BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H24

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587088.1|  PREDICTED: uncharacterized protein LOC104084...    150   7e-42   Nicotiana tomentosiformis
ref|XP_009796725.1|  PREDICTED: uncharacterized protein LOC104243262    148   4e-41   Nicotiana sylvestris
ref|XP_009587086.1|  PREDICTED: uncharacterized protein LOC104084...    147   2e-40   Nicotiana tomentosiformis
ref|XP_006353405.1|  PREDICTED: uncharacterized protein LOC102603...    138   3e-37   Solanum tuberosum [potatoes]
ref|XP_004240896.1|  PREDICTED: uncharacterized protein LOC101265648    134   6e-36   Solanum lycopersicum
ref|XP_003633434.1|  PREDICTED: uncharacterized protein LOC100253518    126   6e-33   Vitis vinifera
ref|XP_011076630.1|  PREDICTED: uncharacterized protein LOC105160829    125   2e-32   Sesamum indicum [beniseed]
emb|CDP13949.1|  unnamed protein product                                118   2e-29   Coffea canephora [robusta coffee]
ref|XP_010031141.1|  PREDICTED: uncharacterized protein LOC104421024    117   3e-29   Eucalyptus grandis [rose gum]
ref|XP_009761007.1|  PREDICTED: uncharacterized protein LOC104213009    115   1e-28   Nicotiana sylvestris
gb|EYU20083.1|  hypothetical protein MIMGU_mgv1a015205mg                114   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_010256999.1|  PREDICTED: uncharacterized protein LOC104597244    114   4e-28   Nelumbo nucifera [Indian lotus]
ref|XP_008233834.1|  PREDICTED: uncharacterized protein LOC103332...    113   5e-28   Prunus mume [ume]
ref|XP_007218537.1|  hypothetical protein PRUPE_ppa012708mg             113   6e-28   Prunus persica
ref|XP_008233835.1|  PREDICTED: uncharacterized protein LOC103332...    111   4e-27   
gb|KHG28253.1|  Putative sel1-like repeat-containing protein L18        110   4e-27   Gossypium arboreum [tree cotton]
gb|KJB77082.1|  hypothetical protein B456_012G119700                    107   6e-26   Gossypium raimondii
gb|KJB77084.1|  hypothetical protein B456_012G119700                    107   9e-26   Gossypium raimondii
ref|XP_002520815.1|  conserved hypothetical protein                     106   3e-25   Ricinus communis
ref|XP_004137693.1|  PREDICTED: uncharacterized protein LOC101206121    102   1e-24   
gb|KGN65322.1|  hypothetical protein Csa_1G324870                       102   1e-24   Cucumis sativus [cucumbers]
ref|XP_004156634.1|  PREDICTED: uncharacterized LOC101206121            102   2e-24   
ref|XP_004146456.1|  PREDICTED: uncharacterized protein LOC101213...    104   2e-24   Cucumis sativus [cucumbers]
ref|XP_008442362.1|  PREDICTED: uncharacterized protein LOC103486254    102   3e-24   Cucumis melo [Oriental melon]
ref|XP_008355547.1|  PREDICTED: uncharacterized protein LOC103419212    103   3e-24   Malus domestica [apple tree]
ref|XP_010264502.1|  PREDICTED: uncharacterized protein LOC104602492    102   3e-24   
ref|XP_004146455.1|  PREDICTED: uncharacterized protein LOC101213...    103   4e-24   Cucumis sativus [cucumbers]
ref|XP_009369229.1|  PREDICTED: uncharacterized protein LOC103958662    103   4e-24   Pyrus x bretschneideri [bai li]
ref|XP_010921063.1|  PREDICTED: uncharacterized protein LOC105044761    103   5e-24   Elaeis guineensis
ref|XP_009350684.1|  PREDICTED: uncharacterized protein LOC103942213    102   6e-24   Pyrus x bretschneideri [bai li]
ref|XP_008456900.1|  PREDICTED: uncharacterized protein LOC103496...    102   6e-24   Cucumis melo [Oriental melon]
ref|XP_006486231.1|  PREDICTED: uncharacterized protein LOC102630...    102   8e-24   
ref|XP_006429512.1|  hypothetical protein CICLE_v10013155mg             101   9e-24   Citrus clementina [clementine]
ref|XP_002265642.1|  PREDICTED: uncharacterized protein LOC100243...    100   9e-24   Vitis vinifera
ref|XP_008456899.1|  PREDICTED: uncharacterized protein LOC103496...    102   1e-23   
ref|XP_006828167.1|  hypothetical protein AMTR_s00023p00110940          100   1e-23   
ref|XP_006481131.1|  PREDICTED: uncharacterized protein LOC102610...    100   1e-23   Citrus sinensis [apfelsine]
ref|XP_002265673.1|  PREDICTED: uncharacterized protein LOC100243...    100   2e-23   Vitis vinifera
ref|XP_010039279.1|  PREDICTED: uncharacterized protein LOC104427...    100   2e-23   Eucalyptus grandis [rose gum]
ref|XP_002315124.1|  hypothetical protein POPTR_0010s18960g             100   3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_004307701.1|  PREDICTED: uncharacterized protein LOC101294508    100   4e-23   Fragaria vesca subsp. vesca
ref|XP_007134617.1|  hypothetical protein PHAVU_010G062000g           99.0    4e-23   Phaseolus vulgaris [French bean]
ref|XP_010039170.1|  PREDICTED: uncharacterized protein LOC104427...  99.8    7e-23   Eucalyptus grandis [rose gum]
ref|XP_010695454.1|  PREDICTED: uncharacterized protein LOC104908080    100   9e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011015169.1|  PREDICTED: uncharacterized protein LOC105118821  99.8    1e-22   Populus euphratica
ref|XP_008355552.1|  PREDICTED: uncharacterized protein LOC103419214  99.8    1e-22   Malus domestica [apple tree]
gb|KCW88248.1|  hypothetical protein EUGRSUZ_A00636                     100   1e-22   Eucalyptus grandis [rose gum]
ref|XP_010091064.1|  hypothetical protein L484_021946                   102   1e-22   
gb|EPS60291.1|  hypothetical protein M569_14514                       99.0    2e-22   Genlisea aurea
ref|XP_006289188.1|  hypothetical protein CARUB_v10002629mg           98.6    3e-22   Capsella rubella
ref|XP_011095090.1|  PREDICTED: uncharacterized protein LOC105174627  97.8    3e-22   Sesamum indicum [beniseed]
ref|XP_008782586.1|  PREDICTED: uncharacterized protein LOC103702077  97.8    5e-22   Phoenix dactylifera
ref|XP_007026543.1|  Uncharacterized protein TCM_021578               97.8    6e-22   
ref|XP_007207508.1|  hypothetical protein PRUPE_ppa013808mg           95.9    8e-22   Prunus persica
ref|XP_006282317.1|  hypothetical protein CARUB_v10028606mg           95.9    1e-21   
gb|KDP22810.1|  hypothetical protein JCGZ_00397                       96.7    1e-21   Jatropha curcas
ref|NP_001238121.1|  uncharacterized protein LOC100527831             95.1    1e-21   Glycine max [soybeans]
ref|XP_006289773.1|  hypothetical protein CARUB_v10003374mg           95.9    2e-21   
ref|XP_003552182.1|  PREDICTED: uncharacterized protein LOC100779520  95.9    3e-21   Glycine max [soybeans]
ref|XP_008388305.1|  PREDICTED: uncharacterized protein LOC103450710  94.4    3e-21   
ref|XP_009122145.1|  PREDICTED: uncharacterized protein LOC103846889  95.5    4e-21   Brassica rapa
gb|ACU23149.1|  unknown                                               95.5    4e-21   Glycine max [soybeans]
gb|KDP21698.1|  hypothetical protein JCGZ_03369                       95.5    4e-21   Jatropha curcas
emb|CDX70156.1|  BnaA10g25050D                                        95.5    4e-21   
ref|XP_003522147.1|  PREDICTED: uncharacterized protein LOC100794...  93.6    5e-21   Glycine max [soybeans]
gb|KHN31321.1|  hypothetical protein glysoja_022975                   95.1    7e-21   Glycine soja [wild soybean]
gb|KDO44850.1|  hypothetical protein CISIN_1g032635mg                 94.0    8e-21   Citrus sinensis [apfelsine]
ref|XP_010543693.1|  PREDICTED: uncharacterized protein LOC104816524  94.7    9e-21   Tarenaya hassleriana [spider flower]
gb|AFK39264.1|  unknown                                               92.8    9e-21   Lotus japonicus
ref|XP_006374033.1|  hypothetical protein POPTR_0016s13640g           94.0    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_007163593.1|  hypothetical protein PHAVU_001G247500g           94.4    1e-20   Phaseolus vulgaris [French bean]
ref|NP_974733.1|  uncharacterized protein                             94.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011032587.1|  PREDICTED: uncharacterized protein LOC105131358  94.0    1e-20   Populus euphratica
gb|AAO42324.1|  unknown protein                                       94.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003623468.1|  hypothetical protein MTR_7g071210                92.8    1e-20   Medicago truncatula
ref|XP_011077502.1|  PREDICTED: uncharacterized protein LOC105161501  92.8    1e-20   Sesamum indicum [beniseed]
gb|KFK24957.1|  hypothetical protein AALP_AA8G047700                  94.4    1e-20   Arabis alpina [alpine rockcress]
ref|NP_196155.2|  uncharacterized protein                             94.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ABK26779.1|  unknown                                               93.6    1e-20   Picea sitchensis
ref|NP_001238136.1|  uncharacterized protein LOC100527576             92.4    1e-20   Glycine max [soybeans]
ref|XP_010491070.1|  PREDICTED: uncharacterized protein LOC104768733  94.0    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010452441.1|  PREDICTED: uncharacterized protein LOC104734539  94.4    2e-20   Camelina sativa [gold-of-pleasure]
emb|CDX98838.1|  BnaC09g49970D                                        94.0    2e-20   
ref|XP_006398999.1|  hypothetical protein EUTSA_v10014886mg           94.0    2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_010423476.1|  PREDICTED: uncharacterized protein LOC104708579  94.0    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009416310.1|  PREDICTED: uncharacterized protein LOC103996957  93.6    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU41977.1|  hypothetical protein MIMGU_mgv1a016033mg              92.4    4e-20   Erythranthe guttata [common monkey flower]
gb|KHN04800.1|  hypothetical protein glysoja_031900                   92.4    4e-20   Glycine soja [wild soybean]
ref|XP_010497949.1|  PREDICTED: uncharacterized protein LOC104775718  90.1    4e-20   
ref|XP_002871153.1|  hypothetical protein ARALYDRAFT_325170           93.2    5e-20   
dbj|BAB09979.1|  unnamed protein product                              93.2    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002312191.1|  hypothetical protein POPTR_0008s07490g           90.5    8e-20   Populus trichocarpa [western balsam poplar]
ref|XP_008370217.1|  PREDICTED: uncharacterized protein LOC103433...  90.5    8e-20   Malus domestica [apple tree]
ref|XP_006435843.1|  hypothetical protein CICLE_v10033159mg           90.5    8e-20   
ref|XP_008370215.1|  PREDICTED: uncharacterized protein LOC103433...  91.7    9e-20   Malus domestica [apple tree]
ref|XP_007008833.1|  Uncharacterized protein TCM_042415               91.7    1e-19   
ref|XP_010529121.1|  PREDICTED: uncharacterized protein LOC104806101  91.3    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_004984894.1|  PREDICTED: myc-associated zinc finger protei...  91.3    2e-19   Setaria italica
ref|XP_004492521.1|  PREDICTED: uncharacterized protein LOC101512...  89.4    2e-19   Cicer arietinum [garbanzo]
ref|XP_009421405.1|  PREDICTED: uncharacterized protein LOC104000960  89.0    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001144203.1|  uncharacterized protein LOC100277064             90.9    3e-19   Zea mays [maize]
ref|XP_007140174.1|  hypothetical protein PHAVU_008G090100g           88.6    4e-19   Phaseolus vulgaris [French bean]
ref|XP_011005568.1|  PREDICTED: uncharacterized protein LOC105111778  88.6    4e-19   Populus euphratica
ref|XP_009373106.1|  PREDICTED: uncharacterized protein LOC103962...  88.2    6e-19   Pyrus x bretschneideri [bai li]
gb|KHN29550.1|  hypothetical protein glysoja_005274                   90.1    7e-19   Glycine soja [wild soybean]
ref|XP_002465405.1|  hypothetical protein SORBIDRAFT_01g038090        90.9    7e-19   
ref|XP_009373105.1|  PREDICTED: uncharacterized protein LOC103962...  89.4    8e-19   Pyrus x bretschneideri [bai li]
ref|XP_002879746.1|  hypothetical protein ARALYDRAFT_345628           89.0    8e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_009373104.1|  PREDICTED: uncharacterized protein LOC103962...  89.4    8e-19   
gb|AAC28759.2|  expressed protein                                     87.8    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500530.1|  PREDICTED: uncharacterized protein LOC101512...  89.0    1e-18   
ref|XP_008809978.1|  PREDICTED: uncharacterized protein LOC103721508  89.0    1e-18   
ref|XP_010509118.1|  PREDICTED: uncharacterized protein LOC104785576  88.6    1e-18   Camelina sativa [gold-of-pleasure]
ref|NP_565889.2|  uncharacterized protein                             88.2    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EMT09012.1|  hypothetical protein F775_27191                       88.6    1e-18   
ref|XP_006295208.1|  hypothetical protein CARUB_v10024290mg           87.4    2e-18   Capsella rubella
ref|XP_009421407.1|  PREDICTED: uncharacterized protein LOC104000963  87.4    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS50296.1|  hypothetical protein TRIUR3_29514                     90.1    3e-18   Triticum urartu
ref|NP_001049844.1|  Os03g0298600                                     87.8    4e-18   
ref|XP_010505467.1|  PREDICTED: uncharacterized protein LOC104782284  87.0    4e-18   Camelina sativa [gold-of-pleasure]
dbj|BAJ91570.1|  predicted protein                                    87.4    4e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010517139.1|  PREDICTED: uncharacterized protein LOC104792...  87.0    5e-18   Camelina sativa [gold-of-pleasure]
gb|AAM62527.1|  unknown                                               85.9    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683583.1|  PREDICTED: uncharacterized protein LOC104898233  85.5    6e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE58888.1|  hypothetical protein OsJ_10507                        87.4    6e-18   Oryza sativa Japonica Group [Japonica rice]
gb|KFK36738.1|  hypothetical protein AALP_AA4G163100                  85.5    6e-18   Arabis alpina [alpine rockcress]
dbj|BAK02754.1|  predicted protein                                    86.3    9e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006411058.1|  hypothetical protein EUTSA_v10017381mg           85.9    1e-17   Eutrema salsugineum [saltwater cress]
ref|XP_009402772.1|  PREDICTED: uncharacterized protein LOC103986477  85.9    1e-17   
ref|XP_003558119.1|  PREDICTED: uncharacterized protein LOC100845835  85.9    1e-17   Brachypodium distachyon [annual false brome]
emb|CDY07730.1|  BnaA03g17810D                                        85.5    2e-17   Brassica napus [oilseed rape]
ref|XP_010517140.1|  PREDICTED: uncharacterized protein LOC104792...  84.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009133257.1|  PREDICTED: uncharacterized protein LOC103857...  85.1    2e-17   Brassica rapa
ref|XP_009406892.1|  PREDICTED: uncharacterized protein LOC103989686  85.5    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB67482.1|  hypothetical protein B456_010G193200                  85.5    2e-17   Gossypium raimondii
gb|KJB67484.1|  hypothetical protein B456_010G193200                  85.1    5e-17   Gossypium raimondii
ref|XP_003601009.1|  hypothetical protein MTR_3g072010                83.2    2e-16   Medicago truncatula
ref|XP_009133258.1|  PREDICTED: uncharacterized protein LOC103857...  81.6    4e-16   Brassica rapa
ref|NP_001055251.1|  Os05g0342900                                     79.3    1e-15   
ref|XP_006654273.1|  PREDICTED: uncharacterized protein LOC102714375  78.6    2e-15   Oryza brachyantha
ref|XP_004962417.1|  PREDICTED: uncharacterized protein LOC101777...  78.2    4e-15   Setaria italica
ref|NP_001142513.1|  hypothetical protein                             77.4    7e-15   Zea mays [maize]
ref|XP_008647657.1|  PREDICTED: uncharacterized protein LOC100276...  77.4    7e-15   
ref|XP_008654668.1|  PREDICTED: uncharacterized protein LOC100274...  77.4    7e-15   Zea mays [maize]
ref|XP_002439596.1|  hypothetical protein SORBIDRAFT_09g015880        76.6    1e-14   Sorghum bicolor [broomcorn]
ref|NP_001143861.1|  uncharacterized protein LOC100276657             77.4    1e-14   
gb|ACG31011.1|  hypothetical protein                                  75.5    3e-14   Zea mays [maize]
ref|XP_010529921.1|  PREDICTED: uncharacterized protein LOC104806634  71.6    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_001778215.1|  predicted protein                                69.7    1e-11   
ref|XP_005650064.1|  hypothetical protein COCSUDRAFT_32673            65.5    1e-10   Coccomyxa subellipsoidea C-169
ref|XP_001692982.1|  predicted protein                                65.9    2e-10   Chlamydomonas reinhardtii
ref|XP_002950802.1|  hypothetical protein VOLCADRAFT_120924           64.3    5e-10   Volvox carteri f. nagariensis
gb|KIY93418.1|  hypothetical protein MNEG_14545                       55.1    5e-07   Monoraphidium neglectum
ref|XP_009590059.1|  PREDICTED: uncharacterized protein LOC104087340  53.5    1e-06   
gb|EEE63318.1|  hypothetical protein OsJ_18129                        52.0    6e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KIY94194.1|  hypothetical protein MNEG_13768                       50.8    1e-05   Monoraphidium neglectum
ref|XP_002505403.1|  predicted protein                                52.4    1e-05   Micromonas commoda
ref|XP_005850343.1|  hypothetical protein CHLNCDRAFT_142152           53.9    2e-05   Chlorella variabilis
ref|XP_003059675.1|  predicted protein                                51.6    2e-05   Micromonas pusilla CCMP1545
emb|CBI25405.3|  unnamed protein product                              49.7    2e-05   Vitis vinifera
ref|XP_002962942.1|  hypothetical protein SELMODRAFT_404377           51.6    1e-04   
emb|CBI18085.3|  unnamed protein product                              46.2    5e-04   Vitis vinifera
ref|XP_011401235.1|  hypothetical protein F751_6989                   46.2    7e-04   Auxenochlorella protothecoides



