BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002I02

Length=335
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHB59608.1|  putative MYB-related protein 22                         102   9e-24   Arachis hypogaea [goober]
gb|EYU19295.1|  hypothetical protein MIMGU_mgv1a005826mg                103   1e-23   Erythranthe guttata [common monkey flower]
ref|XP_011081287.1|  PREDICTED: uncharacterized protein LOC105164353    101   3e-23   Sesamum indicum [beniseed]
ref|XP_010275370.1|  PREDICTED: transcription factor MYB1R1-like        101   4e-23   Nelumbo nucifera [Indian lotus]
ref|NP_001238622.1|  MYB transcription factor MYB180                    100   5e-23   
ref|XP_008363786.1|  PREDICTED: transcription factor MYB1R1-like        100   5e-23   Malus domestica [apple tree]
ref|XP_006600251.1|  PREDICTED: MYB transcription factor MYB180 i...    100   5e-23   
gb|AGV54357.1|  MYB transcription factor                                100   6e-23   Phaseolus vulgaris [French bean]
ref|XP_007155690.1|  hypothetical protein PHAVU_003G222900g             100   6e-23   Phaseolus vulgaris [French bean]
ref|XP_009344186.1|  PREDICTED: transcription factor MYB1R1-like        100   6e-23   Pyrus x bretschneideri [bai li]
ref|NP_001237520.1|  MYB transcription factor MYB93                     100   6e-23   Glycine max [soybeans]
gb|ADL36775.1|  MYBR domain class transcription factor                  100   7e-23   Malus domestica [apple tree]
ref|XP_010258818.1|  PREDICTED: transcription factor MYB1R1             100   9e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010053506.1|  PREDICTED: uncharacterized protein LOC104441938    100   1e-22   Eucalyptus grandis [rose gum]
ref|XP_007209344.1|  hypothetical protein PRUPE_ppa008493mg           99.8    1e-22   Prunus persica
ref|XP_008238436.1|  PREDICTED: transcription factor MYB1R1 isofo...  99.8    1e-22   Prunus mume [ume]
gb|KDP39902.1|  hypothetical protein JCGZ_03433                       99.8    1e-22   Jatropha curcas
ref|XP_008238435.1|  PREDICTED: transcription factor MYB1R1 isofo...  99.8    1e-22   Prunus mume [ume]
ref|XP_002304291.1|  syringolide-induced protein 1-3-1B               99.8    1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_004508939.1|  PREDICTED: transcription factor MYB1R1-like      99.8    1e-22   Cicer arietinum [garbanzo]
ref|XP_004299409.1|  PREDICTED: transcription factor MYB1R1           98.6    3e-22   Fragaria vesca subsp. vesca
ref|XP_006477144.1|  PREDICTED: transcription factor MYB1R1-like      98.6    3e-22   Citrus sinensis [apfelsine]
gb|KDO61361.1|  hypothetical protein CISIN_1g019948mg                 98.6    3e-22   Citrus sinensis [apfelsine]
ref|XP_006440261.1|  hypothetical protein CICLE_v10021067mg           98.6    4e-22   
gb|ABD65013.1|  myb family transcription factor                       97.8    7e-22   Brassica oleracea
ref|XP_010941063.1|  PREDICTED: uncharacterized protein LOC105059...  97.4    8e-22   
ref|XP_010941064.1|  PREDICTED: uncharacterized protein LOC105059...  97.4    9e-22   Elaeis guineensis
emb|CDY51681.1|  BnaC02g46900D                                        97.4    1e-21   Brassica napus [oilseed rape]
ref|XP_009626131.1|  PREDICTED: transcription factor MYB1R1 isofo...  97.4    1e-21   Nicotiana tomentosiformis
ref|XP_009783629.1|  PREDICTED: transcription factor MYB1R1 isofo...  97.4    1e-21   Nicotiana sylvestris
ref|XP_009626132.1|  PREDICTED: transcription factor MYB1R1 isofo...  97.1    1e-21   Nicotiana tomentosiformis
ref|XP_009144512.1|  PREDICTED: uncharacterized protein LOC103868158  97.4    1e-21   Brassica rapa
ref|XP_009783628.1|  PREDICTED: transcription factor MYB1R1 isofo...  97.1    1e-21   Nicotiana sylvestris
ref|NP_001275007.1|  MYBST1 protein                                   97.1    1e-21   Solanum tuberosum [potatoes]
ref|XP_010481334.1|  PREDICTED: pinin-like                            97.4    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010518718.1|  PREDICTED: uncharacterized protein LOC104798365  97.1    1e-21   Tarenaya hassleriana [spider flower]
gb|KJB25540.1|  hypothetical protein B456_004G196500                  96.7    1e-21   Gossypium raimondii
emb|CDY28938.1|  BnaA02g25380D                                        96.7    2e-21   Brassica napus [oilseed rape]
ref|XP_009128962.1|  PREDICTED: uncharacterized protein LOC103853804  96.7    2e-21   Brassica rapa
gb|KJB25538.1|  hypothetical protein B456_004G196500                  96.7    2e-21   Gossypium raimondii
gb|KHF99337.1|  Transcription factor MYB1R1                           96.7    2e-21   Gossypium arboreum [tree cotton]
gb|KJB25539.1|  hypothetical protein B456_004G196500                  96.3    2e-21   Gossypium raimondii
emb|CDP09999.1|  unnamed protein product                              96.7    2e-21   Coffea canephora [robusta coffee]
gb|KFK31380.1|  hypothetical protein AALP_AA6G104600                  96.7    2e-21   Arabis alpina [alpine rockcress]
gb|EPS65377.1|  hypothetical protein M569_09400                       96.7    2e-21   Genlisea aurea
ref|NP_199550.1|  myb-like transcription factor family protein        96.7    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441468.1|  PREDICTED: uncharacterized protein LOC104724629  96.7    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002865122.1|  myb family transcription factor                  96.7    2e-21   Arabidopsis lyrata subsp. lyrata
dbj|BAJ34014.1|  unnamed protein product                              96.7    2e-21   Eutrema halophilum
ref|XP_006398430.1|  hypothetical protein EUTSA_v10000932mg           96.3    2e-21   Eutrema salsugineum [saltwater cress]
ref|XP_006279493.1|  hypothetical protein CARUB_v10026634mg           96.3    2e-21   Capsella rubella
ref|XP_011031922.1|  PREDICTED: myb-like protein J isoform X1         95.9    3e-21   Populus euphratica
ref|XP_011031924.1|  PREDICTED: myb-like protein J isoform X3         95.9    3e-21   Populus euphratica
ref|XP_004245787.1|  PREDICTED: transcription factor MYB1R1           95.9    4e-21   Solanum lycopersicum
gb|ABD65094.1|  myb family transcription factor                       95.9    4e-21   Brassica oleracea
emb|CBI29498.3|  unnamed protein product                              95.5    4e-21   Vitis vinifera
ref|XP_002274350.1|  PREDICTED: transcription factor MYB1R1           95.5    4e-21   Vitis vinifera
emb|CDY18967.1|  BnaC01g21010D                                        95.5    4e-21   Brassica napus [oilseed rape]
ref|XP_008790110.1|  PREDICTED: uncharacterized protein LOC103707412  95.5    4e-21   Phoenix dactylifera
ref|XP_006853679.1|  hypothetical protein AMTR_s00056p00127760        92.8    5e-21   
emb|CDY58852.1|  BnaAnng15540D                                        95.1    6e-21   Brassica napus [oilseed rape]
ref|XP_004170300.1|  PREDICTED: transcription factor MYB1R1-like      95.1    7e-21   
ref|XP_008448819.1|  PREDICTED: transcription factor MYB1R1           94.7    7e-21   Cucumis melo [Oriental melon]
ref|XP_010529976.1|  PREDICTED: protein REVEILLE 8-like               94.7    8e-21   Tarenaya hassleriana [spider flower]
ref|XP_006414230.1|  hypothetical protein EUTSA_v10025432mg           95.1    9e-21   
emb|CDX90475.1|  BnaA03g43060D                                        94.4    1e-20   
gb|ABD65139.1|  myb family transcription factor                       94.4    1e-20   Brassica oleracea
ref|XP_009136840.1|  PREDICTED: uncharacterized protein LOC103860911  94.4    1e-20   Brassica rapa
emb|CDY09630.1|  BnaC07g34310D                                        94.0    1e-20   Brassica napus [oilseed rape]
gb|AAN63154.1|  transcription factor MYBS3                            93.6    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|AAK31280.1|AC079890_16  putative Myb-related protein               93.6    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010677080.1|  PREDICTED: transcription factor MYB1R1           94.0    2e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK40445.1|  unknown                                               92.8    2e-20   Medicago truncatula
ref|XP_003608683.1|  MYB domain containing transcription factor       93.6    2e-20   Medicago truncatula
gb|EAY79518.1|  hypothetical protein OsI_34646                        93.2    3e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_009400892.1|  PREDICTED: uncharacterized protein LOC103985010  93.2    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR18214.1|  unknown                                               92.8    4e-20   Picea sitchensis
gb|KHG18328.1|  Transcription factor MYB1R1                           92.4    6e-20   Gossypium arboreum [tree cotton]
ref|XP_011002026.1|  PREDICTED: myb-like protein G                    92.4    6e-20   Populus euphratica
gb|KJB20972.1|  hypothetical protein B456_003G175300                  92.0    7e-20   Gossypium raimondii
ref|XP_006368993.1|  syringolide-induced protein 1-3-1B               92.0    8e-20   Populus trichocarpa [western balsam poplar]
emb|CAJ53899.1|  transcription factor MybS3                           90.1    3e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009400698.1|  PREDICTED: transcription factor MYB1R1-like      90.1    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG00790.1|  Transcription factor MYB1R1                           89.7    5e-19   Gossypium arboreum [tree cotton]
gb|KJB51831.1|  hypothetical protein B456_008G233500                  89.4    5e-19   Gossypium raimondii
ref|XP_009368939.1|  PREDICTED: transcription factor MYB1R1           89.4    7e-19   Pyrus x bretschneideri [bai li]
emb|CBY88798.1|  myb transcription factor                             89.0    8e-19   Humulus lupulus [common hop]
ref|XP_002464930.1|  hypothetical protein SORBIDRAFT_01g029020        89.0    9e-19   Sorghum bicolor [broomcorn]
ref|XP_004983650.1|  PREDICTED: transcription factor MYB1R1-like      88.6    1e-18   Setaria italica
ref|NP_001169313.1|  putative MYB DNA-binding domain superfamily ...  88.6    1e-18   Zea mays [maize]
ref|XP_008796132.1|  PREDICTED: protein REVEILLE 6-like isoform X1    88.6    1e-18   Phoenix dactylifera
ref|XP_008796133.1|  PREDICTED: transcription factor MYB1R1-like ...  88.6    1e-18   
ref|XP_008796134.1|  PREDICTED: transcription factor MYB1R1-like ...  88.6    1e-18   
emb|CCU64193.1|  ScMYB41 protein                                      88.2    1e-18   Saccharum hybrid cultivar Co 86032
ref|XP_009401485.1|  PREDICTED: transcription factor MYB1R1-like      87.8    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010267150.1|  PREDICTED: uncharacterized protein LOC104604...  87.8    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010933630.1|  PREDICTED: transcription factor MYB1R1-like      87.4    3e-18   Elaeis guineensis
ref|XP_010267151.1|  PREDICTED: transcription factor MYB1R1 isofo...  87.4    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009397874.1|  PREDICTED: transcription factor MYB1R1-like      87.0    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008775190.1|  PREDICTED: transcription factor MYB1R1-like      86.3    6e-18   Phoenix dactylifera
ref|XP_010934654.1|  PREDICTED: transcription factor MYB1R1-like      86.7    6e-18   Elaeis guineensis
gb|ABK24521.1|  unknown                                               87.0    8e-18   Picea sitchensis
gb|ACF85648.1|  unknown                                               86.3    8e-18   Zea mays [maize]
gb|AIB05106.1|  MYB-related transcription factor                      86.3    8e-18   Zea mays [maize]
ref|NP_001266509.1|  ZmMybst1                                         86.3    8e-18   
ref|NP_001105212.1|  LOC542109                                        86.3    8e-18   
ref|XP_010249506.1|  PREDICTED: uncharacterized protein LOC104592058  85.9    1e-17   Nelumbo nucifera [Indian lotus]
ref|XP_001764790.1|  predicted protein                                84.7    3e-17   
ref|XP_001775256.1|  predicted protein                                84.7    3e-17   
ref|XP_002990122.1|  hypothetical protein SELMODRAFT_131017           82.8    3e-17   
ref|XP_002989801.1|  hypothetical protein SELMODRAFT_130556           82.4    3e-17   
gb|ABD64943.1|  myb transcription factor, putative                    84.0    5e-17   Brassica oleracea
emb|CDO97977.1|  unnamed protein product                              84.3    5e-17   Coffea canephora [robusta coffee]
emb|CDX95438.1|  BnaC01g33300D                                        83.6    6e-17   
ref|XP_006593489.1|  PREDICTED: MYB transcription factor MYB62 is...  82.8    2e-16   
ref|XP_009380499.1|  PREDICTED: transcription factor MYB1R1-like      82.4    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004486782.1|  PREDICTED: uncharacterized protein LOC101494...  82.4    2e-16   Cicer arietinum [garbanzo]
emb|CDY68924.1|  BnaCnng61080D                                        82.0    2e-16   Brassica napus [oilseed rape]
ref|XP_004487226.1|  PREDICTED: uncharacterized protein LOC101496138  79.0    3e-16   
gb|ABR28340.1|  MYB transcription factor MYB52                        82.0    4e-16   Medicago truncatula
ref|XP_003597679.1|  hypothetical protein MTR_2g100930                82.0    4e-16   Medicago truncatula
ref|XP_008462421.1|  PREDICTED: uncharacterized protein LOC103500780  81.6    5e-16   
gb|ABI74688.1|  MYB                                                   81.6    5e-16   Brassica rapa subsp. pekinensis [bai cai]
gb|AAB63650.1|  Myb-related transcription activator (MybSt1) isolog   81.6    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114281.1|  PREDICTED: uncharacterized protein LOC103839529  81.3    5e-16   Brassica rapa
emb|CDY41049.1|  BnaA09g18280D                                        80.9    6e-16   Brassica napus [oilseed rape]
ref|NP_001235649.1|  MYB transcription factor MYB52                   81.3    8e-16   Glycine max [soybeans]
gb|ABK96220.1|  unknown                                               81.3    8e-16   Populus trichocarpa x Populus deltoides
ref|XP_011010432.1|  PREDICTED: uncharacterized protein LOC105115...  81.3    9e-16   Populus euphratica
ref|XP_011010433.1|  PREDICTED: uncharacterized protein LOC105115...  81.3    9e-16   Populus euphratica
ref|XP_006369213.1|  hypothetical protein POPTR_0001s19070g           80.9    1e-15   
ref|XP_004141664.1|  PREDICTED: uncharacterized protein LOC101214316  80.5    1e-15   Cucumis sativus [cucumbers]
ref|XP_002298242.1|  myb family transcription factor family protein   80.5    1e-15   
ref|XP_011010434.1|  PREDICTED: uncharacterized protein LOC105115...  80.5    1e-15   Populus euphratica
ref|XP_004147257.1|  PREDICTED: transcription factor MYB1R1-like      80.1    2e-15   
dbj|BAJ40869.1|  transcriptional factor MYB-4                         79.0    2e-15   Coptis japonica
ref|XP_010545666.1|  PREDICTED: myb-like protein J                    80.1    2e-15   Tarenaya hassleriana [spider flower]
dbj|BAG15871.1|  myb transcription factor                             80.5    2e-15   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_001766973.1|  predicted protein                                77.4    3e-15   
ref|XP_006385452.1|  hypothetical protein POPTR_0003s04750g           76.6    3e-15   
ref|XP_007150607.1|  hypothetical protein PHAVU_005G166300g           79.3    3e-15   Phaseolus vulgaris [French bean]
ref|XP_007039774.1|  Myb-like transcription factor family protein...  79.3    3e-15   
ref|NP_001280790.1|  uncharacterized protein LOC103443746             79.3    4e-15   Malus domestica [apple tree]
gb|ADL36774.1|  MYBR domain class transcription factor                79.0    5e-15   Malus domestica [apple tree]
ref|XP_011012039.1|  PREDICTED: uncharacterized protein LOC105116394  79.0    6e-15   Populus euphratica
ref|XP_009353549.1|  PREDICTED: uncharacterized protein LOC103944815  78.2    9e-15   Pyrus x bretschneideri [bai li]
ref|XP_010465657.1|  PREDICTED: uncharacterized protein LOC104745965  78.2    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009421290.1|  PREDICTED: transcription factor MYB1R1-like      77.4    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008791498.1|  PREDICTED: uncharacterized protein LOC103708379  77.8    1e-14   Phoenix dactylifera
ref|XP_010419320.1|  PREDICTED: transcription factor MYB1R1-like      77.0    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010915399.1|  PREDICTED: uncharacterized protein LOC105040...  74.7    2e-14   Elaeis guineensis
ref|XP_006426881.1|  hypothetical protein CICLE_v10025950mg           77.4    2e-14   Citrus clementina [clementine]
ref|XP_010487491.1|  PREDICTED: uncharacterized protein LOC104765474  77.8    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_001764190.1|  predicted protein                                79.3    2e-14   
ref|XP_006465688.1|  PREDICTED: transcription factor MYB1R1-like      77.0    3e-14   Citrus sinensis [apfelsine]
ref|XP_010915398.1|  PREDICTED: uncharacterized protein LOC105040...  74.7    3e-14   Elaeis guineensis
ref|XP_010504183.1|  PREDICTED: uncharacterized protein LOC104781253  77.4    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_001766974.1|  predicted protein                                75.1    3e-14   
gb|ABZ04613.1|  MYB domain containing transcription factor            72.0    3e-14   Pinus taeda
gb|ABZ04595.1|  MYB domain containing transcription factor            72.0    4e-14   Pinus taeda
emb|CDX82407.1|  BnaA03g34140D                                        76.3    4e-14   
ref|XP_007215594.1|  hypothetical protein PRUPE_ppa007697mg           76.3    5e-14   Prunus persica
gb|KDO51780.1|  hypothetical protein CISIN_1g0164772mg                73.2    6e-14   Citrus sinensis [apfelsine]
