BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H23

Length=445
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001275397.1|  glucose-6-phosphate 1-dehydrogenase, cytopla...    126   3e-31   Solanum tuberosum [potatoes]
sp|P37830.1|G6PD_SOLTU  RecName: Full=Glucose-6-phosphate 1-dehyd...    126   3e-31   Solanum tuberosum [potatoes]
ref|XP_006338664.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    126   3e-31   Solanum tuberosum [potatoes]
ref|XP_004231802.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    126   3e-31   Solanum lycopersicum
ref|XP_009601968.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    122   6e-30   Nicotiana tomentosiformis
emb|CAA04993.1|  glucose-6-phosphate dehydrogenase                      122   6e-30   Nicotiana tabacum [American tobacco]
ref|XP_009774777.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    120   5e-29   Nicotiana sylvestris
emb|CAA04992.1|  glucose-6-phosphate dehydrogenase                      120   5e-29   Nicotiana tabacum [American tobacco]
dbj|BAK22407.1|  glucose-6-phosphate dehydrogenase                      120   5e-29   Nicotiana benthamiana
gb|KDO42046.1|  hypothetical protein CISIN_1g010132mg                   116   1e-28   Citrus sinensis [apfelsine]
gb|KDO42045.1|  hypothetical protein CISIN_1g010132mg                   116   2e-28   Citrus sinensis [apfelsine]
gb|KDO42044.1|  hypothetical protein CISIN_1g010132mg                   117   3e-28   Citrus sinensis [apfelsine]
ref|XP_006447163.1|  hypothetical protein CICLE_v10015153mg             117   5e-28   
ref|XP_006469975.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    117   6e-28   Citrus sinensis [apfelsine]
gb|KDO42043.1|  hypothetical protein CISIN_1g010132mg                   117   7e-28   Citrus sinensis [apfelsine]
ref|XP_004161667.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-6-ph...    114   6e-27   
ref|XP_008442193.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    114   6e-27   Cucumis melo [Oriental melon]
ref|XP_004150984.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    114   6e-27   
ref|XP_011098824.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    114   1e-26   Sesamum indicum [beniseed]
gb|AFJ00340.1|  cytoplasmic glucose-6-phosphate dehydrogenase           113   1e-26   Cucumis hystrix
gb|KCW55886.1|  hypothetical protein EUGRSUZ_I01691                     112   2e-26   Eucalyptus grandis [rose gum]
ref|XP_002266527.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    112   3e-26   Vitis vinifera
gb|KCW55885.1|  hypothetical protein EUGRSUZ_I01691                     112   3e-26   Eucalyptus grandis [rose gum]
ref|XP_010029040.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    112   3e-26   Eucalyptus grandis [rose gum]
ref|XP_011097324.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    111   8e-26   Sesamum indicum [beniseed]
gb|KDP46341.1|  hypothetical protein JCGZ_10181                         111   1e-25   Jatropha curcas
gb|KJB11615.1|  hypothetical protein B456_001G268300                    111   1e-25   Gossypium raimondii
gb|AAB69318.1|  cytosolic glucose-6-phosphate dehydrogenase 1           110   1e-25   Petroselinum crispum
ref|XP_006290916.1|  hypothetical protein CARUB_v10017030mg             110   2e-25   Capsella rubella
ref|XP_009111567.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    110   2e-25   Brassica rapa
emb|CDY20053.1|  BnaA09g01980D                                          110   2e-25   Brassica napus [oilseed rape]
gb|ABR45722.1|  G6PD1                                                   110   2e-25   Actinidia chinensis
emb|CDY00159.1|  BnaC09g01420D                                          110   3e-25   
emb|CDX67476.1|  BnaA07g15160D                                          109   4e-25   
ref|XP_006282586.1|  hypothetical protein CARUB_v10004603mg             109   4e-25   Capsella rubella
ref|XP_010450623.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    109   5e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006395458.1|  hypothetical protein EUTSA_v10004014mg             109   5e-25   Eutrema salsugineum [saltwater cress]
ref|XP_006405432.1|  hypothetical protein EUTSA_v10027727mg             109   5e-25   Eutrema salsugineum [saltwater cress]
ref|NP_189366.1|  glucose-6-phosphate dehydrogenase 5                   109   5e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57688.1|  AT3g27300/K17E12_12                                     109   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870678.1|  glucose-6-phosphate dehydrogenase 6                109   6e-25   Arabidopsis lyrata subsp. lyrata
ref|NP_198892.1|  glucose-6-phosphate dehydrogenase 6                   109   6e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CAB52675.1|  glucose-6-phosphate 1-dehydrogenase                    108   7e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010248854.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    108   7e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010502697.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    108   7e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010425474.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    108   8e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010514422.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    108   8e-25   Camelina sativa [gold-of-pleasure]
emb|CAB52674.1|  glucose-6-phosphate 1-dehydrogenase                    108   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125158.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    108   1e-24   Brassica rapa
ref|XP_011045226.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    108   1e-24   Populus euphratica
gb|AAR26303.3|  glucose-6-phosphate dehydrogenase                       107   2e-24   Populus suaveolens [Mongolian poplar]
gb|KJB11613.1|  hypothetical protein B456_001G268300                    107   2e-24   Gossypium raimondii
ref|XP_010436011.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    107   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010528187.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    107   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_007031738.1|  Glucose-6-phosphate dehydrogenase 6                107   3e-24   
gb|EYU34779.1|  hypothetical protein MIMGU_mgv1a004680mg                105   1e-23   Erythranthe guttata [common monkey flower]
ref|XP_010441234.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    105   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010554089.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    105   1e-23   Tarenaya hassleriana [spider flower]
gb|AFF18796.1|  glucose-6-phosphate dehydrogenase                       103   1e-23   Dimocarpus longan [longan]
ref|XP_002877035.1|  glucose-6-phosphate dehydrogenase 5                105   2e-23   
ref|XP_007215121.1|  hypothetical protein PRUPE_ppa004323mg             104   3e-23   Prunus persica
ref|XP_002298586.2|  glucose-6-phosphate 1-dehydrogenase family p...    104   3e-23   
ref|XP_008231184.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    103   4e-23   Prunus mume [ume]
gb|ABC74527.1|  glucose-6-phosphate dehydrogenase                       103   5e-23   Populus trichocarpa [western balsam poplar]
emb|CDP16654.1|  unnamed protein product                                103   1e-22   Coffea canephora [robusta coffee]
gb|KJB33921.1|  hypothetical protein B456_006G038700                    102   1e-22   Gossypium raimondii
gb|KJB33922.1|  hypothetical protein B456_006G038700                    102   1e-22   Gossypium raimondii
gb|AIE47268.1|  glucose-6-phosphate dehydrogenase                       102   1e-22   Hevea brasiliensis [jebe]
gb|KJB33920.1|  hypothetical protein B456_006G038700                    102   2e-22   Gossypium raimondii
gb|KJB33923.1|  hypothetical protein B456_006G038700                    102   2e-22   Gossypium raimondii
gb|AAB69319.1|  cytosolic glucose-6-phosphate dehydrogenase 2           102   2e-22   Petroselinum crispum
ref|XP_010250853.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    101   4e-22   Nelumbo nucifera [Indian lotus]
ref|XP_011010244.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...    101   4e-22   Populus euphratica
emb|CDY11711.1|  BnaC06g13190D                                          101   6e-22   Brassica napus [oilseed rape]
gb|EPS70489.1|  glucose-6-phosphate 1-dehydrogenase                   99.4    3e-21   Genlisea aurea
gb|ABC74528.1|  glucose-6-phosphate dehydrogenase                     99.0    3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_009151975.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  99.0    4e-21   Brassica rapa
gb|ABC74526.1|  glucose-6-phosphate dehydrogenase                     98.6    4e-21   Populus trichocarpa [western balsam poplar]
emb|CDY13701.1|  BnaA06g32220D                                        98.6    4e-21   Brassica napus [oilseed rape]
ref|XP_002323796.1|  glucose-6-phosphate 1-dehydrogenase family p...  98.6    5e-21   Populus trichocarpa [western balsam poplar]
ref|XP_003553875.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  98.2    6e-21   Glycine max [soybeans]
ref|XP_009370302.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  98.2    7e-21   Pyrus x bretschneideri [bai li]
ref|XP_010111634.1|  Glucose-6-phosphate 1-dehydrogenase, cytopla...  98.2    7e-21   Morus notabilis
ref|XP_009371708.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  98.2    7e-21   Pyrus x bretschneideri [bai li]
ref|XP_008362117.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  97.4    1e-20   Malus domestica [apple tree]
emb|CDX83677.1|  BnaC07g24170D                                        96.7    3e-20   
ref|XP_008792156.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  95.9    5e-20   Phoenix dactylifera
gb|KJB76462.1|  hypothetical protein B456_012G089700                  95.5    6e-20   Gossypium raimondii
gb|KJB76461.1|  hypothetical protein B456_012G089700                  95.5    7e-20   Gossypium raimondii
ref|XP_007151560.1|  hypothetical protein PHAVU_004G0570000g          93.2    7e-20   Phaseolus vulgaris [French bean]
ref|XP_004304016.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  94.7    1e-19   Fragaria vesca subsp. vesca
ref|XP_009406393.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  94.7    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGI65622.1|  cytoplasmic glucose-6-phosphate dehydrogenase         94.7    1e-19   Fragaria x ananassa
gb|AAD11426.1|  cytoplasmic glucose-6-phosphate 1-dehydrogenase       94.4    1e-19   Mesembryanthemum crystallinum
ref|XP_004953000.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  94.4    1e-19   Setaria italica
ref|XP_003547679.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  94.4    1e-19   Glycine max [soybeans]
ref|XP_010912859.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  94.0    2e-19   Elaeis guineensis
gb|KJB76463.1|  hypothetical protein B456_012G089700                  93.2    2e-19   Gossypium raimondii
ref|XP_008365361.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  94.0    2e-19   
ref|XP_010930046.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  93.6    3e-19   
ref|XP_010930044.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  93.6    3e-19   Elaeis guineensis
ref|XP_010912860.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  92.4    3e-19   Elaeis guineensis
ref|XP_009416632.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  93.2    4e-19   
gb|EMT16963.1|  Glucose-6-phosphate 1-dehydrogenase, cytoplasmic ...  93.2    4e-19   
gb|EMS62742.1|  Glucose-6-phosphate 1-dehydrogenase, cytoplasmic ...  92.8    5e-19   Triticum urartu
gb|AFK42993.1|  unknown                                               92.4    7e-19   Lotus japonicus
ref|NP_001241264.1|  glucose-6-phosphate 1-dehydrogenase, cytopla...  92.4    7e-19   Glycine max [soybeans]
ref|XP_003575296.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  92.4    7e-19   Brachypodium distachyon [annual false brome]
gb|ACN41003.1|  unknown                                               92.4    9e-19   Picea sitchensis
ref|XP_004491740.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  92.0    9e-19   Cicer arietinum [garbanzo]
gb|AGZ15362.1|  glucose-6-phosphate 1-dehydrogenase                   92.0    1e-18   Phaseolus vulgaris [French bean]
ref|XP_007140875.1|  hypothetical protein PHAVU_008G148700g           92.0    1e-18   Phaseolus vulgaris [French bean]
gb|ABI97284.1|  glucose-6-phosphate dehydrogenase                     91.7    2e-18   Pisum sativum [garden pea]
ref|NP_001047345.1|  Os02g0600400                                     90.9    2e-18   
ref|XP_006647463.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  90.9    3e-18   Oryza brachyantha
ref|XP_006652432.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  89.7    6e-18   Oryza brachyantha
ref|XP_006852171.1|  hypothetical protein AMTR_s00049p00097260        89.7    6e-18   Amborella trichopoda
ref|XP_003580004.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  89.7    7e-18   Brachypodium distachyon [annual false brome]
gb|EEC77511.1|  hypothetical protein OsI_16377                        89.4    8e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_004489579.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  89.4    8e-18   Cicer arietinum [garbanzo]
gb|AAL79959.1|  glucose-6-phosphate dehydrogenase                     89.4    9e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053132.1|  Os04g0485300                                     89.4    9e-18   
ref|XP_010680729.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  89.4    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001169544.1|  uncharacterized protein LOC100383421             89.0    1e-17   Zea mays [maize]
ref|XP_009415064.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  88.6    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008812421.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  88.6    2e-17   Phoenix dactylifera
ref|NP_001150684.1|  glucose-6-phosphate 1-dehydrogenase, cytopla...  88.2    2e-17   Zea mays [maize]
gb|AIY34491.1|  glucose-6-phosphate dehydrogenase                     87.8    3e-17   Saccharum hybrid cultivar Yacheng05-179
ref|XP_004976009.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  87.8    3e-17   Setaria italica
gb|EEC73539.1|  hypothetical protein OsI_07937                        87.8    3e-17   Oryza sativa Indica Group [Indian rice]
sp|Q42919.1|G6PD_MEDSA  RecName: Full=Glucose-6-phosphate 1-dehyd...  87.4    5e-17   Medicago sativa [alfalfa]
ref|XP_003622423.1|  Glucose-6-phosphate 1-dehydrogenase              87.4    5e-17   Medicago truncatula
gb|ACN36479.1|  unknown                                               87.4    5e-17   Zea mays [maize]
gb|KEH25436.1|  glucose-6-phosphate 1-dehydrogenase                   86.3    1e-16   Medicago truncatula
gb|ACJ85742.1|  unknown                                               86.3    1e-16   Medicago truncatula
dbj|BAA97664.1|  glucose-6-phosphate dehydrogenase                    85.5    2e-16   Triticum aestivum [Canadian hard winter wheat]
gb|ACV97161.1|  cytosolic glucose 6 phosphate dehydrogenase           85.5    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA97662.1|  glucose-6-phosphate dehydrogenase                    85.5    2e-16   Triticum aestivum [Canadian hard winter wheat]
gb|EMS65357.1|  Glucose-6-phosphate 1-dehydrogenase, cytoplasmic ...  85.5    2e-16   Triticum urartu
dbj|BAJ90864.1|  predicted protein                                    85.5    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA97663.1|  glucose-6-phosphate dehydrogenase                    85.5    2e-16   Triticum aestivum [Canadian hard winter wheat]
gb|KHG01601.1|  Glucose-6-phosphate 1-dehydrogenase-2C cytoplasmi...  84.3    4e-16   Gossypium arboreum [tree cotton]
gb|EMT23941.1|  Glucose-6-phosphate 1-dehydrogenase, cytoplasmic ...  84.3    6e-16   
ref|XP_001775510.1|  predicted protein                                79.3    3e-14   
ref|XP_001777530.1|  predicted protein                                77.8    1e-13   
ref|XP_002975183.1|  hypothetical protein SELMODRAFT_150322           76.6    3e-13   Selaginella moellendorffii
ref|XP_002977589.1|  hypothetical protein SELMODRAFT_151970           76.6    3e-13   Selaginella moellendorffii
ref|XP_001765091.1|  predicted protein                                69.7    6e-11   
gb|KIO25023.1|  hypothetical protein M407DRAFT_244236                 68.9    1e-10   Tulasnella calospora MUT 4182
gb|KIM29528.1|  hypothetical protein M408DRAFT_22868                  68.6    1e-10   Serendipita vermifera MAFF 305830