>ref|XP_009587088.1| PREDICTED: uncharacterized protein LOC104084834 isoform X2 [Nicotiana 
tomentosiformis]
Length=175

 Score =   150 bits (378),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 121/158 (77%), Gaps = 6/158 (4%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  267
            MGKSVPSP ++QDFARII S+  R   PTQVKPP SR RS+  A   K + +VGG  S  
Sbjct  1    MGKSVPSPNRIQDFARIISSSNNRIHGPTQVKPPASRIRSLPSA---KSRAVVGGDSSER  57

Query  268  serrlrrN--KMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQV  441
              +   +N  +    S++  SS  Q+ +R+PLA+VV DCV+RWFQDTLKEAKAGDISMQV
Sbjct  58   RLKLKTKNMEEASSNSNSNTSSSNQQRQRVPLADVVADCVKRWFQDTLKEAKAGDISMQV  117

Query  442  LVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            LVGQMY+SGYG+SRDAQKG+AWI+RAS++RSSAW+VSD
Sbjct  118  LVGQMYYSGYGISRDAQKGRAWINRASKSRSSAWKVSD  155



>ref|XP_009796725.1| PREDICTED: uncharacterized protein LOC104243262 [Nicotiana sylvestris]
 ref|XP_009796726.1| PREDICTED: uncharacterized protein LOC104243262 [Nicotiana sylvestris]
Length=175

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 120/158 (76%), Gaps = 6/158 (4%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  267
            MGKSV SP ++QDFARII S+  R   PTQVKPP SR RSV  A   K + +VGG  S  
Sbjct  1    MGKSVLSPNRIQDFARIISSSNNRIHGPTQVKPPASRIRSVPSA---KSRAVVGGDSSER  57

Query  268  serrlrrN--KMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQV  441
              +   +N  +    S++  SS  Q+ +R+PLA+VV DCV+RWFQDTLKEAKAGDISMQV
Sbjct  58   RLKLRTKNMEEASSNSNSNTSSSNQQRQRVPLADVVADCVKRWFQDTLKEAKAGDISMQV  117

Query  442  LVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            LVGQMY+SGYG+SRDAQKG+AWI+RAS++RSSAW+VSD
Sbjct  118  LVGQMYYSGYGISRDAQKGRAWINRASKSRSSAWKVSD  155



>ref|XP_009587086.1| PREDICTED: uncharacterized protein LOC104084834 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009587087.1| PREDICTED: uncharacterized protein LOC104084834 isoform X1 [Nicotiana 
tomentosiformis]
Length=189

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 101/138 (73%), Gaps = 6/138 (4%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  267
            MGKSVPSP ++QDFARII S+  R   PTQVKPP SR RS+  A   K + +VGG  S  
Sbjct  1    MGKSVPSPNRIQDFARIISSSNNRIHGPTQVKPPASRIRSLPSA---KSRAVVGGDSSER  57

Query  268  serrlrrN--KMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQV  441
              +   +N  +    S++  SS  Q+ +R+PLA+VV DCV+RWFQDTLKEAKAGDISMQV
Sbjct  58   RLKLKTKNMEEASSNSNSNTSSSNQQRQRVPLADVVADCVKRWFQDTLKEAKAGDISMQV  117

Query  442  LVGQMYFSGYGVSRDAQK  495
            LVGQMY+SGYG+SRDAQK
Sbjct  118  LVGQMYYSGYGISRDAQK  135



>ref|XP_006353405.1| PREDICTED: uncharacterized protein LOC102603532 isoform X1 [Solanum 
tuberosum]
 ref|XP_006353406.1| PREDICTED: uncharacterized protein LOC102603532 isoform X2 [Solanum 
tuberosum]
Length=176

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PSP ++QDFARII SN  +R PTQVKP  SR RSV      K + +V G  S   
Sbjct  1    MGKSLPSPNRIQDFARIISSNRIQR-PTQVKP-ASRIRSVPSPVAAKFRAVVDGDSSERR  58

Query  271  er-rlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
             + +    +    S++ +++     RR+PLA+VV DCV+RWF DTLKEAKAGD +MQVLV
Sbjct  59   LKLKKNMEEASSNSNSNSNTSSSNQRRLPLADVVADCVKRWFHDTLKEAKAGDANMQVLV  118

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            GQMYFSGYG+S+DAQKG+AWI+RAS++RSSAW+VSD
Sbjct  119  GQMYFSGYGISKDAQKGRAWITRASKSRSSAWKVSD  154



>ref|XP_004240896.1| PREDICTED: uncharacterized protein LOC101265648 [Solanum lycopersicum]
Length=176

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 113/156 (72%), Gaps = 3/156 (2%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PSP ++QDFARII SN     PTQVKP  +R RSV      K + +V G  S   
Sbjct  1    MGKSLPSPNRIQDFARIINSNRIHH-PTQVKP-ATRIRSVPSPVAAKSRAVVDGDSSERR  58

Query  271  er-rlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
             + +    +    S++ +++     RR+PLA+VV DCV+RWF DTLKEAKAGD +MQVLV
Sbjct  59   LKLKKNMEEASSNSNSNSNTSSSNQRRLPLADVVADCVKRWFHDTLKEAKAGDANMQVLV  118

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            GQMYFSGYG++RDAQKG+AWI+RAS++RSSAW+VSD
Sbjct  119  GQMYFSGYGIARDAQKGRAWITRASKSRSSAWKVSD  154



>ref|XP_003633434.1| PREDICTED: uncharacterized protein LOC100253518 [Vitis vinifera]
 ref|XP_010658206.1| PREDICTED: uncharacterized protein LOC100253518 [Vitis vinifera]
Length=156

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 89/137 (65%), Gaps = 19/137 (14%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+P+ T+LQ+FAR++ S    + P   KP +SR R VSP E  KL+G   G E    
Sbjct  1    MGKSLPTTTRLQEFARVVTSEK-FQSPKHAKP-ISRNR-VSPPETTKLRGARLGSERVRL  57

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
            +      +                RR+PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVG
Sbjct  58   KMESSEGQ----------------RRMPLAQVVSDCAKRWFQDTLKEAKAGDTTMQVLVG  101

Query  451  QMYFSGYGVSRDAQKGK  501
            QMYFSGYGVSRDAQKG+
Sbjct  102  QMYFSGYGVSRDAQKGR  118



>ref|XP_011076630.1| PREDICTED: uncharacterized protein LOC105160829 [Sesamum indicum]
Length=163

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 90/138 (65%), Gaps = 14/138 (10%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  267
            MGKS+PS   LQ FAR+I S T R RR  Q++P VS+TR   P   P   G         
Sbjct  1    MGKSIPSAHNLQHFARVIASATTRPRRAAQLRP-VSKTR---PISSPDATG---------  47

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
            S     + +++  +     +E    RR+PL+EVV DCV+RWFQDTLKEAK GDI+MQVLV
Sbjct  48   SRPDSHQLRLKAPARQMEDAENSERRRMPLSEVVADCVKRWFQDTLKEAKNGDIAMQVLV  107

Query  448  GQMYFSGYGVSRDAQKGK  501
            GQMY+SGYGV+RDAQKG+
Sbjct  108  GQMYYSGYGVARDAQKGR  125



>emb|CDP13949.1| unnamed protein product [Coffea canephora]
Length=179

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 97/145 (67%), Gaps = 12/145 (8%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PSP  LQ+ +R+I +N   RR  QV P   R  ++S A+ P   GL G     S 
Sbjct  1    MGKSLPSPAALQELSRVISTNRLHRR--QV-PKSPRPTTLSSAQ-PPAAGLSGSRRLASK  56

Query  271  errlrrNKMe--------eessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGD  426
            +++L + ++E          S++ ++S  ++ RRIPLAE V DCV+RWFQDTLKEAKAGD
Sbjct  57   DQQLPQLRLENKGMEGKKSTSNDNSTSASEQGRRIPLAEAVADCVKRWFQDTLKEAKAGD  116

Query  427  ISMQVLVGQMYFSGYGVSRDAQKGK  501
             +MQVLV QMY+SGYG+ RDAQKGK
Sbjct  117  TAMQVLVSQMYYSGYGIPRDAQKGK  141



>ref|XP_010031141.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 ref|XP_010031142.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 ref|XP_010031143.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 gb|KCW50408.1| hypothetical protein EUGRSUZ_J00156 [Eucalyptus grandis]
 gb|KCW50409.1| hypothetical protein EUGRSUZ_J00156 [Eucalyptus grandis]
Length=171

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 105/155 (68%), Gaps = 4/155 (3%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PS T+LQDFAR + S+   R P Q KP +SR R VS  E  +  G  GG      
Sbjct  1    MGKSIPSATRLQDFARAVSSSDKLRLPKQAKP-ISRIR-VSTPETSRPGGSGGGGGGGGG  58

