139122 [Chlorella variabilis]
 gb|EFN52324.1| hypothetical protein CHLNCDRAFT_139122 [Chlorella variabilis]
Length=233

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 120/141 (85%), Gaps = 5/141 (4%)
 Frame = +1

Query  40   CSAEEGEEALLFADMGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRR  219
            CS E G      +  GISRDS+HKRRATGGKQK WRKKRKYELGRQ A TKLSSN  VRR
Sbjct  9    CSVERGA-----SHWGISRDSLHKRRATGGKQKPWRKKRKYELGRQPAMTKLSSNVCVRR  63

Query  220  IRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVD  399
            +RVRGGN K+RALRLD GN+SWGSEAVTRK RILDV YNASNNELVRTQTLVKSAI+Q+D
Sbjct  64   VRVRGGNSKFRALRLDHGNFSWGSEAVTRKVRILDVSYNASNNELVRTQTLVKSAIIQID  123

Query  400  AAPFKQWYLQHYAVDIGRKKK  462
            AAPFKQWY QHY +++G+KKK
Sbjct  124  AAPFKQWYQQHYGLEVGQKKK  144



>ref|XP_011397165.1| 40S ribosomal protein S8 [Auxenochlorella protothecoides]
 gb|KFM24278.1| 40S ribosomal protein S8 [Auxenochlorella protothecoides]
Length=191

 Score =   205 bits (522),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQKAWRKKRKYELGRQ ANTKLSSN TVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSLHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNVTVRRVRVRGGNSKFRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LD+GN+SWGSEA TRKTRILDV YNASNNELVRTQTLVK+AI+Q+DAAPFKQWY QHY V
Sbjct  61   LDSGNFSWGSEATTRKTRILDVSYNASNNELVRTQTLVKNAIIQIDAAPFKQWYQQHYGV  120

Query  442  D  444
            +
Sbjct  121  E  121



>ref|XP_005648786.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
 gb|EIE24242.1| 40S ribosomal protein S8 [Coccomyxa subellipsoidea C-169]
Length=214

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRR TGGKQK WRKKRK+ELGRQ ANTKLSSN TVRR+RVRGGN K+RALR
Sbjct  1    MGISRDSLHKRRLTGGKQKTWRKKRKFELGRQPANTKLSSNVTVRRVRVRGGNFKFRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LD+GN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVKSAIVQVDA PFKQ+Y QHY V
Sbjct  61   LDSGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKSAIVQVDATPFKQFYTQHYGV  120

Query  442  DIG  450
            + G
Sbjct  121  EAG  123



>ref|XP_001773385.1| predicted protein [Physcomitrella patens]
 gb|EDQ61758.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   206 bits (523),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS HKRRATGGK+K+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTRILDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  442  DIG  450
            +IG
Sbjct  121  EIG  123



>ref|XP_001777813.1| predicted protein [Physcomitrella patens]
 gb|EDQ57351.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   205 bits (522),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS HKRRATGGK+K+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNFKFRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  442  DIG  450
            +IG
Sbjct  121  EIG  123



>gb|KJB81682.1| hypothetical protein B456_013G156600 [Gossypium raimondii]
Length=196

 Score =   204 bits (520),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +1

Query  157  KYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  336
            +YELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN
Sbjct  5    RYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  64

Query  337  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY +DIGRKKK
Sbjct  65   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGRKKK  106



>ref|XP_007049645.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
 gb|EOX93802.1| 40S ribosomal protein S8 isoform 3 [Theobroma cacao]
Length=195

 Score =   204 bits (519),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +1

Query  157  KYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  336
            +YELGRQ ANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN
Sbjct  8    RYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  67

Query  337  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY VDIGRKKK
Sbjct  68   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVDIGRKKK  109



>ref|XP_001777587.1| predicted protein [Physcomitrella patens]
 gb|EDQ57630.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   205 bits (521),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS HKRRATGGK+K+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  442  DIG  450
            +IG
Sbjct  121  EIG  123