ref|XP_006297882.1|  hypothetical protein CARUB_v10013924mg           76.3    7e-14   Capsella rubella
ref|NP_001235701.1|  MYB transcription factor MYB62                   75.9    8e-14   
gb|KHG24899.1|  Transcription factor MYB1R1                           75.5    8e-14   Gossypium arboreum [tree cotton]
gb|KJB56816.1|  hypothetical protein B456_009G137300                  75.5    9e-14   Gossypium raimondii
emb|CDY30163.1|  BnaC05g36990D                                        75.5    1e-13   Brassica napus [oilseed rape]
ref|XP_008228426.1|  PREDICTED: transcription factor MYB1R1           75.5    1e-13   Prunus mume [ume]
ref|XP_009404535.1|  PREDICTED: transcription factor MYB1R1-like      74.7    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY70918.1|  BnaAnng35540D                                        75.1    1e-13   Brassica napus [oilseed rape]
ref|XP_007024302.1|  Myb-like transcription factor family protein     74.7    2e-13   Theobroma cacao [chocolate]
ref|XP_006406842.1|  hypothetical protein EUTSA_v10020915mg           75.1    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010665911.1|  PREDICTED: transcription factor MYB1R1           74.7    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002883001.1|  hypothetical protein ARALYDRAFT_479087           73.9    4e-13   
ref|XP_002515966.1|  DNA binding protein, putative                    73.6    6e-13   Ricinus communis
gb|KDP40862.1|  hypothetical protein JCGZ_24861                       73.2    8e-13   Jatropha curcas
ref|NP_188256.1|  myb family transcription factor                     72.8    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010098140.1|  Transcription factor                             72.4    1e-12   Morus notabilis
ref|XP_004302861.1|  PREDICTED: transcription factor MYB1R1           71.6    2e-12   Fragaria vesca subsp. vesca
emb|CDX75876.1|  BnaC03g39590D                                        71.6    3e-12   
ref|XP_002283785.1|  PREDICTED: uncharacterized protein LOC100241227  71.2    3e-12   Vitis vinifera
gb|AAS09982.1|  MYB transcription factor                              71.2    4e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38991.1|  hypothetical protein AALP_AA3G185700                  71.2    4e-12   Arabis alpina [alpine rockcress]
ref|XP_001764191.1|  predicted protein                                72.4    4e-12   
ref|XP_009385776.1|  PREDICTED: transcription factor MYB1R1-like      70.9    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009146146.1|  PREDICTED: transcription factor MYB1R1           70.9    5e-12   Brassica rapa
ref|XP_002991458.1|  hypothetical protein SELMODRAFT_133546           68.6    6e-12   
ref|XP_009413857.1|  PREDICTED: transcription factor MYB1R1-like ...  70.1    9e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413856.1|  PREDICTED: transcription factor MYB1R1-like ...  70.1    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002443842.1|  hypothetical protein SORBIDRAFT_07g003170        69.3    2e-11   Sorghum bicolor [broomcorn]
ref|XP_006359477.1|  PREDICTED: transcription factor MYB1R1-like      68.9    3e-11   Solanum tuberosum [potatoes]
ref|XP_009626737.1|  PREDICTED: transcription factor MYB1R1           68.9    3e-11   Nicotiana tomentosiformis
ref|XP_002450856.1|  hypothetical protein SORBIDRAFT_05g019746        65.5    3e-11   
ref|XP_011072427.1|  PREDICTED: protein REVEILLE 4-like               67.4    3e-11   Sesamum indicum [beniseed]
ref|XP_004252360.1|  PREDICTED: transcription factor MYB1R1           68.6    3e-11   Solanum lycopersicum
gb|ABR16522.1|  unknown                                               68.6    3e-11   Picea sitchensis
ref|XP_002455032.1|  hypothetical protein SORBIDRAFT_03g003270        68.2    5e-11   Sorghum bicolor [broomcorn]
ref|NP_001151255.1|  LOC100284888                                     68.2    5e-11   Zea mays [maize]
ref|XP_004972870.1|  PREDICTED: transcription factor MYB1R1-like      67.4    9e-11   Setaria italica
ref|XP_010033837.1|  PREDICTED: uncharacterized protein LOC104423076  66.2    2e-10   Eucalyptus grandis [rose gum]
ref|XP_010925548.1|  PREDICTED: transcription factor MYB1R1-like      65.9    2e-10   Elaeis guineensis
ref|XP_008794113.1|  PREDICTED: transcription factor MYB1R1-like      65.9    3e-10   Phoenix dactylifera
ref|XP_010652808.1|  PREDICTED: transcription factor MYB1R1           65.1    4e-10   Vitis vinifera
ref|XP_009772765.1|  PREDICTED: transcription factor MYB1R1           65.5    4e-10   Nicotiana sylvestris
gb|AEV91192.1|  MYB-related protein                                   65.1    7e-10   Triticum carthlicum [Persian black wheat]
ref|XP_010255646.1|  PREDICTED: transcription factor MYB1R1-like      63.9    8e-10   Nelumbo nucifera [Indian lotus]
gb|EAZ10847.1|  hypothetical protein OsJ_00686                        63.9    2e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CDM81700.1|  unnamed protein product                              63.2    2e-09   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK02871.1|  predicted protein                                    63.2    3e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN71598.1|  hypothetical protein VITISV_010937                   61.6    6e-09   Vitis vinifera
ref|XP_010272144.1|  PREDICTED: transcription factor MYB1R1-like      61.6    7e-09   Nelumbo nucifera [Indian lotus]
ref|XP_009127770.1|  PREDICTED: transcription factor MYB1R1-like      60.5    7e-09   Brassica rapa
emb|CDY52459.1|  BnaCnng22510D                                        60.5    8e-09   Brassica napus [oilseed rape]
dbj|BAJ89354.1|  predicted protein                                    62.0    8e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW79484.1|  putative MYB DNA-binding domain superfamily protein   62.4    8e-09   
ref|NP_001149973.1|  myb-related transcription activator              61.6    8e-09   Zea mays [maize]
ref|NP_001042254.1|  Os01g0187900                                     61.6    9e-09   
gb|AFW79483.1|  putative MYB DNA-binding domain superfamily protein   61.6    2e-08   
ref|XP_007044445.1|  Myb-like transcription factor family protein     59.7    3e-08   
ref|XP_003573373.1|  PREDICTED: uncharacterized protein LOC100834934  60.1    3e-08   Brachypodium distachyon [annual false brome]
ref|XP_003564624.1|  PREDICTED: uncharacterized protein LOC100828575  59.7    4e-08   Brachypodium distachyon [annual false brome]
ref|XP_007222642.1|  hypothetical protein PRUPE_ppa008539mg           59.7    4e-08   Prunus persica
gb|ABK26274.1|  unknown                                               59.3    6e-08   Picea sitchensis
ref|XP_010258761.1|  PREDICTED: transcription factor MYB1R1-like ...  58.9    7e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010258762.1|  PREDICTED: transcription factor MYB1R1-like ...  58.9    7e-08   Nelumbo nucifera [Indian lotus]
ref|XP_011043023.1|  PREDICTED: transcription factor MYB1R1-like      58.2    1e-07   Populus euphratica
ref|XP_002315700.2|  DNA-binding family protein                       57.8    2e-07   
gb|AHB59602.1|  putative MYB-related protein 16                       57.4    2e-07   Arachis hypogaea [goober]
ref|XP_007157550.1|  hypothetical protein PHAVU_002G078600g           57.4    2e-07   Phaseolus vulgaris [French bean]
ref|XP_008221488.1|  PREDICTED: transcription factor MYB1R1           57.4    2e-07   Prunus mume [ume]
gb|KJB46488.1|  hypothetical protein B456_007G371900                  57.4    2e-07   Gossypium raimondii
gb|KHG08349.1|  Transcription factor MYB1R1                           57.0    3e-07   Gossypium arboreum [tree cotton]
ref|NP_001281063.1|  transcription factor MYB1R1-like                 57.0    3e-07   Malus domestica [apple tree]
ref|XP_004135214.1|  PREDICTED: uncharacterized protein LOC101207806  57.0    3e-07   Cucumis sativus [cucumbers]
gb|ACJ85142.1|  unknown                                               55.1    4e-07   Medicago truncatula
ref|XP_008339970.1|  PREDICTED: transcription factor MYB1R1           56.6    5e-07   Malus domestica [apple tree]
ref|XP_008446280.1|  PREDICTED: transcription factor MYB1R1           56.2    5e-07   Cucumis melo [Oriental melon]
ref|XP_006302702.1|  hypothetical protein CARUB_v10020813mg           55.1    8e-07   Capsella rubella
ref|XP_003613473.1|  DIV1B protein                                    55.5    9e-07   
gb|AFV79077.1|  myb-related protein                                   55.8    9e-07   Pinus sylvestris [Scotch pine]
ref|XP_010662238.1|  PREDICTED: transcription factor MYB1R1-like ...  55.5    1e-06   
gb|AFV79045.1|  myb-related protein                                   55.5    1e-06   Pinus sylvestris [Scotch pine]
gb|AFV78976.1|  myb-related protein                                   55.5    1e-06   Pinus sylvestris [Scotch pine]
emb|CAN76720.1|  hypothetical protein VITISV_005733                   53.9    1e-06   Vitis vinifera
ref|XP_002278155.2|  PREDICTED: transcription factor MYB1R1-like ...  55.5    1e-06   Vitis vinifera
gb|AFV79075.1|  myb-related protein                                   55.5    1e-06   Pinus sylvestris [Scotch pine]
gb|AFV78994.1|  myb-related protein                                   55.5    1e-06   Pinus sylvestris [Scotch pine]
emb|CBI38571.3|  unnamed protein product                              53.9    1e-06   Vitis vinifera
gb|AFV79026.1|  myb-related protein                                   55.5    1e-06   Pinus sylvestris [Scotch pine]
ref|NP_177158.1|  myb-like transcription factor                       54.7    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517881.1|  PREDICTED: transcription factor MYB1R1           55.1    1e-06   
ref|XP_002312695.2|  hypothetical protein POPTR_0008s19610g           55.1    1e-06   
ref|XP_004489944.1|  PREDICTED: transcription factor MYB1R1-like      54.7    1e-06   Cicer arietinum [garbanzo]
gb|AFV78996.1|  myb-related protein                                   55.1    1e-06   Pinus sylvestris [Scotch pine]
ref|XP_010062531.1|  PREDICTED: myb-like protein H                    55.5    1e-06   Eucalyptus grandis [rose gum]
gb|ABK95405.1|  unknown                                               55.1    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010512072.1|  PREDICTED: transcription factor MYB1R1-like      54.7    1e-06   Camelina sativa [gold-of-pleasure]
ref|NP_001237761.1|  MYB transcription factor MYB138                  54.7    1e-06   
gb|AFV78990.1|  myb-related protein                                   55.1    2e-06   Pinus sylvestris [Scotch pine]
gb|AFV78981.1|  myb-related protein                                   55.1    2e-06   Pinus sylvestris [Scotch pine]
gb|AFV78978.1|  myb-related protein                                   55.1    2e-06   Pinus sylvestris [Scotch pine]
gb|AFV78977.1|  myb-related protein                                   55.1    2e-06   Pinus sylvestris [Scotch pine]
gb|AFV79000.1|  myb-related protein                                   55.1    2e-06   Pinus sylvestris [Scotch pine]
gb|AFV78975.1|  myb-related protein                                   55.1    2e-06   Pinus sylvestris [Scotch pine]
ref|XP_010415672.1|  PREDICTED: transcription factor MYB1R1-like      54.7    2e-06   Camelina sativa [gold-of-pleasure]
gb|AFV79550.1|  myb-related protein                                   55.1    2e-06   Pinus pinaster [cluster pine]
ref|XP_006837395.1|  hypothetical protein AMTR_s00111p00135880        54.7    2e-06   Amborella trichopoda
ref|XP_006483742.1|  PREDICTED: transcription factor MYB1R1-like ...  54.7    2e-06   Citrus sinensis [apfelsine]
ref|XP_006438522.1|  hypothetical protein CICLE_v10032167mg           54.7    2e-06   Citrus clementina [clementine]
ref|XP_006438524.1|  hypothetical protein CICLE_v10032167mg           54.7    2e-06   Citrus clementina [clementine]
ref|XP_010098248.1|  Transcription factor                             54.7    2e-06   Morus notabilis
ref|XP_006483741.1|  PREDICTED: transcription factor MYB1R1-like ...  54.7    2e-06   Citrus sinensis [apfelsine]
ref|XP_006438523.1|  hypothetical protein CICLE_v10032167mg           54.3    2e-06   
gb|AFV79053.1|  myb-related protein                                   54.7    2e-06   Pinus sylvestris [Scotch pine]
gb|AFV79042.1|  myb-related protein                                   54.7    2e-06   Pinus sylvestris [Scotch pine]
gb|KDO82664.1|  hypothetical protein CISIN_1g021351mg                 54.3    2e-06   Citrus sinensis [apfelsine]
emb|CDP05386.1|  unnamed protein product                              53.1    2e-06   Coffea canephora [robusta coffee]
gb|KDO82665.1|  hypothetical protein CISIN_1g021351mg                 54.3    3e-06   Citrus sinensis [apfelsine]
gb|KDO82666.1|  hypothetical protein CISIN_1g021351mg                 54.3    3e-06   
ref|XP_010043839.1|  PREDICTED: transcription factor MYB1R1           53.9    3e-06   
ref|XP_010471001.1|  PREDICTED: transcription factor MYB1R1           53.5    3e-06   
ref|XP_004297686.2|  PREDICTED: transcription factor MYB1R1           53.9    5e-06   
gb|KDP22474.1|  hypothetical protein JCGZ_26305                       53.5    6e-06   
ref|NP_001060982.1|  Os08g0144000                                     53.5    7e-06   
gb|EAZ05569.1|  hypothetical protein OsI_27782                        53.5    7e-06   
emb|CCA29105.1|  putative MYB transcription factor                    53.1    7e-06   
ref|XP_002888750.1|  hypothetical protein ARALYDRAFT_476127           52.4    8e-06   
ref|XP_011076440.1|  PREDICTED: myb-like protein J                    52.8    8e-06   
ref|XP_002520190.1|  transcription factor, putative                   52.8    9e-06   
gb|AFV79024.1|  myb-related protein                                   52.4    1e-05   
gb|AFV78992.1|  myb-related protein                                   52.4    1e-05   
ref|XP_004489945.1|  PREDICTED: transcription factor MYB1R1-like      52.4    1e-05   
emb|CBI15104.3|  unnamed protein product                              51.6    2e-05   
ref|XP_007218820.1|  hypothetical protein PRUPE_ppa010092mg           51.2    3e-05   
ref|XP_009370418.1|  PREDICTED: myb-like protein J                    51.2    3e-05   
ref|XP_002511019.1|  conserved hypothetical protein                   51.2    4e-05   
ref|XP_009362715.1|  PREDICTED: myb-like protein J                    51.2    4e-05   
gb|KDP21270.1|  hypothetical protein JCGZ_21741                       50.8    4e-05   
ref|XP_009609816.1|  PREDICTED: transcription factor MYB1R1-like ...  50.1    7e-05   
ref|XP_009609815.1|  PREDICTED: transcription factor MYB1R1-like ...  50.1    7e-05   
ref|XP_008453855.1|  PREDICTED: transcription factor MYB1R1 isofo...  50.4    7e-05   
ref|XP_008453854.1|  PREDICTED: transcription factor MYB1R1 isofo...  50.1    7e-05   
ref|XP_006829488.1|  hypothetical protein AMTR_s00074p00097250        50.1    8e-05   
gb|KDO57294.1|  hypothetical protein CISIN_1g048263mg                 48.9    1e-04   
ref|XP_007038261.1|  Myb-like transcription factor family protein...  49.7    1e-04   
gb|KGN53172.1|  hypothetical protein Csa_4G025050                     49.7    1e-04   
emb|CAN77681.1|  hypothetical protein VITISV_040763                   49.7    1e-04   
ref|XP_008375712.1|  PREDICTED: transcription factor MYB1R1-like      49.7    1e-04   
gb|ADC94863.1|  MYB transcription factor 2                            49.3    1e-04   
ref|XP_009778274.1|  PREDICTED: transcription factor MYB1R1-like      49.3    1e-04   
ref|XP_002283896.1|  PREDICTED: transcription factor MYB1R1           49.3    1e-04   
gb|ADC94862.1|  MYB transcription factor 1                            49.3    1e-04   
ref|XP_008234449.1|  PREDICTED: transcription factor MYB1R1 isofo...  49.3    1e-04   
ref|XP_006853787.1|  hypothetical protein AMTR_s00056p00213450        48.9    1e-04   
ref|XP_006490065.1|  PREDICTED: uncharacterized protein LOC102615658  49.3    1e-04   
ref|XP_008234450.1|  PREDICTED: myb-like protein J isoform X2         49.3    1e-04   
gb|KFK40215.1|  hypothetical protein AALP_AA3G345600                  48.9    2e-04   
ref|XP_011026742.1|  PREDICTED: transcription factor MYB1R1-like      49.3    2e-04   
ref|XP_009104974.1|  PREDICTED: transcription factor MYB1R1           48.5    2e-04   
emb|CDY48382.1|  BnaA07g24010D                                        48.5    2e-04   
ref|XP_002297928.1|  syringolide-induced protein 1-3-1B               48.9    2e-04   
gb|KCW46233.1|  hypothetical protein EUGRSUZ_K00122                   47.4    2e-04   
ref|XP_006421517.1|  hypothetical protein CICLE_v10006771mg           48.5    2e-04   
ref|XP_004309020.1|  PREDICTED: myb-like protein J isoform X1         48.5    3e-04   
ref|XP_011470039.1|  PREDICTED: myb-like protein J isoform X2         48.5    3e-04   
ref|XP_006390934.1|  hypothetical protein EUTSA_v10019007mg           48.1    3e-04   
ref|XP_009400577.1|  PREDICTED: transcription factor MYB1R1-like      47.8    3e-04   
ref|XP_008376363.1|  PREDICTED: myb-like protein J isoform X2         48.1    4e-04   
ref|XP_008376361.1|  PREDICTED: myb-like protein J isoform X1         48.1    4e-04   
emb|CDY23531.1|  BnaC06g25000D                                        47.4    5e-04   
ref|XP_010109133.1|  Transcription factor                             47.8    5e-04   
ref|XP_010915342.1|  PREDICTED: transcription factor MYB1R1-like ...  47.4    5e-04   
ref|XP_010915341.1|  PREDICTED: transcription factor MYB1R1-like ...  47.4    5e-04   
ref|NP_200970.1|  myb-like transcription factor family protein        47.4    6e-04   
ref|XP_010457560.1|  PREDICTED: uncharacterized protein LOC104739021  46.6    0.001   