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
             R   + KME   +       +R  R+PLA+VV+DC RRWFQDTL+EAKAGD +MQVLVG
Sbjct  59   VRTDPKKKMEVGRAKSLEL--ERNTRLPLAQVVSDCARRWFQDTLREAKAGDGAMQVLVG  116

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            QMY SGYGV RD QKG+AWI++AS+ RSS WRVSD
Sbjct  117  QMYNSGYGVPRDPQKGRAWINKASKARSSVWRVSD  151



>ref|XP_009761007.1| PREDICTED: uncharacterized protein LOC104213009 [Nicotiana sylvestris]
 ref|XP_009761613.1| PREDICTED: uncharacterized protein LOC104213009 [Nicotiana sylvestris]
Length=162

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 111/155 (72%), Gaps = 13/155 (8%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+P     Q FARII SN   R  ++++P +S T      E PK KG+ G     S 
Sbjct  1    MGKSLP-----QGFARIISSNRIHR-TSRIRPSISSTER----ETPKSKGVAG---ESSE  47

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
            +R   ++KMEEESSN NS      RR PLA+VV +CV+RWFQDTLKEAKAGD +MQVLVG
Sbjct  48   QRLKIKSKMEEESSNSNSKPLAEQRRHPLADVVGECVKRWFQDTLKEAKAGDTAMQVLVG  107

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            QMY+SGYG+ RD QKG+AWI+RAS++RSSAW+VSD
Sbjct  108  QMYYSGYGIPRDPQKGRAWINRASKSRSSAWKVSD  142



>gb|EYU20083.1| hypothetical protein MIMGU_mgv1a015205mg [Erythranthe guttata]
 gb|EYU20084.1| hypothetical protein MIMGU_mgv1a015205mg [Erythranthe guttata]
 gb|EYU20085.1| hypothetical protein MIMGU_mgv1a015205mg [Erythranthe guttata]
Length=165

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 84/142 (59%), Gaps = 20/142 (14%)
 Frame = +1

Query  88   FMGKSVPSPTKLQDFARIIGS--NTPRRRPTQVKPPVSRTRSVSPAE--GPKLKGLVGGl  255
            FMGKS+PS  KLQ  AR + S  N   RR  Q+KP  S+ R +SP+   GP+  G    L
Sbjct  2    FMGKSIPSSQKLQQIARFVASPDNGSNRR-AQLKP-ASKARPISPSNPTGPRT-GSNHQL  58

Query  256  espsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISM  435
            +  +       N               R R  PLA+VV DCV+RWFQDTLKEAK GD SM
Sbjct  59   KVDNRHMEAAEN-------------SDRQRMTPLADVVADCVKRWFQDTLKEAKNGDTSM  105

Query  436  QVLVGQMYFSGYGVSRDAQKGK  501
            QVLVGQMY+SGYGV RD+QK K
Sbjct  106  QVLVGQMYYSGYGVGRDSQKAK  127



>ref|XP_010256999.1| PREDICTED: uncharacterized protein LOC104597244 [Nelumbo nucifera]
Length=156

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 101/155 (65%), Gaps = 20/155 (13%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PS T+LQ+FA++  ++   + P   KP + ++ S SP       G  GG      
Sbjct  1    MGKSLPSTTRLQEFAKV--TSEKFKGPKHTKP-IQKSSSFSPEIAKS--GCGGGASKHLK  55

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                                 +R  R+PL+EVV+DCV+RWFQDTLKEAKAGD +MQ+LVG
Sbjct  56   LTMENP---------------ERQTRVPLSEVVSDCVKRWFQDTLKEAKAGDSAMQILVG  100

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            QMY+SGYGV RDAQKG+AWI+RAS++RSSAW+VSD
Sbjct  101  QMYYSGYGVPRDAQKGRAWITRASKSRSSAWKVSD  135



>ref|XP_008233834.1| PREDICTED: uncharacterized protein LOC103332851 isoform X1 [Prunus 
mume]
Length=157

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 87/137 (64%), Gaps = 18/137 (13%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK++PS T+ Q+F R++ ++    RP + K  VS+ R +SP + PK +           
Sbjct  1    MGKALPSATRFQEFTRVVSADKLPGRPRRTKQ-VSQVR-ISPPQAPKSESF---------  49

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   +++ E         +   R+PLA VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  50   -------RVDPERIKLKMESSEGQGRVPLARVVSDCVKRWFQDTLKEAKAGDSSMQVLVG  102

Query  451  QMYFSGYGVSRDAQKGK  501
            QMY+SGYGVSRDA+KG+
Sbjct  103  QMYYSGYGVSRDAKKGQ  119



>ref|XP_007218537.1| hypothetical protein PRUPE_ppa012708mg [Prunus persica]
 gb|EMJ19736.1| hypothetical protein PRUPE_ppa012708mg [Prunus persica]
Length=157

 Score =   113 bits (283),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 18/137 (13%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK++P+ T+ Q+F R++ ++    RP + K  VS+ R +SP + PK +           
Sbjct  1    MGKALPTATRFQEFTRVVSADKLPGRPRRTKQ-VSQVR-ISPPQAPKSESF---------  49

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   +++ E         +   R+PLA VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  50   -------RVDPERIKLKMESSEGQSRVPLARVVSDCVKRWFQDTLKEAKAGDSSMQVLVG  102

Query  451  QMYFSGYGVSRDAQKGK  501
            QMY+SGYGVSRDA+KG+
Sbjct  103  QMYYSGYGVSRDAKKGQ  119



>ref|XP_008233835.1| PREDICTED: uncharacterized protein LOC103332851 isoform X2 [Prunus 
mume]
Length=155

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 18/136 (13%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK++PS T+ Q+F R++ ++    RP + K  VS+ R +SP + PK +           
Sbjct  1    MGKALPSATRFQEFTRVVSADKLPGRPRRTKQ-VSQVR-ISPPQAPKSESF---------  49

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   +++ E         +   R+PLA VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  50   -------RVDPERIKLKMESSEGQGRVPLARVVSDCVKRWFQDTLKEAKAGDSSMQVLVG  102

Query  451  QMYFSGYGVSRDAQKG  498
            QMY+SGYGVSRDA+K 
Sbjct  103  QMYYSGYGVSRDAKKA  118



>gb|KHG28253.1| Putative sel1-like repeat-containing protein L18 [Gossypium arboreum]
Length=149

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 84/141 (60%), Gaps = 33/141 (23%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGS----NTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGle  258
            MGKS+P  TKLQ  A++ G+    NT  + P   KP     R +S    P  K       
Sbjct  1    MGKSLPGATKLQHLAKVTGAAHHLNTTGKNP---KPTTLNRRIISEDNKPNSK-------  50

Query  259  spsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQ  438
                       KME  S++         +R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQ
Sbjct  51   ----------KKMESSSAS---------QRLPLSEVVSDCVKRWFKDTLKEAKAGDVNMQ  91

Query  439  VLVGQMYFSGYGVSRDAQKGK  501
            VLVGQMY+SGYGV RDAQKG+
Sbjct  92   VLVGQMYYSGYGVPRDAQKGR  112



>gb|KJB77082.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
 gb|KJB77083.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
 gb|KJB77085.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
Length=149

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 83/141 (59%), Gaps = 33/141 (23%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGS----NTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGle  258
            MGKS+P  TKLQ  A++ G+    NT  + P   KP     R +     P  K       
Sbjct  1    MGKSLPGATKLQHLAKVTGAAHHLNTTGKNP---KPTTLNRRIIGEDNKPNSK-------  50

Query  259  spsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQ  438
                       KME  S++         +R+PL+EVV+DCV+RWF+D+LKEAKAGD++MQ
Sbjct  51   ----------KKMESSSAS---------QRLPLSEVVSDCVKRWFKDSLKEAKAGDVNMQ  91

Query  439  VLVGQMYFSGYGVSRDAQKGK  501
            VLVGQMY+SGYGV RDAQKG+
Sbjct  92   VLVGQMYYSGYGVPRDAQKGR  112



>gb|KJB77084.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
Length=137

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 83/141 (59%), Gaps = 33/141 (23%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGS----NTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGle  258
            MGKS+P  TKLQ  A++ G+    NT  + P   KP     R +     P  K       
Sbjct  1    MGKSLPGATKLQHLAKVTGAAHHLNTTGKNP---KPTTLNRRIIGEDNKPNSK-------  50

Query  259  spsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQ  438
                       KME  S++         +R+PL+EVV+DCV+RWF+D+LKEAKAGD++MQ
Sbjct  51   ----------KKMESSSAS---------QRLPLSEVVSDCVKRWFKDSLKEAKAGDVNMQ  91

Query  439  VLVGQMYFSGYGVSRDAQKGK  501
            VLVGQMY+SGYGV RDAQKG+
Sbjct  92   VLVGQMYYSGYGVPRDAQKGR  112



>ref|XP_002520815.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41524.1| conserved hypothetical protein [Ricinus communis]
Length=159

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 104/155 (67%), Gaps = 19/155 (12%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS  S   LQ  A+I+  + P+ + +Q+  P  ++R V P +  +LK           
Sbjct  1    MGKSQFSTGDLQALAKIVSFHKPKPKKSQLIIPF-KSREVGPIDTDQLK-----------  48

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   KMEE SS+    + +   R+PL+ VV+DCVRRWFQDTLKEAKAGDISMQVLVG
Sbjct  49   -----VKKMEESSSSSLILDGKN--RLPLSNVVSDCVRRWFQDTLKEAKAGDISMQVLVG  101

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            QMYF+GYG+ +D+QKG+AWI+RAS++R SAW+VSD
Sbjct  102  QMYFNGYGIPKDSQKGRAWINRASKSRVSAWKVSD  136



>ref|XP_004137693.1| PREDICTED: uncharacterized protein LOC101206121, partial [Cucumis 
sativus]
Length=81

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            + L R+PL+EVV+DCV+RWF+DTLKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+ W++
Sbjct  8    EALNRVPLSEVVSDCVKRWFKDTLKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGRIWMT  67

Query  514  rasrtrssawrVSD  555
            +ASR+RSS W+VSD
Sbjct  68   KASRSRSSVWKVSD  81



>gb|KGN65322.1| hypothetical protein Csa_1G324870 [Cucumis sativus]
Length=85

 Score =   102 bits (254),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            + L R+PL+EVV+DCV+RWF+DTLKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+ W++
Sbjct  8    EALNRVPLSEVVSDCVKRWFKDTLKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGRIWMT  67

Query  514  rasrtrssawrVSD  555
            +ASR+RSS W+VSD
Sbjct  68   KASRSRSSVWKVSD  81



>ref|XP_004156634.1| PREDICTED: uncharacterized LOC101206121 [Cucumis sativus]
 gb|KGN58719.1| hypothetical protein Csa_3G730830 [Cucumis sativus]
Length=100

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            + L R+PL+EVV+DCV+RWF+DTLKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+
Sbjct  8    EALNRVPLSEVVSDCVKRWFKDTLKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGR  63



>ref|XP_004146456.1| PREDICTED: uncharacterized protein LOC101213931 isoform 2 [Cucumis 
sativus]
 ref|XP_004146457.1| PREDICTED: uncharacterized protein LOC101213931 isoform 3 [Cucumis 
sativus]
 ref|XP_004171853.1| PREDICTED: uncharacterized protein LOC101228310 isoform 2 [Cucumis 
sativus]
 ref|XP_004171854.1| PREDICTED: uncharacterized protein LOC101228310 isoform 3 [Cucumis 
sativus]
 gb|KGN50710.1| hypothetical protein Csa_5G218760 [Cucumis sativus]
Length=157

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 21/136 (15%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            M KS+PSP + Q FA+++ S+    +  Q +P  SR R+ SP+E P + G V        
Sbjct  1    MAKSLPSPARFQQFAKLVFSS----KNPQSQPKKSRIRA-SPSETP-ISGSV--------  46

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   ++  E +     EE+   R PLA+VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  47   -------RVISEPNKNKYMEEEEKNRTPLADVVSDCVKRWFQDTLKEAKAGDTSMQVLVG  99

Query  451  QMYFSGYGVSRDAQKG  498
            QM+ SGYGV ++ +KG
Sbjct  100  QMFCSGYGVPKNTKKG  115



>ref|XP_008442362.1| PREDICTED: uncharacterized protein LOC103486254 [Cucumis melo]
 ref|XP_008442363.1| PREDICTED: uncharacterized protein LOC103486254 [Cucumis melo]
 ref|XP_008442364.1| PREDICTED: uncharacterized protein LOC103486254 [Cucumis melo]
Length=100

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            L R+PL+EVV+DCV+RWF+DTLKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+
Sbjct  10   LNRVPLSEVVSDCVKRWFKDTLKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGR  63



>ref|XP_008355547.1| PREDICTED: uncharacterized protein LOC103419212 [Malus domestica]
Length=152

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 97/158 (61%), Gaps = 29/158 (18%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNT-PR-RRPTQV-KPPVSRTRSVSPAEGPKLKGLVGGles  261
            MGK++PSPT+ QD  RII ++  PR RR  QV +  +S  ++  P +  ++K        
Sbjct  1    MGKALPSPTRFQDLTRIIAADKLPRTRRAKQVSQVRISSPQTSKPVDPERVK--------  52

Query  262  psserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQV  441
                                    +   R+PLA VV+DCVRRWFQDTLKEAKAGD SMQV
Sbjct  53   ------------------LRMESSEGRNRVPLARVVSDCVRRWFQDTLKEAKAGDSSMQV  94

Query  442  LVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            LVGQMY SGYGV +D +KG AW+++AS++R+S W+VSD
Sbjct  95   LVGQMYCSGYGVPKDPKKGHAWMNKASKSRASVWKVSD  132



>ref|XP_010264502.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
 ref|XP_010264503.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
 ref|XP_010264504.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
 ref|XP_010264505.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
Length=100