>ref|XP_001780988.1| predicted protein [Physcomitrella patens]
 gb|EDQ54172.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   205 bits (521),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS HKRRATGGK+K+WRKKRKYELGRQ A TKLSSNKTVRRIRVRGGN K+RALR
Sbjct  1    MGISRDSTHKRRATGGKKKSWRKKRKYELGRQGAMTKLSSNKTVRRIRVRGGNSKFRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEAVTRKTR+LDVVYNASNNELVRTQTLVK+AI+QVDAAPF+ WY QHY V
Sbjct  61   LDTGNFSWGSEAVTRKTRVLDVVYNASNNELVRTQTLVKNAIIQVDAAPFRTWYSQHYGV  120

Query  442  DIG  450
            +IG
Sbjct  121  EIG  123



>ref|XP_003059699.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55651.1| predicted protein [Micromonas pusilla CCMP1545]
Length=213

 Score =   204 bits (518),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGGKQK WRKKRKYELGRQS NTKLSS+ +VR +R RGGN K+RA+R
Sbjct  1    MGISRDSLHKRRATGGKQKPWRKKRKYELGRQSGNTKLSSSVSVRTVRCRGGNKKFRAIR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LD+GN+SWGSE  T KTRILDV YNASNNELVRT+TLVK+A+VQVDAAPF+ WY QHY  
Sbjct  61   LDSGNFSWGSENTTHKTRILDVNYNASNNELVRTKTLVKNAVVQVDAAPFRAWYQQHYGK  120

Query  442  DIGRKKK  462
             IG K+K
Sbjct  121  KIGIKEK  127



>gb|KDD75705.1| ribosomal protein S8e [Helicosporidium sp. ATCC 50920]
Length=353

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRA+G +   WRKKRK+ELGRQ ANTKLSSN TVR +R RGGN+K+RALR
Sbjct  1    MGISRDSIHKRRASGARPNIWRKKRKFELGRQPANTKLSSNVTVRPVRCRGGNMKYRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LD+GN+SWGSEA TR+TRIL V YNASNNELVRTQTLVKSAIVQVDAAPFK WY Q Y  
Sbjct  61   LDSGNFSWGSEATTRRTRILSVSYNASNNELVRTQTLVKSAIVQVDAAPFKAWYSQRYGT  120

Query  442  DIGRKK  459
            ++GRKK
Sbjct  121  ELGRKK  126



>ref|XP_010926672.1| PREDICTED: 40S ribosomal protein S8-like isoform X2 [Elaeis guineensis]
Length=207

 Score =   202 bits (513),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = +1

Query  148  KKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDV  327
            + R+YELGR+ ANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDV
Sbjct  6    RARRYELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDV  65

Query  328  VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V+IGRKKK
Sbjct  66   VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKK  110



>ref|XP_010926670.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
 ref|XP_010926671.1| PREDICTED: 40S ribosomal protein S8-like isoform X1 [Elaeis guineensis]
Length=212

 Score =   200 bits (509),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +1

Query  154  RKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVY  333
            ++YELGR+ ANTKLSSNKTVRR+RVRGGNVKWRALRLDTGNYSWGSEAVTRKTR+LDVVY
Sbjct  13   KRYELGRRPANTKLSSNKTVRRVRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRVLDVVY  72

Query  334  NASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            NASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V+IGRKKK
Sbjct  73   NASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGRKKK  115



>ref|XP_008647178.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=177

 Score =   197 bits (501),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  160  YELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  339
            YELGRQ ANTKLSSNKTVRR+ VRGGNVKWRALRLDTGNYSWGSEA+TRKTRILDVVYNA
Sbjct  15   YELGRQPANTKLSSNKTVRRVCVRGGNVKWRALRLDTGNYSWGSEALTRKTRILDVVYNA  74

Query  340  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            SNNELVRTQTLVKSAIVQVDAAPFKQWYL HY VDIGRKKK
Sbjct  75   SNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKK  115



>ref|XP_005702569.1| 40S ribosomal protein S8e [Galdieria sulphuraria]
 gb|EME26049.1| 40S ribosomal protein S8e [Galdieria sulphuraria]
Length=207

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGI+RD++HKRR TGGK+  WRKKRKY LGRQ ANTKL   K VR +RVRGGN K+RALR
Sbjct  1    MGITRDTLHKRRLTGGKKAVWRKKRKYNLGRQPANTKLGP-KAVRPVRVRGGNYKFRALR  59

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSE+ +RKTRI+ VVYNASNNELVRT TLVK  IVQ+DA PF+QWY QHY +
Sbjct  60   LDTGNFSWGSESTSRKTRIVAVVYNASNNELVRTNTLVKGCIVQIDATPFRQWYSQHYGI  119