>gb|AHB59608.1| putative MYB-related protein 22 [Arachis hypogaea]
Length=332

 Score =   102 bits (255),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/47 (100%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>gb|EYU19295.1| hypothetical protein MIMGU_mgv1a005826mg [Erythranthe guttata]
Length=469

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +1

Query  190  SMTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            +MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  125  AMTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  172



>ref|XP_011081287.1| PREDICTED: uncharacterized protein LOC105164353 [Sesamum indicum]
Length=342

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>ref|XP_010275370.1| PREDICTED: transcription factor MYB1R1-like [Nelumbo nucifera]
Length=331

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>ref|NP_001238622.1| MYB transcription factor MYB180 [Glycine max]
 gb|ABH02846.1| MYB transcription factor MYB180 [Glycine max]
Length=316

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>ref|XP_008363786.1| PREDICTED: transcription factor MYB1R1-like [Malus domestica]
Length=328

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>ref|XP_006600251.1| PREDICTED: MYB transcription factor MYB180 isoform X1 [Glycine 
max]
Length=333

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>gb|AGV54357.1| MYB transcription factor [Phaseolus vulgaris]
Length=333

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>ref|XP_007155690.1| hypothetical protein PHAVU_003G222900g [Phaseolus vulgaris]
 gb|ESW27684.1| hypothetical protein PHAVU_003G222900g [Phaseolus vulgaris]
Length=333

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>ref|XP_009344186.1| PREDICTED: transcription factor MYB1R1-like [Pyrus x bretschneideri]
 ref|XP_009344193.1| PREDICTED: transcription factor MYB1R1-like [Pyrus x bretschneideri]
Length=328

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>ref|NP_001237520.1| MYB transcription factor MYB93 [Glycine max]
 gb|ABH02845.1| MYB transcription factor MYB93 [Glycine max]
Length=333

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>gb|ADL36775.1| MYBR domain class transcription factor [Malus domestica]
Length=328

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/47 (98%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>ref|XP_010258818.1| PREDICTED: transcription factor MYB1R1 [Nelumbo nucifera]
Length=335

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLTHY  47



>ref|XP_010053506.1| PREDICTED: uncharacterized protein LOC104441938 [Eucalyptus grandis]
 gb|KCW77815.1| hypothetical protein EUGRSUZ_D02103 [Eucalyptus grandis]
Length=340

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSHY  47



>ref|XP_007209344.1| hypothetical protein PRUPE_ppa008493mg [Prunus persica]
 gb|EMJ10543.1| hypothetical protein PRUPE_ppa008493mg [Prunus persica]
Length=329

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSHY  47



>ref|XP_008238436.1| PREDICTED: transcription factor MYB1R1 isoform X2 [Prunus mume]
Length=322

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSHY  47



>gb|KDP39902.1| hypothetical protein JCGZ_03433 [Jatropha curcas]
Length=335

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSHY  47



>ref|XP_008238435.1| PREDICTED: transcription factor MYB1R1 isoform X1 [Prunus mume]
Length=329

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSHY  47



>ref|XP_002304291.1| syringolide-induced protein 1-3-1B [Populus trichocarpa]
 gb|EEE79270.1| syringolide-induced protein 1-3-1B [Populus trichocarpa]
Length=336

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSHY  47



>ref|XP_004508939.1| PREDICTED: transcription factor MYB1R1-like [Cicer arietinum]
Length=337

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSHY  47



>ref|XP_004299409.1| PREDICTED: transcription factor MYB1R1 [Fragaria vesca subsp. 
vesca]
Length=329

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDG IRKSASMGNLTHY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGGIRKSASMGNLTHY  47



>ref|XP_006477144.1| PREDICTED: transcription factor MYB1R1-like [Citrus sinensis]
Length=333

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLSHY  47



>gb|KDO61361.1| hypothetical protein CISIN_1g019948mg [Citrus sinensis]
Length=333

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLSHY  47



>ref|XP_006440261.1| hypothetical protein CICLE_v10021067mg [Citrus clementina]
 ref|XP_006440262.1| hypothetical protein CICLE_v10021067mg [Citrus clementina]
 gb|ESR53501.1| hypothetical protein CICLE_v10021067mg [Citrus clementina]
 gb|ESR53502.1| hypothetical protein CICLE_v10021067mg [Citrus clementina]
Length=333

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLSHY  47



>gb|ABD65013.1| myb family transcription factor [Brassica oleracea]
Length=351

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_010941063.1| PREDICTED: uncharacterized protein LOC105059464 isoform X1 [Elaeis 
guineensis]
Length=319

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC +NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL HY
Sbjct  1    MTRRCSHCGHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLAHY  47



>ref|XP_010941064.1| PREDICTED: uncharacterized protein LOC105059464 isoform X2 [Elaeis 
guineensis]
Length=314

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC +NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL HY
Sbjct  1    MTRRCSHCGHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLAHY  47



>emb|CDY51681.1| BnaC02g46900D [Brassica napus]
Length=351

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_009626131.1| PREDICTED: transcription factor MYB1R1 isoform X1 [Nicotiana 
tomentosiformis]
Length=336

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS NGHNSRTCPNRGVKLFGVRLTDG IRKSASMGNLTH+
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRGVKLFGVRLTDGLIRKSASMGNLTHF  47



>ref|XP_009783629.1| PREDICTED: transcription factor MYB1R1 isoform X2 [Nicotiana 
sylvestris]
Length=334

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS NGHNSRTCPNRGVKLFGVRLTDG IRKSASMGNLTH+
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRGVKLFGVRLTDGLIRKSASMGNLTHF  47



>ref|XP_009626132.1| PREDICTED: transcription factor MYB1R1 isoform X2 [Nicotiana 
tomentosiformis]
Length=334

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS NGHNSRTCPNRGVKLFGVRLTDG IRKSASMGNLTH+
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRGVKLFGVRLTDGLIRKSASMGNLTHF  47



>ref|XP_009144512.1| PREDICTED: uncharacterized protein LOC103868158 [Brassica rapa]
Length=359

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC+ NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNQNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_009783628.1| PREDICTED: transcription factor MYB1R1 isoform X1 [Nicotiana 
sylvestris]
Length=336

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS NGHNSRTCPNRGVKLFGVRLTDG IRKSASMGNLTH+
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRGVKLFGVRLTDGLIRKSASMGNLTHF  47



>ref|NP_001275007.1| MYBST1 protein [Solanum tuberosum]
 gb|AAB32591.2| MybSt1 [Solanum tuberosum]
Length=342

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS NGHNSRTCPNRGVKLFGVRLTDG IRKSASMGNLTH+
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRGVKLFGVRLTDGLIRKSASMGNLTHF  47



>ref|XP_010481334.1| PREDICTED: pinin-like [Camelina sativa]
Length=381

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_010518718.1| PREDICTED: uncharacterized protein LOC104798365 [Tarenaya hassleriana]
Length=339

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>gb|KJB25540.1| hypothetical protein B456_004G196500 [Gossypium raimondii]
Length=323

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+ Y
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSQY  47



>emb|CDY28938.1| BnaA02g25380D [Brassica napus]
Length=351

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_009128962.1| PREDICTED: uncharacterized protein LOC103853804 [Brassica rapa]
Length=351

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>gb|KJB25538.1| hypothetical protein B456_004G196500 [Gossypium raimondii]
Length=328

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+ Y
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSQY  47



>gb|KHF99337.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=328

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+ Y
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSQY  47



>gb|KJB25539.1| hypothetical protein B456_004G196500 [Gossypium raimondii]
Length=306

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+ Y
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSQY  47



>emb|CDP09999.1| unnamed protein product [Coffea canephora]
Length=338

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS NGHNSRTCPNRGVKLFGVRLTDG IRKSASMGNL+HY
Sbjct  1    MTRRCSHCSQNGHNSRTCPNRGVKLFGVRLTDGLIRKSASMGNLSHY  47



>gb|KFK31380.1| hypothetical protein AALP_AA6G104600 [Arabis alpina]
Length=367

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>gb|EPS65377.1| hypothetical protein M569_09400 [Genlisea aurea]
Length=386

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTD SIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDVSIRKSASMGNLSHY  47



>ref|NP_199550.1| myb-like transcription factor family protein [Arabidopsis thaliana]
 dbj|BAA97173.1| Myb-related transcription activator-like [Arabidopsis thaliana]
 gb|AAL59900.1| putative Myb-related transcription activator protein [Arabidopsis 
thaliana]
 gb|AAM20295.1| putative Myb-related transcription activator [Arabidopsis thaliana]
 gb|AAM60886.1| Myb-related transcription activator-like [Arabidopsis thaliana]
 gb|AAS09986.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAE99002.1| Myb-related transcription activator-like [Arabidopsis thaliana]
 gb|AED95505.1| myb-like transcription factor family protein [Arabidopsis thaliana]
Length=365

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_010441468.1| PREDICTED: uncharacterized protein LOC104724629 [Camelina sativa]
Length=375

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_002865122.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41381.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=366

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>dbj|BAJ34014.1| unnamed protein product [Thellungiella halophila]
Length=367

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_006398430.1| hypothetical protein EUTSA_v10000932mg [Eutrema salsugineum]
 gb|ESQ39883.1| hypothetical protein EUTSA_v10000932mg [Eutrema salsugineum]
Length=367

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_006279493.1| hypothetical protein CARUB_v10026634mg [Capsella rubella]
 gb|EOA12391.1| hypothetical protein CARUB_v10026634mg [Capsella rubella]
Length=366

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC++NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNHNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_011031922.1| PREDICTED: myb-like protein J isoform X1 [Populus euphratica]
 ref|XP_011031923.1| PREDICTED: myb-like protein J isoform X2 [Populus euphratica]
Length=338

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNR VKLFGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRVVKLFGVRLTDGSIRKSASMGNLSHY  47



>ref|XP_011031924.1| PREDICTED: myb-like protein J isoform X3 [Populus euphratica]
Length=337

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNR VKLFGVRLTDGSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRVVKLFGVRLTDGSIRKSASMGNLSHY  47



>ref|XP_004245787.1| PREDICTED: transcription factor MYB1R1 [Solanum lycopersicum]
Length=342

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS NGHNSRTCPNRGVKLFGVRLTDG IRKSASMGNL+H+
Sbjct  1    MTRRCSHCSTNGHNSRTCPNRGVKLFGVRLTDGLIRKSASMGNLSHF  47



>gb|ABD65094.1| myb family transcription factor [Brassica oleracea]
Length=359

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC+ NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNQNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>emb|CBI29498.3| unnamed protein product [Vitis vinifera]
Length=324

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDG IRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGLIRKSASMGNLSHY  47



>ref|XP_002274350.1| PREDICTED: transcription factor MYB1R1 [Vitis vinifera]
Length=335

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDG IRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGLIRKSASMGNLSHY  47



>emb|CDY18967.1| BnaC01g21010D [Brassica napus]
Length=358

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC+ NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNQNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_008790110.1| PREDICTED: uncharacterized protein LOC103707412 [Phoenix dactylifera]
 ref|XP_008790111.1| PREDICTED: uncharacterized protein LOC103707412 [Phoenix dactylifera]
Length=328

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +1

Query  190  SMTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
             MTRRCSHC +NGHNSRTCPNRGVKLFGVRLTDGSIRKS SMGNL HY
Sbjct  13   EMTRRCSHCGHNGHNSRTCPNRGVKLFGVRLTDGSIRKSVSMGNLAHY  60



>ref|XP_006853679.1| hypothetical protein AMTR_s00056p00127760 [Amborella trichopoda]
 gb|ERN15146.1| hypothetical protein AMTR_s00056p00127760 [Amborella trichopoda]
Length=158

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCSNNGHNSRTCP+R V+LFGVRLTDGSI+KSASMGNLTHY
Sbjct  1    MTRRCSHCSNNGHNSRTCPSRVVRLFGVRLTDGSIKKSASMGNLTHY  47



>emb|CDY58852.1| BnaAnng15540D [Brassica napus]
Length=358

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC+ NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNQNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_004170300.1| PREDICTED: transcription factor MYB1R1-like [Cucumis sativus]
 gb|KGN55848.1| hypothetical protein Csa_3G019390 [Cucumis sativus]
Length=335

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNR VKLFGVRLTDGSIRKSASMGNL HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRVVKLFGVRLTDGSIRKSASMGNLNHY  47



>ref|XP_008448819.1| PREDICTED: transcription factor MYB1R1 [Cucumis melo]
Length=334

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNR VKLFGVRLTDGSIRKSASMGNL HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRVVKLFGVRLTDGSIRKSASMGNLNHY  47



>ref|XP_010529976.1| PREDICTED: protein REVEILLE 8-like [Tarenaya hassleriana]
Length=353

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC+ NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+HY
Sbjct  1    MTRRCSHCNLNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHY  47