gb|EPB91635.1|  glucose-6-phosphate dehydrogenase                     67.8    3e-10   Mucor circinelloides f. circinelloides 1006PhL
emb|CEP10545.1|  hypothetical protein                                 67.4    4e-10   Parasitella parasitica
ref|XP_001694367.1|  glucose-6-phosphate dehydrogenase                64.7    5e-10   Chlamydomonas reinhardtii
ref|XP_002491203.1|  Glucose-6-phosphate dehydrogenase (G6PD), ca...  67.0    5e-10   Komagataella phaffii GS115
dbj|GAN03829.1|  glucose-6-P dehydrogenase                            66.6    6e-10   Mucor ambiguus
emb|CDS06387.1|  hypothetical protein LRAMOSA08915                    66.6    6e-10   Lichtheimia ramosa
dbj|BAJ88465.1|  predicted protein                                    66.6    7e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006460350.1|  hypothetical protein AGABI2DRAFT_192087          66.2    8e-10   Agaricus bisporus var. bisporus H97
ref|XP_007382144.1|  glucose-6-phosphate 1-dehydrogenase              66.2    9e-10   Punctularia strigosozonata HHB-11173 SS5
ref|XP_009543666.1|  hypothetical protein HETIRDRAFT_449546           66.2    1e-09   Heterobasidion irregulare TC 32-1
gb|AHL26985.1|  glucose-6-phosphate 1-dehydrogenase                   65.1    2e-09   Volvariella volvacea
ref|XP_007329303.1|  hypothetical protein AGABI1DRAFT_113271          65.1    2e-09   Agaricus bisporus var. burnettii JB137-S8
gb|EKG04538.1|  glucose-6-phosphate 1-dehydrogenase, putative         62.8    3e-09   Trypanosoma cruzi
ref|XP_007861864.1|  glucose-6-phosphate dehydrogenase                64.7    3e-09   Gloeophyllum trabeum ATCC 11539
gb|EMF11690.1|  glucose-6-phosphate dehydrogenase                     64.7    3e-09   Sphaerulina musiva SO2202
gb|KIM90820.1|  hypothetical protein PILCRDRAFT_811308                64.7    3e-09   Piloderma croceum F 1598
emb|CDS08935.1|  hypothetical protein LRAMOSA10295                    64.7    3e-09   Lichtheimia ramosa
gb|KDQ64510.1|  hypothetical protein JAAARDRAFT_28148                 64.3    3e-09   Jaapia argillacea MUCL 33604
gb|ABD72518.1|  glucose 6-phosphate dehydrogenase                     64.3    4e-09   Trypanosoma cruzi
ref|XP_820060.1|  glucose-6-phosphate 1-dehydrogenase                 64.3    4e-09   Trypanosoma cruzi strain CL Brener
ref|XP_807540.1|  glucose-6-phosphate 1-dehydrogenase                 62.8    4e-09   Trypanosoma cruzi strain CL Brener
gb|KIR88668.1|  glucose-6-phosphate dehydrogenase                     63.9    4e-09   Cryptococcus gattii VGIV IND107
gb|KIR52019.1|  glucose-6-phosphate dehydrogenase                     63.9    4e-09   Cryptococcus gattii Ru294
gb|KIR49166.1|  glucose-6-phosphate dehydrogenase                     63.9    4e-09   Cryptococcus gattii CA1280
gb|KIR31719.1|  glucose-6-phosphate dehydrogenase                     63.9    4e-09   Cryptococcus gattii VGII MMRL2647
gb|KGB76508.1|  glucose-6-phosphate 1-dehydrogenase                   63.9    4e-09   Cryptococcus gattii VGII R265
ref|XP_003195210.1|  glucose-6-phosphate 1-dehydrogenase              63.9    4e-09   Cryptococcus gattii WM276
emb|CDH58020.1|  glucose-6-phosphate 1-dehydrogenase                  63.9    5e-09   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS09438.1|  hypothetical protein LRAMOSA10798                    63.9    5e-09   Lichtheimia ramosa
gb|KII95192.1|  hypothetical protein PLICRDRAFT_96946                 63.9    6e-09   Plicaturopsis crispa FD-325 SS-3
gb|EMS22982.1|  glucose-6-phosphate 1-dehydrogenase                   63.5    7e-09   Rhodotorula toruloides NP11
gb|ESS60775.1|  glucose-6-phosphate dehydrogenase                     63.2    7e-09   Trypanosoma cruzi Dm28c
ref|XP_005647602.1|  glucose-6-phosphate dehydrogenase 1              63.5    8e-09   Coccomyxa subellipsoidea C-169
gb|KIM46170.1|  hypothetical protein M413DRAFT_441239                 63.5    8e-09   Hebeloma cylindrosporum h7
ref|XP_001837181.1|  glucose-6-phosphate 1-dehydrogenase              63.5    8e-09   Coprinopsis cinerea okayama7#130
emb|CEP07228.1|  hypothetical protein                                 63.2    8e-09   Parasitella parasitica
emb|CEI98049.1|  Putative Glucose-6-phosphate 1-dehydrogenase         63.2    1e-08   Rhizopus microsporus
emb|CEG67451.1|  Putative Glucose-6-phosphate 1-dehydrogenase         63.2    1e-08   Rhizopus microsporus
ref|XP_572045.1|  glucose-6-phosphate 1-dehydrogenase                 63.2    1e-08   Cryptococcus neoformans var. neoformans JEC21
gb|AFR96471.1|  glucose-6-phosphate dehydrogenase                     63.2    1e-08   Cryptococcus neoformans var. grubii H99
pdb|4E9I|A  Chain A, Glucose-6-P Dehydrogenase (Apo Form) From Tr...  63.2    1e-08   
gb|ABD72519.1|  glucose 6-phosphate dehydrogenase                     63.2    1e-08   Trypanosoma cruzi
gb|KIY96886.1|  glucose-6-phosphate 1-dehydrogenase                   62.8    1e-08   Monoraphidium neglectum
gb|EKG04547.1|  glucose-6-phosphate 1-dehydrogenase, putative         63.2    1e-08   Trypanosoma cruzi
ref|XP_002393942.1|  hypothetical protein MPER_06249                  61.2    1e-08   
gb|KIJ70545.1|  hypothetical protein HYDPIDRAFT_105287                62.8    1e-08   Hydnomerulius pinastri MD-312
ref|XP_007315621.1|  hypothetical protein SERLADRAFT_461153           62.8    1e-08   Serpula lacrymans var. lacrymans S7.9
dbj|BAB96757.1|  glucose-6-phosphate dehydrogenase 1                  62.8    1e-08   Chlorella vulgaris
gb|EPB88420.1|  glucose-6-phosphate 1-dehydrogenase                   62.8    1e-08   Mucor circinelloides f. circinelloides 1006PhL
emb|CCD42343.1|  similar to glucose-6-phosphate-1-dehydrogenase       60.5    1e-08   Botrytis cinerea T4
gb|KIJ56677.1|  hypothetical protein M422DRAFT_22833                  62.8    1e-08   Sphaerobolus stellatus SS14
gb|KIZ06619.1|  glucose-6-phosphate 1-dehydrogenase                   62.8    1e-08   Monoraphidium neglectum
gb|KDR83724.1|  hypothetical protein GALMADRAFT_219554                62.8    1e-08   Galerina marginata CBS 339.88
emb|CDI55460.1|  probable ZWF1-glucose-6-phosphate dehydrogenase      62.4    1e-08   Melanopsichium pennsylvanicum 4
gb|KIK48890.1|  hypothetical protein CY34DRAFT_797680                 62.4    1e-08   Suillus luteus UH-Slu-Lm8-n1
dbj|GAN05145.1|  glucose-6-phosphate 1-dehydrogenase                  62.8    2e-08   Mucor ambiguus
emb|CDJ26843.1|  Glucose-6-phosphate dehydrogenase, putative          62.8    2e-08   Eimeria mitis
ref|XP_007338064.1|  glucose-6-P dehydrogenase                        62.4    2e-08   
gb|EIE81093.1|  hypothetical protein RO3G_05798                       62.8    2e-08   Rhizopus delemar RA 99-880
emb|CCX30776.1|  Similar to Glucose-6-phosphate 1-dehydrogenase; ...  62.4    2e-08   Pyronema omphalodes CBS 100304
ref|XP_007268445.1|  glucose-6-P dehydrogenase                        62.4    2e-08   Fomitiporia mediterranea MF3/22
ref|XP_010450423.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  62.4    2e-08   
emb|CAM82769.1|  glucose-6-phosphate-1-dehydrogenase                  60.1    2e-08   Nidula niveotomentosa
ref|XP_003036452.1|  hypothetical protein SCHCODRAFT_254896           62.0    2e-08   Schizophyllum commune H4-8
ref|XP_003036454.1|  hypothetical protein SCHCODRAFT_12537            62.0    2e-08   Schizophyllum commune H4-8
ref|XP_007675790.1|  hypothetical protein BAUCODRAFT_450434           62.0    2e-08   Baudoinia panamericana UAMH 10762
emb|CDK25966.1|  unnamed protein product                              62.0    2e-08   Kuraishia capsulata CBS 1993
emb|CCM02497.1|  predicted protein                                    62.0    2e-08   Fibroporia radiculosa
emb|CEI98845.1|  Putative Glucose-6-phosphate 1-dehydrogenase         62.0    2e-08   Rhizopus microsporus
emb|CEI99397.1|  Putative Glucose-6-phosphate 1-dehydrogenase         62.0    2e-08   Rhizopus microsporus
emb|CEG74632.1|  Putative Glucose-6-phosphate 1-dehydrogenase         62.0    2e-08   Rhizopus microsporus
emb|CEG79627.1|  Putative Glucose-6-phosphate 1-dehydrogenase         62.0    2e-08   Rhizopus microsporus
ref|XP_504275.1|  YALI0E22649p                                        62.0    2e-08   Yarrowia lipolytica CLIB122
gb|EME43509.1|  glucose-6-phosphate dehydrogenase-like protein        62.0    3e-08   Dothistroma septosporum NZE10
emb|CDM31934.1|  Glucose-6-phosphate 1-dehydrogenase                  62.0    3e-08   Penicillium roqueforti FM164
gb|EDK39626.2|  hypothetical protein PGUG_03724                       62.0    3e-08   Meyerozyma guilliermondii ATCC 6260
ref|XP_001484343.1|  hypothetical protein PGUG_03724                  62.0    3e-08   Meyerozyma guilliermondii ATCC 6260
dbj|GAA99092.1|  hypothetical protein E5Q_05781                       62.0    3e-08   Mixia osmundae IAM 14324
ref|XP_007366094.1|  glucose-6-P dehydrogenase                        62.0    3e-08   Dichomitus squalens LYAD-421 SS1
ref|XP_008035704.1|  glucose-6-P dehydrogenase                        62.0    3e-08   Trametes versicolor FP-101664 SS1
gb|EJU06130.1|  glucose-6-P dehydrogenase                             61.6    3e-08   Dacryopinax primogenitus
emb|CDR40666.1|  CYFA0S05e03048g1_1                                   61.6    3e-08   Cyberlindnera fabianii
gb|ABF29698.1|  glucose-6-phosphate dehydrogenase                     57.0    3e-08   Populus suaveolens [Mongolian poplar]
gb|KDQ28957.1|  hypothetical protein PLEOSDRAFT_1088946               61.6    3e-08   Pleurotus ostreatus PC15
ref|XP_002953022.1|  hypothetical protein VOLCADRAFT_82038            61.6    4e-08   Volvox carteri f. nagariensis
ref|XP_007844618.1|  glucose-6-phosphate 1-dehydrogenase              61.2    4e-08   
gb|KDN50955.1|  hypothetical protein RSAG8_00584                      61.2    4e-08   Rhizoctonia solani AG-8 WAC10335
ref|XP_001386049.2|  Glucose-6-phosphate 1-dehydrogenase              61.2    4e-08   Scheffersomyces stipitis CBS 6054
gb|KJA30260.1|  hypothetical protein HYPSUDRAFT_32409                 61.2    4e-08   Hypholoma sublateritium FD-334 SS-4
emb|CCW67650.1|  unnamed protein product                              61.6    4e-08   Phytomonas sp. isolate Hart1
ref|XP_007927065.1|  hypothetical protein MYCFIDRAFT_56496            61.2    4e-08   Pseudocercospora fijiensis CIRAD86
gb|AGG11544.1|  hypothetical protein                                  61.2    4e-08   Paratrypanosoma confusum
ref|XP_007303038.1|  glucose-6-P dehydrogenase                        61.2    4e-08   Stereum hirsutum FP-91666 SS1
gb|EUC57752.1|  glucose-6-phosphate 1-dehydrogenase                   61.2    4e-08   Rhizoctonia solani AG-3 Rhs1AP
gb|EXU96667.1|  glucose-6-phosphate 1-dehydrogenase                   61.2    4e-08   Metarhizium robertsii
ref|XP_007813860.1|  Glucose-6-phosphate 1-dehydrogenase (G6PD)       61.2    4e-08   Metarhizium acridum CQMa 102
gb|KDO81817.1|  hypothetical protein CISIN_1g007745mg                 61.2    4e-08   Citrus sinensis [apfelsine]
ref|XP_006484164.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  61.2    4e-08   Citrus sinensis [apfelsine]
gb|KDO81818.1|  hypothetical protein CISIN_1g007745mg                 61.2    4e-08   Citrus sinensis [apfelsine]
ref|XP_006484163.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  61.2    4e-08   Citrus sinensis [apfelsine]
gb|AAM64231.1|  glucose-6-phosphate dehydrogenase                     60.8    5e-08   Leishmania braziliensis
emb|CDJ50721.1|  Glucose-6-phosphate dehydrogenase, putative          61.2    5e-08   Eimeria brunetti
gb|KIW09381.1|  glucose-6-phosphate 1-dehydrogenase                   60.8    5e-08   Verruconis gallopava
emb|CCW60472.1|  unnamed protein product                              60.8    6e-08   Phytomonas sp. isolate EM1
gb|KIY71411.1|  glucose-6-phosphate 1-dehydrogenase                   60.8    6e-08   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_006856289.1|  hypothetical protein AMTR_s00047p00095590        60.8    6e-08   
ref|XP_002618411.1|  hypothetical protein CLUG_01870                  60.8    6e-08   Clavispora lusitaniae ATCC 42720
gb|AAM64230.1|  glucose-6-phosphate dehydrogenase                     60.8    6e-08   Leishmania guyanensis
ref|XP_010698232.1|  glucose-6-phosphate 1-dehydrogenase, putative    60.8    6e-08   Leishmania panamensis
gb|ABU25158.1|  glucose-6-phosphate dehydrogenase                     60.8    6e-08   Leishmania braziliensis
emb|CCF50078.1|  probable ZWF1-glucose-6-phosphate dehydrogenase      60.5    6e-08   Ustilago hordei
gb|ABU25155.1|  glucose-6-phosphate dehydrogenase                     60.8    6e-08   Leishmania braziliensis
gb|EST09242.1|  glucose-6-phosphate 1-dehydrogenase                   60.5    6e-08   Kalmanozyma brasiliensis GHG001
dbj|GAC95954.1|  glucose-6-phosphate 1-dehydrogenase                  60.5    6e-08   Pseudozyma hubeiensis SY62
dbj|GAK68546.1|  glucose-6-phosphate 1-dehydrogenase                  60.5    6e-08   Moesziomyces antarcticus
gb|ETS65312.1|  hypothetical protein PaG_00039                        60.5    6e-08   Moesziomyces aphidis DSM 70725
ref|XP_001564303.1|  putative glucose-6-phosphate 1-dehydrogenase     60.8    7e-08   Leishmania braziliensis MHOM/BR/75/M2904
gb|KDE06469.1|  glucose-6-phosphate 1-dehydrogenase                   60.5    7e-08   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_003658684.1|  hypothetical protein MYCTH_2074905               60.5    7e-08   Thermothelomyces thermophila ATCC 42464
ref|XP_007797055.1|  putative glucose-6-phosphate 1-dehydrogenase...  60.5    7e-08   
emb|CDH60320.1|  glucose-6-phosphate 1-dehydrogenase                  60.5    8e-08   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001553624.1|  glucose-6-phosphate 1-dehydrogenase              60.5    8e-08   
gb|EMR87423.1|  putative glucose-6-phosphate 1-dehydrogenase protein  60.5    8e-08   Botrytis cinerea BcDW1
ref|XP_001586308.1|  hypothetical protein SS1G_12886                  60.5    8e-08   Sclerotinia sclerotiorum 1980 UF-70
gb|EEQ88494.1|  glucose-6-phosphate dehydrogenase                     60.1    8e-08   Blastomyces dermatitidis ER-3
gb|EPY38481.1|  glucose-6-phosphate 1-dehydrogenase                   60.5    8e-08   Angomonas deanei
gb|KEF59847.1|  glucose-6-phosphate 1-dehydrogenase                   60.5    8e-08   Exophiala aquamarina CBS 119918
gb|EEH37712.2|  glucose-6-phosphate 1-dehydrogenase                   60.1    9e-08   Paracoccidioides lutzii Pb01
gb|EPY24927.1|  glucose-6-phosphate 1-dehydrogenase                   60.5    9e-08   Angomonas deanei
ref|XP_010759358.1|  glucose-6-phosphate 1-dehydrogenase              60.1    9e-08   
ref|XP_011391249.1|  putative glucose-6-phosphate dehydrogenase       60.1    9e-08   
gb|KIW65158.1|  glucose-6-phosphate 1-dehydrogenase                   60.1    9e-08   
gb|EEH10762.1|  glucose-6-phosphate 1-dehydrogenase                   60.1    9e-08   
ref|XP_002627278.1|  glucose-6-phosphate dehydrogenase                60.1    9e-08   
ref|XP_002796774.1|  glucose-6-phosphate 1-dehydrogenase              60.1    9e-08   
gb|EPS59088.1|  glucose-6-phosphate 1-dehydrogenase                   58.9    9e-08   
gb|ABU25161.1|  glucose-6-phosphate dehydrogenase                     60.1    9e-08   
ref|XP_003850503.1|  glucose-6-phosphate 1-dehydrogenase              60.1    9e-08   
ref|XP_002508505.1|  glucose-6-phosphate dehydrogenase (G6PDH) ch...  60.1    1e-07   
dbj|GAD99664.1|  glucose-6-phosphate dehydrogenase                    60.1    1e-07   
gb|ESZ98899.1|  glucose-6-phosphate 1-dehydrogenase                   60.1    1e-07   
emb|CCC51196.1|  putative glucose-6-phosphate 1-dehydrogenase         60.1    1e-07   
ref|XP_007826807.1|  Glucose-6-phosphate 1-dehydrogenase              60.1    1e-07   
gb|KIJ20036.1|  glucose-6-phosphate dehydrogenase                     60.1    1e-07   
emb|CDY65677.1|  BnaCnng48180D                                        60.1    1e-07   
gb|KFH66056.1|  glucose-6-phosphate dehydrogenase                     60.1    1e-07   
ref|XP_009108011.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  60.1    1e-07   
emb|CDY69162.1|  BnaA08g30000D                                        60.1    1e-07   
gb|KFZ13365.1|  hypothetical protein V501_03740                       60.1    1e-07   
gb|KFY72892.1|  hypothetical protein V499_06992                       60.1    1e-07   
gb|KFY27792.1|  hypothetical protein V493_03303                       60.1    1e-07   
gb|KFY21648.1|  hypothetical protein V491_02954                       60.1    1e-07   
gb|ELR06288.1|  glucose-6-phosphate 1-dehydrogenase                   60.1    1e-07   
gb|KFY82642.1|  hypothetical protein V500_10412                       60.1    1e-07   
gb|KFY53960.1|  hypothetical protein V496_07359                       60.1    1e-07   
ref|XP_004338851.1|  glucose6-phosphate dehydrogenase, C-terminal...  60.1    1e-07   