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            +R  R+PL+EVV+DCVRRWFQDTLKEAKAGD  MQVLVGQMY+SGYGV RDAQKG+
Sbjct  5    ERQNRVPLSEVVSDCVRRWFQDTLKEAKAGDSGMQVLVGQMYYSGYGVPRDAQKGR  60



>ref|XP_004146455.1| PREDICTED: uncharacterized protein LOC101213931 isoform 1 [Cucumis 
sativus]
 ref|XP_004171852.1| PREDICTED: uncharacterized protein LOC101228310 isoform 1 [Cucumis 
sativus]
Length=181

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 21/136 (15%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            M KS+PSP + Q FA+++ S+    +  Q +P  SR R+ SP+E P + G V        
Sbjct  1    MAKSLPSPARFQQFAKLVFSS----KNPQSQPKKSRIRA-SPSETP-ISGSV--------  46

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   ++  E +     EE+   R PLA+VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  47   -------RVISEPNKNKYMEEEEKNRTPLADVVSDCVKRWFQDTLKEAKAGDTSMQVLVG  99

Query  451  QMYFSGYGVSRDAQKG  498
            QM+ SGYGV ++ +KG
Sbjct  100  QMFCSGYGVPKNTKKG  115



>ref|XP_009369229.1| PREDICTED: uncharacterized protein LOC103958662 [Pyrus x bretschneideri]
Length=151

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 94/157 (60%), Gaps = 28/157 (18%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNT-PR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesp  264
            MGK++P PT+ QD  RII ++  PR RR  QV    S+ R  SP   P            
Sbjct  1    MGKALPWPTRFQDLTRIIAADKLPRPRRAKQV----SQVRISSPQPKP------------  44

Query  265  sserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVL  444
                      +  +         +   R+PLA VV+DCVRRWFQDTLKEAKAGD SMQVL
Sbjct  45   ----------VNPDRVKLRMESSEGQNRVPLARVVSDCVRRWFQDTLKEAKAGDSSMQVL  94

Query  445  VGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            VGQMY SGYGV +D +KG AW+++AS++R+S W+VSD
Sbjct  95   VGQMYCSGYGVPKDPKKGHAWMNKASKSRASVWKVSD  131



>ref|XP_010921063.1| PREDICTED: uncharacterized protein LOC105044761 [Elaeis guineensis]
Length=169

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 93/164 (57%), Gaps = 18/164 (11%)
 Frame = +1

Query  64   VIFLFCFCFMGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGL  243
            ++ L    FMGK +PS   L++FAR+    T R R  + + P  R+ + S       +  
Sbjct  4    LVALRSLLFMGKRLPSAKSLEEFARVA---TERIRRGKHRKPALRSLASSKEAASVARAT  60

Query  244  VGGlespsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAG  423
              G    +        +                RR+PL+EVV+DCVRRWFQD L+EAK G
Sbjct  61   AEGPRPAAHSMENGEREE---------------RRVPLSEVVSDCVRRWFQDALREAKNG  105

Query  424  DISMQVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            D +MQVLVGQMY SGYG  R+ QKGKAWI++AS+ RS+ W+VSD
Sbjct  106  DAAMQVLVGQMYHSGYGCPRNEQKGKAWIAKASKYRSTVWKVSD  149



>ref|XP_009350684.1| PREDICTED: uncharacterized protein LOC103942213 [Pyrus x bretschneideri]
Length=151

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 95/157 (61%), Gaps = 28/157 (18%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNT-PR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesp  264
            MGK++P PT+ QD  RII ++  PR RR  QV    S+ R  SP   P            
Sbjct  1    MGKALPWPTRFQDLTRIIAADKFPRPRRAKQV----SQVRISSPQPKP------------  44

Query  265  sserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVL  444
                      ++ E         +   R+PLA VV+DCVRRWFQDTLKEAKAGD SMQVL
Sbjct  45   ----------VDPERVKLRMDSSEGQNRVPLARVVSDCVRRWFQDTLKEAKAGDSSMQVL  94

Query  445  VGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            VGQMY SGYGV +D +KG AW+++AS++R+S W+VSD
Sbjct  95   VGQMYCSGYGVPKDPKKGHAWMNKASKSRASVWKVSD  131



>ref|XP_008456900.1| PREDICTED: uncharacterized protein LOC103496713 isoform X2 [Cucumis 
melo]
 ref|XP_008456901.1| PREDICTED: uncharacterized protein LOC103496713 isoform X2 [Cucumis 
melo]
Length=157

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 21/136 (15%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            M KS+PSPT+ Q FA+++ S+   + P    P  SR R+ SP+E P + G V        
Sbjct  1    MAKSLPSPTRFQQFAKLVFSSKNPQSP----PKKSRIRA-SPSETP-ISGSV--------  46

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   ++  E +     EE+   R PL++VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  47   -------RVILEPNKNKYMEEKEKNRTPLSDVVSDCVKRWFQDTLKEAKAGDTSMQVLVG  99

Query  451  QMYFSGYGVSRDAQKG  498
            QM+ SGYGV ++ +KG
Sbjct  100  QMFCSGYGVPKNTKKG  115



>ref|XP_006486231.1| PREDICTED: uncharacterized protein LOC102630879 isoform X1 [Citrus 
sinensis]
 ref|XP_006486232.1| PREDICTED: uncharacterized protein LOC102630879 isoform X2 [Citrus 
sinensis]
 ref|XP_006486233.1| PREDICTED: uncharacterized protein LOC102630879 isoform X3 [Citrus 
sinensis]
Length=160

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 87/141 (62%), Gaps = 25/141 (18%)
 Frame = +1

Query  91   MGKSVPSP-TKLQDFARIIGSNTPRR----RPTQVKPPVSRTRSVSPAEGPKLKGLVGGl  255
            MGKS+ S  T L+D ARI+ S++P R    RP   KPP   T  VS     K + +V   
Sbjct  1    MGKSIASTVTTLRDLARIVSSSSPERLQRVRPRHSKPPP--TSVVSARSETKARPIV---  55

Query  256  espsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISM  435
                     ++ KM        + + Q+ +R+PL++VV+DCV+RWFQDTL+EAK GD +M
Sbjct  56   ---------KKPKM------NINWDTQQQQRVPLSQVVSDCVQRWFQDTLREAKNGDKAM  100

Query  436  QVLVGQMYFSGYGVSRDAQKG  498
            +VLVGQMY SGYGV+RD +KG
Sbjct  101  EVLVGQMYLSGYGVARDEKKG  121



>ref|XP_006429512.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 ref|XP_006429513.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 ref|XP_006481132.1| PREDICTED: uncharacterized protein LOC102610400 isoform X2 [Citrus 
sinensis]
 gb|ESR42752.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 gb|ESR42753.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 gb|KDO63289.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
 gb|KDO63290.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
 gb|KDO63291.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
 gb|KDO63292.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
Length=115

 Score =   101 bits (251),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+EVV+DCV+RWF+DTLKEAK GDI+MQVLVGQMYFSGYGV+RDAQKG+
Sbjct  27   RVPLSEVVSDCVKRWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDAQKGR  78



>ref|XP_002265642.1| PREDICTED: uncharacterized protein LOC100243041 isoform X1 [Vitis 
vinifera]
 ref|XP_003632590.1| PREDICTED: uncharacterized protein LOC100243041 isoform X1 [Vitis 
vinifera]
Length=100

 Score =   100 bits (250),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
             R+PL+EVV+DCV+RWFQDTL+EAK+GD+SMQVLVGQMY+SGYGV RDAQKG+
Sbjct  11   HRVPLSEVVSDCVKRWFQDTLREAKSGDVSMQVLVGQMYYSGYGVPRDAQKGR  63



>ref|XP_008456899.1| PREDICTED: uncharacterized protein LOC103496713 isoform X1 [Cucumis 
melo]
Length=181

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 21/136 (15%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            M KS+PSPT+ Q FA+++ S+   + P    P  SR R+ SP+E P + G V        
Sbjct  1    MAKSLPSPTRFQQFAKLVFSSKNPQSP----PKKSRIRA-SPSETP-ISGSV--------  46

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   ++  E +     EE+   R PL++VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  47   -------RVILEPNKNKYMEEKEKNRTPLSDVVSDCVKRWFQDTLKEAKAGDTSMQVLVG  99

Query  451  QMYFSGYGVSRDAQKG  498
            QM+ SGYGV ++ +KG
Sbjct  100  QMFCSGYGVPKNTKKG  115



>ref|XP_006828167.1| hypothetical protein AMTR_s00023p00110940 [Amborella trichopoda]
 gb|ERM95583.1| hypothetical protein AMTR_s00023p00110940 [Amborella trichopoda]
Length=99

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            Q   R+PL+EVV DCV+RWFQDTLKEA+AGD SMQVLVGQMY+SGYG+ RDAQKG+AW++
Sbjct  6    QNHNRLPLSEVVADCVKRWFQDTLKEARAGDSSMQVLVGQMYYSGYGIPRDAQKGRAWLT  65

Query  514  rasrtrssawrVSD  555
            +AS+ RSS W+VSD
Sbjct  66   KASKNRSSVWKVSD  79



>ref|XP_006481131.1| PREDICTED: uncharacterized protein LOC102610400 isoform X1 [Citrus 
sinensis]
Length=116

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+EVV+DCV+RWF+DTLKEAK GDI+MQVLVGQMYFSGYGV+RDAQKG+
Sbjct  27   RVPLSEVVSDCVKRWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDAQKGR  78



>ref|XP_002265673.1| PREDICTED: uncharacterized protein LOC100243041 isoform X2 [Vitis 
vinifera]
Length=99

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
             R+PL+EVV+DCV+RWFQDTL+EAK+GD+SMQVLVGQMY+SGYGV RDAQKG+ W++RAS
Sbjct  11   HRVPLSEVVSDCVKRWFQDTLREAKSGDVSMQVLVGQMYYSGYGVPRDAQKGRVWMTRAS  70

Query  523  rtrssawrVSD  555
            RTRSS W+VSD
Sbjct  71   RTRSSVWKVSD  81



>ref|XP_010039279.1| PREDICTED: uncharacterized protein LOC104427816 isoform X2 [Eucalyptus 
grandis]
Length=108

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+
Sbjct  14   RVPLSEVVSDCVKRWFKDTLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGR  65



>ref|XP_002315124.1| hypothetical protein POPTR_0010s18960g [Populus trichocarpa]
 gb|EEF01295.1| hypothetical protein POPTR_0010s18960g [Populus trichocarpa]
Length=150

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 83/136 (61%), Gaps = 22/136 (16%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PS  KL + ++I+ S+ PR + + V  PV  +R   P+E                
Sbjct  1    MGKSLPSTGKLLELSKIVSSHKPRHKRSIV--PVVPSR---PSE----------------  39

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
              R+   +++ +    +S      +R+PL +VV+DC +RWF+DTLKEAK GDISMQVLVG
Sbjct  40   -VRVDSERLKVKKMEESSLILDGQKRVPLGQVVSDCAKRWFEDTLKEAKTGDISMQVLVG  98

Query  451  QMYFSGYGVSRDAQKG  498
            QMYF+GYGV +D +KG
Sbjct  99   QMYFNGYGVPKDVEKG  114



>ref|XP_004307701.1| PREDICTED: uncharacterized protein LOC101294508 [Fragaria vesca 
subsp. vesca]
Length=154

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 76/141 (54%), Gaps = 29/141 (21%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRR--RPTQVK--PPVSRTRSVSPAEGPKLKGLVGGle  258
            MGKS+PS T+ Q+  RII S    R  RP QV+  PP +     S     +L GL     
Sbjct  1    MGKSLPSSTRFQNLTRIIASEKFSRPTRPIQVRVSPPQTAKTGTSLRVDSELVGL-----  55

Query  259  spsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQ  438
                       KME               R+PLA VV+DC +RWFQDTLKEAK GD +MQ
Sbjct  56   -----------KMESSEGQS---------RVPLARVVSDCAKRWFQDTLKEAKGGDTAMQ  95

Query  439  VLVGQMYFSGYGVSRDAQKGK  501
            VLVGQMY SGYGV ++ +KG 
Sbjct  96   VLVGQMYHSGYGVEKNPEKGH  116



>ref|XP_007134617.1| hypothetical protein PHAVU_010G062000g [Phaseolus vulgaris]
 gb|ESW06611.1| hypothetical protein PHAVU_010G062000g [Phaseolus vulgaris]
Length=100

 Score = 99.0 bits (245),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            +R  R+PL+EVV DCV+RWF+D LKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+
Sbjct  8    ERSSRVPLSEVVADCVKRWFRDALKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGR  63



>ref|XP_010039170.1| PREDICTED: uncharacterized protein LOC104427816 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010039222.1| PREDICTED: uncharacterized protein LOC104427816 isoform X1 [Eucalyptus 
grandis]
Length=149

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+
Sbjct  55   RVPLSEVVSDCVKRWFKDTLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGR  106



>ref|XP_010695454.1| PREDICTED: uncharacterized protein LOC104908080 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695460.1| PREDICTED: uncharacterized protein LOC104908080 [Beta vulgaris 
subsp. vulgaris]
Length=160

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 94/160 (59%), Gaps = 24/160 (15%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNT--PRRRPTQVKPPVSRTRSVS---PAEGPKLKGLVGGl  255
            MGKS+PS   L++FARII S    P   P QVKP  +   S S    A  P     V   
Sbjct  1    MGKSLPSTAGLKNFARIITSEKIFP---PKQVKPTSNNKVSTSIPKSATEPTKMSRVDSA  57

Query  256  espsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISM  435
            +          ++                 R+PLAEVV+DC RRWFQDTLKEA+ GD +M
Sbjct  58   QLSLKMENSSVSRT----------------RVPLAEVVSDCARRWFQDTLKEARDGDTAM  101