>ref|XP_006414230.1| hypothetical protein EUTSA_v10025432mg [Eutrema salsugineum]
 gb|ESQ55683.1| hypothetical protein EUTSA_v10025432mg [Eutrema salsugineum]
Length=386

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 2/57 (4%)
 Frame = +1

Query  166  DPV--LRWILSMTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTH  330
            DP+   + +  MTRRCSHC+ NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+H
Sbjct  30   DPIRITKSLSDMTRRCSHCNQNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSH  86



>emb|CDX90475.1| BnaA03g43060D [Brassica napus]
Length=338

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC+ NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+H+
Sbjct  1    MTRRCSHCNQNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHH  47



>gb|ABD65139.1| myb family transcription factor [Brassica oleracea]
Length=315

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC+ NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+H+
Sbjct  1    MTRRCSHCNQNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHH  47



>ref|XP_009136840.1| PREDICTED: uncharacterized protein LOC103860911 [Brassica rapa]
Length=338

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC+ NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+H+
Sbjct  1    MTRRCSHCNQNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHH  47



>emb|CDY09630.1| BnaC07g34310D [Brassica napus]
Length=315

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHC+ NGHNSRTCPNRGVKLFGVRLT+GSIRKSASMGNL+H+
Sbjct  1    MTRRCSHCNQNGHNSRTCPNRGVKLFGVRLTEGSIRKSASMGNLSHH  47



>gb|AAN63154.1| transcription factor MYBS3 [Oryza sativa Japonica Group]
Length=318

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDGSIRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLS  45



>gb|AAK31280.1|AC079890_16 putative Myb-related protein [Oryza sativa Japonica Group]
 gb|AAP55017.1| ZmMybst1, putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ16977.1| hypothetical protein OsJ_32461 [Oryza sativa Japonica Group]
 gb|ACF60472.1| myb transcription factor [Oryza sativa Japonica Group]
 dbj|BAG94895.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDGSIRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLS  45



>ref|XP_010677080.1| PREDICTED: transcription factor MYB1R1 [Beta vulgaris subsp. 
vulgaris]
Length=341

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLS  45



>gb|AFK40445.1| unknown [Medicago truncatula]
Length=230

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 1/47 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDG IRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDG-IRKSASMGNLSHY  46



>ref|XP_003608683.1| MYB domain containing transcription factor [Medicago truncatula]
 gb|ABR28336.1| MYB transcription factor MYB48 [Medicago truncatula]
 gb|AES90880.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=326

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 1/47 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDG IRKSASMGNL+HY
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDG-IRKSASMGNLSHY  46



>gb|EAY79518.1| hypothetical protein OsI_34646 [Oryza sativa Indica Group]
Length=305

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDGSIRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGNLS  45



>ref|XP_009400892.1| PREDICTED: uncharacterized protein LOC103985010 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400893.1| PREDICTED: uncharacterized protein LOC103985010 [Musa acuminata 
subsp. malaccensis]
Length=304

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDGS+RKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSVRKSASMGNLS  45



>gb|ABR18214.1| unknown [Picea sitchensis]
Length=322

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTR+CSHC +NGHNSRTCPNRGVKLFGVRLTDG IRKS SMGNL HY
Sbjct  1    MTRKCSHCGHNGHNSRTCPNRGVKLFGVRLTDGPIRKSVSMGNLLHY  47



>gb|KHG18328.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=331

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLT+G IRKSASMGNL+ Y
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTEGLIRKSASMGNLSQY  47



>ref|XP_011002026.1| PREDICTED: myb-like protein G [Populus euphratica]
Length=337

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNR VKLFGVRLTDGSIRKSASMGNL+ Y
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRVVKLFGVRLTDGSIRKSASMGNLSLY  47



>gb|KJB20972.1| hypothetical protein B456_003G175300 [Gossypium raimondii]
Length=330

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRG KLFGVRLTDG IRKSASMGNL+ Y
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGFKLFGVRLTDGLIRKSASMGNLSQY  47



>ref|XP_006368993.1| syringolide-induced protein 1-3-1B [Populus trichocarpa]
 gb|ERP65562.1| syringolide-induced protein 1-3-1B [Populus trichocarpa]
Length=337

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNR VKLFGVRLTDGSIRKSASMGNL+ Y
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRVVKLFGVRLTDGSIRKSASMGNLSLY  47



>emb|CAJ53899.1| transcription factor MybS3 [Hordeum vulgare subsp. vulgare]
 emb|CAI84067.1| Mybst1 protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97718.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGN  321
            MTRRCSHCS NGHNSRTCPNRGVK+FGVRLTDGSIRKSASMGN
Sbjct  1    MTRRCSHCSYNGHNSRTCPNRGVKIFGVRLTDGSIRKSASMGN  43



>ref|XP_009400698.1| PREDICTED: transcription factor MYB1R1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400699.1| PREDICTED: transcription factor MYB1R1-like [Musa acuminata subsp. 
malaccensis]
Length=308

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLT  327
            MTRRC HCS++GHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+
Sbjct  1    MTRRCFHCSHDGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLS  45



>gb|KHG00790.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=324

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDG +RKSASM NL+ +
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGFVRKSASMSNLSQF  47



>gb|KJB51831.1| hypothetical protein B456_008G233500 [Gossypium raimondii]
Length=324

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCSHCS+NGHNSRTCPNRGVKLFGVRLTDG +RKSASM NL+ +
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKLFGVRLTDGLVRKSASMSNLSQF  47



>ref|XP_009368939.1| PREDICTED: transcription factor MYB1R1 [Pyrus x bretschneideri]
Length=328

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRR    S+NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY
Sbjct  1    MTRRSPLPSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  47



>emb|CBY88798.1| myb transcription factor [Humulus lupulus]
Length=336

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTRRCS+C +NGHNSRTCPNRGVKL GVRLTDGSIRKSASMGN +HY
Sbjct  1    MTRRCSYCCHNGHNSRTCPNRGVKLSGVRLTDGSIRKSASMGNFSHY  47



>ref|XP_002464930.1| hypothetical protein SORBIDRAFT_01g029020 [Sorghum bicolor]
 gb|EER91928.1| hypothetical protein SORBIDRAFT_01g029020 [Sorghum bicolor]
Length=316

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 1/46 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDGS IRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSAIRKSASMGNLS  46



>ref|XP_004983650.1| PREDICTED: transcription factor MYB1R1-like [Setaria italica]
Length=315

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 1/46 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDGS IRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSAIRKSASMGNLS  46



>ref|NP_001169313.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACN33369.1| unknown [Zea mays]
 tpg|DAA46237.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05025.1| MYB-related transcription factor, partial [Zea mays]
Length=317

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 1/46 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDGS IRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSAIRKSASMGNLS  46



>ref|XP_008796132.1| PREDICTED: protein REVEILLE 6-like isoform X1 [Phoenix dactylifera]
Length=319

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 1/47 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-GVKLFGVRLTDGSIRKSASMGNLTH  330
            MTRRCSHC +NGHNSRTCPNR GVK+FGVRLTDGSIRKSASMGNL+H
Sbjct  1    MTRRCSHCCHNGHNSRTCPNRGGVKIFGVRLTDGSIRKSASMGNLSH  47



>ref|XP_008796133.1| PREDICTED: transcription factor MYB1R1-like isoform X2 [Phoenix 
dactylifera]
Length=311

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 1/47 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-GVKLFGVRLTDGSIRKSASMGNLTH  330
            MTRRCSHC +NGHNSRTCPNR GVK+FGVRLTDGSIRKSASMGNL+H
Sbjct  1    MTRRCSHCCHNGHNSRTCPNRGGVKIFGVRLTDGSIRKSASMGNLSH  47



>ref|XP_008796134.1| PREDICTED: transcription factor MYB1R1-like isoform X3 [Phoenix 
dactylifera]
Length=307

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 1/47 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-GVKLFGVRLTDGSIRKSASMGNLTH  330
            MTRRCSHC +NGHNSRTCPNR GVK+FGVRLTDGSIRKSASMGNL+H
Sbjct  1    MTRRCSHCCHNGHNSRTCPNRGGVKIFGVRLTDGSIRKSASMGNLSH  47



>emb|CCU64193.1| ScMYB41 protein [Saccharum hybrid cultivar Co 86032]
Length=316

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 45/46 (98%), Gaps = 1/46 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVK+FGVRLTDGS IRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVRLTDGSAIRKSASMGNLS  46



>ref|XP_009401485.1| PREDICTED: transcription factor MYB1R1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009401604.1| PREDICTED: transcription factor MYB1R1-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLT  327
            MTRRCSHCS++ H+SRTCPNRGVKLFGVRLTDGSIRKSASMGNL+
Sbjct  1    MTRRCSHCSHDDHHSRTCPNRGVKLFGVRLTDGSIRKSASMGNLS  45



>ref|XP_010267150.1| PREDICTED: uncharacterized protein LOC104604492 isoform X1 [Nelumbo 
nucifera]
Length=346

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 43/45 (96%), Gaps = 1/45 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-GVKLFGVRLTDGSIRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R GVKLFGVRLTDGSI+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGVKLFGVRLTDGSIKKSASMGNL  45



>ref|XP_010933630.1| PREDICTED: transcription factor MYB1R1-like [Elaeis guineensis]
Length=312

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 1/47 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-GVKLFGVRLTDGSIRKSASMGNLTH  330
            MTRRCSHC +NGHNSRTCPNR GVKLFGVRLTDGSIRKSAS+GNL+H
Sbjct  1    MTRRCSHCCHNGHNSRTCPNRGGVKLFGVRLTDGSIRKSASVGNLSH  47



>ref|XP_010267151.1| PREDICTED: transcription factor MYB1R1 isoform X2 [Nelumbo nucifera]
Length=309

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 43/45 (96%), Gaps = 1/45 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-GVKLFGVRLTDGSIRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R GVKLFGVRLTDGSI+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGVKLFGVRLTDGSIKKSASMGNL  45



>ref|XP_009397874.1| PREDICTED: transcription factor MYB1R1-like [Musa acuminata subsp. 
malaccensis]
Length=300

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLT  327
            M RRCSHC++NGHNSRTCPNRGVKLFGV LTDGS+RKSASMGNL+
Sbjct  1    MARRCSHCNHNGHNSRTCPNRGVKLFGVHLTDGSVRKSASMGNLS  45



>ref|XP_008775190.1| PREDICTED: transcription factor MYB1R1-like [Phoenix dactylifera]
Length=300

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            M RRCS C N GHNSRTCPNRGV+LFGVR+ DGSIRKSASMGN+ HY
Sbjct  1    MMRRCSLCGNGGHNSRTCPNRGVRLFGVRIADGSIRKSASMGNIAHY  47



>ref|XP_010934654.1| PREDICTED: transcription factor MYB1R1-like [Elaeis guineensis]
Length=319

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            M RRCS C NNGHNSRTCPNRGV+LFGVR+ DGS RKSASMGN+ HY
Sbjct  1    MMRRCSLCGNNGHNSRTCPNRGVRLFGVRIADGSFRKSASMGNIAHY  47



>gb|ABK24521.1| unknown [Picea sitchensis]
Length=390

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 42/45 (93%), Gaps = 1/45 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-GVKLFGVRLTDGSIRKSASMGNL  324
            MTR+CSHC NNGHNSRTCPNR GVKLFGVRLTDG IRKSASMGNL
Sbjct  1    MTRKCSHCGNNGHNSRTCPNRGGVKLFGVRLTDGPIRKSASMGNL  45



>gb|ACF85648.1| unknown [Zea mays]
 gb|AFW87869.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=315

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 44/46 (96%), Gaps = 1/46 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVK+FGV LTDGS IRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVHLTDGSAIRKSASMGNLS  46



>gb|AIB05106.1| MYB-related transcription factor, partial [Zea mays]
Length=315

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 44/46 (96%), Gaps = 1/46 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVK+FGV LTDGS IRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVHLTDGSAIRKSASMGNLS  46



>ref|NP_001266509.1| ZmMybst1 [Zea mays]
 gb|ACG34833.1| ZmMybst1 [Zea mays]
Length=315

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 44/46 (96%), Gaps = 1/46 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVK+FGV LTDGS IRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVHLTDGSAIRKSASMGNLS  46



>ref|NP_001105212.1| LOC542109 [Zea mays]
 gb|AAO47339.1| ZmMybst1 [Zea mays]
Length=314

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 44/46 (96%), Gaps = 1/46 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCS+NGHNSRTCPNRGVK+FGV LTDGS IRKSASMGNL+
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGVHLTDGSAIRKSASMGNLS  46



>ref|XP_010249506.1| PREDICTED: uncharacterized protein LOC104592058 [Nelumbo nucifera]
Length=344

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 43/45 (96%), Gaps = 1/45 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-GVKLFGVRLTDGSIRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R G+KLFGVRLTDGSI+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPMRGGLKLFGVRLTDGSIKKSASMGNL  45



>ref|XP_001764790.1| predicted protein [Physcomitrella patens]
 gb|EDQ70489.1| predicted protein [Physcomitrella patens]
Length=317

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            M R CSHC +NGHNSRTCP+RGV+LFGVRLTDG +RKS SMGNL+HY
Sbjct  1    MARGCSHCGHNGHNSRTCPDRGVRLFGVRLTDGVMRKSVSMGNLSHY  47



>ref|XP_001775256.1| predicted protein [Physcomitrella patens]
 gb|EDQ59992.1| predicted protein [Physcomitrella patens]
Length=318

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            M R CSHC +NGHNSRTCP+RGV+LFGVRLTDG +RKS SMGNL+HY
Sbjct  1    MARGCSHCGHNGHNSRTCPDRGVRLFGVRLTDGVMRKSVSMGNLSHY  47



>ref|XP_002990122.1| hypothetical protein SELMODRAFT_131017, partial [Selaginella 
moellendorffii]
 gb|EFJ08839.1| hypothetical protein SELMODRAFT_131017, partial [Selaginella 
moellendorffii]
Length=153

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTR+CSHC +NGHNSRTCP+RGV+LFGVRLT+G +RKSASMGNL HY
Sbjct  1    MTRKCSHCGHNGHNSRTCPDRGVRLFGVRLTEG-MRKSASMGNLLHY  46



>ref|XP_002989801.1| hypothetical protein SELMODRAFT_130556, partial [Selaginella 
moellendorffii]
 gb|EFJ09068.1| hypothetical protein SELMODRAFT_130556, partial [Selaginella 
moellendorffii]
Length=153

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 1/47 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            MTR+CSHC +NGHNSRTCP+RGV+LFGVRLT+G +RKSASMGNL HY
Sbjct  1    MTRKCSHCGHNGHNSRTCPDRGVRLFGVRLTEG-MRKSASMGNLLHY  46



>gb|ABD64943.1| myb transcription factor, putative [Brassica oleracea]
Length=327

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL  324
            MTRRCSHC++NGHNSRTCP+RGV LFGVRLT GSIRKSASMGNL
Sbjct  1    MTRRCSHCNHNGHNSRTCPSRGVMLFGVRLTGGSIRKSASMGNL  44



>emb|CDO97977.1| unnamed protein product [Coffea canephora]
Length=370

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 46/60 (77%), Gaps = 13/60 (22%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDGSI-RKSASMGNLTHY  333
            MTRRCSHCSNNGHNSRTCP R            GVKLFGVRLTDGSI +KSASMGNL+HY
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGGGSGGCAGGGVKLFGVRLTDGSIMKKSASMGNLSHY  60



>emb|CDX95438.1| BnaC01g33300D [Brassica napus]
Length=258

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL  324
            MTRRCSHC++NGHNSRTCPN GV LFGVRLT+GSIRKSAS+GNL
Sbjct  1    MTRRCSHCNHNGHNSRTCPNPGVMLFGVRLTEGSIRKSASLGNL  44



>ref|XP_006593489.1| PREDICTED: MYB transcription factor MYB62 isoform X1 [Glycine 
max]
 gb|KHN32647.1| Transcription factor MYB1R1 [Glycine soja]
Length=356

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 4/48 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP+R   GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPSRGGGGVKLFGVRLTDGSIIKKSASMGNL  48



>ref|XP_009380499.1| PREDICTED: transcription factor MYB1R1-like [Musa acuminata subsp. 
malaccensis]
Length=326

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL  324
            MTRRCSHCS++GHNSRTCP+RG+ LFGVRLT G+IRKSASMGNL
Sbjct  1    MTRRCSHCSHDGHNSRTCPDRGLMLFGVRLTGGTIRKSASMGNL  44



>ref|XP_004486782.1| PREDICTED: uncharacterized protein LOC101494932 isoform X1 [Cicer 
arietinum]
 ref|XP_004486783.1| PREDICTED: uncharacterized protein LOC101494932 isoform X2 [Cicer 
arietinum]
Length=348