gb|EZF22128.1|  glucose-6-phosphate 1-dehydrogenase                   60.1    1e-07   
ref|XP_010689260.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-6-ph...  60.1    1e-07   
gb|EZF29406.1|  glucose-6-phosphate 1-dehydrogenase                   60.1    1e-07   
gb|EGE08291.1|  glucose-6-phosphate 1-dehydrogenase                   60.1    1e-07   
ref|XP_002153443.1|  glucose-6-phosphate 1-dehydrogenase              60.1    1e-07   
ref|XP_003235653.1|  glucose-6-phosphate 1-dehydrogenase              60.1    1e-07   
gb|EZF22127.1|  glucose-6-phosphate 1-dehydrogenase                   60.1    1e-07   
ref|XP_003177916.1|  glucose-6-phosphate 1-dehydrogenase              60.1    1e-07   
ref|XP_002846249.1|  glucose-6-phosphate 1-dehydrogenase              60.1    1e-07   
gb|KIV85400.1|  glucose-6-phosphate 1-dehydrogenase                   60.1    1e-07   
ref|XP_002153442.1|  glucose-6-phosphate 1-dehydrogenase              60.1    1e-07   
gb|EYE99262.1|  glucose-6-phosphate dehydrogenase                     60.1    1e-07   
ref|XP_008720459.1|  glucose-6-phosphate 1-dehydrogenase              60.1    1e-07   
ref|XP_009154713.1|  glucose-6-phosphate 1-dehydrogenase              60.1    1e-07   
gb|ESW98231.1|  Glucose-6-phosphate 1-dehydrogenase                   60.1    1e-07   
gb|EPY27977.1|  glucose-6-phosphate 1-dehydrogenase                   60.1    1e-07   
gb|EHL03590.1|  putative Glucose-6-phosphate 1-dehydrogenase          59.7    1e-07   
emb|CDJ45268.1|  Glucose-6-phosphate dehydrogenase, putative          60.1    1e-07   
ref|XP_003656652.1|  hypothetical protein THITE_2121584               59.7    1e-07   
ref|XP_008083786.1|  Glyceraldehyde-3-phosphate dehydrogenase-lik...  59.7    1e-07   
gb|KIW48425.1|  glucose-6-phosphate 1-dehydrogenase, variant 1        60.1    1e-07   
gb|KFY10292.1|  hypothetical protein V492_05083                       59.7    1e-07   
gb|KFX94519.1|  hypothetical protein V490_04317                       59.7    1e-07   
gb|KIW48424.1|  glucose-6-phosphate 1-dehydrogenase                   60.1    1e-07   
gb|KIN04797.1|  hypothetical protein OIDMADRAFT_177161                59.7    1e-07   
gb|KFZ18866.1|  hypothetical protein V502_03919                       59.7    1e-07   
ref|XP_008601372.1|  Glucose-6-phosphate 1-dehydrogenase (G6PD)       59.7    1e-07   
ref|XP_001876685.1|  glucose-6-P dehydrogenase                        59.7    1e-07   
gb|AAO37825.1|  glucose-6-phosphate dehydrogenase                     59.7    1e-07   
ref|XP_003054102.1|  predicted protein                                59.7    1e-07   
gb|ABB29861.1|  glucose-6-phosphate dehydrogenase                     58.5    1e-07   
gb|KDD76630.1|  glucose-6-phosphate dehydrogenase                     60.1    1e-07   
ref|XP_007781879.1|  glucose-6-phosphate 1-dehydrogenase              59.7    1e-07   
ref|XP_003681492.1|  hypothetical protein TDEL_0E00380                59.7    1e-07   
ref|XP_007586024.1|  putative glucose-6-phosphate 1-dehydrogenase...  59.7    1e-07   
gb|EKG15888.1|  Glucose-6-phosphate dehydrogenase                     59.7    1e-07   
gb|EWY94633.1|  glucose-6-phosphate 1-dehydrogenase                   59.7    1e-07   
emb|CCT62016.1|  probable ZWF1-glucose-6-phosphate dehydrogenase      59.7    1e-07   
ref|XP_006672184.1|  glucose-6-phosphate 1-dehydrogenase (G6PD)       59.7    1e-07   
gb|KFK28285.1|  hypothetical protein AALP_AA8G496500                  59.7    1e-07   
gb|EWG38068.1|  glucose-6-phosphate 1-dehydrogenase                   59.7    1e-07   
gb|EMT66692.1|  Glucose-6-phosphate 1-dehydrogenase                   59.7    1e-07   
gb|KFK28284.1|  hypothetical protein AALP_AA8G496500                  59.7    1e-07   
gb|EQK99957.1|  Glucose-6-phosphate 1-dehydrogenase (G6PD)            59.7    1e-07   
ref|XP_009262982.1|  hypothetical protein FPSE_11590                  59.7    1e-07   
gb|EGU89257.1|  hypothetical protein FOXB_00210                       59.7    1e-07   
ref|XP_002985871.1|  hypothetical protein SELMODRAFT_123209           59.7    1e-07   
gb|KHN98497.1|  Glucose-6-phosphate 1-dehydrogenase (G6PD)            59.3    2e-07   
gb|EMD40697.1|  glucose-6-P dehydrogenase                             59.3    2e-07   
ref|XP_002487987.1|  glucose-6-phosphate 1-dehydrogenase              59.3    2e-07   
ref|XP_003886318.1|  Glucose-6-phosphate 1-dehydrogenase, related     59.7    2e-07   
ref|XP_002487986.1|  glucose-6-phosphate 1-dehydrogenase              59.3    2e-07   
ref|XP_003324177.2|  glucose-6-phosphate 1-dehydrogenase              59.3    2e-07   
emb|CEL59540.1|  glucose-6-phosphate 1-dehydrogenase                  59.3    2e-07   
ref|XP_010440771.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  59.3    2e-07   
gb|KIK68146.1|  hypothetical protein GYMLUDRAFT_36984                 59.3    2e-07   
gb|KIW56270.1|  glucose-6-phosphate 1-dehydrogenase                   59.3    2e-07   
gb|KEZ44640.1|  hypothetical protein SAPIO_CDS3683                    59.3    2e-07   
ref|XP_007290452.1|  glucose-6-phosphate 1-dehydrogenase              59.3    2e-07   
gb|KIV90068.1|  glucose-6-phosphate 1-dehydrogenase                   59.3    2e-07   
ref|XP_005538340.1|  glucose-6-phosphate 1-dehydrogenase              59.3    2e-07   
gb|KGQ05055.1|  Glucose-6-phosphate 1-dehydrogenase                   59.7    2e-07   
emb|CCE33070.1|  probable ZWF1-glucose-6-phosphate dehydrogenase      59.3    2e-07   
gb|KDB16687.1|  glucose-6-phosphate 1-dehydrogenase (G6PD)            59.3    2e-07   
ref|XP_644436.1|  glucose 6-phosphate-1-dehydrogenase                 59.3    2e-07   
ref|XP_006283407.1|  hypothetical protein CARUB_v10004456mg           59.3    2e-07   
gb|KIM67979.1|  hypothetical protein SCLCIDRAFT_20930                 59.3    2e-07   
gb|AGC59688.1|  glucose-6-phosphate dehydrogenase                     59.3    2e-07   
gb|AGC59689.1|  glucose-6-phosphate dehydrogenase                     59.3    2e-07   
gb|AFK80084.1|  glucose-6-phosphate dehydrogenase                     59.3    2e-07   
gb|AFK80081.1|  glucose-6-phosphate dehydrogenase                     58.9    2e-07   
gb|AAM64228.1|  glucose-6-phosphate dehydrogenase                     59.3    2e-07   
ref|XP_003878591.1|  glucose-6-phosphate dehydrogenase                59.3    2e-07   
gb|KIL94511.1|  hypothetical protein FAVG1_01442                      59.7    2e-07   
emb|CDI75554.1|  Glucose-6-phosphate dehydrogenase, putative          59.3    2e-07   
ref|XP_003057294.1|  predicted protein                                58.9    2e-07   
ref|XP_006688815.1|  hypothetical protein CANTEDRAFT_115211           58.9    2e-07   
dbj|GAM40962.1|  glucose-6-phosphate dehydrogenase                    59.3    2e-07   
gb|KJB45478.1|  hypothetical protein B456_007G308400                  58.9    2e-07   
gb|ERZ94769.1|  hypothetical protein GLOINDRAFT_14299                 58.9    2e-07   
gb|ABF20355.1|  glucose-6-phosphate dehydrogenase                     58.9    2e-07   
gb|KIW83475.1|  glucose-6-phosphate 1-dehydrogenase                   58.9    2e-07   
ref|XP_007773393.1|  glucose-6-phosphate 1-dehydrogenase              58.9    2e-07   
ref|XP_011401316.1|  Glucose-6-phosphate 1-dehydrogenase, cytopla...  58.9    2e-07   
gb|EXX65827.1|  glucose-6-phosphate dehydrogenase                     58.9    2e-07   
emb|CCO26477.1|  glucose-6-phosphate 1-dehydrogenase                  58.2    3e-07   
ref|XP_001468395.1|  putative glucose-6-phosphate 1-dehydrogenase     58.9    3e-07   
gb|ABF20370.1|  glucose-6-phosphate dehydrogenase                     58.9    3e-07   
ref|XP_010926813.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  58.9    3e-07   
gb|ERS99847.1|  glucose-6-phosphate 1-dehydrogenase                   58.9    3e-07   
ref|XP_010926812.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  58.9    3e-07   
gb|ABF20345.1|  glucose-6-phosphate dehydrogenase                     58.9    3e-07   
emb|CDP16815.1|  unnamed protein product                              58.9    3e-07   
gb|KHJ36071.1|  putative glucose-6-phosphate 1-dehydrogenase          58.9    3e-07   
gb|ABF20357.1|  glucose-6-phosphate dehydrogenase                     58.9    3e-07   
ref|XP_002946469.1|  hypothetical protein VOLCADRAFT_103053           58.9    3e-07   
gb|EFW99489.1|  glucose-6-phosphate 1-dehydrogenase                   58.9    3e-07   
gb|KIK97152.1|  hypothetical protein PAXRUDRAFT_825242                58.9    3e-07   
gb|EGZ77304.1|  glucose-6-phosphate 1-dehydrogenase                   58.5    3e-07   
ref|XP_009856121.1|  glucose-6-phosphate 1-dehydrogenase              58.5    3e-07   
gb|KJB45477.1|  hypothetical protein B456_007G308400                  58.9    3e-07   
gb|KIX98810.1|  glucose-6-phosphate 1-dehydrogenase                   58.5    3e-07   
gb|KIW23137.1|  glucose-6-phosphate 1-dehydrogenase                   58.5    3e-07   
ref|XP_007741206.1|  glucose-6-phosphate 1-dehydrogenase              58.5    3e-07   
ref|XP_007759206.1|  glucose-6-phosphate 1-dehydrogenase              58.5    3e-07   
ref|XP_008725659.1|  glucose-6-phosphate 1-dehydrogenase              58.5    3e-07   
ref|XP_001240498.1|  glucose-6-phosphate 1-dehydrogenase              58.5    3e-07   
emb|CCF40221.1|  glucose-6-phosphate 1-dehydrogenase                  58.5    3e-07   
gb|AFK80095.1|  glucose-6-phosphate dehydrogenase                     58.5    3e-07   
gb|AFK80087.1|  glucose-6-phosphate dehydrogenase                     58.5    3e-07   
gb|KGO75318.1|  Glucose-6-phosphate dehydrogenase, C-terminal         58.5    3e-07   
gb|KGO48477.1|  Glucose-6-phosphate dehydrogenase, NAD-binding        58.5    3e-07   
ref|XP_002562885.1|  Pc20g03330                                       58.5    3e-07   
ref|XP_006696085.1|  glucose-6-phosphate 1-dehydrogenase-like pro...  58.5    3e-07   
gb|ABF20372.1|  glucose-6-phosphate dehydrogenase                     58.5    3e-07   
gb|KIP10615.1|  hypothetical protein PHLGIDRAFT_18276                 58.5    3e-07   
gb|AFK80082.1|  glucose-6-phosphate dehydrogenase                     58.5    3e-07   
ref|XP_007802098.1|  Glucose-6-phosphate 1-dehydrogenase              58.5    3e-07   
gb|AFK80093.1|  glucose-6-phosphate dehydrogenase                     58.5    3e-07   
gb|AGC59686.1|  glucose-6-phosphate dehydrogenase                     58.5    3e-07   
ref|XP_007277825.1|  glucose-6-phosphate 1-dehydrogenase              58.5    3e-07   
ref|XP_009228395.1|  glucose-6-phosphate 1-dehydrogenase              58.5    3e-07   
gb|EFQ26538.1|  glucose-6-phosphate dehydrogenase                     58.5    3e-07   
gb|KDN67038.1|  putative glucose-6-phosphate dehydrogenase            58.5    3e-07   
ref|XP_007601965.1|  glucose-6-phosphate dehydrogenase                58.5    3e-07   
gb|ENH88546.1|  glucose-6-phosphate 1-dehydrogenase                   58.5    3e-07   
ref|XP_001908619.1|  hypothetical protein                             58.5    3e-07   
ref|XP_003710026.1|  glucose-6-phosphate 1-dehydrogenase              58.5    3e-07   
ref|XP_007917239.1|  putative glucose-6-phosphate 1-dehydrogenase...  58.5    3e-07   
ref|XP_006841593.1|  hypothetical protein AMTR_s00003p00202580        58.5    3e-07   
emb|CDH57592.1|  glucose-6-phosphate 1-dehydrogenase                  58.5    3e-07   
gb|EHK40650.1|  hypothetical protein TRIATDRAFT_311245                58.5    3e-07   
ref|XP_754767.1|  glucose-6-phosphate 1-dehydrogenase                 58.5    4e-07   
ref|XP_001263592.1|  glucose-6-phosphate 1-dehydrogenase              58.5    4e-07   
gb|EPS26984.1|  hypothetical protein PDE_01924                        58.5    4e-07   
ref|XP_001270867.1|  glucose-6-phosphate 1-dehydrogenase              58.5    4e-07   
gb|KIW19721.1|  glucose-6-phosphate 1-dehydrogenase                   58.5    4e-07   
ref|XP_007724264.1|  glucose-6-phosphate 1-dehydrogenase              58.5    4e-07   
gb|KEQ61783.1|  glucose-6-phosphate dehydrogenase                     58.5    4e-07   
gb|EKV19270.1|  Glucose-6-phosphate 1-dehydrogenase                   58.2    4e-07   
ref|XP_002984807.1|  hypothetical protein SELMODRAFT_156908           58.2    4e-07   
ref|XP_001799710.1|  hypothetical protein SNOG_09416                  58.2    4e-07   
ref|XP_002497882.1|  ZYRO0F15686p                                     58.2    4e-07   
emb|CAQ43421.1|  Glucose-6-phosphate 1-dehydrogenase                  58.2    4e-07   
ref|XP_005846848.1|  hypothetical protein CHLNCDRAFT_134643           58.2    4e-07   
ref|XP_008023154.1|  hypothetical protein SETTUDRAFT_167861           58.2    4e-07   
ref|XP_003844503.1|  similar to glucose-6-phosphate 1-dehydrogenase   58.2    4e-07   
ref|XP_003306338.1|  hypothetical protein PTT_19468                   58.2    4e-07   
ref|XP_001931341.1|  glucose-6-phosphate 1-dehydrogenase              58.2    4e-07   
dbj|BAI63218.1|  chloroplastic glucose 6-phosphate dehydrogenase      58.2    4e-07   
ref|XP_002840251.1|  hypothetical protein                             58.2    4e-07   
ref|XP_001686097.1|  putative glucose-6-phosphate 1-dehydrogenase     58.2    4e-07   
ref|XP_006963364.1|  glucose-6-phosphate dehydrogenase                58.2    4e-07   
ref|XP_004200786.1|  Piso0_003393                                     58.2    5e-07   
gb|EPX74850.1|  glucose-6-phosphate 1-dehydrogenase                   58.2    5e-07   
ref|XP_009310298.1|  glucose-6-phosphate 1-dehydrogenase              58.2    5e-07   
ref|XP_009649230.1|  glucose-6-phosphate 1-dehydrogenase              58.2    5e-07   
gb|KEY67503.1|  hypothetical protein S7711_02423                      58.2    5e-07   
ref|XP_011092185.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  58.2    5e-07   
gb|KFA62843.1|  hypothetical protein S40285_08182                     58.2    5e-07   
ref|XP_007686240.1|  hypothetical protein COCMIDRAFT_24853            58.2    5e-07   
ref|XP_007707563.1|  hypothetical protein COCCADRAFT_1134             58.2    5e-07   
gb|EMD91956.1|  hypothetical protein COCHEDRAFT_1020991               58.2    5e-07   
ref|XP_007696630.1|  hypothetical protein COCSADRAFT_34503            58.2    5e-07   
gb|KDP23353.1|  hypothetical protein JCGZ_23186                       58.2    5e-07   
gb|EPS95349.1|  hypothetical protein FOMPIDRAFT_1025831               57.8    5e-07   
dbj|GAM22896.1|  hypothetical protein SAMD00019534_060710             57.8    5e-07   
gb|KDO36398.1|  hypothetical protein CISIN_1g043082mg                 55.5    5e-07   
ref|XP_002986239.1|  hypothetical protein SELMODRAFT_446525           58.5    5e-07   
ref|XP_003670953.1|  hypothetical protein NDAI_0F03920                57.8    5e-07   
ref|XP_007732341.1|  glucose-6-phosphate 1-dehydrogenase              57.8    5e-07   
ref|XP_010069726.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  58.2    5e-07   
emb|CAA04696.1|  plastidic glucose-6-phosphate dehydrogenase          58.2    5e-07   
ref|XP_006395930.1|  hypothetical protein EUTSA_v10003851mg           58.2    5e-07   
ref|XP_003956538.1|  hypothetical protein KAFR_0C04120                57.8    5e-07   
gb|KIX02896.1|  glucose-6-phosphate 1-dehydrogenase                   57.8    6e-07   
gb|KDO58387.1|  hypothetical protein CISIN_1g031209mg                 55.1    6e-07   
emb|CBQ69342.1|  probable ZWF1-glucose-6-phosphate dehydrogenase      57.8    6e-07   
gb|EJT44922.1|  ZWF1-like protein                                     57.8    6e-07   
ref|XP_002985058.1|  hypothetical protein SELMODRAFT_446107           58.2    6e-07   
gb|KEH15444.1|  glucose-6-phosphate 1-dehydrogenase                   55.1    6e-07   
ref|XP_007005699.1|  hypothetical protein TREMEDRAFT_44656            57.8    6e-07   
gb|EIE92264.1|  glucose-6-phosphate dehydrogenase                     57.8    6e-07   
ref|XP_006375565.1|  hypothetical protein POPTR_0014s16480g           57.4    6e-07   
gb|KIL70041.1|  hypothetical protein M378DRAFT_156103                 57.8    6e-07   
gb|AGG11624.1|  hypothetical protein                                  57.8    6e-07   
emb|CEJ82195.1|  Putative Glucose-6-phosphate 1-dehydrogenase         57.8    6e-07   
ref|XP_011010201.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  57.8    6e-07   
emb|CEJ82194.1|  Putative Glucose-6-phosphate 1-dehydrogenase         57.8    6e-07   
emb|CEJ82193.1|  Putative Glucose-6-phosphate 1-dehydrogenase         57.8    6e-07   
ref|XP_010929559.1|  PREDICTED: glucose-6-phosphate 1-dehydrogena...  57.8    7e-07   
ref|XP_004181483.1|  hypothetical protein TBLA_0G00130                57.8    7e-07   
gb|KDO58386.1|  hypothetical protein CISIN_1g031209mg                 55.1    7e-07   
ref|XP_008775147.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-6-ph...  57.8    7e-07   