Query  442  DIGRKKK  462
            +IG+KKK
Sbjct  120  EIGKKKK  126



>ref|XP_006369983.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
 gb|ERP66552.1| hypothetical protein POPTR_0001s37140g [Populus trichocarpa]
Length=199

 Score =   197 bits (500),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/98 (96%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +1

Query  160  YELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  339
            YELGRQ A+TKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA
Sbjct  8    YELGRQPASTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  67

Query  340  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGR  453
            SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY +DIGR
Sbjct  68   SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIDIGR  105



>ref|XP_005708143.1| 40S ribosomal protein S8 [Galdieria sulphuraria]
 gb|EME31623.1| 40S ribosomal protein S8 [Galdieria sulphuraria]
Length=175

 Score =   195 bits (495),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGI+RD++HKRR TGGK+  WRKKRKY LGRQ ANTKL   K VR +RVRGGN K+RALR
Sbjct  1    MGITRDTLHKRRLTGGKKAVWRKKRKYNLGRQPANTKLGP-KAVRPVRVRGGNYKFRALR  59

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSE+ +RKTRI+ VVYNASNNELVRT TLVK  IVQ+DA PF+QWY QHY +
Sbjct  60   LDTGNFSWGSESTSRKTRIVAVVYNASNNELVRTNTLVKGCIVQIDATPFRQWYSQHYGI  119

Query  442  DIGRKKK  462
            +IG+KKK
Sbjct  120  EIGKKKK  126



>tpg|DAA42540.1| TPA: putative ribosomal protein S8e family protein [Zea mays]
Length=245

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  115  RATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSE  294
            R  G +  ++    +YELGR  ANTKLSSNKTVRR+ VRGGNVKWRALRLDT NYSWGSE
Sbjct  105  RPVGSRSSSFHGVTRYELGRHPANTKLSSNKTVRRVCVRGGNVKWRALRLDTCNYSWGSE  164

Query  295  AVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            A+TRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY VDIGRKKK
Sbjct  165  ALTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKK  220



>ref|XP_002945874.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52869.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=209

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGG++K WRKK+KYE+GR  ANTKLSSN  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLSSNVAVRTVRVRGGHTKFRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA  FKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATQFKQWYQKHYNV  120

Query  442  DIGRKKKGP  468
            ++G KK  P
Sbjct  121  ELGAKKDQP  129



>ref|XP_001696201.1| ribosomal protein S8, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP08178.1| ribosomal protein S8 [Chlamydomonas reinhardtii]
Length=208

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRRATGG++K WRKK+KYE+GR  ANTKLS+N  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRATGGRKKHWRKKKKYEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA PFKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYNV  120

Query  442  DIGRKKKG  465
            ++G K + 
Sbjct  121  ELGAKNQA  128



>ref|XP_002963298.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
 ref|XP_002974597.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ24117.1| hypothetical protein SELMODRAFT_101634, partial [Selaginella 
moellendorffii]
 gb|EFJ35169.1| hypothetical protein SELMODRAFT_80565, partial [Selaginella moellendorffii]
Length=214

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  85   GISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRL  264
            GISRDS+HKRRATGGK+KAWRKKRKYELGRQ A TKL++ KTVRRIRVRGGN K RALRL
Sbjct  1    GISRDSLHKRRATGGKKKAWRKKRKYELGRQPAMTKLAA-KTVRRIRVRGGNFKLRALRL  59

Query  265  DTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVD  444
            D GNYSWG+EAV RKTRIL+VVYNASNNELVRTQTLVKSAIVQVDA PF+ WY QHY VD
Sbjct  60   DAGNYSWGTEAVARKTRILEVVYNASNNELVRTQTLVKSAIVQVDATPFRAWYNQHYGVD  119

Query  445  IGRKKK  462
            + RKKK
Sbjct  120  LSRKKK  125



>ref|XP_002505425.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66683.1| predicted protein [Micromonas sp. RCC299]
Length=215