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 4/49 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---GVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP+R   GVK+FGVRLTDGS I+KSASMGNLT
Sbjct  1    MTRRCSHCSNNGHNSRTCPSRGGAGVKIFGVRLTDGSIIQKSASMGNLT  49



>emb|CDY68924.1| BnaCnng61080D [Brassica napus]
Length=327

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL  324
            MTRRCSHC++NGHNSRTCP+RGV LFGVRLT GSIRKS SMGNL
Sbjct  1    MTRRCSHCNHNGHNSRTCPSRGVMLFGVRLTGGSIRKSVSMGNL  44



>ref|XP_004487226.1| PREDICTED: uncharacterized protein LOC101496138 [Cicer arietinum]
Length=108

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 4/49 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---GVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP+R   GVK+FGVRLTDGS I+KSASMGNLT
Sbjct  1    MTRRCSHCSNNGHNSRTCPSRGGAGVKIFGVRLTDGSIIQKSASMGNLT  49



>gb|ABR28340.1| MYB transcription factor MYB52 [Medicago truncatula]
Length=353

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 6/50 (12%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-----GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP+R     GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPSRTAAAGGVKLFGVRLTDGSIIKKSASMGNL  50



>ref|XP_003597679.1| hypothetical protein MTR_2g100930 [Medicago truncatula]
 gb|AES67930.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=353

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 6/50 (12%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-----GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP+R     GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPSRTAAAGGVKLFGVRLTDGSIIKKSASMGNL  50



>ref|XP_008462421.1| PREDICTED: uncharacterized protein LOC103500780 [Cucumis melo]
 ref|XP_008462422.1| PREDICTED: uncharacterized protein LOC103500780 [Cucumis melo]
 ref|XP_008462424.1| PREDICTED: uncharacterized protein LOC103500780 [Cucumis melo]
 ref|XP_008462425.1| PREDICTED: uncharacterized protein LOC103500780 [Cucumis melo]
Length=344

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 47/56 (84%), Gaps = 9/56 (16%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-------GVKLFGVRLTDGS-IRKSASMGNLT-HY  333
            MTRRCSHCSNNGHNSRTCP+R       GVKLFGVRLTDGS I+KSASMGNL+ HY
Sbjct  1    MTRRCSHCSNNGHNSRTCPSRGGGGGGSGVKLFGVRLTDGSFIKKSASMGNLSVHY  56



>gb|ABI74688.1| MYB [Brassica rapa subsp. pekinensis]
Length=348

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL  324
            MTRRCSHC++ GHNSRTCP+RGV LFGVRLT GSIRKSASMGNL
Sbjct  1    MTRRCSHCNHYGHNSRTCPSRGVMLFGVRLTGGSIRKSASMGNL  44



>gb|AAB63650.1| Myb-related transcription activator (MybSt1) isolog [Arabidopsis 
thaliana]
 dbj|BAB01274.1| Myb-related transcription activator [Arabidopsis thaliana]
Length=369

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 44/52 (85%), Gaps = 7/52 (13%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG------VKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP RG      VKLFGVRLTDGS I+KSASMGNL+
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGSGSSSAVKLFGVRLTDGSIIKKSASMGNLS  52



>ref|XP_009114281.1| PREDICTED: uncharacterized protein LOC103839529 [Brassica rapa]
Length=322

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL  324
            MTRRCSHC++ GHNSRTCP+RGV LFGVRLT GSIRKSASMGNL
Sbjct  1    MTRRCSHCNHYGHNSRTCPSRGVMLFGVRLTGGSIRKSASMGNL  44



>emb|CDY41049.1| BnaA09g18280D [Brassica napus]
Length=322

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL  324
            MTRRCSHC++ GHNSRTCP+RGV LFGVRLT GSIRKSASMGNL
Sbjct  1    MTRRCSHCNHYGHNSRTCPSRGVMLFGVRLTGGSIRKSASMGNL  44



>ref|NP_001235649.1| MYB transcription factor MYB52 [Glycine max]
 gb|ABH02825.1| MYB transcription factor MYB52 [Glycine max]
Length=360

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 4/48 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHC+NNGHNSRTCP+R   GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCTNNGHNSRTCPSRGGGGVKLFGVRLTDGSIIKKSASMGNL  48



>gb|ABK96220.1| unknown [Populus trichocarpa x Populus deltoides]
Length=369

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 43/57 (75%), Gaps = 13/57 (23%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R            GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRSSLASSSSSPLSGVKLFGVRLTDGSIIKKSASMGNL  57



>ref|XP_011010432.1| PREDICTED: uncharacterized protein LOC105115293 isoform X1 [Populus 
euphratica]
Length=371

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 43/57 (75%), Gaps = 13/57 (23%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R            GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRSSLASSSSAPLSGVKLFGVRLTDGSIIKKSASMGNL  57



>ref|XP_011010433.1| PREDICTED: uncharacterized protein LOC105115293 isoform X2 [Populus 
euphratica]
Length=369

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 43/57 (75%), Gaps = 13/57 (23%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R            GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRSSLASSSSAPLSGVKLFGVRLTDGSIIKKSASMGNL  57



>ref|XP_006369213.1| hypothetical protein POPTR_0001s19070g [Populus trichocarpa]
 gb|ERP65782.1| hypothetical protein POPTR_0001s19070g [Populus trichocarpa]
Length=367

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 43/57 (75%), Gaps = 13/57 (23%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R            GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRSSLASSSSSPLSGVKLFGVRLTDGSIIKKSASMGNL  57



>ref|XP_004141664.1| PREDICTED: uncharacterized protein LOC101214316 [Cucumis sativus]
 ref|XP_004155948.1| PREDICTED: uncharacterized protein LOC101229963 [Cucumis sativus]
 gb|KGN45584.1| hypothetical protein Csa_7G452880 [Cucumis sativus]
Length=346

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 11/58 (19%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---------GVKLFGVRLTDGS-IRKSASMGNLT-HY  333
            MTRRCSHCSNNGHNSRTCP+R         GVKLFGVRLTDGS I+KSASMGNL+ HY
Sbjct  1    MTRRCSHCSNNGHNSRTCPSRAGGGGGSGAGVKLFGVRLTDGSFIKKSASMGNLSVHY  58



>ref|XP_002298242.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE83047.1| myb family transcription factor family protein [Populus trichocarpa]
Length=369

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 43/57 (75%), Gaps = 13/57 (23%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R            GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRSSLASSSSSPLSGVKLFGVRLTDGSIIKKSASMGNL  57



>ref|XP_011010434.1| PREDICTED: uncharacterized protein LOC105115293 isoform X3 [Populus 
euphratica]
Length=368

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 43/57 (75%), Gaps = 13/57 (23%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R            GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRSSLASSSSAPLSGVKLFGVRLTDGSIIKKSASMGNL  57



>ref|XP_004147257.1| PREDICTED: transcription factor MYB1R1-like [Cucumis sativus]
Length=336

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  214  CSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            CS+NGHNSRTCPNR VKLFGVRLTDGSIRKSASMGNL HY
Sbjct  9    CSHNGHNSRTCPNRVVKLFGVRLTDGSIRKSASMGNLNHY  48



>dbj|BAJ40869.1| transcriptional factor MYB-4 [Coptis japonica]
Length=221

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 3/50 (6%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPN-RGVKLFGVRLTDGS--IRKSASMGNLTHY  333
            MTRRCSHCSNNGHNSRTCP  +GVKLFGVRLTDG+  ++KSASMGNL+ Y
Sbjct  1    MTRRCSHCSNNGHNSRTCPTIKGVKLFGVRLTDGAGLMKKSASMGNLSLY  50



>ref|XP_010545666.1| PREDICTED: myb-like protein J [Tarenaya hassleriana]
Length=350

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 44/55 (80%), Gaps = 10/55 (18%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG---------VKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP RG         VKLFGVRLTDGS I+KSASMGNL+
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGGGSPVAAVKLFGVRLTDGSIIKKSASMGNLS  55



>dbj|BAG15871.1| myb transcription factor [Bruguiera gymnorhiza]
Length=382

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 43/68 (63%), Gaps = 23/68 (34%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-----------------------GVKLFGVRLTDGSIRK  303
            MTRRCSHCSNNGHNSRTCP R                        +KLFGVRLTDGSI+K
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRTASSGAASASSASSSSSSSGPIPSLKLFGVRLTDGSIKK  60

Query  304  SASMGNLT  327
            SASMGNL+
Sbjct  61   SASMGNLS  68



>ref|XP_001766973.1| predicted protein [Physcomitrella patens]
 gb|EDQ68139.1| predicted protein, partial [Physcomitrella patens]
Length=156

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 4/51 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDG----SIRKSASMGNLTHY  333
            M+RRCSHC  NGHNSRTCP RGV+LFGVRLTDG    ++RKS SM NL+HY
Sbjct  1    MSRRCSHCGLNGHNSRTCPERGVRLFGVRLTDGVSSTNMRKSVSMNNLSHY  51



>ref|XP_006385452.1| hypothetical protein POPTR_0003s04750g [Populus trichocarpa]
 gb|ERP63249.1| hypothetical protein POPTR_0003s04750g [Populus trichocarpa]
Length=130

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 46/61 (75%), Gaps = 14/61 (23%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDGS-IRKSASMGNLT-H  330
            MTRRCSHCSNNGHNSRTCP R            GVKLFGVRLTDGS I+KSASMGNL+ H
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRSSLASSSSSPLSGVKLFGVRLTDGSIIKKSASMGNLSVH  60

Query  331  Y  333
            Y
Sbjct  61   Y  61



>ref|XP_007150607.1| hypothetical protein PHAVU_005G166300g [Phaseolus vulgaris]
 ref|XP_007150608.1| hypothetical protein PHAVU_005G166300g [Phaseolus vulgaris]
 gb|ESW22601.1| hypothetical protein PHAVU_005G166300g [Phaseolus vulgaris]
 gb|ESW22602.1| hypothetical protein PHAVU_005G166300g [Phaseolus vulgaris]
Length=355

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 43/50 (86%), Gaps = 6/50 (12%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-----GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP+      GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPSSRGAAAGVKLFGVRLTDGSIIKKSASMGNL  50



>ref|XP_007039774.1| Myb-like transcription factor family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24275.1| Myb-like transcription factor family protein isoform 1 [Theobroma 
cacao]
Length=364

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  196  TRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            +R  ++  +NGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNL+ Y
Sbjct  38   SRALTYMRHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSQY  83



>ref|NP_001280790.1| uncharacterized protein LOC103443746 [Malus domestica]
 gb|AAZ20443.1| MYBR2 [Malus domestica]
Length=351

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 44/58 (76%), Gaps = 13/58 (22%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP R            GVKLFGVRLTDGS I+KSASMGNL+
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRVGSSSSSPSLGGGVKLFGVRLTDGSIIKKSASMGNLS  58



>gb|ADL36774.1| MYBR domain class transcription factor [Malus domestica]
Length=356

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 44/60 (73%), Gaps = 15/60 (25%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--------------GVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP R              GVKLFGVRLTDGS I+KSASMGNL+
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRVGSSSSSPSLCGGGGVKLFGVRLTDGSIIKKSASMGNLS  60



>ref|XP_011012039.1| PREDICTED: uncharacterized protein LOC105116394 [Populus euphratica]
Length=377

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 46/61 (75%), Gaps = 14/61 (23%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDGS-IRKSASMGNLT-H  330
            MTRRCSHCSNNGHNSRTCP R            GVKLFGVRLTDGS I+KSASMG+L+ H
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRSSLASSSSSPLSGVKLFGVRLTDGSIIKKSASMGSLSGH  60

Query  331  Y  333
            Y
Sbjct  61   Y  61



>ref|XP_009353549.1| PREDICTED: uncharacterized protein LOC103944815 [Pyrus x bretschneideri]
 ref|XP_009342531.1| PREDICTED: uncharacterized protein LOC103934507 [Pyrus x bretschneideri]
Length=351

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 44/58 (76%), Gaps = 13/58 (22%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP R            GVKLFGVRLTDGS I+KSASMGNL+
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRVGSSSSSPSLGGGVKLFGVRLTDGSIIKKSASMGNLS  58



>ref|XP_010465657.1| PREDICTED: uncharacterized protein LOC104745965 [Camelina sativa]
Length=386

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 44/61 (72%), Gaps = 16/61 (26%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG---------------VKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP RG               VKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGTCGGGGGGGSCSSSAVKLFGVRLTDGSIIKKSASMGNL  60

Query  325  T  327
            +
Sbjct  61   S  61



>ref|XP_009421290.1| PREDICTED: transcription factor MYB1R1-like [Musa acuminata subsp. 
malaccensis]
Length=334

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--GVKLFGVRLTD--GSIRKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP R  GV+LFGVRLTD  G+++KSASMG L+
Sbjct  1    MTRRCSHCSNNGHNSRTCPARGGGVRLFGVRLTDGVGAMKKSASMGCLS  49



>ref|XP_008791498.1| PREDICTED: uncharacterized protein LOC103708379 [Phoenix dactylifera]
Length=351

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 4/48 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--GVKLFGVRLTD--GSIRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R  GV+LFGVRLTD  GS++KSASMG+L
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRAGGVRLFGVRLTDGVGSMKKSASMGSL  48



>ref|XP_010419320.1| PREDICTED: transcription factor MYB1R1-like, partial [Camelina 
sativa]
Length=308

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 44/64 (69%), Gaps = 19/64 (30%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG------------------VKLFGVRLTDGS-IRKSASM  315
            MTRRCSHCSNNGHNSRTCP RG                  VKLFGVRLTDGS I+KSASM
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGTCGGGGGGGGGGSCSSSAVKLFGVRLTDGSIIKKSASM  60

Query  316  GNLT  327
            GNL+
Sbjct  61   GNLS  64



>ref|XP_010915399.1| PREDICTED: uncharacterized protein LOC105040534 isoform X2 [Elaeis 
guineensis]
Length=109

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 4/48 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--GVKLFGVRLTD--GSIRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R  GV+LFGVRLTD  GS++KSASMG+L
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRAGGVRLFGVRLTDGVGSMKKSASMGSL  48



>ref|XP_006426881.1| hypothetical protein CICLE_v10025950mg [Citrus clementina]
 gb|ESR40121.1| hypothetical protein CICLE_v10025950mg [Citrus clementina]
Length=357

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 12/59 (20%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---------GVKLFGVRLTDGS-IRKSASMGNLT--HY  333
            MTRRCSHCSNNGHNSRTCP R         G+KLFGVRLTDGS I+KSASMGNL+  HY
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGSSPGVGGLKLFGVRLTDGSIIKKSASMGNLSALHY  59



>ref|XP_010487491.1| PREDICTED: uncharacterized protein LOC104765474 [Camelina sativa]
Length=385

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 44/62 (71%), Gaps = 17/62 (27%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG----------------VKLFGVRLTDGS-IRKSASMGN  321
            MTRRCSHCSNNGHNSRTCP RG                VKLFGVRLTDGS I+KSASMGN
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGTCGGGGGGGGSCSSSAVKLFGVRLTDGSIIKKSASMGN  60

Query  322  LT  327
            L+
Sbjct  61   LS  62



>ref|XP_001764190.1| predicted protein [Physcomitrella patens]
 gb|EDQ71031.1| predicted protein [Physcomitrella patens]
Length=694

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 4/53 (8%)
 Frame = +1

Query  187  LSMTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDG----SIRKSASMGNLTHY  333
            + M+RRCSHC  NGHNSRTCP+RGV+LFGVRLTDG    ++RKS SM NL+HY
Sbjct  151  IEMSRRCSHCGLNGHNSRTCPDRGVRLFGVRLTDGISSMNMRKSVSMNNLSHY  203



>ref|XP_006465688.1| PREDICTED: transcription factor MYB1R1-like [Citrus sinensis]
Length=357

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 12/59 (20%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---------GVKLFGVRLTDGS-IRKSASMGNLT--HY  333
            MTRRCSHCSNNGHNSRTCP R         G+KLFGVRLTDGS I+KSASMGNL+  HY
Sbjct  1    MTRRCSHCSNNGHNSRTCPARGGGSSPGVGGLKLFGVRLTDGSIIKKSASMGNLSALHY  59



>ref|XP_010915398.1| PREDICTED: uncharacterized protein LOC105040534 isoform X1 [Elaeis 
guineensis]
Length=143

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 4/48 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--GVKLFGVRLTD--GSIRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R  GV+LFGVRLTD  GS++KSASMG+L
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRAGGVRLFGVRLTDGVGSMKKSASMGSL  48



>ref|XP_010504183.1| PREDICTED: uncharacterized protein LOC104781253 [Camelina sativa]
Length=387