>ref|NP_001275397.1| glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform [Solanum 
tuberosum]
 gb|ABB55386.1| glucose-6-phosphate 1-dehydrogenase cytoplasmic isoform-like 
[Solanum tuberosum]
Length=511

 Score =   126 bits (317),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQS  415
            +A WC+EKRG + NDSF D + + ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFLQS
Sbjct  2    AASWCIEKRGSIRNDSFRDNDNIPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQS  61

Query  416  NDVHIFGYAR  445
            N+VHIFGYAR
Sbjct  62   NEVHIFGYAR  71



>sp|P37830.1|G6PD_SOLTU RecName: Full=Glucose-6-phosphate 1-dehydrogenase, cytoplasmic 
isoform; Short=G6PD [Solanum tuberosum]
 emb|CAA52442.1| glucose-6-phosphate 1-dehydrogenase [Solanum tuberosum]
Length=511

 Score =   126 bits (317),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQS  415
            +A WC+EKRG + NDSF D + + ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFLQS
Sbjct  2    AASWCIEKRGSIRNDSFRDNDNIPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQS  61

Query  416  NDVHIFGYAR  445
            N+VHIFGYAR
Sbjct  62   NEVHIFGYAR  71



>ref|XP_006338664.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006338665.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006338666.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006338667.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X4 [Solanum tuberosum]
 ref|XP_006338668.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X5 [Solanum tuberosum]
Length=511

 Score =   126 bits (317),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQS  415
            +A WC+EKRG + NDSF D + + ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFLQS
Sbjct  2    AASWCIEKRGSIRNDSFRDNDNIPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQS  61

Query  416  NDVHIFGYAR  445
            N+VHIFGYAR
Sbjct  62   NEVHIFGYAR  71



>ref|XP_004231802.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Solanum lycopersicum]
 ref|XP_004231803.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Solanum lycopersicum]
 ref|XP_010315937.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Solanum lycopersicum]
Length=511

 Score =   126 bits (317),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQS  415
            +A WC+EKRG + NDSF D + + ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFLQS
Sbjct  2    AASWCIEKRGSIRNDSFRDNDNIPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQS  61

Query  416  NDVHIFGYAR  445
            N+VHIFGYAR
Sbjct  62   NEVHIFGYAR  71



>ref|XP_009601968.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Nicotiana tomentosiformis]
 ref|XP_009601969.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Nicotiana tomentosiformis]
 ref|XP_009601970.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Nicotiana tomentosiformis]
 ref|XP_009601971.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Nicotiana tomentosiformis]
Length=511

 Score =   122 bits (307),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQS  415
            +A WC+EKRG +  DSF D + + ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFLQS
Sbjct  2    AASWCIEKRGSIRLDSFRDNDNIPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQS  61

Query  416  NDVHIFGYAR  445
            N+VHIFGYAR
Sbjct  62   NEVHIFGYAR  71



>emb|CAA04993.1| glucose-6-phosphate dehydrogenase [Nicotiana tabacum]
Length=511

 Score =   122 bits (307),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQS  415
            +A WC+EKRG +  DSF D + + ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFLQS
Sbjct  2    AASWCIEKRGSIRLDSFRDNDNIPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQS  61

Query  416  NDVHIFGYAR  445
            N+VHIFGYAR
Sbjct  62   NEVHIFGYAR  71



>ref|XP_009774777.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Nicotiana sylvestris]
 ref|XP_009774778.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Nicotiana sylvestris]
 ref|XP_009774779.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Nicotiana sylvestris]
 ref|XP_009774780.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Nicotiana sylvestris]
Length=510

 Score =   120 bits (301),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQS  415
            +A WC+EKRG +  DSF + + + ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFLQS
Sbjct  2    AASWCIEKRGSLRLDSFRENDNIPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQS  61

Query  416  NDVHIFGYAR  445
            N+VHIFGYAR
Sbjct  62   NEVHIFGYAR  71



>emb|CAA04992.1| glucose-6-phosphate dehydrogenase [Nicotiana tabacum]
Length=510

 Score =   120 bits (301),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQS  415
            +A WC+EKRG +  DSF + + + ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFLQS
Sbjct  2    AASWCIEKRGSLRLDSFRENDNIPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQS  61

Query  416  NDVHIFGYAR  445
            N+VHIFGYAR
Sbjct  62   NEVHIFGYAR  71



>dbj|BAK22407.1| glucose-6-phosphate dehydrogenase [Nicotiana benthamiana]
Length=511

 Score =   120 bits (301),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQS  415
            +A WC+EKRG +  DSF + + + ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFLQS
Sbjct  2    AASWCIEKRGSLRLDSFRENDNIPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQS  61

Query  416  NDVHIFGYAR  445
            N+VHIFGYAR
Sbjct  62   NEVHIFGYAR  71



>gb|KDO42046.1| hypothetical protein CISIN_1g010132mg [Citrus sinensis]
Length=281

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW +EKR  + NDSF+ D + V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWIMEKRSSLRNDSFSRDNDNVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            LQSN+VHIFGYAR
Sbjct  61   LQSNEVHIFGYAR  73



>gb|KDO42045.1| hypothetical protein CISIN_1g010132mg [Citrus sinensis]
Length=299

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW +EKR  + NDSF+ D + V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWIMEKRSSLRNDSFSRDNDNVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            LQSN+VHIFGYAR
Sbjct  61   LQSNEVHIFGYAR  73



>gb|KDO42044.1| hypothetical protein CISIN_1g010132mg [Citrus sinensis]
Length=356

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW +EKR  + NDSF+ D + V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWIMEKRSSLRNDSFSRDNDNVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            LQSN+VHIFGYAR
Sbjct  61   LQSNEVHIFGYAR  73



>ref|XP_006447163.1| hypothetical protein CICLE_v10015153mg [Citrus clementina]
 gb|ESR60403.1| hypothetical protein CICLE_v10015153mg [Citrus clementina]
Length=464

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW +EKR  + NDSF+ D + V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWIMEKRSSLRNDSFSRDNDNVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            LQSN+VHIFGYAR
Sbjct  61   LQSNEVHIFGYAR  73



>ref|XP_006469975.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Citrus sinensis]
Length=516

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW +EKR  + NDSF+ D + V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWIMEKRSSLRNDSFSRDNDNVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            LQSN+VHIFGYAR
Sbjct  61   LQSNEVHIFGYAR  73



>gb|KDO42043.1| hypothetical protein CISIN_1g010132mg [Citrus sinensis]
Length=517

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW +EKR  + NDSF+ D + V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWIMEKRSSLRNDSFSRDNDNVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            LQSN+VHIFGYAR
Sbjct  61   LQSNEVHIFGYAR  73



>ref|XP_004161667.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-phosphate 1-dehydrogenase, 
cytoplasmic isoform-like [Cucumis sativus]
Length=516

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            MES  W VEKR  + NDSF   + V ETGCLSIVVLGASGDLAKKKTFPALF+L+ QGFL
Sbjct  1    MESGSWHVEKRSSLRNDSFTGEDNVPETGCLSIVVLGASGDLAKKKTFPALFHLFVQGFL  60

Query  410  QSNDVHIFGYAR  445
            QSN+VHIFGYAR
Sbjct  61   QSNEVHIFGYAR  72



>ref|XP_008442193.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Cucumis melo]
 ref|XP_008442194.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Cucumis melo]
Length=516

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            MES  W VEKR  + NDSF   + V ETGCLSIVVLGASGDLAKKKTFPALF+L+ QGFL
Sbjct  1    MESGSWHVEKRSSLRNDSFTGEDNVPETGCLSIVVLGASGDLAKKKTFPALFHLFVQGFL  60

Query  410  QSNDVHIFGYAR  445
            QSN+VHIFGYAR
Sbjct  61   QSNEVHIFGYAR  72



>ref|XP_004150984.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Cucumis sativus]
Length=516

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            MES  W VEKR  + NDSF   + V ETGCLSIVVLGASGDLAKKKTFPALF+L+ QGFL
Sbjct  1    MESGSWHVEKRSSLRNDSFTGEDNVPETGCLSIVVLGASGDLAKKKTFPALFHLFVQGFL  60

Query  410  QSNDVHIFGYAR  445
            QSN+VHIFGYAR
Sbjct  61   QSNEVHIFGYAR  72



>ref|XP_011098824.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Sesamum indicum]
 ref|XP_011098825.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Sesamum indicum]
Length=514

 Score =   114 bits (284),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQ  412
            S +W  EKR    N+SFA D E V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFLQ
Sbjct  4    SGEWYCEKRPFSKNESFARDNENVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQ  63

Query  413  SNDVHIFGYAR  445
            SN+VHIFGY+R
Sbjct  64   SNEVHIFGYSR  74



>gb|AFJ00340.1| cytoplasmic glucose-6-phosphate dehydrogenase [Cucumis hystrix]
Length=516

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            MES  W VEKR  + NDSF   + V ETGC+SIVVLGASGDLAKKKTFPALF+L+ QGFL
Sbjct  1    MESGSWHVEKRSSLRNDSFTGEDNVPETGCISIVVLGASGDLAKKKTFPALFHLFVQGFL  60

Query  410  QSNDVHIFGYAR  445
            QSN+VHIFGYAR
Sbjct  61   QSNEVHIFGYAR  72



>gb|KCW55886.1| hypothetical protein EUGRSUZ_I01691 [Eucalyptus grandis]
Length=454

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + +DSF+ DI+ V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWSVEKRSSLRSDSFSKDIDDVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L + +VHIFGYAR
Sbjct  61   LPAEEVHIFGYAR  73



>ref|XP_002266527.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Vitis vinifera]
 ref|XP_010660806.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Vitis vinifera]
 ref|XP_010660807.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Vitis vinifera]
 ref|XP_010660808.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Vitis vinifera]
 ref|XP_010660809.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Vitis vinifera]
 ref|XP_010660810.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Vitis vinifera]
 ref|XP_010660811.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Vitis vinifera]
 emb|CBI40087.3| unnamed protein product [Vitis vinifera]
Length=516

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSF-ADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S+ W VEKR  + +D+F  DI+ V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSSTWSVEKRSGLRSDTFLKDIDNVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L SN+VHIFGYAR
Sbjct  61   LHSNEVHIFGYAR  73



>gb|KCW55885.1| hypothetical protein EUGRSUZ_I01691 [Eucalyptus grandis]
Length=517

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + +DSF+ DI+ V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWSVEKRSSLRSDSFSKDIDDVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L + +VHIFGYAR
Sbjct  61   LPAEEVHIFGYAR  73