Query  436  QVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            QVLVGQMY SGYGV ++ +KG+ WI+RAS++RSSAWRVSD
Sbjct  102  QVLVGQMYNSGYGVPKNTEKGRTWITRASKSRSSAWRVSD  141



>ref|XP_011015169.1| PREDICTED: uncharacterized protein LOC105118821 [Populus euphratica]
Length=150

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 83/136 (61%), Gaps = 22/136 (16%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PS  KL + ++I+ S+ PR + + V  PV  +R   P+E                
Sbjct  1    MGKSLPSTGKLLELSKIVSSHKPRHKKSIV--PVVPSR---PSE---------------I  40

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                 R K+++   +    + Q+L  +PL +VV+DC +RWF+DTLKEAK GDISMQVLVG
Sbjct  41   RVDSERLKVKKMEESSLILDGQKL--VPLGQVVSDCAKRWFEDTLKEAKTGDISMQVLVG  98

Query  451  QMYFSGYGVSRDAQKG  498
            QMYF+GYGV +D +KG
Sbjct  99   QMYFNGYGVPKDVEKG  114



>ref|XP_008355552.1| PREDICTED: uncharacterized protein LOC103419214 [Malus domestica]
Length=151

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 95/156 (61%), Gaps = 26/156 (17%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNT-PRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  267
            MGK++PS T+ QD  RII ++  PR  P +VK   S+ R  SP   P             
Sbjct  1    MGKALPSRTRFQDLTRIIAADKLPR--PRRVKQ-ASQVRISSPQPKP-------------  44

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
                     ++ E         +R  R+PLA  V+DCVRRWFQDTLKEA+AGD SMQVLV
Sbjct  45   ---------VDPERVKLRIESSERQNRVPLARKVSDCVRRWFQDTLKEARAGDSSMQVLV  95

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            GQMY SGYGV +D +KG AW+++AS++R+S W+VSD
Sbjct  96   GQMYCSGYGVPKDPRKGHAWMNKASKSRASVWKVSD  131



>gb|KCW88248.1| hypothetical protein EUGRSUZ_A00636 [Eucalyptus grandis]
 gb|KCW88249.1| hypothetical protein EUGRSUZ_A00636 [Eucalyptus grandis]
Length=180

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+
Sbjct  86   RVPLSEVVSDCVKRWFKDTLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGR  137



>ref|XP_010091064.1| hypothetical protein L484_021946 [Morus notabilis]
 gb|EXB42354.1| hypothetical protein L484_021946 [Morus notabilis]
Length=348

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+EVVTDCV+RWF+DTLKEAK+GDI+MQVLVGQMY+SGYGV RDAQKG+
Sbjct  260  RLPLSEVVTDCVKRWFKDTLKEAKSGDINMQVLVGQMYYSGYGVPRDAQKGR  311



>gb|EPS60291.1| hypothetical protein M569_14514 [Genlisea aurea]
Length=161

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 83/138 (60%), Gaps = 16/138 (12%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  267
            MG+S+ SP     FARII S   R RR  Q K      R++S  E P   G         
Sbjct  1    MGRSIQSPQ----FARIIQSLGQRPRRSAQSKRQSEPVRTLSTPEPPASSG-------TG  49

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
             + R+   +M+  + N       R +R+PL+EVV DCV+RWFQDTLKEA+ GD SMQ+L+
Sbjct  50   RKLRIDARRMDAAAENSE----NRQQRLPLSEVVADCVKRWFQDTLKEARNGDASMQLLL  105

Query  448  GQMYFSGYGVSRDAQKGK  501
            GQMY++GYGV+RD QKG+
Sbjct  106  GQMYYNGYGVARDPQKGR  123



>ref|XP_006289188.1| hypothetical protein CARUB_v10002629mg [Capsella rubella]
 gb|EOA22086.1| hypothetical protein CARUB_v10002629mg [Capsella rubella]
Length=164

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            + RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+S+D QKG+
Sbjct  76   INRIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGISKDEQKGR  129



>ref|XP_011095090.1| PREDICTED: uncharacterized protein LOC105174627 [Sesamum indicum]
 ref|XP_011095091.1| PREDICTED: uncharacterized protein LOC105174627 [Sesamum indicum]
Length=137

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+EVV+DC  RWFQDTLKEAKAGD++MQVLVGQMY+SGYGV +DA KGK
Sbjct  47   RLPLSEVVSDCTERWFQDTLKEAKAGDVNMQVLVGQMYYSGYGVPKDADKGK  98



>ref|XP_008782586.1| PREDICTED: uncharacterized protein LOC103702077 [Phoenix dactylifera]
Length=155

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 91/161 (57%), Gaps = 32/161 (20%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPR----RRPTQVKPPVSRTRSVSPAEGPK--LKGLVGG  252
            MGK +PS   L++FAR+      R    +R  +         + + AEGP+  ++ +  G
Sbjct  1    MGKRLPSAKNLEEFARVATEGIRRAKHAKRALRSLASNKEAAARASAEGPRPAVQSMENG  60

Query  253  lespsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDIS  432
                                       +  RR+PL+EVV+DCVRRWFQD L+EAK GD +
Sbjct  61   E--------------------------REERRVPLSEVVSDCVRRWFQDALREAKNGDAA  94

Query  433  MQVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            MQVLVGQMY SGYG  R+ QKGKAWI++AS+ RS+ W+VSD
Sbjct  95   MQVLVGQMYHSGYGCPRNEQKGKAWIAKASKYRSAVWKVSD  135



>ref|XP_007026543.1| Uncharacterized protein TCM_021578 [Theobroma cacao]
 gb|EOY07045.1| Uncharacterized protein TCM_021578 [Theobroma cacao]
Length=162

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            +R+PL++VV+DCV+RWF+DTLKEAKAGD++MQVLV QMY+SGYGV RDAQKG+
Sbjct  73   QRLPLSDVVSDCVKRWFKDTLKEAKAGDVNMQVLVSQMYYSGYGVPRDAQKGR  125



>ref|XP_007207508.1| hypothetical protein PRUPE_ppa013808mg [Prunus persica]
 ref|XP_008244803.1| PREDICTED: uncharacterized protein LOC103342916 [Prunus mume]
 ref|XP_008244804.1| PREDICTED: uncharacterized protein LOC103342916 [Prunus mume]
 gb|EMJ08707.1| hypothetical protein PRUPE_ppa013808mg [Prunus persica]
Length=102

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
             R+PL+EVV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV RDA  G+
Sbjct  13   HRLPLSEVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVPRDAHMGR  65



>ref|XP_006282317.1| hypothetical protein CARUB_v10028606mg, partial [Capsella rubella]
 gb|EOA15215.1| hypothetical protein CARUB_v10028606mg, partial [Capsella rubella]
Length=117

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            + RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+S+D QK
Sbjct  66   INRIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGISKDEQK  117



>gb|KDP22810.1| hypothetical protein JCGZ_00397 [Jatropha curcas]
Length=153

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+EVV+DCV+RWF+DTLK+AK+GDI+MQVLV QMY+SGYGV RDAQKG+
Sbjct  65   RLPLSEVVSDCVKRWFKDTLKDAKSGDINMQVLVSQMYYSGYGVPRDAQKGR  116



>ref|NP_001238121.1| uncharacterized protein LOC100527831 [Glycine max]
 ref|XP_006572841.1| PREDICTED: uncharacterized protein LOC100527831 isoform X1 [Glycine 
max]
 gb|ACU17021.1| unknown [Glycine max]
 gb|KHN44844.1| hypothetical protein glysoja_024415 [Glycine soja]
Length=100

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            +R  R+ L+EVV DCV+RWF+D LKEAKAGDI+MQVLVGQMY+ GYGV RDAQKG+
Sbjct  8    ERSERVALSEVVADCVKRWFRDALKEAKAGDINMQVLVGQMYYGGYGVPRDAQKGR  63



>ref|XP_006289773.1| hypothetical protein CARUB_v10003374mg, partial [Capsella rubella]
 gb|EOA22671.1| hypothetical protein CARUB_v10003374mg, partial [Capsella rubella]
Length=130

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            + RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+S+D QK
Sbjct  79   INRIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGISKDEQK  130



>ref|XP_003552182.1| PREDICTED: uncharacterized protein LOC100779520 [Glycine max]
Length=159

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 77/136 (57%), Gaps = 19/136 (14%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK + S  +L + +RI+ S     RP +  P     RS +    P+     G       
Sbjct  1    MGKYLESAARLAELSRIVSSAAKPNRPKRALP-----RSPNRVATPRSANPFGV------  49

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   K+E         EEQ+ R  PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVG
Sbjct  50   -------KVEPAKKMEPLEEEQQCR-TPLAKVVSDCSKRWFQDTLKEAKAGDTTMQVLVG  101

Query  451  QMYFSGYGVSRDAQKG  498
            QMY+SGYGV+RD QKG
Sbjct  102  QMYYSGYGVARDPQKG  117



>ref|XP_008388305.1| PREDICTED: uncharacterized protein LOC103450710 [Malus domestica]
 ref|XP_008388306.1| PREDICTED: uncharacterized protein LOC103450711 [Malus domestica]
Length=106

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
             R+PL+ VV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV+RDA  G+
Sbjct  17   HRVPLSAVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVARDAHMGR  69



>ref|XP_009122145.1| PREDICTED: uncharacterized protein LOC103846889 [Brassica rapa]
Length=160

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 93/155 (60%), Gaps = 12/155 (8%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+ S  +  + A  + S  P RRPT   PP ++   V  A   KL      ++   +
Sbjct  1    MGKSILSTVRFAELAIRLSSENPSRRPTT--PPRNKV-FVKKARETKLGDYSNLVKLEKA  57

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                  N     S            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVG
Sbjct  58   GSHSGSNPAPPGSDP---------NRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVG  108

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            QMY SGYG+ +D  KG+AWI++ASRTRSSAW+VSD
Sbjct  109  QMYCSGYGIPKDEHKGRAWINKASRTRSSAWQVSD  143



>gb|ACU23149.1| unknown [Glycine max]
Length=159

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 77/136 (57%), Gaps = 19/136 (14%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK + S  +L + +RI+ S     RP +  P     RS +    P+     G       
Sbjct  1    MGKYLESAARLAELSRIVSSAAKPNRPKRALP-----RSPNRVATPRSANPFGV------  49

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   K+E         EEQ+ R  PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVG
Sbjct  50   -------KVEPAKKMEPLEEEQQCR-TPLAKVVSDCSKRWFQDTLKEAKAGDTTMQVLVG  101

Query  451  QMYFSGYGVSRDAQKG  498
            QMY+SGYGV+RD QKG
Sbjct  102  QMYYSGYGVARDPQKG  117



>gb|KDP21698.1| hypothetical protein JCGZ_03369 [Jatropha curcas]
Length=156

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 81/140 (58%), Gaps = 31/140 (22%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPT----QVKPPVSRTRSVSPAEGPKLKGLVGGle  258
            MGK +PS  ++Q+ ++I  S  P+RR T     +KP   R      A+  K+K       
Sbjct  1    MGKLLPSTGEIQELSKIFASCKPKRRKTVPLINLKPNEVRVN----AQPLKVK-------  49

Query  259  spsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQ  438
                       KM E S   +        R+PL++VV++CV+RWFQDTLKEAKAGDI+MQ
Sbjct  50   -----------KMGESSLCLDGQ-----NRVPLSQVVSECVKRWFQDTLKEAKAGDIAMQ  93

Query  439  VLVGQMYFSGYGVSRDAQKG  498
            VLVGQMY +GYGV +D QKG
Sbjct  94   VLVGQMYCNGYGVPKDDQKG  113



>emb|CDX70156.1| BnaA10g25050D [Brassica napus]
Length=160

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 93/155 (60%), Gaps = 12/155 (8%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+ S  +  + A  + S  P RRPT   PP ++   V  A   KL      ++   +
Sbjct  1    MGKSILSTVRFAELAIRLSSENPSRRPTT--PPRNKV-FVKKARETKLGDYSNLVKLEKA  57

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                  N     S            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVG
Sbjct  58   GSHSGSNPAPPGSDPT---------RVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVG  108

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            QMY SGYG+ +D  KG+AWI++ASRTRSSAW+VSD
Sbjct  109  QMYCSGYGIPKDEHKGRAWINKASRTRSSAWQVSD  143



>ref|XP_003522147.1| PREDICTED: uncharacterized protein LOC100794599 isoform X1 [Glycine 
max]
 ref|XP_006576459.1| PREDICTED: uncharacterized protein LOC100794599 isoform X2 [Glycine 
max]
 ref|XP_006576460.1| PREDICTED: uncharacterized protein LOC100794599 isoform X3 [Glycine 
max]
 ref|XP_006576461.1| PREDICTED: uncharacterized protein LOC100794599 isoform X4 [Glycine 
max]
 ref|XP_006576462.1| PREDICTED: uncharacterized protein LOC100794599 isoform X5 [Glycine 
max]
 ref|XP_006576463.1| PREDICTED: uncharacterized protein LOC100794599 isoform X6 [Glycine 
max]
 gb|KHN33246.1| hypothetical protein glysoja_027933 [Glycine soja]
Length=100

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            +R  R+ L+EVV DCV+RWF+D LKEAKAGDI+MQVLVGQMY SGYGV RDAQKG+
Sbjct  8    ERSGRVALSEVVADCVKRWFRDALKEAKAGDINMQVLVGQMYNSGYGVPRDAQKGR  63



>gb|KHN31321.1| hypothetical protein glysoja_022975 [Glycine soja]
Length=159

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            R PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVGQMY+SGYGV+RD QKG
Sbjct  67   RTPLAKVVSDCSKRWFQDTLKEAKAGDTTMQVLVGQMYYSGYGVARDPQKG  117



>gb|KDO44850.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44851.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44852.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44853.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44854.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
Length=137