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 44/64 (69%), Gaps = 19/64 (30%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG------------------VKLFGVRLTDGS-IRKSASM  315
            MTRRCSHCSNNGHNSRTCP RG                  VKLFGVRLTDGS I+KSASM
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGTCGGGGGGGGGGSCSSSAVKLFGVRLTDGSIIKKSASM  60

Query  316  GNLT  327
            GNL+
Sbjct  61   GNLS  64



>ref|XP_001766974.1| predicted protein [Physcomitrella patens]
 gb|EDQ68140.1| predicted protein [Physcomitrella patens]
Length=187

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 4/51 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDG----SIRKSASMGNLTHY  333
            M+RRCSHC  NGHNSRTCP RGV+LFGVRLTD     ++RKS SM NL+HY
Sbjct  1    MSRRCSHCGLNGHNSRTCPERGVRLFGVRLTDSVSSTNMRKSVSMNNLSHY  51



>gb|ABZ04613.1| MYB domain containing transcription factor, partial [Pinus taeda]
Length=50

 Score = 72.0 bits (175),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRL-TDGSIRKSASMGNL  324
            M RRCSHC +NGHNSRTCP+RGVKLFGVRL TD  +RKS SMGNL
Sbjct  1    MNRRCSHCGHNGHNSRTCPDRGVKLFGVRLTTDEPMRKSLSMGNL  45



>gb|ABZ04595.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04596.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04597.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04598.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04599.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04600.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04601.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04602.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04603.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04604.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04605.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04606.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04607.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04608.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04609.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04610.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04611.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04612.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04614.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04615.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04616.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04617.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04618.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04619.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04620.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04621.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04622.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04623.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04624.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04625.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04626.1| MYB domain containing transcription factor, partial [Pinus taeda]
 gb|ABZ04627.1| MYB domain containing transcription factor, partial [Pinus radiata]
 gb|ABZ04628.1| MYB domain containing transcription factor, partial [Pinus radiata]
 gb|ABZ04629.1| MYB domain containing transcription factor, partial [Pinus sylvestris]
 gb|ABZ04630.1| MYB domain containing transcription factor, partial [Pinus elliottii]
 gb|ABZ04631.1| MYB domain containing transcription factor, partial [Pinus elliottii]
Length=50

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRL-TDGSIRKSASMGNL  324
            M RRCSHC +NGHNSRTCP+RGVKLFGVRL TD  +RKS SMGNL
Sbjct  1    MNRRCSHCGHNGHNSRTCPDRGVKLFGVRLTTDEPMRKSLSMGNL  45



>emb|CDX82407.1| BnaA03g34140D [Brassica napus]
Length=337

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 43/60 (72%), Gaps = 15/60 (25%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--------------GVKLFGVRLTDGSI-RKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP R               VKLFGVRLTDGSI +KSASMGNL+
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGSGTCGGLGGSSSSAVKLFGVRLTDGSIVKKSASMGNLS  60



>ref|XP_007215594.1| hypothetical protein PRUPE_ppa007697mg [Prunus persica]
 gb|EMJ16793.1| hypothetical protein PRUPE_ppa007697mg [Prunus persica]
Length=358

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 43/60 (72%), Gaps = 16/60 (27%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---------------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R               G+KLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRVGSSSSSSAGGGGCGGLKLFGVRLTDGSIIKKSASMGNL  60



>gb|KDO51780.1| hypothetical protein CISIN_1g0164772mg, partial [Citrus sinensis]
 gb|KDO51781.1| hypothetical protein CISIN_1g0164772mg, partial [Citrus sinensis]
Length=109

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 12/59 (20%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---------GVKLFGVRLTDGS-IRKSASMGNLT--HY  333
            MTRRCSHCSNNGHNSRTCP R         G+KLFGVRLTDGS I+KSASMGNL+  HY
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGSSPGVGGLKLFGVRLTDGSIIKKSASMGNLSALHY  59



>ref|XP_006297882.1| hypothetical protein CARUB_v10013924mg [Capsella rubella]
 gb|EOA30780.1| hypothetical protein CARUB_v10013924mg [Capsella rubella]
Length=385

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 43/63 (68%), Gaps = 18/63 (29%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-----------------GVKLFGVRLTDGS-IRKSASMG  318
            MTRRCSHCSNNGHNSRTCP R                  VKLFGVRLTDGS I+KSASMG
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGGTCGGGGGGSCSSSAVKLFGVRLTDGSIIKKSASMG  60

Query  319  NLT  327
            NL+
Sbjct  61   NLS  63



>ref|NP_001235701.1| MYB transcription factor MYB62 [Glycine max]
 gb|ABH02830.1| MYB transcription factor MYB62 [Glycine max]
Length=359

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 4/48 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP+R   GVKLFGVRLTDGS I   ASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPSRGGGGVKLFGVRLTDGSIIIIYASMGNL  48



>gb|KHG24899.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=353

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 43/53 (81%), Gaps = 9/53 (17%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R        GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGGVGCGGVKLFGVRLTDGSIIKKSASMGNL  53



>gb|KJB56816.1| hypothetical protein B456_009G137300 [Gossypium raimondii]
Length=353

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 43/53 (81%), Gaps = 9/53 (17%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R        GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGGVGCGGVKLFGVRLTDGSIIKKSASMGNL  53



>emb|CDY30163.1| BnaC05g36990D [Brassica napus]
Length=355

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 42/54 (78%), Gaps = 9/54 (17%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--------GVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCS NGHNSRTCP R         VKLFGVRLTDGS I+KSASMGNL+
Sbjct  1    MTRRCSHCSYNGHNSRTCPTRSASSSSSAAVKLFGVRLTDGSIIKKSASMGNLS  54



>ref|XP_008228426.1| PREDICTED: transcription factor MYB1R1 [Prunus mume]
Length=358

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 46/66 (70%), Gaps = 19/66 (29%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---------------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R               G+KLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRVGSSSSSSVGGGGGGGLKLFGVRLTDGSIIKKSASMGNL  60

Query  325  T---HY  333
            +   HY
Sbjct  61   SSAAHY  66



>ref|XP_009404535.1| PREDICTED: transcription factor MYB1R1-like [Musa acuminata subsp. 
malaccensis]
Length=332

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 4/49 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--GVKLFGVRLTD--GSIRKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP R  GV+LFGVRLTD  G+++KSASMG L+
Sbjct  1    MTRRCSHCSNNGHNSRTCPARGGGVRLFGVRLTDGVGTMKKSASMGCLS  49



>emb|CDY70918.1| BnaAnng35540D [Brassica napus]
Length=359

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 42/55 (76%), Gaps = 10/55 (18%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---------GVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCS NGHNSRTCP R          VKLFGVRLTDGS I+KSASMGNL+
Sbjct  1    MTRRCSHCSYNGHNSRTCPTRSSASSSSSSAVKLFGVRLTDGSIIKKSASMGNLS  55



>ref|XP_007024302.1| Myb-like transcription factor family protein [Theobroma cacao]
 gb|EOY26924.1| Myb-like transcription factor family protein [Theobroma cacao]
Length=356

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 43/55 (78%), Gaps = 11/55 (20%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR----------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R          GVKLFGVRLTDGS I+KSASMGNL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGGSGGVGGGVKLFGVRLTDGSIIKKSASMGNL  55



>ref|XP_006406842.1| hypothetical protein EUTSA_v10020915mg [Eutrema salsugineum]
 gb|ESQ48295.1| hypothetical protein EUTSA_v10020915mg [Eutrema salsugineum]
Length=383

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 20/65 (31%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-------------------GVKLFGVRLTDGS-IRKSAS  312
            MTRRCSHCSNNGHNSRTCP R                    VKLFGVRLTDGS I+KSAS
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGTCGGNGGGAGGGSSSSAVKLFGVRLTDGSIIKKSAS  60

Query  313  MGNLT  327
            MGNL+
Sbjct  61   MGNLS  65



>ref|XP_010665911.1| PREDICTED: transcription factor MYB1R1 [Beta vulgaris subsp. 
vulgaris]
Length=364

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 46/72 (64%), Gaps = 25/72 (35%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG------------------------VKLFGVRLTDGS-I  297
            MTR+CSHCSNNGHNSRTCP RG                        VKLFGVRLTDGS +
Sbjct  1    MTRKCSHCSNNGHNSRTCPTRGGAVATNSSSSSVGVSGGSFNGSGGVKLFGVRLTDGSFM  60

Query  298  RKSASMGNLTHY  333
            +KSASMGNL+HY
Sbjct  61   KKSASMGNLSHY  72



>ref|XP_002883001.1| hypothetical protein ARALYDRAFT_479087 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59260.1| hypothetical protein ARALYDRAFT_479087 [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 20/65 (31%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-------------------GVKLFGVRLTDGS-IRKSAS  312
            MTRRCSHCSNNGHNSRTCP R                    VKLFGVRLTDGS I+KSAS
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGTCGGSGGGGGGSCSSSTVKLFGVRLTDGSIIKKSAS  60

Query  313  MGNLT  327
            MGNL+
Sbjct  61   MGNLS  65



>ref|XP_002515966.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF46386.1| DNA binding protein, putative [Ricinus communis]
Length=381

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 45/70 (64%), Gaps = 23/70 (33%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG---------------------VKLFGVRLTDGS-IRKS  306
            MTRRCSHCSNNGHNSRTCP R                      V+LFGVRLTDGS I+KS
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRSSTCSSAAGSGSASSSASSIAGVRLFGVRLTDGSIIKKS  60

Query  307  ASMGNLT-HY  333
            ASMGNL+ HY
Sbjct  61   ASMGNLSAHY  70



>gb|KDP40862.1| hypothetical protein JCGZ_24861 [Jatropha curcas]
Length=377

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 40/58 (69%), Positives = 42/58 (72%), Gaps = 14/58 (24%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-------------GVKLFGVRLTDGS-IRKSASMGNL  324
            MTRRCSHCSNNGHNSRTCP R             GV+LFGVRLTDGS I+KSASM NL
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRSSGASSSSASSLSGVRLFGVRLTDGSIIKKSASMSNL  58



>ref|NP_188256.1| myb family transcription factor [Arabidopsis thaliana]
 gb|AAO64767.1| At3g16350 [Arabidopsis thaliana]
 gb|AEE75801.1| myb family transcription factor [Arabidopsis thaliana]
Length=387

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 43/70 (61%), Gaps = 25/70 (36%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------------------GVKLFGVRLTDGS-I  297
            MTRRCSHCSNNGHNSRTCP R                         VKLFGVRLTDGS I
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGTCGGSGGGGGGGGGGGSGSSSAVKLFGVRLTDGSII  60

Query  298  RKSASMGNLT  327
            +KSASMGNL+
Sbjct  61   KKSASMGNLS  70



>ref|XP_010098140.1| Transcription factor [Morus notabilis]
 gb|EXB74577.1| Transcription factor [Morus notabilis]
Length=357

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 42/57 (74%), Gaps = 15/57 (26%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--------------GVKLFGVRLTDGS-IRKSASMG  318
            MTRRCSHCSNNGHNSRTCP+R              G+KLFGVRLTDGS I+KSASMG
Sbjct  1    MTRRCSHCSNNGHNSRTCPSRGSGSGGGGGGASGGGLKLFGVRLTDGSIIKKSASMG  57



>ref|XP_004302861.1| PREDICTED: transcription factor MYB1R1 [Fragaria vesca subsp. 
vesca]
Length=361

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 14/59 (24%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCP-------------NRGVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP             + GV+LFGV+LTDGS I+KSASMGNL+
Sbjct  1    MTRRCSHCSNNGHNSRTCPSRGGGASSSCSSGSGGVRLFGVKLTDGSIIKKSASMGNLS  59



>emb|CDX75876.1| BnaC03g39590D [Brassica napus]
Length=381

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 42/60 (70%), Gaps = 15/60 (25%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--------------GVKLFGVRLTDGS-IRKSASMGNLT  327
            MTRRCSH SNNGHNSRTCP R               VKLFGVRLTDGS I+KSASMGNL+
Sbjct  1    MTRRCSHFSNNGHNSRTCPTRGSGTCGGLGGSSSSAVKLFGVRLTDGSIIKKSASMGNLS  60



>ref|XP_002283785.1| PREDICTED: uncharacterized protein LOC100241227 [Vitis vinifera]
 emb|CBI36067.3| unnamed protein product [Vitis vinifera]
Length=358

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/53 (74%), Positives = 41/53 (77%), Gaps = 11/53 (21%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR----------GVKLFGVRLTDGS-IRKSASMG  318
            MTRRCSHCS NGHNSRTCP+R          GVKLFGVRLTDGS I+KSASMG
Sbjct  1    MTRRCSHCSTNGHNSRTCPSRGGGAVAGGIGGVKLFGVRLTDGSIIKKSASMG  53



>gb|AAS09982.1| MYB transcription factor [Arabidopsis thaliana]
Length=387

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 43/70 (61%), Gaps = 25/70 (36%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------------------GVKLFGVRLTDGS-I  297
            MTRRCSHCSNNGHNSRTCP R                         +KLFGVRLTDGS I
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGTCGGSGGGGGGGGGGGSGSSSAMKLFGVRLTDGSII  60

Query  298  RKSASMGNLT  327
            +KSASMGNL+
Sbjct  61   KKSASMGNLS  70



>gb|KFK38991.1| hypothetical protein AALP_AA3G185700 [Arabis alpina]
Length=392

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 44/72 (61%), Gaps = 27/72 (38%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG--------------------------VKLFGVRLTDGS  294
            MTRRCSHCSNNGHNSRTCP RG                          VKLFGVRLTDGS
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRGGGGGGTCGGSGGGGGGGGGGSFSSSTVKLFGVRLTDGS  60

Query  295  -IRKSASMGNLT  327
             I+KSASMGNL+
Sbjct  61   IIKKSASMGNLS  72



>ref|XP_001764191.1| predicted protein [Physcomitrella patens]
 gb|EDQ71032.1| predicted protein [Physcomitrella patens]
Length=657

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 4/52 (8%)
 Frame = +1

Query  190  SMTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDG----SIRKSASMGNLTHY  333
             M+RRCSHC+ NGHNSRTC +RGV+LFGVRLTD     ++RKS SM NL+HY
Sbjct  134  EMSRRCSHCNLNGHNSRTCSDRGVRLFGVRLTDSVSSMNMRKSVSMNNLSHY  185



>ref|XP_009385776.1| PREDICTED: transcription factor MYB1R1-like [Musa acuminata subsp. 
malaccensis]
Length=354

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 4/49 (8%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--GVKLFGVRLTDG--SIRKSASMGNLT  327
            MTRRCSHCSNNGHNSRTCP R  GV+LFGVRL +G  +++KSASMG L 
Sbjct  1    MTRRCSHCSNNGHNSRTCPARGGGVRLFGVRLAEGVAAMKKSASMGCLP  49



>ref|XP_009146146.1| PREDICTED: transcription factor MYB1R1 [Brassica rapa]
Length=372

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 42/68 (62%), Gaps = 23/68 (34%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR----------------------GVKLFGVRLTDGS-IRK  303
            MTRRCSHCS NGHNSRTCP R                       VKLFGVRLTDGS I+K
Sbjct  1    MTRRCSHCSYNGHNSRTCPTRGGGGGTCGGNGGGSSASSSSSSAVKLFGVRLTDGSIIKK  60

Query  304  SASMGNLT  327
            SASMGNL+
Sbjct  61   SASMGNLS  68



>ref|XP_002991458.1| hypothetical protein SELMODRAFT_133546 [Selaginella moellendorffii]
 ref|XP_002993844.1| hypothetical protein SELMODRAFT_137652 [Selaginella moellendorffii]
 gb|EFJ05081.1| hypothetical protein SELMODRAFT_137652 [Selaginella moellendorffii]
 gb|EFJ07570.1| hypothetical protein SELMODRAFT_133546 [Selaginella moellendorffii]
Length=175

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 8/53 (15%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRL----TDG----SIRKSASMGNLT  327
            M RRCSHC +NGHNSRTCP+RG++LFGVRL    TDG    ++R+SAS GNL 
Sbjct  1    MARRCSHCGHNGHNSRTCPDRGIRLFGVRLTMKATDGASGVAMRRSASAGNLV  53



>ref|XP_009413857.1| PREDICTED: transcription factor MYB1R1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=357

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 4/46 (9%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--GVKLFGVRLTD--GSIRKSASMG  318
            MTRRCSHCSNNGHNSRTCP R  GV+LFGVRL +  G+++KSASMG
Sbjct  1    MTRRCSHCSNNGHNSRTCPARGGGVRLFGVRLMEGTGTMKKSASMG  46



>ref|XP_009413856.1| PREDICTED: transcription factor MYB1R1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=398