>ref|XP_010029040.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Eucalyptus grandis]
 ref|XP_010029041.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Eucalyptus grandis]
 ref|XP_010029042.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Eucalyptus grandis]
 gb|KCW55883.1| hypothetical protein EUGRSUZ_I01691 [Eucalyptus grandis]
 gb|KCW55884.1| hypothetical protein EUGRSUZ_I01691 [Eucalyptus grandis]
Length=517

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + +DSF+ DI+ V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWSVEKRSSLRSDSFSKDIDDVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L + +VHIFGYAR
Sbjct  61   LPAEEVHIFGYAR  73



>ref|XP_011097324.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Sesamum indicum]
 ref|XP_011097325.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Sesamum indicum]
 ref|XP_011097326.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Sesamum indicum]
Length=515

 Score =   111 bits (278),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  AQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQS  415
             +W  EKR    N+SFA D E V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFLQS
Sbjct  5    GEWHCEKRPFAKNESFARDNENVQETGCLSIIVLGASGDLAKKKTFPALFNLYRQGFLQS  64

Query  416  NDVHIFGYAR  445
            N+V+IFGYAR
Sbjct  65   NEVYIFGYAR  74



>gb|KDP46341.1| hypothetical protein JCGZ_10181 [Jatropha curcas]
Length=515

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW +EKR    ++SF  D E V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWSIEKRSNFRSESFGRDSEDVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            LQS++VHIFGYAR
Sbjct  61   LQSHEVHIFGYAR  73



>gb|KJB11615.1| hypothetical protein B456_001G268300 [Gossypium raimondii]
Length=537

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  218  EAFKMESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYH  397
            + +KM S +WC++KR    +DS +  E V ETGCLSI+VLGASGDLAKKKTFPALFNLY 
Sbjct  20   KGYKMGSGKWCLQKRDSFRSDSLSGNENVPETGCLSIIVLGASGDLAKKKTFPALFNLYC  79

Query  398  QGFLQSNDVHIFGYAR  445
            QGFL  ++VHIFGYAR
Sbjct  80   QGFLPPDEVHIFGYAR  95



>gb|AAB69318.1| cytosolic glucose-6-phosphate dehydrogenase 1 [Petroselinum crispum]
Length=495

 Score =   110 bits (276),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S +W +EKR  + NDS    E V E GCLSIVVLGASGDLAKKKTFPALFNLY QGFL
Sbjct  1    MTSDKWSIEKRAPLRNDSVLKEENVPEIGCLSIVVLGASGDLAKKKTFPALFNLYRQGFL  60

Query  410  QSNDVHIFGYAR  445
            QS++V+IFGYAR
Sbjct  61   QSHEVYIFGYAR  72



>ref|XP_006290916.1| hypothetical protein CARUB_v10017030mg [Capsella rubella]
 gb|EOA23814.1| hypothetical protein CARUB_v10017030mg [Capsella rubella]
Length=516

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + NDSF  +   V+ETG LSI+VLGASGDLAKKKTFPALFNLYHQGF
Sbjct  1    MGSGQWHVEKRSTLKNDSFVKEYNPVSETGSLSIIVLGASGDLAKKKTFPALFNLYHQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>ref|XP_009111567.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
1 [Brassica rapa]
 ref|XP_009111568.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
1 [Brassica rapa]
Length=516

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M+S QW VEKR  + N+SF    G V+ETG LSIVVLGASGDLAKKKTFPALFNLYHQGF
Sbjct  1    MDSGQWHVEKRSTLRNESFLKEYGPVSETGSLSIVVLGASGDLAKKKTFPALFNLYHQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>emb|CDY20053.1| BnaA09g01980D [Brassica napus]
Length=515

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M+S QW VEKR  + N+SF    G V+ETG LSIVVLGASGDLAKKKTFPALFNLYHQGF
Sbjct  1    MDSGQWHVEKRSTLRNESFLKEYGPVSETGSLSIVVLGASGDLAKKKTFPALFNLYHQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>gb|ABR45722.1| G6PD1 [Actinidia chinensis]
Length=517

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S  W +EKR    N+SF+ +   V+ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGAWTIEKRSTFRNESFSKEYVTVSETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            LQSN+VHIFGYAR
Sbjct  61   LQSNEVHIFGYAR  73



>emb|CDY00159.1| BnaC09g01420D [Brassica napus]
Length=523

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M+S QW VEKR  + N+SF    G V+ETG LSIVVLGASGDLAKKKTFPALFNLYHQGF
Sbjct  1    MDSGQWHVEKRSTLRNESFLKEYGPVSETGSLSIVVLGASGDLAKKKTFPALFNLYHQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>emb|CDX67476.1| BnaA07g15160D [Brassica napus]
Length=524

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + NDSF    G   ETGCLSIVVLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWHVEKRSTLRNDSFVKESGSAPETGCLSIVVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>ref|XP_006282586.1| hypothetical protein CARUB_v10004603mg [Capsella rubella]
 gb|EOA15484.1| hypothetical protein CARUB_v10004603mg [Capsella rubella]
Length=515

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR    NDSF    G V ETGCLSIVVLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWHVEKRSTFRNDSFVREYGSVPETGCLSIVVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>ref|XP_010450623.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2-like [Camelina sativa]
 ref|XP_010450624.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2-like [Camelina sativa]
Length=517

 Score =   109 bits (273),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQ  412
            S QW VEKR    NDSF    G V ETGCLSIVVLGASGDLAKKKTFPALFNLY QGFL 
Sbjct  5    SGQWHVEKRSTFRNDSFVREYGTVPETGCLSIVVLGASGDLAKKKTFPALFNLYRQGFLN  64

Query  413  SNDVHIFGYAR  445
             ++VHIFGYAR
Sbjct  65   PDEVHIFGYAR  75



>ref|XP_006395458.1| hypothetical protein EUTSA_v10004014mg [Eutrema salsugineum]
 gb|ESQ32744.1| hypothetical protein EUTSA_v10004014mg [Eutrema salsugineum]
Length=516

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + NDSF  D   V+ETG LSI+VLGASGDLAKKKTFPALF+LYHQGF
Sbjct  1    MASCQWHVEKRSSLRNDSFVKDDVPVSETGSLSIIVLGASGDLAKKKTFPALFHLYHQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  N+VHIFGYAR
Sbjct  61   LDQNEVHIFGYAR  73



>ref|XP_006405432.1| hypothetical protein EUTSA_v10027727mg [Eutrema salsugineum]
 gb|ESQ46885.1| hypothetical protein EUTSA_v10027727mg [Eutrema salsugineum]
Length=515

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR    NDSF    G V ETGCLSIVVLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWHVEKRSTFRNDSFVKEYGTVLETGCLSIVVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>ref|NP_189366.1| glucose-6-phosphate dehydrogenase 5 [Arabidopsis thaliana]
 ref|NP_001030780.1| glucose-6-phosphate dehydrogenase 5 [Arabidopsis thaliana]
 ref|NP_001078214.1| glucose-6-phosphate dehydrogenase 5 [Arabidopsis thaliana]
 sp|Q9LK23.1|G6PD5_ARATH RecName: Full=Glucose-6-phosphate 1-dehydrogenase, cytoplasmic 
isoform 1; AltName: Full=G6PDH5; Short=G6PD5 [Arabidopsis 
thaliana]
 dbj|BAB02125.1| glucose-6-phosphate 1-dehydrogenase [Arabidopsis thaliana]
 gb|AAX12871.1| At3g27300 [Arabidopsis thaliana]
 gb|ABK32112.1| At3g27300 [Arabidopsis thaliana]
 dbj|BAH19852.1| AT3G27300 [Arabidopsis thaliana]
 gb|AEE77290.1| glucose-6-phosphate dehydrogenase 5 [Arabidopsis thaliana]
 gb|AEE77291.1| glucose-6-phosphate dehydrogenase 5 [Arabidopsis thaliana]
 gb|AEE77292.1| glucose-6-phosphate dehydrogenase 5 [Arabidopsis thaliana]
Length=516

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW +EKR  + NDSF  +   VTETG LSI+VLGASGDLAKKKTFPALFNL+HQGF
Sbjct  1    MGSGQWHMEKRSTLKNDSFVKEYNPVTETGSLSIIVLGASGDLAKKKTFPALFNLFHQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>gb|AAL57688.1| AT3g27300/K17E12_12 [Arabidopsis thaliana]
Length=516

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW +EKR  + NDSF  +   VTETG LSI+VLGASGDLAKKKTFPALFNL+HQGF
Sbjct  1    MGSGQWHMEKRSTLKNDSFVKEYNPVTETGSLSIIVLGASGDLAKKKTFPALFNLFHQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>ref|XP_002870678.1| glucose-6-phosphate dehydrogenase 6 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46937.1| glucose-6-phosphate dehydrogenase 6 [Arabidopsis lyrata subsp. 
lyrata]
Length=515

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR    NDSF    G V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWHVEKRSTFRNDSFVREYGTVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>ref|NP_198892.1| glucose-6-phosphate dehydrogenase 6 [Arabidopsis thaliana]
 sp|Q9FJI5.1|G6PD6_ARATH RecName: Full=Glucose-6-phosphate 1-dehydrogenase, cytoplasmic 
isoform 2; AltName: Full=G6PDH6; Short=G6PD6 [Arabidopsis 
thaliana]
 dbj|BAB08837.1| glucose-6-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAO42879.1| At5g40760 [Arabidopsis thaliana]
 dbj|BAE99888.1| glucose-6-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AED94591.1| glucose-6-phosphate dehydrogenase 6 [Arabidopsis thaliana]
Length=515

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR    NDSF    G V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWHVEKRSTFRNDSFVREYGIVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>emb|CAB52675.1| glucose-6-phosphate 1-dehydrogenase [Arabidopsis thaliana]
Length=515

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR    NDSF    G V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWHVEKRSTFRNDSFVREYGIVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>ref|XP_010248854.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Nelumbo nucifera]
 ref|XP_010248855.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Nelumbo nucifera]
 ref|XP_010248856.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Nelumbo nucifera]
Length=518

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFAD---IEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQ  400
            MES    +E+R  + +DSF+D    + + ETGCLSI+VLGASGDLAKKKTFPALFNLY Q
Sbjct  1    MESGGSSIERRNTLRSDSFSDGKDFDNLPETGCLSIIVLGASGDLAKKKTFPALFNLYRQ  60

Query  401  GFLQSNDVHIFGYAR  445
            GFLQSN+VHIFGYAR
Sbjct  61   GFLQSNEVHIFGYAR  75



>ref|XP_010502697.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
1-like [Camelina sativa]
Length=516

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + NDSF  +   V+ETG LSI+VLGASGDLAKKKTFPALFNL+HQGF
Sbjct  1    MGSGQWHVEKRSTLKNDSFVKEYNPVSETGSLSIIVLGASGDLAKKKTFPALFNLFHQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LSPDEVHIFGYAR  73



>ref|XP_010425474.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
1 [Camelina sativa]
Length=516

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + NDSF  +   V+ETG LSI+VLGASGDLAKKKTFPALFNL+HQGF
Sbjct  1    MGSGQWHVEKRSTLKNDSFVKEYNPVSETGSLSIIVLGASGDLAKKKTFPALFNLFHQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LSPDEVHIFGYAR  73



>ref|XP_010514422.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
1-like [Camelina sativa]
 ref|XP_010514423.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
1-like [Camelina sativa]
Length=516

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + NDSF  +   V+ETG LSI+VLGASGDLAKKKTFPALFNL+HQGF
Sbjct  1    MGSGQWHVEKRSTLKNDSFVKEYNPVSETGSLSIIVLGASGDLAKKKTFPALFNLFHQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LSPDEVHIFGYAR  73



>emb|CAB52674.1| glucose-6-phosphate 1-dehydrogenase [Arabidopsis thaliana]
Length=516

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW +EKR  + NDSF  +   +TETG LSI+VLGASGDLAKKKTFPALFNL+HQGF
Sbjct  1    MGSGQWHMEKRSTLKNDSFVKEYNPITETGSLSIIVLGASGDLAKKKTFPALFNLFHQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>ref|XP_009125158.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Brassica rapa]
 ref|XP_009125159.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Brassica rapa]
Length=512

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S +W VEKR  + NDSF    G   ETGCLSIVVLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGEWHVEKRSTLRNDSFVKESGSAPETGCLSIVVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>ref|XP_011045226.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2-like [Populus euphratica]
Length=510

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + NDSF  + E  +ETGCLSI+VLGASGDLAKKKTFPAL++L+ QGF
Sbjct  1    MGSGQWMVEKRSGLENDSFPKEHETASETGCLSIIVLGASGDLAKKKTFPALYHLFRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L SN+VHIFGYAR
Sbjct  61   LHSNEVHIFGYAR  73



>gb|AAR26303.3| glucose-6-phosphate dehydrogenase [Populus suaveolens]
Length=510

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + NDSF  + E  +E+GCLSI+VLGASGDLAKKKTFPAL++LY QGF
Sbjct  1    MGSGQWMVEKRSGLENDSFRNEHETASESGCLSIIVLGASGDLAKKKTFPALYHLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L SN+VHIFGYAR
Sbjct  61   LDSNEVHIFGYAR  73



>gb|KJB11613.1| hypothetical protein B456_001G268300 [Gossypium raimondii]
 gb|KJB11614.1| hypothetical protein B456_001G268300 [Gossypium raimondii]
Length=514

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S +WC++KR    +DS +  E V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGFL
Sbjct  1    MGSGKWCLQKRDSFRSDSLSGNENVPETGCLSIIVLGASGDLAKKKTFPALFNLYCQGFL  60

Query  410  QSNDVHIFGYAR  445
              ++VHIFGYAR
Sbjct  61   PPDEVHIFGYAR  72



>ref|XP_010436011.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Camelina sativa]
Length=515

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VE+R    NDSF    G V ETGCLSIVVLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWHVEERSTFRNDSFVREYGTVPETGCLSIVVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>ref|XP_010528187.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Tarenaya hassleriana]
Length=516

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            ME  QW V+KR    NDSF    G V ETGCLSI+VLGASGDLAKKKTFPALF+LY QGF
Sbjct  1    MEDGQWHVQKRSSFRNDSFVREYGAVPETGCLSIIVLGASGDLAKKKTFPALFHLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L+ ++VHIFGYAR
Sbjct  61   LRQDEVHIFGYAR  73



>ref|XP_007031738.1| Glucose-6-phosphate dehydrogenase 6 [Theobroma cacao]
 gb|EOY02664.1| Glucose-6-phosphate dehydrogenase 6 [Theobroma cacao]
Length=514

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S +WC++KR    +DSF+  E V ETGCLSI+VLGASGDLAKKKTFPALF+LY QGFL
Sbjct  1    MGSGEWCLQKRDSFKSDSFSINENVLETGCLSIIVLGASGDLAKKKTFPALFHLYCQGFL  60

Query  410  QSNDVHIFGYAR  445
              ++VHIFGYAR
Sbjct  61   PPDEVHIFGYAR  72



>gb|EYU34779.1| hypothetical protein MIMGU_mgv1a004680mg [Erythranthe guttata]
Length=515

 Score =   105 bits (263),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +2

Query  233  ESAQWCVEKRGLVSNDSFADI-EGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            E  +W  EKR    N+SF  + E V+ETG LSI+VLGASGDLAKKKTFPALFNLY QGFL
Sbjct  3    ELGEWHCEKRPFPKNESFTKVHETVSETGSLSIIVLGASGDLAKKKTFPALFNLYRQGFL  62

Query  410  QSNDVHIFGYAR  445
             SN+VHIFGYAR
Sbjct  63   PSNEVHIFGYAR  74



>ref|XP_010441234.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2-like [Camelina sativa]
Length=515

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR    N SF    G V ETGCLSIVVLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWHVEKRSTFRNVSFVREYGTVPETGCLSIVVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LNPDEVHIFGYAR  73



>ref|XP_010554089.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2-like [Tarenaya hassleriana]
Length=516

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            MES QW ++KR    NDSF  + + V ETGCLSI+VLGASGDLAKKKTFPALF+LY QGF
Sbjct  1    MESGQWHIQKRSSFRNDSFVREYDDVPETGCLSIIVLGASGDLAKKKTFPALFHLYLQGF  60

Query  407  LQSNDVHIFGYAR  445
            L+ ++V+IFGYAR
Sbjct  61   LRQDEVYIFGYAR  73



>gb|AFF18796.1| glucose-6-phosphate dehydrogenase, partial [Dimocarpus longan]
Length=311