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 83/141 (59%), Gaps = 25/141 (18%)
 Frame = +1

Query  91   MGKSVPSP-TKLQDFARIIGSNTPRR----RPTQVKPPVSRTRSVSPAEGPKLKGLVGGl  255
            MGKS+ S  T L+D ARI+ S++P R    RP   KPP   T  VS     K + +V   
Sbjct  1    MGKSIASTVTTLRDLARIVSSSSPERLQRVRPRHSKPPP--TSVVSARSETKARPIV---  55

Query  256  espsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISM  435
                           ++     + + Q+ +R+PL++VV+DCV+RWFQDTL+EAK GD +M
Sbjct  56   ---------------KKPKMNINWDTQQQQRVPLSQVVSDCVQRWFQDTLREAKNGDKAM  100

Query  436  QVLVGQMYFSGYGVSRDAQKG  498
            +VLVGQMY SGYGV+   ++G
Sbjct  101  EVLVGQMYLSGYGVAEMKKRG  121



>ref|XP_010543693.1| PREDICTED: uncharacterized protein LOC104816524 [Tarenaya hassleriana]
 ref|XP_010543694.1| PREDICTED: uncharacterized protein LOC104816524 [Tarenaya hassleriana]
 ref|XP_010543696.1| PREDICTED: uncharacterized protein LOC104816524 [Tarenaya hassleriana]
Length=155

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PLA+VV DCV+RWFQDTLKEAKAGD+ MQVLVGQMY SGYGV +D QKG+AWI+RASR
Sbjct  69   RVPLAQVVDDCVKRWFQDTLKEAKAGDVGMQVLVGQMYCSGYGVPKDEQKGRAWINRASR  128

Query  526  trssawrVSD  555
            TRSSAW+VSD
Sbjct  129  TRSSAWQVSD  138



>gb|AFK39264.1| unknown [Lotus japonicus]
Length=101

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+EVV DCV+RWF+DTLKEAK GDI+MQVLVGQMY +GYGV +DAQKG+
Sbjct  13   RVPLSEVVADCVKRWFKDTLKEAKGGDINMQVLVGQMYCTGYGVPKDAQKGR  64



>ref|XP_006374033.1| hypothetical protein POPTR_0016s13640g [Populus trichocarpa]
 gb|ERP51830.1| hypothetical protein POPTR_0016s13640g [Populus trichocarpa]
Length=145

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL++VV+DC++RWF+DTLKEAKAGDI+MQVLV QMY+SGYGV +D QKG+
Sbjct  55   RVPLSDVVSDCIKRWFKDTLKEAKAGDINMQVLVSQMYYSGYGVPKDEQKGR  106



>ref|XP_007163593.1| hypothetical protein PHAVU_001G247500g [Phaseolus vulgaris]
 gb|ESW35587.1| hypothetical protein PHAVU_001G247500g [Phaseolus vulgaris]
Length=156

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 72/136 (53%), Gaps = 22/136 (16%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK + S  +L++ +RI+ S  P  RP    P     RS +    P+     G       
Sbjct  1    MGKYLESAARLEELSRIVSSAKPNIRPKGTLP-----RSPNRVSTPRTATPFG-------  48

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
             +     KME               R PLA+VV DC +RWFQDTL+EAKAGD SMQVLVG
Sbjct  49   VKVELAEKMEPFEEC----------RTPLAKVVADCAKRWFQDTLREAKAGDTSMQVLVG  98

Query  451  QMYFSGYGVSRDAQKG  498
            QMY SGYGV RD QKG
Sbjct  99   QMYNSGYGVPRDPQKG  114



>ref|NP_974733.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABK32156.1| At5g05360 [Arabidopsis thaliana]
 gb|AED90863.1| uncharacterized protein AT5G05360 [Arabidopsis thaliana]
Length=153

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++A
Sbjct  75   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGRAWINKA  134

Query  520  srtrssawrVSD  555
            SRTRSSAW+VSD
Sbjct  135  SRTRSSAWQVSD  146



>ref|XP_011032587.1| PREDICTED: uncharacterized protein LOC105131358 [Populus euphratica]
 ref|XP_011032588.1| PREDICTED: uncharacterized protein LOC105131358 [Populus euphratica]
 ref|XP_011032589.1| PREDICTED: uncharacterized protein LOC105131358 [Populus euphratica]
Length=145

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL++VV+DC++RWF+DTLKEAKAGDI+MQVLV QMY+SGYGV +D QKG+
Sbjct  55   RVPLSDVVSDCIKRWFKDTLKEAKAGDINMQVLVSQMYYSGYGVPKDEQKGR  106



>gb|AAO42324.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00521.1| hypothetical protein [Arabidopsis thaliana]
Length=157

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++A
Sbjct  69   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGRAWINKA  128

Query  520  srtrssawrVSD  555
            SRTRSSAW+VSD
Sbjct  129  SRTRSSAWQVSD  140



>ref|XP_003623468.1| hypothetical protein MTR_7g071210 [Medicago truncatula]
 gb|AES79686.1| hypothetical protein MTR_7g071210 [Medicago truncatula]
Length=100

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R PL+ VV DCV+RWF+DTL+EAKAGD++MQ+LVGQMY SGYGV++DAQKGK
Sbjct  12   RFPLSGVVADCVKRWFKDTLREAKAGDVNMQILVGQMYCSGYGVAKDAQKGK  63



>ref|XP_011077502.1| PREDICTED: uncharacterized protein LOC105161501 [Sesamum indicum]
 ref|XP_011077503.1| PREDICTED: uncharacterized protein LOC105161501 [Sesamum indicum]
Length=98

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+ VV+DC++RWFQDTLKEA+ GDI+MQVLV QMY+SGYGV+RDA KG+
Sbjct  10   RLPLSVVVSDCIKRWFQDTLKEARTGDINMQVLVAQMYYSGYGVARDANKGR  61



>gb|KFK24957.1| hypothetical protein AALP_AA8G047700 [Arabis alpina]
Length=155

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++ASR
Sbjct  69   RIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDEHKGRAWINKASR  128

Query  526  trssawrVSD  555
            TRSSAW+VSD
Sbjct  129  TRSSAWQVSD  138



>ref|NP_196155.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90864.1| uncharacterized protein AT5G05360 [Arabidopsis thaliana]
Length=163

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++A
Sbjct  75   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGRAWINKA  134

Query  520  srtrssawrVSD  555
            SRTRSSAW+VSD
Sbjct  135  SRTRSSAWQVSD  146



>gb|ABK26779.1| unknown [Picea sitchensis]
Length=144

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL EVV DC RRWFQD+LKEAKAGD  MQVLVGQMY SGYGV RD Q+GK
Sbjct  55   RLPLKEVVADCARRWFQDSLKEAKAGDTGMQVLVGQMYCSGYGVHRDIQRGK  106



>ref|NP_001238136.1| uncharacterized protein LOC100527576 [Glycine max]
 gb|ACU16686.1| unknown [Glycine max]
Length=100

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R PL+ VV DCV+RWF+DTLKEAKAGD++MQVLVGQMY+ GYGV RDAQKG+
Sbjct  13   RAPLSGVVADCVKRWFKDTLKEAKAGDVNMQVLVGQMYYHGYGVPRDAQKGR  64



>ref|XP_010491070.1| PREDICTED: uncharacterized protein LOC104768733 [Camelina sativa]
Length=167

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QKG+
Sbjct  79   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQKGR  132



>ref|XP_010452441.1| PREDICTED: uncharacterized protein LOC104734539 [Camelina sativa]
Length=170

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QKG+
Sbjct  82   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQKGR  135



>emb|CDX98838.1| BnaC09g49970D [Brassica napus]
Length=160

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++ASR
Sbjct  74   RVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDEHKGRAWINKASR  133

Query  526  trssawrVSD  555
            TRSSAW+VSD
Sbjct  134  TRSSAWQVSD  143



>ref|XP_006398999.1| hypothetical protein EUTSA_v10014886mg [Eutrema salsugineum]
 gb|ESQ40452.1| hypothetical protein EUTSA_v10014886mg [Eutrema salsugineum]
Length=161

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++ASR
Sbjct  75   RVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDEHKGRAWINKASR  134

Query  526  trssawrVSD  555
            +RSSAW+VSD
Sbjct  135  SRSSAWQVSD  144



>ref|XP_010423476.1| PREDICTED: uncharacterized protein LOC104708579 [Camelina sativa]
Length=170

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QKG+
Sbjct  82   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQKGR  135



>ref|XP_009416310.1| PREDICTED: uncharacterized protein LOC103996957 [Musa acuminata 
subsp. malaccensis]
Length=153

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 71/136 (52%), Gaps = 23/136 (17%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK +PSPT LQ +AR+                + R +   PA    LK L  G E  ++
Sbjct  1    MGKQLPSPTSLQRYARLAVET------------IRRAKIAKPA----LKSLASGKEEAAA  44

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   +  +E             R+PL +VV DC RRWFQD LKEA+AGD +MQVLVG
Sbjct  45   APSRGPGRWMDERERQQG-------RVPLKDVVADCTRRWFQDALKEARAGDAAMQVLVG  97

Query  451  QMYFSGYGVSRDAQKG  498
            QMY SGYGV R+ QK 
Sbjct  98   QMYHSGYGVPRNEQKA  113



>gb|EYU41977.1| hypothetical protein MIMGU_mgv1a016033mg [Erythranthe guttata]
Length=136

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            RR+PL++VV+DCV RWFQDTLKEAK GD+SMQVLVGQM+ SGYG+ RDA K +
Sbjct  47   RRVPLSDVVSDCVERWFQDTLKEAKTGDVSMQVLVGQMFNSGYGIPRDADKAR  99



>gb|KHN04800.1| hypothetical protein glysoja_031900 [Glycine soja]
Length=144

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            R PLA+VV DC +RWFQDTLKEAKAGD +MQVLVGQMY+SGYGV RD QKG
Sbjct  63   RTPLAKVVADCSKRWFQDTLKEAKAGDSAMQVLVGQMYYSGYGVPRDPQKG  113



>ref|XP_010497949.1| PREDICTED: uncharacterized protein LOC104775718, partial [Camelina 
sativa]
Length=68

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QK
Sbjct  17   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQK  68



>ref|XP_002871153.1| hypothetical protein ARALYDRAFT_325170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47412.1| hypothetical protein ARALYDRAFT_325170 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+
Sbjct  73   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGR  126



>dbj|BAB09979.1| unnamed protein product [Arabidopsis thaliana]
Length=179

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+
Sbjct  75   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGR  128



>ref|XP_002312191.1| hypothetical protein POPTR_0008s07490g [Populus trichocarpa]
 gb|EEE89558.1| hypothetical protein POPTR_0008s07490g [Populus trichocarpa]
Length=102

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            +R+PL  VV+DC +RWFQDTLKEAK GDI+MQVLVGQMYF+GYGV +D +KG
Sbjct  12   KRVPLGLVVSDCAKRWFQDTLKEAKTGDITMQVLVGQMYFNGYGVPKDVEKG  63



>ref|XP_008370217.1| PREDICTED: uncharacterized protein LOC103433722 isoform X2 [Malus 
domestica]
 ref|XP_008345562.1| PREDICTED: uncharacterized protein LOC103408493 isoform X2 [Malus 
domestica]
Length=106

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
             R+PL+ VV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV RD   G+
Sbjct  17   HRVPLSAVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVPRDDHMGR  69



>ref|XP_006435843.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
 ref|XP_006435844.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
 gb|ESR49083.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
 gb|ESR49084.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
Length=101

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            Q+ +R+PL++VV+DCV+RWFQDTL+EAK GD +M+VLVGQMY SGYGV+RD +KG
Sbjct  8    QQQQRVPLSQVVSDCVQRWFQDTLREAKNGDKAMEVLVGQMYLSGYGVARDEKKG  62



>ref|XP_008370215.1| PREDICTED: uncharacterized protein LOC103433722 isoform X1 [Malus 
domestica]
 ref|XP_008370216.1| PREDICTED: uncharacterized protein LOC103433722 isoform X1 [Malus 
domestica]
 ref|XP_008345560.1| PREDICTED: uncharacterized protein LOC103408493 isoform X1 [Malus 
domestica]
 ref|XP_008345561.1| PREDICTED: uncharacterized protein LOC103408493 isoform X1 [Malus 
domestica]
Length=151

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
             R+PL+ VV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV RD   G+
Sbjct  62   HRVPLSAVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVPRDDHMGR  114



>ref|XP_007008833.1| Uncharacterized protein TCM_042415 [Theobroma cacao]
 gb|EOY17643.1| Uncharacterized protein TCM_042415 [Theobroma cacao]
Length=157

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 77/137 (56%), Gaps = 20/137 (15%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGL-VGGlesps  267
            MG+S+   TK QDFA+ + S+    RP  VKP  SR R V+  E   L G+ V       
Sbjct  1    MGRSILCTTKGQDFAKAVPSDK-LHRPKHVKP-TSRNR-VACQEKASLPGVRVDSERVKQ  57

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
             E     ++                 RIPLA+VV+D V+ WFQD LKEAKAGD +MQVLV
Sbjct  58   KEMDSWGDR----------------DRIPLAQVVSDLVKGWFQDALKEAKAGDTNMQVLV  101

Query  448  GQMYFSGYGVSRDAQKG  498
            GQMY SG+GV +D QKG
Sbjct  102  GQMYCSGFGVPKDVQKG  118



>ref|XP_010529121.1| PREDICTED: uncharacterized protein LOC104806101 [Tarenaya hassleriana]
Length=145

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            RR PL+ VV DC +RWF+DTL+EAKAGD  MQVLVGQMY++GYGV RDA+KG+
Sbjct  62   RRFPLSAVVADCAKRWFKDTLQEAKAGDTGMQVLVGQMYYTGYGVPRDARKGR  114