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRR TGGKQK WRKKRKYELGRQ ANTKLSS+  VR +R RGGN K+RALR
Sbjct  1    MGISRDSLHKRRLTGGKQKPWRKKRKYELGRQPANTKLSSHVDVRVVRCRGGNKKFRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LD GN+SWGSE VTRK RILDV YNASNNELVRT+TLVK A++ +DA+ F+ WY QHY  
Sbjct  61   LDHGNFSWGSENVTRKARILDVCYNASNNELVRTKTLVKGAVIAIDASEFRSWYQQHYGK  120

Query  442  DIGRKKK  462
             IG K K
Sbjct  121  KIGIKVK  127



>gb|ABA01100.1| 40S ribosomal protein S8 [Chlamydomonas incerta]
Length=208

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS+HKRR TGG++K WRKK+KYE+GR  ANTKLS+N  VR +RVRGG+ K+RALR
Sbjct  1    MGISRDSLHKRRDTGGRKKHWRKKKKYEMGRVPANTKLSTNVAVRTVRVRGGHTKFRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA PFKQWY +HY V
Sbjct  61   LDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYNV  120

Query  442  DIGRKKK  462
            ++G K +
Sbjct  121  ELGAKSQ  127



>gb|AFW73090.1| putative ribosomal protein S8e family protein [Zea mays]
Length=423

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +1

Query  157  KYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  336
            +YELGRQ ANTKLSSNKTVRR+ VRGGNVKWRALRLDTGNYSWGSEA+TRKTRILDVVYN
Sbjct  192  RYELGRQPANTKLSSNKTVRRVCVRGGNVKWRALRLDTGNYSWGSEALTRKTRILDVVYN  251

Query  337  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYL HY VDIGRKKK
Sbjct  252  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKK  293



>ref|XP_003604700.1| Ribosomal protein S8 [Medicago truncatula]
Length=280

 Score =   194 bits (492),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  148  KKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDV  327
            KKRKYELGRQ ANTKLSSNKT+R IRVRGGNVK RALRLDTGN SWGSEAVTRKTR+L+V
Sbjct  4    KKRKYELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRLLNV  63

Query  328  VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V+IG  KK
Sbjct  64   VYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGSAKK  108



>gb|EPZ31448.1| 40S ribosomal protein S8-B [Rozella allomycis CSF55]
Length=205

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS HKR  TG K+  +RKKRK+ELGRQ ANTKL + K +  +RVRGGN K+RA+R
Sbjct  1    MGISRDSRHKRSHTGAKRAQYRKKRKFELGRQPANTKLGA-KRIHPVRVRGGNTKFRAMR  59

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEA+TRKTRI+DVVYNASNNELVRT+TLVKSAIVQ+DA PF+QWY  HY  
Sbjct  60   LDTGNFSWGSEAITRKTRIIDVVYNASNNELVRTKTLVKSAIVQIDATPFRQWYEAHYGS  119

Query  442  DIGRKK  459
             +G+KK
Sbjct  120  LLGKKK  125



>gb|AFW85401.1| putative ribosomal protein S8e family protein [Zea mays]
Length=191

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  127  GKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTR  306
            G     ++++ YELGRQ ANTKLSSNKTVRR+RVRGGN KWRALR DT NYSWGSEA+TR
Sbjct  59   GPFCPLQEEQGYELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTR  118

Query  307  KTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            KTRILDVVY A+NNELVRTQTLVKSAIVQVDAAPFKQWYL HY VDIGRKKK
Sbjct  119  KTRILDVVYIATNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKK  170



>ref|XP_001622696.1| hypothetical protein NEMVEDRAFT_v1g195152 [Nematostella vectensis]
 gb|EDO30596.1| predicted protein [Nematostella vectensis]
Length=208

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS HK RATGGK K  RKKRK+ELGR  ANTK+ + K +  +R RGGN K+RALR
Sbjct  1    MGISRDSWHKHRATGGKMKPLRKKRKFELGRPPANTKIGT-KRIHEVRTRGGNRKFRALR  59

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSE+ TRK RI+DVVYNASNNELVRT+TLVK+ IVQVD+ PF+QWY  HYA+
Sbjct  60   LDTGNFSWGSESCTRKARIIDVVYNASNNELVRTKTLVKNCIVQVDSTPFRQWYEAHYAI  119