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M + QW VEKR    +DSF  + E + ETGCLSI+VLGASGDLAKKKTFPALF+LY QGF
Sbjct  1    MGTGQWVVEKRSSFRSDSFGKEDENMPETGCLSIIVLGASGDLAKKKTFPALFHLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LPPDEVHIFGYAR  73



>ref|XP_002877035.1| glucose-6-phosphate dehydrogenase 5 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53294.1| glucose-6-phosphate dehydrogenase 5 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   105 bits (261),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQ  412
            S +W +EKR  + NDSF  +   V+ETG LSI+VLGASGDLAKKKTFPALF+LYHQGFL 
Sbjct  6    SGEWHMEKRSTLKNDSFVKEYNPVSETGSLSIIVLGASGDLAKKKTFPALFHLYHQGFLN  65

Query  413  SNDVHIFGYAR  445
             ++VHIFGYAR
Sbjct  66   PDEVHIFGYAR  76



>ref|XP_007215121.1| hypothetical protein PRUPE_ppa004323mg [Prunus persica]
 gb|EMJ16320.1| hypothetical protein PRUPE_ppa004323mg [Prunus persica]
Length=516

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S  W +EKR    N+   D+E V E G LSI+VLGASGDLAKKKTFPALFNL+ QGFL
Sbjct  1    MGSGSWHMEKRESFKNEPVKDVEHVLENGSLSIIVLGASGDLAKKKTFPALFNLFQQGFL  60

Query  410  QSNDVHIFGYAR  445
            Q N+VHIFGYAR
Sbjct  61   QPNEVHIFGYAR  72



>ref|XP_002298586.2| glucose-6-phosphate 1-dehydrogenase family protein [Populus trichocarpa]
 gb|EEE83391.2| glucose-6-phosphate 1-dehydrogenase family protein [Populus trichocarpa]
Length=510

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSF-ADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + NDSF  + E   E+GCLSI+VLGASGDLAKKKTFPAL++LY QGF
Sbjct  1    MGSGQWMVEKRSGLENDSFLKEHETAPESGCLSIIVLGASGDLAKKKTFPALYHLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LHPDEVHIFGYAR  73



>ref|XP_008231184.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Prunus mume]
Length=516

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S  W +E+R    N+   D+E V E G LSI+VLGASGDLAKKKTFPALFNL+ QGFL
Sbjct  1    MGSGSWHMERRDSFKNEPVKDVEHVLENGSLSIIVLGASGDLAKKKTFPALFNLFQQGFL  60

Query  410  QSNDVHIFGYAR  445
            Q N+VHIFGYAR
Sbjct  61   QPNEVHIFGYAR  72



>gb|ABC74527.1| glucose-6-phosphate dehydrogenase [Populus trichocarpa]
Length=511

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSF-ADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR  + NDSF  + E   E+GCLSI+VLGASGDLAKKKTFPAL++LY QGF
Sbjct  1    MGSGQWKVEKRSGLENDSFLKEHETAPESGCLSIIVLGASGDLAKKKTFPALYHLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LHPDEVHIFGYAR  73



>emb|CDP16654.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRG-LVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M SA W +EKR    +  S  D + V +TGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MASAAWSIEKRASFKTESSVGDDDNVPDTGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LPPDEVHIFGYAR  73



>gb|KJB33921.1| hypothetical protein B456_006G038700 [Gossypium raimondii]
Length=468

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S +WC++KR    +++    E V E GCLSI+VLGASGDLAKKKTFPALF+LY QGFL
Sbjct  1    MGSGEWCLQKRDSFKSETLVGNETVPEIGCLSIIVLGASGDLAKKKTFPALFHLYCQGFL  60

Query  410  QSNDVHIFGYAR  445
              N+VHIFGYAR
Sbjct  61   PPNEVHIFGYAR  72



>gb|KJB33922.1| hypothetical protein B456_006G038700 [Gossypium raimondii]
Length=436

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S +WC++KR    +++    E V E GCLSI+VLGASGDLAKKKTFPALF+LY QGFL
Sbjct  1    MGSGEWCLQKRDSFKSETLVGNETVPEIGCLSIIVLGASGDLAKKKTFPALFHLYCQGFL  60

Query  410  QSNDVHIFGYAR  445
              N+VHIFGYAR
Sbjct  61   PPNEVHIFGYAR  72



>gb|AIE47268.1| glucose-6-phosphate dehydrogenase [Hevea brasiliensis]
Length=515

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSF-ADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW +EKR    +DSF  + E V ETGCLSI+VLGASGDLAKKKTFPALFNLY QGF
Sbjct  1    MGSGQWLMEKRSSFRSDSFSKEYENVPETGCLSIIVLGASGDLAKKKTFPALFNLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            LQSN+VHIFGYAR
Sbjct  61   LQSNEVHIFGYAR  73



>gb|KJB33920.1| hypothetical protein B456_006G038700 [Gossypium raimondii]
Length=514

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S +WC++KR    +++    E V E GCLSI+VLGASGDLAKKKTFPALF+LY QGFL
Sbjct  1    MGSGEWCLQKRDSFKSETLVGNETVPEIGCLSIIVLGASGDLAKKKTFPALFHLYCQGFL  60

Query  410  QSNDVHIFGYAR  445
              N+VHIFGYAR
Sbjct  61   PPNEVHIFGYAR  72



>gb|KJB33923.1| hypothetical protein B456_006G038700 [Gossypium raimondii]
Length=513

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S +WC++KR    +++    E V E GCLSI+VLGASGDLAKKKTFPALF+LY QGFL
Sbjct  1    MGSGEWCLQKRDSFKSETLVGNETVPEIGCLSIIVLGASGDLAKKKTFPALFHLYCQGFL  60

Query  410  QSNDVHIFGYAR  445
              N+VHIFGYAR
Sbjct  61   PPNEVHIFGYAR  72



>gb|AAB69319.1| cytosolic glucose-6-phosphate dehydrogenase 2 [Petroselinum crispum]
Length=534

 Score =   102 bits (254),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 58/78 (74%), Gaps = 8/78 (10%)
 Frame = +2

Query  236  SAQWCVEKRGLVSNDSFADI--------EGVTETGCLSIVVLGASGDLAKKKTFPALFNL  391
            S +WC+E+R  V  DS  D           V+E GCLSIVVLGASGDLAKKKTFPALFNL
Sbjct  13   SDKWCLEERAPVVEDSAGDPIVKDTQPPPPVSEDGCLSIVVLGASGDLAKKKTFPALFNL  72

Query  392  YHQGFLQSNDVHIFGYAR  445
            Y QGFLQS++V+IFGYAR
Sbjct  73   YRQGFLQSHEVYIFGYAR  90



>ref|XP_010250853.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Nelumbo nucifera]
Length=523

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVT---ETGCLSIVVLGASGDLAKKKTFPALFNLYHQ  400
            M S+   VEK   + NDSF+D        ETGCLSI+VLGASGDLAKKKTFPALFNLY Q
Sbjct  4    MPSSAPSVEKGPTLRNDSFSDRRDSVNKLETGCLSIIVLGASGDLAKKKTFPALFNLYRQ  63

Query  401  GFLQSNDVHIFGYAR  445
            GFLQS+ VHIFGYAR
Sbjct  64   GFLQSSGVHIFGYAR  78



>ref|XP_011010244.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Populus euphratica]
 ref|XP_011012349.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Populus euphratica]
Length=514

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSF-ADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR   S+DSF  + E V ETGCLSI+VLGASGDLAKKKTFPAL+NLY +GF
Sbjct  1    MGSGQWMVEKRSSFSSDSFSKEYETVPETGCLSIIVLGASGDLAKKKTFPALYNLYRRGF  60

Query  407  LQSNDVHIFGYAR  445
            LQSN+V+IFGYAR
Sbjct  61   LQSNEVYIFGYAR  73



>emb|CDY11711.1| BnaC06g13190D [Brassica napus]
Length=532

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG-VTETGCLSIVVLGASGDLAKKKTFPALFNLY-HQG  403
            M S QW VE+R  + NDSF    G   ETGCLSI VLGASGDLAKKKTFPALFNL+  QG
Sbjct  1    MGSGQWHVERRSTLRNDSFVKESGSAPETGCLSIAVLGASGDLAKKKTFPALFNLFRQQG  60

Query  404  FLQSNDVHIFGYAR  445
            FL  ++VHIFGYAR
Sbjct  61   FLNPDEVHIFGYAR  74



>gb|EPS70489.1| glucose-6-phosphate 1-dehydrogenase [Genlisea aurea]
Length=521

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 50/73 (68%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +2

Query  233  ESAQWCVEKRGLVSNDSFA--DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            E  QW +EKR    N S    +   V ETGCLSI VLGASGDLAKKKTFPALFNLY QGF
Sbjct  3    EVGQWHLEKRPYAKNASLPKDNDTPVPETGCLSITVLGASGDLAKKKTFPALFNLYRQGF  62

Query  407  LQSNDVHIFGYAR  445
            L S+ VHIFGYAR
Sbjct  63   LPSDQVHIFGYAR  75



>gb|ABC74528.1| glucose-6-phosphate dehydrogenase [Populus trichocarpa]
Length=511

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSF-ADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S Q  VEKR  + NDSF  + E   E+GCLSI+VLGASGDLAKKKTFPAL++LY QGF
Sbjct  1    MGSGQRKVEKRSGLENDSFLKEHETAPESGCLSIIVLGASGDLAKKKTFPALYHLYRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L  ++VHIFGYAR
Sbjct  61   LHPDEVHIFGYAR  73



>ref|XP_009151975.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
1-like [Brassica rapa]
Length=517

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG--VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQG  403
            M S QW VEKR  +  +SF    G  V+E+  LSI+VLGASGDLAKKKTFPALFNLYHQ 
Sbjct  1    MGSGQWHVEKRSTLKKESFLKEYGAAVSESRSLSIIVLGASGDLAKKKTFPALFNLYHQR  60

Query  404  FLQSNDVHIFGYAR  445
            FL  ++VHIFGYAR
Sbjct  61   FLNPDEVHIFGYAR  74



>gb|ABC74526.1| glucose-6-phosphate dehydrogenase [Populus trichocarpa]
 gb|ABC74529.1| glucose-6-phosphate dehydrogenase [Populus trichocarpa]
Length=507

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR    +DSF+ + E V ETGCLSI+VLGASGDLAKKKTFPAL+NLY +GF
Sbjct  1    MGSGQWKVEKRSSFRSDSFSKEYETVPETGCLSIIVLGASGDLAKKKTFPALYNLYRRGF  60

Query  407  LQSNDVHIFGYAR  445
            LQSN+V+IFGYAR
Sbjct  61   LQSNEVYIFGYAR  73



>emb|CDY13701.1| BnaA06g32220D [Brassica napus]
Length=530

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG--VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQG  403
            M S QW VEKR  +  +SF    G  V+E+  LSI+VLGASGDLAKKKTFPALFNLYHQ 
Sbjct  1    MGSGQWHVEKRSTLKKESFLKEYGAAVSESRSLSIIVLGASGDLAKKKTFPALFNLYHQR  60

Query  404  FLQSNDVHIFGYAR  445
            FL  ++VHIFGYAR
Sbjct  61   FLNPDEVHIFGYAR  74



>ref|XP_002323796.1| glucose-6-phosphate 1-dehydrogenase family protein [Populus trichocarpa]
 gb|EEF03929.1| glucose-6-phosphate 1-dehydrogenase family protein [Populus trichocarpa]
Length=514

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSF-ADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S QW VEKR    +DSF  + E V ETGCLSI+VLGASGDLAKKKTFPAL+NLY +GF
Sbjct  1    MGSGQWMVEKRSSFRSDSFSKEYETVPETGCLSIIVLGASGDLAKKKTFPALYNLYRRGF  60

Query  407  LQSNDVHIFGYAR  445
            LQSN+V+IFGYAR
Sbjct  61   LQSNEVYIFGYAR  73



>ref|XP_003553875.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Glycine max]
 ref|XP_006604097.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X2 [Glycine max]
 gb|KHN32066.1| Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform [Glycine 
soja]
Length=519

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 58/74 (78%), Gaps = 2/74 (3%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSF--ADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQG  403
            M S++W VE+R   +N+S    D+E  TETG LSIVVLGASGDLAKKKTFPALFNLY QG
Sbjct  1    MTSSEWRVERRQSSTNESPLSRDLEHATETGSLSIVVLGASGDLAKKKTFPALFNLYRQG  60

Query  404  FLQSNDVHIFGYAR  445
            FL  ++V IFGYAR
Sbjct  61   FLLPDEVCIFGYAR  74



>ref|XP_009370302.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Pyrus x bretschneideri]
Length=516

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S  W +EKR     +   DI+ V E G LSI+VLGASGDLAKKKTFPALFNLY QGFL
Sbjct  1    MGSGSWHIEKRDSFRVEPVRDIDNVLENGSLSIIVLGASGDLAKKKTFPALFNLYRQGFL  60

Query  410  QSNDVHIFGYAR  445
               +VHIFGYAR
Sbjct  61   LPEEVHIFGYAR  72



>ref|XP_010111634.1| Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 2 [Morus 
notabilis]
 gb|EXC31379.1| Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 2 [Morus 
notabilis]
Length=517

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M S  W VEKR  + ++SF+ + E V E G LSI+VLGASGDLAKKKTFPALFNL+ QGF
Sbjct  1    MGSGAWHVEKRSTLRSESFSKEFENVLENGFLSIIVLGASGDLAKKKTFPALFNLFRQGF  60

Query  407  LQSNDVHIFGYAR  445
            L   +VHIFGYAR
Sbjct  61   LHPKEVHIFGYAR  73



>ref|XP_009371708.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Pyrus x bretschneideri]
Length=516

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S  W +EKR     +   DI+ V E G LSI+VLGASGDLAKKKTFPALFNLY QGFL
Sbjct  1    MGSGSWHIEKRDSFRVEPVRDIDNVLENGSLSIIVLGASGDLAKKKTFPALFNLYRQGFL  60

Query  410  QSNDVHIFGYAR  445
               +VHIFGYAR
Sbjct  61   LPEEVHIFGYAR  72



>ref|XP_008362117.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Malus domestica]
Length=516

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S  W +EKR     +   DI+ V E G LSI+VLGASGDLAKKKTFPALFNLY QGFL
Sbjct  1    MGSGSWHMEKRDSFRVEPVRDIDNVLENGSLSIIVLGASGDLAKKKTFPALFNLYRQGFL  60

Query  410  QSNDVHIFGYAR  445
               +VHIFGYAR
Sbjct  61   LPEEVHIFGYAR  72



>emb|CDX83677.1| BnaC07g24170D [Brassica napus]
Length=521

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S QW VEKR   S     +   V+E+  LSI+VLGASGDLAKKKTFPALFNLYHQGFL
Sbjct  1    MGSGQWHVEKR---STSFLKEYGAVSESRSLSIIVLGASGDLAKKKTFPALFNLYHQGFL  57

Query  410  QSNDVHIFGYAR  445
              ++VHIFGYAR
Sbjct  58   NPDEVHIFGYAR  69



>ref|XP_008792156.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Phoenix dactylifera]
 ref|XP_008792157.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Phoenix dactylifera]
Length=527

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 54/66 (82%), Gaps = 3/66 (5%)
 Frame = +2

Query  257  KRGLVSNDSFA---DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVH  427
            +R    ++SF+   D E ++ETGCLSI+VLGASGDLAKKKTFPALFNL+ QGFLQ N+V 
Sbjct  18   ERNSFRSESFSEDRDQEAISETGCLSIIVLGASGDLAKKKTFPALFNLFRQGFLQPNEVR  77

Query  428  IFGYAR  445
            IFGYAR
Sbjct  78   IFGYAR  83



>gb|KJB76462.1| hypothetical protein B456_012G089700 [Gossypium raimondii]
Length=512

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 6/72 (8%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S++W         +DSF   + V ETGCLSI+VLGASGDLAKKKTFPALF+LY QGFL
Sbjct  1    MGSSEWSHR------SDSFWSNDNVAETGCLSIIVLGASGDLAKKKTFPALFHLYCQGFL  54

Query  410  QSNDVHIFGYAR  445
              N+VHIFGYAR
Sbjct  55   PPNEVHIFGYAR  66



>gb|KJB76461.1| hypothetical protein B456_012G089700 [Gossypium raimondii]
Length=518