>ref|XP_004984894.1| PREDICTED: myc-associated zinc finger protein-like [Setaria italica]
Length=173

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            Q   R+PLAEVV+DC RRWFQD LKEA+AGDI+MQVLVGQMY SGYGV+++  K +
Sbjct  78   QEDERVPLAEVVSDCTRRWFQDALKEARAGDITMQVLVGQMYRSGYGVNKNEHKAR  133



>ref|XP_004492521.1| PREDICTED: uncharacterized protein LOC101512157 isoform X1 [Cicer 
arietinum]
Length=100

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+ +V DCV+RWF+D L+EAKAGD++MQVLVGQMY++GYGV +DAQKG+
Sbjct  12   RVPLSGMVADCVKRWFKDALREAKAGDVNMQVLVGQMYYNGYGVPKDAQKGR  63



>ref|XP_009421405.1| PREDICTED: uncharacterized protein LOC104000960 [Musa acuminata 
subsp. malaccensis]
Length=96

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            +PL EVV DCVRRWFQD LKEA+AGD+SMQVLV QMY SGYGV+++ QK 
Sbjct  11   VPLKEVVADCVRRWFQDALKEARAGDVSMQVLVAQMYHSGYGVAKNEQKA  60



>ref|NP_001144203.1| uncharacterized protein LOC100277064 [Zea mays]
 gb|ACG38663.1| hypothetical protein [Zea mays]
 gb|ACG42742.1| hypothetical protein [Zea mays]
 gb|ACL54176.1| unknown [Zea mays]
 tpg|DAA44916.1| TPA: hypothetical protein ZEAMMB73_023403 [Zea mays]
Length=170

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PLAEVV+DC RRWFQD LKEA+AGDI+MQVLVGQMY SGYGV+++  K +
Sbjct  79   RVPLAEVVSDCTRRWFQDALKEARAGDITMQVLVGQMYRSGYGVNKNEHKAR  130



>ref|XP_007140174.1| hypothetical protein PHAVU_008G090100g [Phaseolus vulgaris]
 gb|ESW12168.1| hypothetical protein PHAVU_008G090100g [Phaseolus vulgaris]
Length=94

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL++VV DC +RWF+DTLKEAKAGD++MQVLV QMY+ GYG+ +D QKG+
Sbjct  6    RVPLSDVVADCAKRWFKDTLKEAKAGDVNMQVLVSQMYYHGYGIPKDGQKGR  57



>ref|XP_011005568.1| PREDICTED: uncharacterized protein LOC105111778 [Populus euphratica]
 ref|XP_011005640.1| PREDICTED: uncharacterized protein LOC105111778 [Populus euphratica]
Length=102

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            +R+PL  VV+DC +RWFQD LKEAK GDI+MQVLVGQMYF+GYGV +D +KG
Sbjct  12   KRVPLGLVVSDCAKRWFQDALKEAKTGDITMQVLVGQMYFNGYGVPKDVEKG  63



>ref|XP_009373106.1| PREDICTED: uncharacterized protein LOC103962156 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009373107.1| PREDICTED: uncharacterized protein LOC103962156 isoform X3 [Pyrus 
x bretschneideri]
Length=108

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
             R+PL+ VV+DC++RWF+DTLKEAK GDI+MQVLVGQMY++GYGV RD   G+
Sbjct  19   HRVPLSAVVSDCIKRWFKDTLKEAKDGDINMQVLVGQMYYNGYGVPRDDHMGR  71



>gb|KHN29550.1| hypothetical protein glysoja_005274 [Glycine soja]
Length=185

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            R PL+ VV DCV+RWF+DTLKEAKAGD++MQVLVGQMY+ GYGV RDAQK
Sbjct  13   RAPLSGVVADCVKRWFKDTLKEAKAGDVNMQVLVGQMYYHGYGVPRDAQK  62



>ref|XP_002465405.1| hypothetical protein SORBIDRAFT_01g038090 [Sorghum bicolor]
 gb|EER92403.1| hypothetical protein SORBIDRAFT_01g038090 [Sorghum bicolor]
Length=215

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PLAEVV+DC RRWFQD LKEA+AGDI+MQVLVGQMY SGYGV+++  K +
Sbjct  124  RVPLAEVVSDCTRRWFQDALKEARAGDITMQVLVGQMYRSGYGVNKNEHKAR  175



>ref|XP_009373105.1| PREDICTED: uncharacterized protein LOC103962156 isoform X2 [Pyrus 
x bretschneideri]
Length=153

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
             R+PL+ VV+DC++RWF+DTLKEAK GDI+MQVLVGQMY++GYGV RD   G+
Sbjct  64   HRVPLSAVVSDCIKRWFKDTLKEAKDGDINMQVLVGQMYYNGYGVPRDDHMGR  116



>ref|XP_002879746.1| hypothetical protein ARALYDRAFT_345628 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56005.1| hypothetical protein ARALYDRAFT_345628 [Arabidopsis lyrata subsp. 
lyrata]
Length=139

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+
Sbjct  54   RFVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDAKKGR  106



>ref|XP_009373104.1| PREDICTED: uncharacterized protein LOC103962156 isoform X1 [Pyrus 
x bretschneideri]
Length=159

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
             R+PL+ VV+DC++RWF+DTLKEAK GDI+MQVLVGQMY++GYGV RD   G+
Sbjct  70   HRVPLSAVVSDCIKRWFKDTLKEAKDGDINMQVLVGQMYYNGYGVPRDDHMGR  122



>gb|AAC28759.2| expressed protein [Arabidopsis thaliana]
 gb|ABD38894.1| At2g38450 [Arabidopsis thaliana]
Length=105

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+
Sbjct  20   RFVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDARKGR  72



>ref|XP_004500530.1| PREDICTED: uncharacterized protein LOC101512952 isoform X1 [Cicer 
arietinum]
 ref|XP_004500531.1| PREDICTED: uncharacterized protein LOC101512952 isoform X2 [Cicer 
arietinum]
 ref|XP_004500532.1| PREDICTED: uncharacterized protein LOC101512952 isoform X3 [Cicer 
arietinum]
 ref|XP_004500533.1| PREDICTED: uncharacterized protein LOC101512952 isoform X4 [Cicer 
arietinum]
Length=154

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 71/137 (52%), Gaps = 24/137 (18%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKSV S  +L++ +R++ S+    RP   +P +S  R  +P                  
Sbjct  1    MGKSVESVIRLKELSRVVSSSAKSNRPKTTQP-ISPNRVTTPRTA---------------  44

Query  271  errlrrNKMeeessngnsseeQRLR-RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
                   K +         + + L  R PLA VV  C +RWFQDTLK AKAGD SMQVLV
Sbjct  45   -------KQDRTVKVEPPKKIEALESRTPLARVVAYCSKRWFQDTLKGAKAGDSSMQVLV  97

Query  448  GQMYFSGYGVSRDAQKG  498
            GQMY SGYGV RD QKG
Sbjct  98   GQMYNSGYGVPRDPQKG  114



>ref|XP_008809978.1| PREDICTED: uncharacterized protein LOC103721508 [Phoenix dactylifera]
 ref|XP_008809979.1| PREDICTED: uncharacterized protein LOC103721508 [Phoenix dactylifera]
 ref|XP_008809980.1| PREDICTED: uncharacterized protein LOC103721508 [Phoenix dactylifera]
Length=166

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            RR+PL+EVV+DCVRRWFQD L EA+ GD  MQVLVGQMY SGYG  R+ QKGK
Sbjct  76   RRVPLSEVVSDCVRRWFQDALNEARTGDPGMQVLVGQMYHSGYGCPRNEQKGK  128



>ref|XP_010509118.1| PREDICTED: uncharacterized protein LOC104785576 [Camelina sativa]
Length=142

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+KG+
Sbjct  57   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKKGR  109



>ref|NP_565889.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09538.1| uncharacterized protein AT2G38450 [Arabidopsis thaliana]
Length=138

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+
Sbjct  53   RFVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDARKGR  105



>gb|EMT09012.1| hypothetical protein F775_27191 [Aegilops tauschii]
Length=152

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  KG
Sbjct  70   RVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKG  120



>ref|XP_006295208.1| hypothetical protein CARUB_v10024290mg [Capsella rubella]
 gb|EOA28106.1| hypothetical protein CARUB_v10024290mg [Capsella rubella]
Length=137

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY SGYG+ +DA+KGK
Sbjct  52   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYNSGYGIPKDAKKGK  104



>ref|XP_009421407.1| PREDICTED: uncharacterized protein LOC104000963 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 65/139 (47%), Gaps = 36/139 (26%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPV---SRTRSVSPAEGPKLKGLVGGles  261
            MGK +P P  L+D AR        RR    KPP+   +  +  + A    L  L      
Sbjct  1    MGKRLPEPKSLEDVARYAADRI--RRTRVAKPPLRPAAWNKETTSASVMNLADLPEAS--  56

Query  262  psserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQV  441
                                         +PL EVV DC RRWFQD LKEA++GD+SMQ+
Sbjct  57   -----------------------------VPLKEVVADCARRWFQDALKEARSGDVSMQI  87

Query  442  LVGQMYFSGYGVSRDAQKG  498
            LV QMY SGYGV+++ QK 
Sbjct  88   LVAQMYHSGYGVAKNEQKA  106



>gb|EMS50296.1| hypothetical protein TRIUR3_29514 [Triticum urartu]
Length=328

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            Q   R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  KG
Sbjct  225  QEDDRVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKG  279



>ref|NP_001049844.1| Os03g0298600 [Oryza sativa Japonica Group]
 gb|ABF95462.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11758.1| Os03g0298600 [Oryza sativa Japonica Group]
 dbj|BAG90150.1| unnamed protein product [Oryza sativa Japonica Group]
Length=170

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+EVV DC RRWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K +
Sbjct  74   RVPLSEVVLDCTRRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKAQ  125



>ref|XP_010505467.1| PREDICTED: uncharacterized protein LOC104782284 [Camelina sativa]
Length=143

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+KG+
Sbjct  58   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKKGR  110



>dbj|BAJ91570.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            Q   R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K +
Sbjct  66   QEDDRVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKSR  121



>ref|XP_010517139.1| PREDICTED: uncharacterized protein LOC104792648 isoform X1 [Camelina 
sativa]
Length=144

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+KG+
Sbjct  59   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKKGR  111



>gb|AAM62527.1| unknown [Arabidopsis thaliana]
Length=105

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R +PL+ VV+DC + WF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+
Sbjct  20   RFVPLSSVVSDCAKXWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDAKKGR  72



>ref|XP_010683583.1| PREDICTED: uncharacterized protein LOC104898233 [Beta vulgaris 
subsp. vulgaris]
Length=104

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R  L+EVV DCVRRWFQDTLKEAK GD++MQVLV QMY +GYGV +D QK K
Sbjct  15   RKALSEVVADCVRRWFQDTLKEAKGGDVNMQVLVSQMYTAGYGVPKDTQKAK  66



>gb|EEE58888.1| hypothetical protein OsJ_10507 [Oryza sativa Japonica Group]
Length=180

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R+PL+EVV DC RRWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K +
Sbjct  74   RVPLSEVVLDCTRRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKAQ  125



>gb|KFK36738.1| hypothetical protein AALP_AA4G163100 [Arabis alpina]
Length=106

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R +PL+ VV+DC +RWF+DTL+EAK G+I+MQVL+GQMY+SGYGV +D++KG+
Sbjct  23   RYVPLSSVVSDCAKRWFKDTLEEAKGGNITMQVLLGQMYYSGYGVPKDSRKGR  75



>dbj|BAK02754.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K
Sbjct  68   RVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHK  117



>ref|XP_006411058.1| hypothetical protein EUTSA_v10017381mg [Eutrema salsugineum]
 gb|ESQ52511.1| hypothetical protein EUTSA_v10017381mg [Eutrema salsugineum]
Length=146

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYG+ +D +KG+
Sbjct  57   RCVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGIPKDPRKGR  109



>ref|XP_009402772.1| PREDICTED: uncharacterized protein LOC103986477, partial [Musa 
acuminata subsp. malaccensis]
Length=155

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            R+PL EVV DC RRWFQD LKEA+AGD  MQVLVGQMY SGYGV ++ QK 
Sbjct  64   RVPLKEVVADCTRRWFQDALKEARAGDAGMQVLVGQMYHSGYGVLKNDQKA  114



>ref|XP_003558119.1| PREDICTED: uncharacterized protein LOC100845835 [Brachypodium 
distachyon]
Length=157

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            Q   R+PL EVV DC +RWFQD+LKEA+AGD +MQVLVGQMY SGYGV+++  K +
Sbjct  64   QEHERVPLGEVVLDCTKRWFQDSLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKAR  119



>emb|CDY07730.1| BnaA03g17810D [Brassica napus]
Length=141

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY SGYGV +DA+KG+
Sbjct  58   VPLSAVVSDCAKRWFEDTLEEAKAGNITMQVVLGQMYNSGYGVPKDARKGR  108



>ref|XP_010517140.1| PREDICTED: uncharacterized protein LOC104792648 isoform X2 [Camelina 
sativa]
Length=127

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+K
Sbjct  59   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKK  109



>ref|XP_009133257.1| PREDICTED: uncharacterized protein LOC103857784 isoform X1 [Brassica 
rapa]
 emb|CDY14460.1| BnaC03g21350D [Brassica napus]
Length=141

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY SGYGV +DA+KG+
Sbjct  58   VPLSAVVSDCAKRWFEDTLEEAKAGNITMQVVLGQMYNSGYGVPKDARKGR  108



>ref|XP_009406892.1| PREDICTED: uncharacterized protein LOC103989686 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL +VV DC RRWFQD LKEA+AGD +MQVLVGQMY +GYG++++ QK  AWI++AS 
Sbjct  65   RVPLRDVVADCTRRWFQDALKEARAGDAAMQVLVGQMYHNGYGIAKNEQKAHAWITKASN  124