Query  442  DIGRKK  459
             IGRKK
Sbjct  120  PIGRKK  125



>gb|AAT08014.1| putative 40S ribosomal protein S8 [Zea mays]
Length=245

 Score =   191 bits (485),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  127  GKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTR  306
            G     ++++ YELGRQ ANTKLSSNKTVRR+RVRGGN KWRALR DT NYSWGSEA+TR
Sbjct  113  GPFCPLQEEQGYELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTR  172

Query  307  KTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            KTRILDVVY A+NNELVRTQTLVKSAIVQVDAAPFKQWYL HY VDIGRKKK
Sbjct  173  KTRILDVVYIATNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKK  224



>ref|XP_008660669.1| PREDICTED: 40S ribosomal protein S8-like [Zea mays]
Length=152

 Score =   188 bits (477),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  160  YELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYNA  339
            YELGRQ ANTKLSSNKTVRR+RVRGGN KWRALR DT NYSWGSEA+TRKTRILDVVY A
Sbjct  31   YELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTRKTRILDVVYIA  90

Query  340  SNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            +NNELVRTQTLVKSAIVQVDAAPFKQWYL HY VDIGRKKK
Sbjct  91   TNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKK  131



>dbj|BAM17705.1| ribosomal protein S8 [Papilio xuthus]
Length=208

 Score =   189 bits (480),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRD  HKRRATGGK+   RKKRKYELGR +ANTKL S + +  +R RGGN+K+RALR
Sbjct  1    MGISRDHWHKRRATGGKRAPIRKKRKYELGRPAANTKLGSQR-IHLVRARGGNIKYRALR  59

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSE  TRKTRI+DVVYNASNNELVRT+TLVK+AIV VDA PF+QWY  HY +
Sbjct  60   LDTGNFSWGSECATRKTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYLL  119

Query  442  DIGRKK  459
             +GRKK
Sbjct  120  PLGRKK  125



>gb|AFW85400.1| putative ribosomal protein S8e family protein [Zea mays]
Length=397

 Score =   194 bits (494),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  127  GKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTR  306
            G     ++++ YELGRQ ANTKLSSNKTVRR+RVRGGN KWRALR DT NYSWGSEA+TR
Sbjct  265  GPFCPLQEEQGYELGRQPANTKLSSNKTVRRVRVRGGNTKWRALRFDTCNYSWGSEALTR  324

Query  307  KTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            KTRILDVVY A+NNELVRTQTLVKSAIVQVDAAPFKQWYL HY VDIGRKKK
Sbjct  325  KTRILDVVYIATNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYGVDIGRKKK  376



>dbj|BAM18930.1| ribosomal protein S8 [Papilio polytes]
Length=208

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRD  HKRRATGGK+   RKKRKYELGR +ANTKL S + +  +R RGGN+K+RALR
Sbjct  1    MGISRDHWHKRRATGGKRAPIRKKRKYELGRPAANTKLGSQR-IHLVRARGGNIKYRALR  59

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSE  TRKTRI+DVVYNASNNELVRT+TLVK+AIV VDA PF+QWY  HY +
Sbjct  60   LDTGNFSWGSECSTRKTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYLL  119

Query  442  DIGRKK  459
             +GRKK
Sbjct  120  PLGRKK  125



>gb|AFW66137.1| putative ribosomal protein S8e family protein [Zea mays]
Length=128

 Score =   184 bits (468),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDSMHKRRATGGKQKAWRKKRKYELGRQ ANTKLSSNKTVRR+RVRGGNVKWRALR
Sbjct  1    MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPANTKLSSNKTVRRVRVRGGNVKWRALR  60

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLV  375
            LDTGNYSWGSEAVTRKTRILDVVYNASNNELVR+   V
Sbjct  61   LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRSNLAV  98



>gb|EHJ65952.1| 40S ribosomal protein S8 [Danaus plexippus]
Length=295

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRD  HKRRATGGK+   RKKRKYELGR +ANTKL S + +  +R RGGN+K+RALR
Sbjct  86   MGISRDHWHKRRATGGKRAPIRKKRKYELGRPAANTKLGSQR-IHLVRARGGNIKYRALR  144

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSE  TRKTRI+DVVYNASNNELVRT+TLVK+AIV VDA PF+QWY  HY +
Sbjct  145  LDTGNFSWGSECATRKTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYLL  204