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 6/72 (8%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S++W         +DSF   + V ETGCLSI+VLGASGDLAKKKTFPALF+LY QGFL
Sbjct  1    MGSSEWSHR------SDSFWSNDNVAETGCLSIIVLGASGDLAKKKTFPALFHLYCQGFL  54

Query  410  QSNDVHIFGYAR  445
              N+VHIFGYAR
Sbjct  55   PPNEVHIFGYAR  66



>ref|XP_007151560.1| hypothetical protein PHAVU_004G0570000g, partial [Phaseolus vulgaris]
 gb|ESW23554.1| hypothetical protein PHAVU_004G0570000g, partial [Phaseolus vulgaris]
Length=279

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDS--FADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQG  403
            M S++W VE+R   SN+S    D+E   ETG LSIVVLGASGDLAKKKTFPALF+LY QG
Sbjct  1    MSSSEWHVERRQ-SSNESPLSRDLENAPETGSLSIVVLGASGDLAKKKTFPALFHLYVQG  59

Query  404  FLQSNDVHIFGYAR  445
            FL  N+V IFGYAR
Sbjct  60   FLPPNEVCIFGYAR  73



>ref|XP_004304016.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Fragaria vesca subsp. vesca]
 ref|XP_011467727.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2 [Fragaria vesca subsp. vesca]
Length=513

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S  W +EKR    +++F + E V E G LSI+VLGASGDLAKKKTFPALF+L+ QGFL
Sbjct  1    MGSGAWKIEKRDDFRSETFKE-ENVLENGTLSIIVLGASGDLAKKKTFPALFHLFKQGFL  59

Query  410  QSNDVHIFGYAR  445
              N+VHIFGYAR
Sbjct  60   NPNEVHIFGYAR  71



>ref|XP_009406393.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406394.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Musa acuminata subsp. malaccensis]
Length=523

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 8/71 (11%)
 Frame = +2

Query  257  KRGLVSNDSF--------ADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQ  412
            + G + N+SF         D+  V E GCLSI+VLGASGDLAKKKTFPALF+L+ QGFLQ
Sbjct  10   RNGSLGNNSFRSESFSEEKDMGLVREAGCLSIIVLGASGDLAKKKTFPALFHLFQQGFLQ  69

Query  413  SNDVHIFGYAR  445
             NDVHIFGYAR
Sbjct  70   ENDVHIFGYAR  80



>gb|AGI65622.1| cytoplasmic glucose-6-phosphate dehydrogenase [Fragaria x ananassa]
Length=513

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S  W +EKR    +++F + E V E G LSI+VLGASGDLAKKKTFPALF+L+ QGFL
Sbjct  1    MGSGAWKIEKRDDFRSETFKE-ENVLENGTLSIIVLGASGDLAKKKTFPALFHLFKQGFL  59

Query  410  QSNDVHIFGYAR  445
              N+VHIFGYAR
Sbjct  60   NPNEVHIFGYAR  71



>gb|AAD11426.1| cytoplasmic glucose-6-phosphate 1-dehydrogenase [Mesembryanthemum 
crystallinum]
Length=516

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 55/75 (73%), Gaps = 3/75 (4%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADI---EGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQ  400
            M S +W VEKR  + ++   DI   E   E G LSI+VLGASGDLAKKKTFPALFNLY Q
Sbjct  1    MGSGEWHVEKRSSLKSELSKDIGESESSQECGSLSIIVLGASGDLAKKKTFPALFNLYRQ  60

Query  401  GFLQSNDVHIFGYAR  445
            GFL  ++VHIFGYAR
Sbjct  61   GFLPPSEVHIFGYAR  75



>ref|XP_004953000.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Setaria italica]
Length=516

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  SNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            S  SF D+   +E+GCLSIVVLGASGDLAKKKTFPALF+L+ QGFLQS +VHIFGYAR
Sbjct  19   SLSSFKDLGLSSESGCLSIVVLGASGDLAKKKTFPALFHLFQQGFLQSEEVHIFGYAR  76



>ref|XP_003547679.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
isoform X1 [Glycine max]
 ref|XP_006599059.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
isoform X2 [Glycine max]
 ref|XP_006599060.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
isoform X3 [Glycine max]
 gb|KHN10854.1| Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform [Glycine 
soja]
Length=518

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 2/74 (3%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG--VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQG  403
            ME+++W +E+R    ++S    E   V ETG LSIVVLGASGDLAKKKTFPALF+LY QG
Sbjct  1    METSEWHIERRSSFGSESPLAREAGNVPETGSLSIVVLGASGDLAKKKTFPALFHLYLQG  60

Query  404  FLQSNDVHIFGYAR  445
            FL  ++VHIFGYAR
Sbjct  61   FLPPDEVHIFGYAR  74



>ref|XP_010912859.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Elaeis guineensis]
Length=457

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = +2

Query  257  KRGLVSNDSFA---DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVH  427
            +R    ++SF+   D E + + GCLSIVVLGASGDLAKKKTFPALFNL+ QGFLQ N+VH
Sbjct  18   ERNSFRSESFSEDRDQEVIPDVGCLSIVVLGASGDLAKKKTFPALFNLFRQGFLQPNEVH  77

Query  428  IFGYAR  445
            IFGYAR
Sbjct  78   IFGYAR  83



>gb|KJB76463.1| hypothetical protein B456_012G089700 [Gossypium raimondii]
Length=444

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 6/72 (8%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M S++W         +DSF   + V ETGCLSI+VLGASGDLAKKKTFPALF+LY QGFL
Sbjct  1    MGSSEWSHR------SDSFWSNDNVAETGCLSIIVLGASGDLAKKKTFPALFHLYCQGFL  54

Query  410  QSNDVHIFGYAR  445
              N+VHIFGYAR
Sbjct  55   PPNEVHIFGYAR  66



>ref|XP_008365361.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Malus domestica]
Length=520

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  245  WCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDV  424
            W +EKR     +   DI+ V E G LSI+VLGASGDLAKKKTFPALFNLY QGFL   +V
Sbjct  10   WHMEKRNSFRVEPVRDIDHVLENGSLSIIVLGASGDLAKKKTFPALFNLYKQGFLLPEEV  69

Query  425  HIFGYAR  445
            HIFGYAR
Sbjct  70   HIFGYAR  76



>ref|XP_010930046.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X2 [Elaeis guineensis]
Length=525

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 3/60 (5%)
 Frame = +2

Query  275  NDSFA---DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++SF+   D   ++ETGCLSI+VLGASGDLAKKKTFPALFNL+ QGFL+ N+VHIFGYAR
Sbjct  24   SESFSEDRDQGAISETGCLSIIVLGASGDLAKKKTFPALFNLFRQGFLRPNEVHIFGYAR  83



>ref|XP_010930044.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010930045.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Elaeis guineensis]
Length=527

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 52/60 (87%), Gaps = 3/60 (5%)
 Frame = +2

Query  275  NDSFA---DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++SF+   D   ++ETGCLSI+VLGASGDLAKKKTFPALFNL+ QGFL+ N+VHIFGYAR
Sbjct  24   SESFSEDRDQGAISETGCLSIIVLGASGDLAKKKTFPALFNLFRQGFLRPNEVHIFGYAR  83



>ref|XP_010912860.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X2 [Elaeis guineensis]
Length=407

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = +2

Query  257  KRGLVSNDSFA---DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVH  427
            +R    ++SF+   D E + + GCLSIVVLGASGDLAKKKTFPALFNL+ QGFLQ N+VH
Sbjct  18   ERNSFRSESFSEDRDQEVIPDVGCLSIVVLGASGDLAKKKTFPALFNLFRQGFLQPNEVH  77

Query  428  IFGYAR  445
            IFGYAR
Sbjct  78   IFGYAR  83



>ref|XP_009416632.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Musa acuminata subsp. malaccensis]
Length=522

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 3/62 (5%)
 Frame = +2

Query  269  VSNDSFADIEG---VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGY  439
            + ++SF+D +    V E GCLSI+VLGASGDLAKKKTFPALF+L+ QGFLQ NDVHIFGY
Sbjct  19   LRSESFSDEKDTGIVQEVGCLSIIVLGASGDLAKKKTFPALFHLFKQGFLQENDVHIFGY  78

Query  440  AR  445
            AR
Sbjct  79   AR  80



>gb|EMT16963.1| Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform [Aegilops 
tauschii]
Length=503

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 3/64 (5%)
 Frame = +2

Query  263  GLVSNDSFADIEGV---TETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIF  433
            G +S  S +D++ +   +E+GCLSIVVLGASGDLAKKKTFPALFNL+ QGF+QS +VHIF
Sbjct  13   GRISTSSLSDLKDLELSSESGCLSIVVLGASGDLAKKKTFPALFNLFQQGFIQSGEVHIF  72

Query  434  GYAR  445
            GYAR
Sbjct  73   GYAR  76



>gb|EMS62742.1| Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform [Triticum 
urartu]
Length=517

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 3/64 (5%)
 Frame = +2

Query  263  GLVSNDSFADIEGV---TETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIF  433
            G +S  S +D++ +   +E+GCLSIVVLGASGDLAKKKTFPALFNL+ QGF+QS +VHIF
Sbjct  13   GRISTSSLSDLKDLDLSSESGCLSIVVLGASGDLAKKKTFPALFNLFQQGFIQSGEVHIF  72

Query  434  GYAR  445
            GYAR
Sbjct  73   GYAR  76



>gb|AFK42993.1| unknown [Lotus japonicus]
Length=514

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M +++W  EKR    N+   D+E   ETG LSI+VLGASGDLAKKKTFPALFNLY QGFL
Sbjct  1    MGTSEWHCEKRSSFINE---DLESAPETGSLSIIVLGASGDLAKKKTFPALFNLYRQGFL  57

Query  410  QSNDVHIFGYAR  445
             ++++ IFGYAR
Sbjct  58   PADEICIFGYAR  69



>ref|NP_001241264.1| glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Glycine max]
 ref|XP_006603751.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Glycine max]
 gb|AEI54339.1| glucose-6-phosphate dehydrogenase [Glycine max]
 gb|KHN45553.1| Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform [Glycine 
soja]
Length=518

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEG--VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQG  403
            M +++W +E+R     +S    E   V ETG LSIVVLGASGDLAKKKTFPALF+LY QG
Sbjct  1    MGTSEWHIERRSSFGTESPLAREAGNVPETGSLSIVVLGASGDLAKKKTFPALFHLYRQG  60

Query  404  FLQSNDVHIFGYAR  445
            FL +++VHIFGYAR
Sbjct  61   FLPADEVHIFGYAR  74



>ref|XP_003575296.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Brachypodium distachyon]
 ref|XP_010235645.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Brachypodium distachyon]
Length=517

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  FADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
              D+E   E+GCLSIVVLGASGDLAKKKTFPALFNL+ QGFLQS +VHIFGYAR
Sbjct  23   LKDLELSPESGCLSIVVLGASGDLAKKKTFPALFNLFQQGFLQSGEVHIFGYAR  76



>gb|ACN41003.1| unknown [Picea sitchensis]
Length=518

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  305  TETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            TE+GCLSIVVLGASGDLAKKKTFPALFNLY QGFLQS DV+I GYAR
Sbjct  26   TESGCLSIVVLGASGDLAKKKTFPALFNLYRQGFLQSEDVYILGYAR  72



>ref|XP_004491740.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Cicer arietinum]
 ref|XP_004491741.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X2 [Cicer arietinum]
Length=515

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M +++W +EKR     +S    E V ETG LSIVVLGASGDLAKKKTFPALF+LY QG L
Sbjct  1    MGTSEWHIEKRDSFGTESPLARE-VLETGTLSIVVLGASGDLAKKKTFPALFHLYKQGLL  59

Query  410  QSNDVHIFGYAR  445
             S++VHIFGYAR
Sbjct  60   PSDEVHIFGYAR  71



>gb|AGZ15362.1| glucose-6-phosphate 1-dehydrogenase [Phaseolus vulgaris]
Length=518

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIE--GVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQG  403
            M +++W +E+R    ++S    E   V ETG LS+VVLGASGDLAKKKTFPALF+LY QG
Sbjct  1    MGTSEWHIERRASFGSESTLAREPGNVPETGSLSVVVLGASGDLAKKKTFPALFHLYRQG  60

Query  404  FLQSNDVHIFGYAR  445
            FL  ++VHIFGYAR
Sbjct  61   FLPPDEVHIFGYAR  74



>ref|XP_007140875.1| hypothetical protein PHAVU_008G148700g [Phaseolus vulgaris]
 gb|ESW12869.1| hypothetical protein PHAVU_008G148700g [Phaseolus vulgaris]
Length=518

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 2/74 (3%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIE--GVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQG  403
            M +++W +E+R    ++S    E   V ETG LS+VVLGASGDLAKKKTFPALF+LY QG
Sbjct  1    MGTSEWHIERRASFGSESTLAREPGNVPETGSLSVVVLGASGDLAKKKTFPALFHLYRQG  60

Query  404  FLQSNDVHIFGYAR  445
            FL  ++VHIFGYAR
Sbjct  61   FLPPDEVHIFGYAR  74



>gb|ABI97284.1| glucose-6-phosphate dehydrogenase [Pisum sativum]
Length=517

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDS-FADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGF  406
            M + +W VE+R     DS  A    V ETG LSIVVLGASGDLAKKKTFPALF+LY Q  
Sbjct  1    MGTNEWHVERRSTSDTDSPLAPRRDVLETGTLSIVVLGASGDLAKKKTFPALFHLYKQDL  60

Query  407  LQSNDVHIFGYAR  445
            L S++VHIFGYAR
Sbjct  61   LPSDEVHIFGYAR  73



>ref|NP_001047345.1| Os02g0600400 [Oryza sativa Japonica Group]
 dbj|BAD22150.1| putative glucose-6-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAF09259.1| Os02g0600400 [Oryza sativa Japonica Group]
 gb|EEE57315.1| hypothetical protein OsJ_07404 [Oryza sativa Japonica Group]
Length=517

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  FADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
              D+E  +E+GCLSIVVLGASGDLAKKKTFPALF+L+ QGFLQS +VHIFGYAR
Sbjct  23   LKDLELSSESGCLSIVVLGASGDLAKKKTFPALFHLFQQGFLQSGEVHIFGYAR  76



>ref|XP_006647463.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Oryza brachyantha]
Length=517

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  FADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
              D+E  +E+GCLSIVVLGASGDLAKKKTFPALF+L+ QGFLQS +VHIFGYAR
Sbjct  23   LKDLELSSESGCLSIVVLGASGDLAKKKTFPALFHLFQQGFLQSGEVHIFGYAR  76



>ref|XP_006652432.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Oryza brachyantha]
Length=508

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D+E  +E GCLS++VLGASGDLAKKKTFPALF+L+ QGFLQS +VHIFGYAR
Sbjct  23   DLELPSEHGCLSVIVLGASGDLAKKKTFPALFHLFAQGFLQSGEVHIFGYAR  74



>ref|XP_006852171.1| hypothetical protein AMTR_s00049p00097260 [Amborella trichopoda]
 gb|ERN13638.1| hypothetical protein AMTR_s00049p00097260 [Amborella trichopoda]
Length=526

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 3/62 (5%)
 Frame = +2

Query  269  VSNDSFAD---IEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGY  439
            + +DSF D    E   E+GCLSIVVLGASGDLAKKKTFPALF+L+ QGFL  N+V+IFGY
Sbjct  21   LKSDSFTDRVESESTLESGCLSIVVLGASGDLAKKKTFPALFHLFQQGFLPPNEVYIFGY  80

Query  440  AR  445
            AR
Sbjct  81   AR  82



>ref|XP_003580004.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Brachypodium distachyon]
 ref|XP_010240041.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Brachypodium distachyon]
 ref|XP_010240042.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
[Brachypodium distachyon]
Length=510

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D+E   E GCLSIVVLGASGDLAKKKTFPAL++L+ QGFLQS +VHIFGYAR
Sbjct  21   DLELPLEQGCLSIVVLGASGDLAKKKTFPALYHLFEQGFLQSGEVHIFGYAR  72



>gb|EEC77511.1| hypothetical protein OsI_16377 [Oryza sativa Indica Group]
 gb|EEE61217.1| hypothetical protein OsJ_15244 [Oryza sativa Japonica Group]
Length=473

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D+E  +E GCLS++VLGASGDLAKKKTFPALF+L+ QGF+QS +VHIFGYAR
Sbjct  20   DLELPSEQGCLSVIVLGASGDLAKKKTFPALFHLFAQGFIQSGEVHIFGYAR  71