Query  526  trssawrVSD  555
             RSS W+VSD
Sbjct  125  YRSSVWKVSD  134



>gb|KJB67482.1| hypothetical protein B456_010G193200 [Gossypium raimondii]
 gb|KJB67483.1| hypothetical protein B456_010G193200 [Gossypium raimondii]
Length=157

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 91/156 (58%), Gaps = 20/156 (13%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGL-VGGlesps  267
            MGKS+   TK Q+FA+ + S+   R    VKP  SR R VS  E     G+ V       
Sbjct  1    MGKSIVCTTKGQEFAKAVPSDKLHR-AKHVKP-ASRNR-VSCREKAGPSGVRVNSERVKQ  57

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
                   N                  RIPLA+VV++ V+ WFQ+ LKEAKAGD +MQVLV
Sbjct  58   KAMDTWGND----------------DRIPLAQVVSELVKGWFQEALKEAKAGDTNMQVLV  101

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            GQMY +GYGV +D QKG+AWIS+ASR+RSS W+VSD
Sbjct  102  GQMYCNGYGVPKDVQKGRAWISKASRSRSSVWKVSD  137



>gb|KJB67484.1| hypothetical protein B456_010G193200 [Gossypium raimondii]
Length=183

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 91/156 (58%), Gaps = 20/156 (13%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGL-VGGlesps  267
            MGKS+   TK Q+FA+ + S+    R   VKP  SR R VS  E     G+ V       
Sbjct  1    MGKSIVCTTKGQEFAKAVPSD-KLHRAKHVKP-ASRNR-VSCREKAGPSGVRVNSERVKQ  57

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
                   N                  RIPLA+VV++ V+ WFQ+ LKEAKAGD +MQVLV
Sbjct  58   KAMDTWGND----------------DRIPLAQVVSELVKGWFQEALKEAKAGDTNMQVLV  101

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSD  555
            GQMY +GYGV +D QKG+AWIS+ASR+RSS W+VSD
Sbjct  102  GQMYCNGYGVPKDVQKGRAWISKASRSRSSVWKVSD  137



>ref|XP_003601009.1| hypothetical protein MTR_3g072010 [Medicago truncatula]
 gb|AES71260.1| Sel1 repeat protein [Medicago truncatula]
 gb|AFK43254.1| unknown [Medicago truncatula]
 gb|AFK48125.1| unknown [Medicago truncatula]
Length=156

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            RI L+ VV DC  RWF DTLKEAK GD+S QVLVGQMY SGYGV R+ QKG
Sbjct  66   RIALSRVVADCTHRWFHDTLKEAKRGDLSSQVLVGQMYCSGYGVPRNPQKG  116



>ref|XP_009133258.1| PREDICTED: uncharacterized protein LOC103857784 isoform X2 [Brassica 
rapa]
Length=130

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY SGYGV +DA+K
Sbjct  58   VPLSAVVSDCAKRWFEDTLEEAKAGNITMQVVLGQMYNSGYGVPKDARK  106



>ref|NP_001055251.1| Os05g0342900 [Oryza sativa Japonica Group]
 gb|AAV43869.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAV44160.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17165.1| Os05g0342900 [Oryza sativa Japonica Group]
 gb|EAY97601.1| hypothetical protein OsI_19526 [Oryza sativa Indica Group]
 dbj|BAG89024.1| unnamed protein product [Oryza sativa Japonica Group]
Length=103

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R PL+EVV DCV+RWFQD LKEA+ GD +MQVLV QMY SGYG+ ++  KG+
Sbjct  13   RKPLSEVVGDCVQRWFQDALKEARRGDSAMQVLVAQMYHSGYGIPKNEHKGR  64



>ref|XP_006654273.1| PREDICTED: uncharacterized protein LOC102714375 [Oryza brachyantha]
Length=105

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R PL+EVV DCV+RWFQD LKEA+ GD +MQVLV QMY SGYG+ +   KG+
Sbjct  15   RKPLSEVVGDCVQRWFQDALKEARRGDSAMQVLVAQMYHSGYGIPKSEHKGR  66



>ref|XP_004962417.1| PREDICTED: uncharacterized protein LOC101777264 isoform X1 [Setaria 
italica]
 ref|XP_004962418.1| PREDICTED: uncharacterized protein LOC101777264 isoform X2 [Setaria 
italica]
Length=104

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  337  RLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
               R PL+EVV DCV+RWFQD  KEA+ GD++ QVLV QM+FSGYGV ++  KG+
Sbjct  11   ECERKPLSEVVGDCVQRWFQDAFKEARKGDVANQVLVAQMFFSGYGVPKNEYKGR  65



>ref|NP_001142513.1| hypothetical protein [Zea mays]
 gb|ACG24563.1| hypothetical protein [Zea mays]
Length=105

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KGK
Sbjct  14   RKPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKGK  65



>ref|XP_008647657.1| PREDICTED: uncharacterized protein LOC100276657 isoform X1 [Zea 
mays]
 ref|XP_008647658.1| PREDICTED: uncharacterized protein LOC100276657 isoform X1 [Zea 
mays]
 gb|AFW77783.1| hypothetical protein ZEAMMB73_141974 [Zea mays]
 gb|AFW77784.1| hypothetical protein ZEAMMB73_141974 [Zea mays]
Length=104

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R PLAEVV DCV+RWFQD  KEA+ GD++ QVLV QM+FSGYG  ++  KGK
Sbjct  14   RKPLAEVVGDCVQRWFQDAYKEARKGDVANQVLVAQMFFSGYGTPKNEYKGK  65



>ref|XP_008654668.1| PREDICTED: uncharacterized protein LOC100274749 isoform X1 [Zea 
mays]
 ref|XP_008654669.1| PREDICTED: uncharacterized protein LOC100274749 isoform X1 [Zea 
mays]
 ref|XP_008654670.1| PREDICTED: uncharacterized protein LOC100274749 isoform X1 [Zea 
mays]
 gb|AFW82044.1| hypothetical protein ZEAMMB73_653152 [Zea mays]
 gb|AFW82045.1| hypothetical protein ZEAMMB73_653152 [Zea mays]
Length=105

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KGK
Sbjct  14   RKPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKGK  65



>ref|XP_002439596.1| hypothetical protein SORBIDRAFT_09g015880 [Sorghum bicolor]
 gb|EES18026.1| hypothetical protein SORBIDRAFT_09g015880 [Sorghum bicolor]
Length=104

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KGK
Sbjct  14   RRPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKGK  65



>ref|NP_001143861.1| uncharacterized protein LOC100276657 [Zea mays]
 gb|ACG36065.1| hypothetical protein [Zea mays]
Length=134

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            R PLAEVV DCV+RWFQD  KEA+ GD++ QVLV QM+FSGYG  ++  KGK
Sbjct  14   RKPLAEVVGDCVQRWFQDAYKEARKGDVANQVLVAQMFFSGYGTPKNEYKGK  65



>gb|ACG31011.1| hypothetical protein [Zea mays]
Length=105

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KG
Sbjct  14   RKPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKG  64



>ref|XP_010529921.1| PREDICTED: uncharacterized protein LOC104806634 [Tarenaya hassleriana]
Length=175

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYG  474
            +RR+PL+     C +RWF++TL+EAKAGD  MQVLVGQMY+SGYG
Sbjct  62   IRRVPLSAGGAGCAKRWFKETLQEAKAGDTGMQVLVGQMYYSGYG  106


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  388  WFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            WF++TL+EAKAGD  MQVLVGQMY+SGYGV RD +KG+
Sbjct  107  WFKETLQEAKAGDTGMQVLVGQMYYSGYGVPRDDRKGR  144



>ref|XP_001778215.1| predicted protein [Physcomitrella patens]
 gb|EDQ56997.1| predicted protein [Physcomitrella patens]
Length=156

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            + IPL EVV +C  RWF+ TLK AK+GDIS Q LVGQM+ SGYGV  + +K
Sbjct  22   KAIPLREVVANCEHRWFEQTLKAAKSGDISSQCLVGQMFCSGYGVPVNVKK  72



>ref|XP_005650064.1| hypothetical protein COCSUDRAFT_32673 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25520.1| hypothetical protein COCSUDRAFT_32673 [Coccomyxa subellipsoidea 
C-169]
Length=116

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  352  PLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            PL  VV D VRRWFQ+T KEA  GD+  Q L+GQM   GYG  RD+  GK
Sbjct  47   PLTAVVHDAVRRWFQETHKEALRGDVKQQALLGQMLLEGYGCERDSAAGK  96



>ref|XP_001692982.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03551.1| predicted protein [Chlamydomonas reinhardtii]
Length=136

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            IPL  VV + V+RWF+DTL EA+ GD+  Q LVG+MY  GYG  +DA+  K
Sbjct  66   IPLKYVVQEAVKRWFEDTLLEAQRGDVKQQALVGEMYKEGYGCQKDARAAK  116



>ref|XP_002950802.1| hypothetical protein VOLCADRAFT_120924 [Volvox carteri f. nagariensis]
 gb|EFJ48117.1| hypothetical protein VOLCADRAFT_120924 [Volvox carteri f. nagariensis]
Length=135

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            IPL  VV + V+RWF+DTL EA+ GD+  Q L+G+MY  GYG  +D + GK
Sbjct  65   IPLKYVVQEAVKRWFEDTLLEAQRGDVKQQALLGEMYKEGYGCQKDVRAGK  115



>gb|KIY93418.1| hypothetical protein MNEG_14545 [Monoraphidium neglectum]
Length=90

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 33/57 (58%), Gaps = 9/57 (16%)
 Frame = +1

Query  349  IPLAEVV---------TDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQ  492
            +PL  VV         T  VRRWF+DTL EA+ GD+  Q LV QM+  GYG  RD Q
Sbjct  11   VPLKAVVQAAQRNRNATAQVRRWFEDTLVEAQRGDVKQQALVAQMFAEGYGCQRDLQ  67



>ref|XP_009590059.1| PREDICTED: uncharacterized protein LOC104087340, partial [Nicotiana 
tomentosiformis]
Length=57

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMY  459
            RR  LAEVV +   RW +DTLKE KAGD +MQVLVGQMY
Sbjct  17   RRHSLAEVVGEW--RWCRDTLKETKAGDTTMQVLVGQMY  53



>gb|EEE63318.1| hypothetical protein OsJ_18129 [Oryza sativa Japonica Group]
Length=84

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQ  438
            R PL+EVV DCV+RWFQD LKEA+ GD +MQ
Sbjct  13   RKPLSEVVGDCVQRWFQDALKEARRGDSAMQ  43



>gb|KIY94194.1| hypothetical protein MNEG_13768, partial [Monoraphidium neglectum]
Length=56

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  379  VRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRD  486
            VRRWF+DT  EA+ GD+  Q L+ QMY  GYG  RD
Sbjct  1    VRRWFEDTQIEAQRGDVKQQALLAQMYNEGYGTERD  36



>ref|XP_002505403.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66661.1| predicted protein [Micromonas sp. RCC299]
Length=155

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +1

Query  355  LAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            L +V+ D + RWF DTL+ AK GD +   L+ +M  +GYG ++DA++ +
Sbjct  85   LKDVMADAIERWFVDTLRNAKNGDANQAALLAEMLSTGYGCTKDAEEAR  133



>ref|XP_005850343.1| hypothetical protein CHLNCDRAFT_142152 [Chlorella variabilis]
 gb|EFN58241.1| hypothetical protein CHLNCDRAFT_142152 [Chlorella variabilis]
Length=486

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +1

Query  355  LAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            L  VV D +RRW+ +T KEA  GD+  Q L+GQM   GYG   D  KG+
Sbjct  36   LGAVVADALRRWYLETEKEALRGDVKAQALLGQMLIEGYGCQADPVKGR  84



>ref|XP_003059675.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55627.1| predicted protein [Micromonas pusilla CCMP1545]
Length=158

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  355  LAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            L +V+ + + RWF DTL+ AK GD++   L+ +M  +GYG ++DA++ +
Sbjct  88   LKDVMANAIERWFIDTLRNAKNGDVNQAALLAEMLATGYGCNKDAEEAR  136



>emb|CBI25405.3| unnamed protein product [Vitis vinifera]
Length=61

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +1

Query  433  MQVLVGQMYFSGYGVSRDAQKGK  501
            MQVLVGQMYFSGYGVSRDAQKG+
Sbjct  1    MQVLVGQMYFSGYGVSRDAQKGR  23



>ref|XP_002962942.1| hypothetical protein SELMODRAFT_404377 [Selaginella moellendorffii]
 gb|EFJ36405.1| hypothetical protein SELMODRAFT_404377 [Selaginella moellendorffii]
Length=833

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            + L + PL E+V    R+WF + L+ A AGD  MQ L+G+M+ +GYG   +  +G
Sbjct  3    ETLEKGPLREIVAQLTRQWFLEALELAMAGDRQMQQLIGKMFCTGYGCHANLSQG  57



>emb|CBI18085.3| unnamed protein product [Vitis vinifera]
Length=60

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  433  MQVLVGQMYFSGYGVSRDAQKGK  501
            MQVLVGQMY+SGYGV RDAQKG+
Sbjct  1    MQVLVGQMYYSGYGVPRDAQKGR  23



>ref|XP_011401235.1| hypothetical protein F751_6989 [Auxenochlorella protothecoides]
 gb|KFM28222.1| hypothetical protein F751_6989 [Auxenochlorella protothecoides]
Length=95

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +1

Query  355  LAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            L+ VV D ++RW+ +T KEA  GD+    L+GQM   GYG   + ++G+
Sbjct  27   LSLVVADALKRWYAETEKEALRGDLKSAALLGQMLNEGYGCKANPERGR  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800