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 4/46 (9%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--GVKLFGVRLTD--GSIRKSASMG  318
            MTRRCSHCSNNGHNSRTCP R  GV+LFGVRL +  G+++KSASMG
Sbjct  1    MTRRCSHCSNNGHNSRTCPARGGGVRLFGVRLMEGTGTMKKSASMG  46



>ref|XP_002443842.1| hypothetical protein SORBIDRAFT_07g003170 [Sorghum bicolor]
 gb|EES13337.1| hypothetical protein SORBIDRAFT_07g003170 [Sorghum bicolor]
Length=383

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  199  RRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTH  330
            RRCS C ++GHN+RTC  R VKLFGVR+ D  IRKSASMGN+ H
Sbjct  31   RRCSQCGHHGHNARTCTARPVKLFGVRIGDKPIRKSASMGNIAH  74



>ref|XP_006359477.1| PREDICTED: transcription factor MYB1R1-like [Solanum tuberosum]
Length=375

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 41/59 (69%), Gaps = 16/59 (27%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCP---------------NRGVKLFGVRLTDGSI-RKSASMGN  321
            MTRRCSHC+NNGHNSRTCP                 GV+LFGVRLTDGSI +KSASMGN
Sbjct  1    MTRRCSHCNNNGHNSRTCPTRGGVTGGVGGGSSGGGGVRLFGVRLTDGSIMKKSASMGN  59



>ref|XP_009626737.1| PREDICTED: transcription factor MYB1R1 [Nicotiana tomentosiformis]
Length=375

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 43/65 (66%), Gaps = 21/65 (32%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCP--------------------NRGVKLFGVRLTDGSI-RKSA  309
            MTRRCSHC+NNGHNSRTCP                    + GV+LFGVRLTDGSI +KSA
Sbjct  1    MTRRCSHCNNNGHNSRTCPTTRGGATTGGVGGSSGSGGASGGVRLFGVRLTDGSIMKKSA  60

Query  310  SMGNL  324
            SMGNL
Sbjct  61   SMGNL  65



>ref|XP_002450856.1| hypothetical protein SORBIDRAFT_05g019746 [Sorghum bicolor]
 gb|EES09844.1| hypothetical protein SORBIDRAFT_05g019746 [Sorghum bicolor]
Length=96

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 4/59 (7%)
 Frame = +1

Query  169  PVLRWILSMT----RRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTHY  333
            PV R I +      RRCS C ++GHN+RTC  R VKLFGVR+ D  IRKSASMGN+ H 
Sbjct  9    PVRRRIGAAAGDGPRRCSQCGHHGHNARTCTMRPVKLFGVRIGDKPIRKSASMGNIAHL  67



>ref|XP_011072427.1| PREDICTED: protein REVEILLE 4-like [Sesamum indicum]
Length=269

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 6/53 (11%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-----GVKLFGVRLTDGS-IRKSASMGNLTHY  333
            M RRCSHC++NGHN+R+C  R     G++LFGVRLTDGS I+KSASMGN++H+
Sbjct  1    MPRRCSHCNSNGHNTRSCTARTGGGGGLRLFGVRLTDGSFIKKSASMGNISHF  53



>ref|XP_004252360.1| PREDICTED: transcription factor MYB1R1 [Solanum lycopersicum]
Length=375

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 41/59 (69%), Gaps = 16/59 (27%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCP---------------NRGVKLFGVRLTDGSI-RKSASMGN  321
            MTRRCSHC+NNGHNSRTCP                 GV+LFGVRLTDGSI +KSASMGN
Sbjct  1    MTRRCSHCNNNGHNSRTCPTRGGVTGGVGGGSSGGGGVRLFGVRLTDGSIMKKSASMGN  59



>gb|ABR16522.1| unknown [Picea sitchensis]
Length=361

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTH  330
            M+R CS C +NGHNSRTC    V LFGVRLTDG +RKS SM NL++
Sbjct  1    MSRSCSQCGHNGHNSRTCVGNAVMLFGVRLTDGPMRKSVSMNNLSN  46



>ref|XP_002455032.1| hypothetical protein SORBIDRAFT_03g003270 [Sorghum bicolor]
 gb|EES00152.1| hypothetical protein SORBIDRAFT_03g003270 [Sorghum bicolor]
Length=361

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 7/48 (15%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---GVKLFGVRLTD----GSIRKSASM  315
            MTRRCSHCSNNGHNSRTCP R   GV+LFGVRLT      +++KSASM
Sbjct  1    MTRRCSHCSNNGHNSRTCPARSGGGVRLFGVRLTTAPAPAAMKKSASM  48



>ref|NP_001151255.1| LOC100284888 [Zea mays]
 gb|ACF82989.1| unknown [Zea mays]
 gb|ACG42143.1| DNA binding protein [Zea mays]
 gb|AFW75803.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04990.1| MYB-related transcription factor, partial [Zea mays]
Length=370

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  199  RRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTH  330
            RRCS C ++GHN+RTC  R VKLFGVR+ D  IRKSASMGN+ H
Sbjct  23   RRCSQCGHHGHNARTCTARPVKLFGVRIGDKPIRKSASMGNIAH  66



>ref|XP_004972870.1| PREDICTED: transcription factor MYB1R1-like [Setaria italica]
Length=371

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  199  RRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTH  330
            RRCS C ++GHN+RTC  R VKLFGVR+ D  +RKSASMGNL  
Sbjct  23   RRCSQCGHHGHNARTCTARPVKLFGVRIGDKPMRKSASMGNLAQ  66



>ref|XP_010033837.1| PREDICTED: uncharacterized protein LOC104423076 [Eucalyptus grandis]
 gb|KCW53675.1| hypothetical protein EUGRSUZ_J02939 [Eucalyptus grandis]
Length=365

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 10/50 (20%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---------GVKLFGVRLTDGS-IRKSAS  312
            MTRRCSHCS+NGHNSRTCP R         GV+LFGVRLTDGS I+KSAS
Sbjct  1    MTRRCSHCSHNGHNSRTCPARGGGGGGGGGGVRLFGVRLTDGSIIKKSAS  50



>ref|XP_010925548.1| PREDICTED: transcription factor MYB1R1-like [Elaeis guineensis]
Length=349

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 2/36 (6%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--GVKLFGVRLTDGS  294
            MTRRCSHCSNNGHNSRTCP R  GV+LFGVRLT+G+
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRAGGVRLFGVRLTEGA  36



>ref|XP_008794113.1| PREDICTED: transcription factor MYB1R1-like [Phoenix dactylifera]
Length=349

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 2/36 (6%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--GVKLFGVRLTDGS  294
            MTRRCSHCSNNGHNSRTCP R  GV+LFGVRLT+G+
Sbjct  1    MTRRCSHCSNNGHNSRTCPTRAGGVRLFGVRLTEGA  36



>ref|XP_010652808.1| PREDICTED: transcription factor MYB1R1 [Vitis vinifera]
 emb|CAN73090.1| hypothetical protein VITISV_028723 [Vitis vinifera]
 emb|CBI32064.3| unnamed protein product [Vitis vinifera]
Length=300

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 8/55 (15%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG--------VKLFGVRLTDGSIRKSASMGNLTHY  333
            M+R CS C NNGHNSRTC   G        + LFGVR+T+G+ RKSASM NL+ Y
Sbjct  1    MSRSCSQCGNNGHNSRTCTESGGAGAAANDIMLFGVRITEGAFRKSASMTNLSQY  55



>ref|XP_009772765.1| PREDICTED: transcription factor MYB1R1 [Nicotiana sylvestris]
Length=376

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 42/66 (64%), Gaps = 22/66 (33%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTC---------------------PNRGVKLFGVRLTDGSI-RKS  306
            MTRRCSHC+NNGHNSRTC                      + GV+LFGVRLTDGSI +KS
Sbjct  1    MTRRCSHCNNNGHNSRTCPTTRGGTPTGGVGSSSGGGGGGSGGVRLFGVRLTDGSIMKKS  60

Query  307  ASMGNL  324
            ASMGNL
Sbjct  61   ASMGNL  66



>gb|AEV91192.1| MYB-related protein [Triticum carthlicum]
Length=391

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +1

Query  199  RRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTH  330
            RRCS C ++GHNSRTC  R VKLFGVR+ D  IRKS SMGNL  
Sbjct  21   RRCSQCGHHGHNSRTCTARPVKLFGVRIGDKPIRKSVSMGNLAQ  64



>ref|XP_010255646.1| PREDICTED: transcription factor MYB1R1-like [Nelumbo nucifera]
Length=298

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 36/56 (64%), Gaps = 9/56 (16%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG---------VKLFGVRLTDGSIRKSASMGNLTHY  333
            M+R CS C NNGHNSRTC   G           LFGVR+T+GSIRKS SM NL+ Y
Sbjct  1    MSRSCSQCGNNGHNSRTCAEAGSGAASESGGFMLFGVRVTEGSIRKSVSMNNLSQY  56



>gb|EAZ10847.1| hypothetical protein OsJ_00686 [Oryza sativa Japonica Group]
Length=387

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 10/51 (20%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-------GVKLFGVRLT---DGSIRKSASM  315
            MTRRCSHCSNNGHN+RTCP R       GV+LFGVRLT   + +++KSASM
Sbjct  1    MTRRCSHCSNNGHNARTCPARGGGGGGGGVRLFGVRLTSPPEVAMKKSASM  51



>emb|CDM81700.1| unnamed protein product [Triticum aestivum]
Length=362

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 6/47 (13%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---GVKLFGVRLTD---GSIRKSASM  315
            MTRRCSHCSNNGHN+RTCP R   GV+LFGV LT     +++KSASM
Sbjct  1    MTRRCSHCSNNGHNARTCPARGGGGVRLFGVHLTSPPVAAMKKSASM  47



>dbj|BAK02871.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=363

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 6/47 (13%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR---GVKLFGVRLTD---GSIRKSASM  315
            MTRRCSHCSNNGHN+RTCP R   GV+LFGV LT     +++KSASM
Sbjct  1    MTRRCSHCSNNGHNARTCPARSGGGVRLFGVHLTSPPVAAMKKSASM  47



>emb|CAN71598.1| hypothetical protein VITISV_010937 [Vitis vinifera]
Length=315

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVKLFGVRLTDG  291
            MTRRCSHCS+NGHNSRTCPNRGVK+FG   T G
Sbjct  1    MTRRCSHCSHNGHNSRTCPNRGVKIFGAGSTSG  33



>ref|XP_010272144.1| PREDICTED: transcription factor MYB1R1-like [Nelumbo nucifera]
Length=299

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 36/57 (63%), Gaps = 8/57 (14%)
 Frame = +1

Query  187  LSMTRRCSHCSNNGHNSRTCPNR--------GVKLFGVRLTDGSIRKSASMGNLTHY  333
            +S +R CS C NNGHNSRTC           G  LFGVR+ +GSIRK+ SM NL+ Y
Sbjct  1    MSQSRSCSQCGNNGHNSRTCSEAVAASESTGGFMLFGVRVIEGSIRKTVSMNNLSQY  57



>ref|XP_009127770.1| PREDICTED: transcription factor MYB1R1-like [Brassica rapa]
Length=234

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 13/60 (22%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCP----------NRGVKLFGVRLTDG---SIRKSASMGNLTHY  333
            M+R CS C NNGHNSRTCP           +G+ LFGVR+T+    S RKS SM NL+ Y
Sbjct  1    MSRSCSQCGNNGHNSRTCPTETPPAAAGGEKGIMLFGVRVTEASPSSFRKSVSMNNLSQY  60



>emb|CDY52459.1| BnaCnng22510D [Brassica napus]
Length=234

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 13/60 (22%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCP----------NRGVKLFGVRLTDG---SIRKSASMGNLTHY  333
            M+R CS C NNGHNSRTCP           +G+ LFGVR+T+    S RKS SM NL+ Y
Sbjct  1    MSRSCSQCGNNGHNSRTCPTETPPAAAGGEKGIMLFGVRVTEASPSSFRKSVSMNNLSQY  60



>dbj|BAJ89354.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  199  RRCSHCSNNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLTH  330
            RRC  C ++GHN+RTC  R VKLFGVR+ D  IRKS SMGNL  
Sbjct  21   RRCGQCGHHGHNARTCTARPVKLFGVRIGDKPIRKSVSMGNLAQ  64



>gb|AFW79484.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=460

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 36/54 (67%), Gaps = 13/54 (24%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG---------VKLFGVRLTDGS----IRKSASM  315
            MTRRCSHCSNNGHNSRTCP R          V+LFGVRLT       ++KSASM
Sbjct  94   MTRRCSHCSNNGHNSRTCPVRSAGGGSGGGGVRLFGVRLTTAPAPAVMKKSASM  147



>ref|NP_001149973.1| myb-related transcription activator [Zea mays]
 gb|ACF83275.1| unknown [Zea mays]
 gb|ACG37377.1| myb-related transcription activator [Zea mays]
 gb|ADX60117.1| MYB-RELATED transcription factor [Zea mays]
Length=367

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 36/54 (67%), Gaps = 13/54 (24%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG---------VKLFGVRLTDGS----IRKSASM  315
            MTRRCSHCSNNGHNSRTCP R          V+LFGVRLT       ++KSASM
Sbjct  1    MTRRCSHCSNNGHNSRTCPVRSAGGGSGGGGVRLFGVRLTTAPAPAVMKKSASM  54



>ref|NP_001042254.1| Os01g0187900 [Oryza sativa Japonica Group]
 dbj|BAD72254.1| putative MybSt1 [Oryza sativa Japonica Group]
 dbj|BAD72263.1| putative MybSt1 [Oryza sativa Japonica Group]
 dbj|BAF04168.1| Os01g0187900 [Oryza sativa Japonica Group]
 gb|EAY72837.1| hypothetical protein OsI_00708 [Oryza sativa Indica Group]
 dbj|BAG92581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=366

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 10/51 (20%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-------GVKLFGVRLT---DGSIRKSASM  315
            MTRRCSHCSNNGHN+RTCP R       GV+LFGVRLT   + +++KSASM
Sbjct  1    MTRRCSHCSNNGHNARTCPARGGGGGGGGVRLFGVRLTSPPEVAMKKSASM  51



>gb|AFW79483.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=533

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 36/54 (67%), Gaps = 13/54 (24%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG---------VKLFGVRLTDGS----IRKSASM  315
            MTRRCSHCSNNGHNSRTCP R          V+LFGVRLT       ++KSASM
Sbjct  94   MTRRCSHCSNNGHNSRTCPVRSAGGGSGGGGVRLFGVRLTTAPAPAVMKKSASM  147



>ref|XP_007044445.1| Myb-like transcription factor family protein [Theobroma cacao]
 gb|EOY00277.1| Myb-like transcription factor family protein [Theobroma cacao]
Length=300

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 9/56 (16%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG---------VKLFGVRLTDGSIRKSASMGNLTHY  333
            M+R CS C NNGHNSRTC             + LFGVR+T+GS RKS SM NL+ +
Sbjct  1    MSRSCSQCGNNGHNSRTCGEVAGGGGGGENGIMLFGVRVTEGSFRKSVSMNNLSQF  56



>ref|XP_003573373.1| PREDICTED: uncharacterized protein LOC100834934 [Brachypodium 
distachyon]
Length=392

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +1

Query  199  RRCSHCSNNGHNSRTCPNRG-VKLFGVRLTDG-SIRKSASMGNLTH  330
            RRCS C ++GHNSRTC  RG VKLFGVR+ D   IRKSASMGNL  
Sbjct  23   RRCSQCGHHGHNSRTCTARGPVKLFGVRIGDKPPIRKSASMGNLAQ  68



>ref|XP_003564624.1| PREDICTED: uncharacterized protein LOC100828575 [Brachypodium 
distachyon]
Length=368

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 11/52 (21%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--------GVKLFGVRLTD---GSIRKSASM  315
            MTRRCSHCSNNGHN+RTCP R        GV+LFGV LT     S++KSASM
Sbjct  1    MTRRCSHCSNNGHNARTCPARGGGGGGGGGVRLFGVHLTSPPVASMKKSASM  52



>ref|XP_007222642.1| hypothetical protein PRUPE_ppa008539mg [Prunus persica]
 gb|EMJ23841.1| hypothetical protein PRUPE_ppa008539mg [Prunus persica]
Length=327

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 10/57 (18%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTC---------PNRGVKLFGVRLTDG-SIRKSASMGNLTHY  333
            M+R CS C NNGHNSRTC            G+ LFGVR+T+G + RKSASM NL+ Y
Sbjct  1    MSRTCSQCGNNGHNSRTCTEASGAASAAKNGIMLFGVRVTEGNAFRKSASMNNLSQY  57