Query  442  DIGRKK  459
             +GRKK
Sbjct  205  PLGRKK  210



>ref|XP_002602335.1| hypothetical protein BRAFLDRAFT_268377 [Branchiostoma floridae]
 gb|EEN58347.1| hypothetical protein BRAFLDRAFT_268377 [Branchiostoma floridae]
Length=208

 Score =   187 bits (474),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRD+ HKRR+TGG++   RKKRKYELGR  ANTKL + K V  +R RGGN K+R LR
Sbjct  1    MGISRDNWHKRRSTGGRRNPIRKKRKYELGRPPANTKLGA-KRVHLVRCRGGNTKFRGLR  59

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN+SWGSEA++RKTR++DV+YNASNNELVRT+TLVK AIVQ+D+ PF+QWY  HYA+
Sbjct  60   LDTGNFSWGSEAISRKTRVIDVMYNASNNELVRTKTLVKGAIVQIDSTPFRQWYEAHYAL  119

Query  442  DIGRKK  459
             +GRKK
Sbjct  120  PLGRKK  125



>gb|AES86897.2| 40S ribosomal S8-like protein [Medicago truncatula]
Length=218

 Score =   187 bits (475),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  157  KYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNYSWGSEAVTRKTRILDVVYN  336
            +YELGRQ ANTKLSSNKT+R IRVRGGNVK RALRLDTGN SWGSEAVTRKTR+L+VVYN
Sbjct  26   RYELGRQPANTKLSSNKTLRTIRVRGGNVKCRALRLDTGNCSWGSEAVTRKTRLLNVVYN  85

Query  337  ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAVDIGRKKK  462
            ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHY V+IG  KK
Sbjct  86   ASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGVEIGSAKK  127



>ref|XP_005717008.1| 40S ribosomal protein S8 [Chondrus crispus]
 emb|CDF37189.1| 40S ribosomal protein S8 [Chondrus crispus]
Length=204

 Score =   186 bits (473),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS HKRR TGGK   +RKKRK+ELGRQ + TKL + K VR +RVRGGN+K RALR
Sbjct  1    MGISRDSRHKRRLTGGKHPYFRKKRKFELGRQPSMTKLGT-KLVRPVRVRGGNLKMRALR  59

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            L+TGN+SWGSE  + K+RIL+VVYNASNNELVRT TLVK  IVQ+DA PF+Q+Y +HY +
Sbjct  60   LETGNFSWGSEGFSGKSRILNVVYNASNNELVRTNTLVKGCIVQIDATPFRQYYHRHYGI  119

Query  442  DIGRKKKG  465
            DIG+KK G
Sbjct  120  DIGKKKAG  127



>gb|AEL28852.1| ribosomal protein S8 [Heliconius melpomene cythera]
Length=208

 Score =   186 bits (473),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRD  HKRRATGGK+   RKKRKYELGR +ANTKL S + +  +R RGGN+K+RALR
Sbjct  1    MGISRDHWHKRRATGGKRAPIRKKRKYELGRPAANTKLGSQR-IHLVRARGGNIKYRALR  59

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LDTGN++WGSE   RKTRI+DVVYNASNNELVRT+TLVK+AIV VDA PF+QWY  HY +
Sbjct  60   LDTGNFAWGSECAARKTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYLL  119

Query  442  DIGRKK  459
             +GRKK
Sbjct  120  PLGRKK  125



>emb|CEG65019.1| Putative 40S ribosomal protein S8 [Rhizopus microsporus]
 emb|CEI90931.1| Putative 40S ribosomal protein S8 [Rhizopus microsporus]
Length=202

 Score =   186 bits (471),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  82   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQSANTKLSSNKTVRRIRVRGGNVKWRALR  261
            MGISRDS HKR ATG ++  +RKKRK+ELGRQSANTKL S K +  +RVRGGN K RALR
Sbjct  1    MGISRDSRHKRSATGARRAQYRKKRKFELGRQSANTKLGS-KRIHLVRVRGGNYKRRALR  59

Query  262  LDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYAV  441
            LD+GN+SWGSE ++RKTR+L VVYNASNNELVRT TLVK A++QVDA PF+QWY  HYA+
Sbjct  60   LDSGNFSWGSEGISRKTRVLTVVYNASNNELVRTNTLVKGAVIQVDATPFRQWYESHYAI  119

Query  442  DIGRKK  459
             +G++K
Sbjct  120  GLGKQK  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000