>gb|ABK26274.1| unknown [Picea sitchensis]
Length=331

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 6/53 (11%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRG-VKLFGVRLT---DGS--IRKSASMGNLTHY  333
            + + CSHC ++GH+SR CP+RG VKLFGVRL    DG   +RKS SMGNL HY
Sbjct  5    LLKMCSHCGHSGHSSRACPDRGSVKLFGVRLIATNDGMACMRKSLSMGNLGHY  57



>ref|XP_010258761.1| PREDICTED: transcription factor MYB1R1-like isoform X1 [Nelumbo 
nucifera]
Length=329

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +1

Query  175  LRWILSMTRRCSHCSNNGHNSRTCPNR-GVKLFGVRLT-DGSIRKSASMGNL  324
            +R      R+CSHC NNGHNSRTC  + G+KLFGVR++ D  ++KS SMGNL
Sbjct  12   VRMAKETVRKCSHCGNNGHNSRTCNEKFGLKLFGVRISKDKHMKKSLSMGNL  63



>ref|XP_010258762.1| PREDICTED: transcription factor MYB1R1-like isoform X2 [Nelumbo 
nucifera]
Length=323

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +1

Query  175  LRWILSMTRRCSHCSNNGHNSRTCPNR-GVKLFGVRLT-DGSIRKSASMGNL  324
            +R      R+CSHC NNGHNSRTC  + G+KLFGVR++ D  ++KS SMGNL
Sbjct  12   VRMAKETVRKCSHCGNNGHNSRTCNEKFGLKLFGVRISKDKHMKKSLSMGNL  63



>ref|XP_011043023.1| PREDICTED: transcription factor MYB1R1-like [Populus euphratica]
Length=309

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 37/60 (62%), Gaps = 13/60 (22%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-----------GVKLFGVRLTDG--SIRKSASMGNLTHY  333
            M+R CS C NNGHNSRTC              G+ LFGVR+T+G  S RKSASM NL+ Y
Sbjct  2    MSRSCSQCGNNGHNSRTCGESPCCGDQNVTPTGIMLFGVRVTEGAASFRKSASMINLSQY  61



>ref|XP_002315700.2| DNA-binding family protein [Populus trichocarpa]
 gb|EEF01871.2| DNA-binding family protein [Populus trichocarpa]
Length=307

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 36/60 (60%), Gaps = 13/60 (22%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR-----------GVKLFGVRLTDG--SIRKSASMGNLTHY  333
            M+R CS C NNGHNSRTC              G+ LFGVRL +G  S RKSASM NL+ Y
Sbjct  2    MSRSCSQCGNNGHNSRTCGESPCCGDQNVTPTGIMLFGVRLAEGAASFRKSASMINLSQY  61



>gb|AHB59602.1| putative MYB-related protein 16 [Arachis hypogaea]
Length=306

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 38/69 (55%), Gaps = 22/69 (32%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTC---------------PNR--GVKLFGVRL-----TDGSIRKS  306
            M+R CS C NNGHNSRTC               P R  G+ LFGVRL     T  S RKS
Sbjct  1    MSRTCSQCGNNGHNSRTCTDASLAAGSVSGGGTPQRENGIMLFGVRLTTTEGTSSSFRKS  60

Query  307  ASMGNLTHY  333
            ASMGNL+ +
Sbjct  61   ASMGNLSQF  69



>ref|XP_007157550.1| hypothetical protein PHAVU_002G078600g [Phaseolus vulgaris]
 gb|ESW29544.1| hypothetical protein PHAVU_002G078600g [Phaseolus vulgaris]
Length=300

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 37/62 (60%), Gaps = 15/62 (24%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNRGVK-------------LFGVRLTDG--SIRKSASMGNLT  327
            M+R CS C NNGHNSRTC + G               LFGVR+T+G  S RKSASM NL+
Sbjct  1    MSRTCSQCGNNGHNSRTCTDGGAAVSGAASPRENGFMLFGVRVTEGISSFRKSASMNNLS  60

Query  328  HY  333
             Y
Sbjct  61   QY  62



>ref|XP_008221488.1| PREDICTED: transcription factor MYB1R1 [Prunus mume]
Length=335

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 13/60 (22%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR------------GVKLFGVRLTDG-SIRKSASMGNLTHY  333
            M+R CS C NNGHNSRTC               G+ LFGVR+T+G + RKSASM N++ Y
Sbjct  1    MSRTCSQCGNNGHNSRTCTEASGGSGGAASAENGIMLFGVRVTEGNAFRKSASMNNISQY  60



>gb|KJB46488.1| hypothetical protein B456_007G371900 [Gossypium raimondii]
Length=306

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 18/66 (27%)
 Frame = +1

Query  190  SMTRRCSHCSNNGHNSRTC------------------PNRGVKLFGVRLTDGSIRKSASM  315
            SM+R CSHC NNGHNSRTC                    +G+ LFGVR+ +GS RKS SM
Sbjct  4    SMSRSCSHCGNNGHNSRTCGEVVAGDASNGSGGSGGGEEKGIMLFGVRVMEGSFRKSVSM  63

Query  316  GNLTHY  333
             NL+ +
Sbjct  64   NNLSQF  69



>gb|KHG08349.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=306

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 18/66 (27%)
 Frame = +1

Query  190  SMTRRCSHCSNNGHNSRTC------------------PNRGVKLFGVRLTDGSIRKSASM  315
            SM+R CSHC NNGHNSRTC                    +G+ LFGVR+ +GS RKS SM
Sbjct  4    SMSRSCSHCGNNGHNSRTCGEVVAGDASNGSGGSGEGGEKGIMLFGVRVMEGSFRKSVSM  63

Query  316  GNLTHY  333
             NL+ +
Sbjct  64   NNLSQF  69



>ref|NP_001281063.1| transcription factor MYB1R1-like [Malus domestica]
 gb|ADL36782.1| MYBR domain class transcription factor [Malus domestica]
Length=323

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 13/60 (22%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPN------------RGVKLFGVRLTDG-SIRKSASMGNLTHY  333
            M+R CS C NNGHNSRTC +             G+ LFGVR+T+G + RKS SM NL+ Y
Sbjct  1    MSRTCSQCGNNGHNSRTCSDVSGGGCGGPIAENGIMLFGVRVTEGNAFRKSVSMNNLSQY  60



>ref|XP_004135214.1| PREDICTED: uncharacterized protein LOC101207806 [Cucumis sativus]
 ref|XP_004155335.1| PREDICTED: uncharacterized LOC101207806 [Cucumis sativus]
 gb|KGN51855.1| hypothetical protein Csa_5G604000 [Cucumis sativus]
Length=312

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 9/58 (16%)
 Frame = +1

Query  187  LSMTRRCSHCSNNGHNSRTCPNR----GVKLFGVRLT---DG--SIRKSASMGNLTHY  333
            ++++R CS C NNGHNSRTCP      G  LFGVRLT   DG  S RKS SM NL+ Y
Sbjct  1    MNVSRTCSLCGNNGHNSRTCPEADGTTGFMLFGVRLTTTSDGSNSFRKSFSMNNLSQY  58



>gb|ACJ85142.1| unknown [Medicago truncatula]
Length=182

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 19/68 (28%)
 Frame = +1

Query  187  LSMTRRCSHCSNNGHNSRTCPNRG----VKLFGVRLTDG---------------SIRKSA  309
            +S++R CS C NNGHNSRTC + G    + +FGVRLT G               S RKSA
Sbjct  1    MSLSRTCSQCGNNGHNSRTCNDGGEEKSIMIFGVRLTGGNNHLNTTTTNTTINNSFRKSA  60

Query  310  SMGNLTHY  333
            SM NL+ Y
Sbjct  61   SMTNLSQY  68



>ref|XP_008339970.1| PREDICTED: transcription factor MYB1R1 [Malus domestica]
Length=328

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 37/62 (60%), Gaps = 15/62 (24%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPNR--------------GVKLFGVRLTDG-SIRKSASMGNLT  327
            M+R CS C NNGHNSRTC +               G+ LFGVR+T+  + RKSASM NL+
Sbjct  1    MSRTCSQCGNNGHNSRTCTDASGGVGGGATASAENGIMLFGVRVTEANAFRKSASMNNLS  60

Query  328  HY  333
             Y
Sbjct  61   QY  62



>ref|XP_008446280.1| PREDICTED: transcription factor MYB1R1 [Cucumis melo]
Length=304

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 36/57 (63%), Gaps = 8/57 (14%)
 Frame = +1

Query  187  LSMTRRCSHCSNNGHNSRTCPNR----GVKLFGVRLT----DGSIRKSASMGNLTHY  333
            ++++R CS C NNGHNSRTCP      G  LFGVRLT      S RKS SM NL+ Y
Sbjct  1    MNVSRTCSLCGNNGHNSRTCPEADGTGGFMLFGVRLTTSEGSNSFRKSVSMNNLSQY  57



>ref|XP_006302702.1| hypothetical protein CARUB_v10020813mg [Capsella rubella]
 gb|EOA35600.1| hypothetical protein CARUB_v10020813mg [Capsella rubella]
Length=262

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 17/63 (27%)
 Frame = +1

Query  193  MTRRCSHCSNNGHNSRTCPN--------------RGVKLFGVRLTDG---SIRKSASMGN  321
            M+R CS C NNGHNSRTCP+              +G+ LFGVR+T+    S+RK+ SM N
Sbjct  1    MSRSCSQCGNNGHNSRTCPSEITTTGDNNGGAGAKGIMLFGVRVTEASPPSVRKTVSMNN  60

Query  322  LTH  330
            L  
Sbjct  61   LVQ  63



>ref|XP_003613473.1| DIV1B protein [Medicago truncatula]
 gb|AES96431.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=314

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 19/68 (28%)
 Frame = +1

Query  187  LSMTRRCSHCSNNGHNSRTCPNRG----VKLFGVRLTDG---------------SIRKSA  309
            +S++R CS C NNGHNSRTC + G    + +FGVRLT G               S RKSA
Sbjct  1    MSLSRTCSQCGNNGHNSRTCNDGGEEKSIMIFGVRLTGGNNHLNTTTTNTTINNSFRKSA  60

Query  310  SMGNLTHY  333
            SM NL+ Y
Sbjct  61   SMTNLSQY  68



>gb|AFV79077.1| myb-related protein [Pinus sylvestris]
 gb|AFV79080.1| myb-related protein [Pinus sylvestris]
 gb|AFV79082.1| myb-related protein [Pinus sylvestris]
Length=331

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 6/56 (11%)
 Frame = +1

Query  184  ILSMTRRCSHCSNNGHNSRTCPNRG-VKLFGVRL---TDGS--IRKSASMGNLTHY  333
            I  +   CS+C ++GH+SR CP+RG VKLFGVRL    DG   +RKS SMGNL HY
Sbjct  2    IKELLMMCSNCGHSGHSSRACPDRGSVKLFGVRLIATDDGMACMRKSLSMGNLGHY  57



>ref|XP_010662238.1| PREDICTED: transcription factor MYB1R1-like isoform X2 [Vitis 
vinifera]
Length=301

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 7/57 (12%)
 Frame = +1

Query  175  LRWILSMTRRCSHCSNNGHNSRTCPNRG---VKLFGVRL----TDGSIRKSASMGNL  324
            +  +    R+CSHC NNGHNSRTC   G   +KLFGV++     D ++RKS SMGNL
Sbjct  1    MEMVKESVRKCSHCGNNGHNSRTCSAGGKGCLKLFGVQILTEKEDEAMRKSLSMGNL  57



>gb|AFV79045.1| myb-related protein [Pinus sylvestris]
 gb|AFV79047.1| myb-related protein [Pinus sylvestris]
Length=331

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 6/56 (11%)
 Frame = +1

Query  184  ILSMTRRCSHCSNNGHNSRTCPNRG-VKLFGVRL---TDGS--IRKSASMGNLTHY  333
            I  +   CS+C ++GH+SR CP+RG VKLFGVRL    DG   +RKS SMGNL HY
Sbjct  2    IKELLMMCSNCGHSGHSSRACPDRGSVKLFGVRLIATDDGMACMRKSLSMGNLGHY  57



>gb|AFV78976.1| myb-related protein [Pinus sylvestris]
 gb|AFV78983.1| myb-related protein [Pinus sylvestris]
 gb|AFV79003.1| myb-related protein [Pinus sylvestris]
 gb|AFV79007.1| myb-related protein [Pinus sylvestris]
 gb|AFV79008.1| myb-related protein [Pinus sylvestris]
 gb|AFV79010.1| myb-related protein [Pinus sylvestris]
 gb|AFV79011.1| myb-related protein [Pinus sylvestris]
 gb|AFV79015.1| myb-related protein [Pinus sylvestris]
 gb|AFV79016.1| myb-related protein [Pinus sylvestris]
 gb|AFV79039.1| myb-related protein [Pinus sylvestris]
 gb|AFV79070.1| myb-related protein [Pinus sylvestris]
 gb|AFV79085.1| myb-related protein [Pinus sylvestris]
Length=331

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 6/56 (11%)
 Frame = +1

Query  184  ILSMTRRCSHCSNNGHNSRTCPNRG-VKLFGVRL---TDGS--IRKSASMGNLTHY  333
            I  +   CS+C ++GH+SR CP+RG VKLFGVRL    DG   +RKS SMGNL HY
Sbjct  2    IKELLMMCSNCGHSGHSSRACPDRGSVKLFGVRLIATDDGMACMRKSLSMGNLGHY  57



>emb|CAN76720.1| hypothetical protein VITISV_005733 [Vitis vinifera]
Length=202

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 7/50 (14%)
 Frame = +1

Query  196  TRRCSHCSNNGHNSRTCPNRG---VKLFGVRL----TDGSIRKSASMGNL  324
             R+CSHC NNGHNSRTC   G   +KLFGV++     D ++RKS SMGNL
Sbjct  6    VRKCSHCGNNGHNSRTCSAGGKGCLKLFGVQILTEKEDEAMRKSLSMGNL  55



>ref|XP_002278155.2| PREDICTED: transcription factor MYB1R1-like isoform X1 [Vitis 
vinifera]
Length=318

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 7/57 (12%)
 Frame = +1

Query  175  LRWILSMTRRCSHCSNNGHNSRTCPNRG---VKLFGVRL----TDGSIRKSASMGNL  324
            +  +    R+CSHC NNGHNSRTC   G   +KLFGV++     D ++RKS SMGNL
Sbjct  1    MEMVKESVRKCSHCGNNGHNSRTCSAGGKGCLKLFGVQILTEKEDEAMRKSLSMGNL  57



>gb|AFV79075.1| myb-related protein [Pinus sylvestris]
Length=331

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 6/56 (11%)
 Frame = +1

Query  184  ILSMTRRCSHCSNNGHNSRTCPNRG-VKLFGVRL---TDGS--IRKSASMGNLTHY  333
            I  +   CS+C ++GH+SR CP+RG VKLFGVRL    DG   +RKS SMGNL HY
Sbjct  2    IKELLMMCSNCGHSGHSSRACPDRGSVKLFGVRLIATDDGMACMRKSLSMGNLGHY  57



>gb|AFV78994.1| myb-related protein [Pinus sylvestris]
Length=331

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 6/56 (11%)
 Frame = +1

Query  184  ILSMTRRCSHCSNNGHNSRTCPNRG-VKLFGVRL---TDGS--IRKSASMGNLTHY  333
            I  +   CS+C ++GH+SR CP+RG VKLFGVRL    DG   +RKS SMGNL HY
Sbjct  2    IKELLMMCSNCGHSGHSSRACPDRGSVKLFGVRLIATDDGMACMRKSLSMGNLGHY  57



>emb|CBI38571.3| unnamed protein product [Vitis vinifera]
Length=185

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 7/50 (14%)
 Frame = +1

Query  196  TRRCSHCSNNGHNSRTCPNRG---VKLFGVRL----TDGSIRKSASMGNL  324
             R+CSHC NNGHNSRTC   G   +KLFGV++     D ++RKS SMGNL
Sbjct  6    VRKCSHCGNNGHNSRTCSAGGKGCLKLFGVQILTEKEDEAMRKSLSMGNL  55



>gb|AFV79026.1| myb-related protein [Pinus sylvestris]
Length=331

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 6/49 (12%)
 Frame = +1

Query  205  CSHCSNNGHNSRTCPNRG-VKLFGVRLT---DGS--IRKSASMGNLTHY  333
            CS+C ++GH+SR CP+RG VKLFGVRL    DG   +RKS SMGNL HY
Sbjct  9    CSNCGHSGHSSRACPDRGSVKLFGVRLIATDDGKACMRKSLSMGNLGHY  57



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562698116640