>ref|XP_004489579.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Cicer arietinum]
 ref|XP_004489580.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X2 [Cicer arietinum]
Length=519

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 53/69 (77%), Gaps = 2/69 (3%)
 Frame = +2

Query  245  WCVEKRGLVSNDSF--ADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSN  418
            W  E+R  + +DS    D E  +ETG LSIVVLGASGDLAKKKTFPALFNLY QGFL +N
Sbjct  7    WHCEQRSSLKDDSPLSVDNENGSETGSLSIVVLGASGDLAKKKTFPALFNLYKQGFLLAN  66

Query  419  DVHIFGYAR  445
            +V IFGYAR
Sbjct  67   EVCIFGYAR  75



>gb|AAL79959.1| glucose-6-phosphate dehydrogenase [Oryza sativa Japonica Group]
Length=505

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D+E  +E GCLS++VLGASGDLAKKKTFPALF+L+ QGF+QS +VHIFGYAR
Sbjct  20   DLELPSEQGCLSVIVLGASGDLAKKKTFPALFHLFAQGFIQSGEVHIFGYAR  71



>ref|NP_001053132.1| Os04g0485300 [Oryza sativa Japonica Group]
 emb|CAE03156.2| OSJNBa0081L15.18 [Oryza sativa Japonica Group]
 emb|CAE02006.2| OJ000223_09.8 [Oryza sativa Japonica Group]
 emb|CAC09489.2| H0811E11.5 [Oryza sativa Indica Group]
 dbj|BAF15046.1| Os04g0485300 [Oryza sativa Japonica Group]
Length=505

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D+E  +E GCLS++VLGASGDLAKKKTFPALF+L+ QGF+QS +VHIFGYAR
Sbjct  20   DLELPSEQGCLSVIVLGASGDLAKKKTFPALFHLFAQGFIQSGEVHIFGYAR  71



>ref|XP_010680729.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
2-like [Beta vulgaris subsp. vulgaris]
Length=520

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 50/70 (71%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  245  WCVEKRGLVSNDSF---ADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQS  415
            W +EKR  V NDSF   AD E   E+G LSI+VLGASGDLAKKKTFPALFNLY QGFL  
Sbjct  7    WHMEKRSSVRNDSFGDKADTESSLESGSLSIIVLGASGDLAKKKTFPALFNLYRQGFLPP  66

Query  416  NDVHIFGYAR  445
            ++VHIFGYAR
Sbjct  67   SEVHIFGYAR  76



>ref|NP_001169544.1| uncharacterized protein LOC100383421 [Zea mays]
 ref|XP_008644070.1| PREDICTED: uncharacterized protein LOC100383421 isoform X1 [Zea 
mays]
 gb|ACN34086.1| unknown [Zea mays]
 gb|AFW72185.1| glucose-6-phosphate 1-dehydrogenase isoform 1 [Zea mays]
 gb|AFW72186.1| glucose-6-phosphate 1-dehydrogenase isoform 2 [Zea mays]
Length=517

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D E  +E+GCLSIVVLGASGDLAKKKTFPALF+L+ QGFLQS +VHIFGYAR
Sbjct  25   DNELSSESGCLSIVVLGASGDLAKKKTFPALFHLFQQGFLQSGEVHIFGYAR  76



>ref|XP_009415064.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009415065.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009415066.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009415067.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009415068.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=520

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 2/56 (4%)
 Frame = +2

Query  278  DSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D + +I+   E  CLSI+VLGASGDLAKKKTFPALF+L+ QGFLQ NDVHIFGYAR
Sbjct  24   DRYTEIK--HEVKCLSIIVLGASGDLAKKKTFPALFHLFQQGFLQENDVHIFGYAR  77



>ref|XP_008812421.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
[Phoenix dactylifera]
Length=527

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 55/81 (68%), Gaps = 16/81 (20%)
 Frame = +2

Query  251  VEKRGLVS-------------NDSFA---DIEGVTETGCLSIVVLGASGDLAKKKTFPAL  382
            +E RGL S             ++SF+   D E + E G LSIVVLGASGDLAKKKTFPAL
Sbjct  3    IESRGLYSTSRNNSLERNSFRSESFSEDRDREVIPEAGVLSIVVLGASGDLAKKKTFPAL  62

Query  383  FNLYHQGFLQSNDVHIFGYAR  445
            FNL+ QGFL  N+VHIFGYAR
Sbjct  63   FNLFRQGFLLPNEVHIFGYAR  83



>ref|NP_001150684.1| glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform [Zea 
mays]
 ref|XP_008668075.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
isoform X1 [Zea mays]
 ref|XP_008668076.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
isoform X1 [Zea mays]
 ref|XP_008668077.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 
isoform X1 [Zea mays]
 gb|ACG39996.1| glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform [Zea 
mays]
 tpg|DAA37256.1| TPA: glucose-6-phosphate 1-dehydrogenase isoform 1 [Zea mays]
 tpg|DAA37257.1| TPA: glucose-6-phosphate 1-dehydrogenase isoform 2 [Zea mays]
 tpg|DAA37258.1| TPA: glucose-6-phosphate 1-dehydrogenase isoform 3 [Zea mays]
Length=507

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D++  +E GCLSIVVLGASGDLAKKKTFPAL++L+ QGF+QS +VHIFGYAR
Sbjct  20   DLDLPSEQGCLSIVVLGASGDLAKKKTFPALYHLFEQGFIQSGEVHIFGYAR  71



>gb|AIY34491.1| glucose-6-phosphate dehydrogenase [Saccharum hybrid cultivar 
Yacheng05-179]
Length=507

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D++  +E GCLSIVVLGASGDLAKKKTFPAL++L+ QGF+QS +VHIFGYAR
Sbjct  20   DLDLPSEQGCLSIVVLGASGDLAKKKTFPALYHLFDQGFIQSGEVHIFGYAR  71



>ref|XP_004976009.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X1 [Setaria italica]
 ref|XP_004976010.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X2 [Setaria italica]
 ref|XP_004976011.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like 
isoform X3 [Setaria italica]
Length=508

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D++  +E GCLSIVVLGASGDLAKKKTFPAL++L+ QGF+QS +VHIFGYAR
Sbjct  20   DLDLPSEQGCLSIVVLGASGDLAKKKTFPALYHLFDQGFIQSGEVHIFGYAR  71



>gb|EEC73539.1| hypothetical protein OsI_07937 [Oryza sativa Indica Group]
Length=517

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  FADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
              D+E  +E+GCLSIVVLGASGDLAKKKTFPALF+L+ QGFL S +VHIFGYAR
Sbjct  23   LKDLELSSESGCLSIVVLGASGDLAKKKTFPALFHLFQQGFLLSGEVHIFGYAR  76



>sp|Q42919.1|G6PD_MEDSA RecName: Full=Glucose-6-phosphate 1-dehydrogenase, cytoplasmic 
isoform; Short=G6PD [Medicago sativa]
 gb|AAB41552.1| glucose-6-phosphate dehydrogenase [Medicago sativa]
Length=515

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M + +W VE+R  +  +S    E V ETG LSIVVLGASGDLAKKKTFPALF+LY Q  L
Sbjct  1    MGTNEWHVERRDSIGTESPVARE-VLETGTLSIVVLGASGDLAKKKTFPALFHLYKQELL  59

Query  410  QSNDVHIFGYAR  445
              ++VHIFGYAR
Sbjct  60   PPDEVHIFGYAR  71



>ref|XP_003622423.1| Glucose-6-phosphate 1-dehydrogenase [Medicago truncatula]
 gb|AES78641.1| glucose-6-phosphate 1-dehydrogenase [Medicago truncatula]
Length=515

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M + +W VE+R  +  +S    E V ETG LSIVVLGASGDLAKKKTFPALF+LY Q  L
Sbjct  1    MGTNEWHVERRDSIGTESPVARE-VLETGTLSIVVLGASGDLAKKKTFPALFHLYKQELL  59

Query  410  QSNDVHIFGYAR  445
              ++VHIFGYAR
Sbjct  60   PPDEVHIFGYAR  71



>gb|ACN36479.1| unknown [Zea mays]
Length=517

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D E  +E+GCLSIVVLGASGDLAKKKTFPALF+L+ QGFLQS +VHIFGY R
Sbjct  25   DNELSSESGCLSIVVLGASGDLAKKKTFPALFHLFQQGFLQSGEVHIFGYVR  76



>gb|KEH25436.1| glucose-6-phosphate 1-dehydrogenase [Medicago truncatula]
Length=518

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +2

Query  245  WCVEKRGLVSNDSFADIEGV-TETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSND  421
            W   +R  + NDS   ++    E G LSIVVLGASGDLAKKKTFPALFNLY QGFL +N+
Sbjct  7    WQCVQRSSIENDSPLSVDNNGPENGSLSIVVLGASGDLAKKKTFPALFNLYKQGFLLANE  66

Query  422  VHIFGYAR  445
            V IFGYAR
Sbjct  67   VCIFGYAR  74



>gb|ACJ85742.1| unknown [Medicago truncatula]
 gb|AFK39078.1| unknown [Medicago truncatula]
Length=518

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +2

Query  245  WCVEKRGLVSNDSFADIEGV-TETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSND  421
            W   +R  + NDS   ++    E G LSIVVLGASGDLAKKKTFPALFNLY QGFL +N+
Sbjct  7    WQCVQRSSIENDSPLSVDNNGPENGSLSIVVLGASGDLAKKKTFPALFNLYKQGFLLANE  66

Query  422  VHIFGYAR  445
            V IFGYAR
Sbjct  67   VCIFGYAR  74



>dbj|BAA97664.1| glucose-6-phosphate dehydrogenase [Triticum aestivum]
Length=509

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D+E   E GCL+IVVLGASGDLAKKKTFPAL++L+ QGFLQS +VHI GYAR
Sbjct  21   DLELPLEKGCLTIVVLGASGDLAKKKTFPALYHLFEQGFLQSGEVHIVGYAR  72



>gb|ACV97161.1| cytosolic glucose 6 phosphate dehydrogenase [Hordeum vulgare 
subsp. vulgare]
Length=509

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D+E   E GCL+IVVLGASGDLAKKKTFPAL++L+ QGFLQS +VHI GYAR
Sbjct  21   DLELPLEQGCLTIVVLGASGDLAKKKTFPALYHLFEQGFLQSGEVHIVGYAR  72



>dbj|BAA97662.1| glucose-6-phosphate dehydrogenase [Triticum aestivum]
Length=509

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D+E   E GCL+IVVLGASGDLAKKKTFPAL++L+ QGFLQS +VHI GYAR
Sbjct  21   DLELPLEQGCLTIVVLGASGDLAKKKTFPALYHLFEQGFLQSGEVHIVGYAR  72



>gb|EMS65357.1| Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform [Triticum 
urartu]
Length=509

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D+E   E GCL+IVVLGASGDLAKKKTFPAL++L+ QGFLQS +VHI GYAR
Sbjct  21   DLELPLEQGCLTIVVLGASGDLAKKKTFPALYHLFEQGFLQSGEVHIVGYAR  72



>dbj|BAJ90864.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D+E   E GCL+IVVLGASGDLAKKKTFPAL++L+ QGFLQS +VHI GYAR
Sbjct  21   DLELPLEQGCLTIVVLGASGDLAKKKTFPALYHLFEQGFLQSGEVHIVGYAR  72



>dbj|BAA97663.1| glucose-6-phosphate dehydrogenase [Triticum aestivum]
Length=513

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D+E   E GCL+IVVLGASGDLAKKKTFPAL++L+ QGFLQS +VHI GYAR
Sbjct  21   DLELPLEQGCLTIVVLGASGDLAKKKTFPALYHLFEQGFLQSGEVHIVGYAR  72



>gb|KHG01601.1| Glucose-6-phosphate 1-dehydrogenase-2C cytoplasmic-like protein 
[Gossypium arboreum]
Length=456

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFL  409
            M   +WC++KR    +++    E V E GCLSI+VLGASGDLAKKKTFPALF+LY QGFL
Sbjct  1    MGPGEWCLQKRDSFKSETLVGNETVPEIGCLSIIVLGASGDLAKKKTFPALFHLYCQGFL  60

Query  410  QSNDV  424
              N++
Sbjct  61   PPNEI  65



>gb|EMT23941.1| Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform [Aegilops 
tauschii]
Length=597

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  275  NDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            N    D+E   E GCL+IVVLGASGDLAKKKTFPAL++L+ QGFLQS +VHI GYAR
Sbjct  104  NSLAKDLELPLEQGCLTIVVLGASGDLAKKKTFPALYHLFEQGFLQSGEVHIVGYAR  160



>ref|XP_001775510.1| predicted protein [Physcomitrella patens]
 gb|EDQ59707.1| predicted protein [Physcomitrella patens]
Length=534

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            GCLS+VVLGASGDLAKKKTFPA+FNLY QGFL  +++HIFGYAR
Sbjct  42   GCLSVVVLGASGDLAKKKTFPAIFNLYKQGFL-PDEMHIFGYAR  84



>ref|XP_001777530.1| predicted protein [Physcomitrella patens]
 gb|EDQ57705.1| predicted protein [Physcomitrella patens]
Length=532

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            GCLS++VLGASGDLAKKKTFPA+FNLY QGFL  +++H+FGYAR
Sbjct  42   GCLSLIVLGASGDLAKKKTFPAIFNLYKQGFL-PDEMHVFGYAR  84



>ref|XP_002975183.1| hypothetical protein SELMODRAFT_150322 [Selaginella moellendorffii]
 gb|EFJ23968.1| hypothetical protein SELMODRAFT_150322 [Selaginella moellendorffii]
Length=530

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  302  VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +    CLSI++LGASGDLAKKKTFPALF+LY QGFL S+ V +FGYAR
Sbjct  46   IVAESCLSIIILGASGDLAKKKTFPALFHLYCQGFLPSHQVKLFGYAR  93



>ref|XP_002977589.1| hypothetical protein SELMODRAFT_151970 [Selaginella moellendorffii]
 gb|EFJ21593.1| hypothetical protein SELMODRAFT_151970 [Selaginella moellendorffii]
Length=530

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +2

Query  302  VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +    CLSI++LGASGDLAKKKTFPALF+LY QGFL S+ V +FGYAR
Sbjct  46   IVAESCLSIIILGASGDLAKKKTFPALFHLYCQGFLPSHQVKLFGYAR  93



>ref|XP_001765091.1| predicted protein [Physcomitrella patens]
 gb|EDQ70086.1| predicted protein [Physcomitrella patens]
Length=508

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +2

Query  311  TGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            TG LSIVVLGASGDLAKKKTFPA+FNLY QGFL  +++ I GY+R
Sbjct  23   TGYLSIVVLGASGDLAKKKTFPAIFNLYTQGFL-PDELKIIGYSR  66



>gb|KIO25023.1| hypothetical protein M407DRAFT_244236 [Tulasnella calospora MUT 
4182]
Length=517

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVVLGASGDLAKKKTFPALF LY +GFL  ND+HI GYAR
Sbjct  30   IVVLGASGDLAKKKTFPALFGLYREGFL-PNDLHIVGYAR  68



>gb|KIM29528.1| hypothetical protein M408DRAFT_22868 [Serendipita vermifera MAFF 
305830]
Length=503

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVVLGASGDLAKKKTFPALF LY QGFL  N VHI GYAR
Sbjct  16   IVVLGASGDLAKKKTFPALFGLYRQGFL-PNGVHIVGYAR  54



>gb|EPB91635.1| glucose-6-phosphate dehydrogenase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=512

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++I+VLGASGDLAKKKT+PALF LY  GFL  N VHI GYAR
Sbjct  18   GSVTIIVLGASGDLAKKKTYPALFGLYRNGFLPEN-VHIVGYAR  60



>emb|CEP10545.1| hypothetical protein [Parasitella parasitica]
Length=535

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++I+VLGASGDLAKKKT+PALF LY  GFL  N VHI GYAR
Sbjct  18   GAVTIIVLGASGDLAKKKTYPALFGLYRNGFLPEN-VHIVGYAR  60



>ref|XP_001694367.1| glucose-6-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP02800.1| glucose-6-phosphate dehydrogenase, partial [Chlamydomonas reinhardtii]
Length=209

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 47/86 (55%), Gaps = 21/86 (24%)
 Frame = +2

Query  188  VIEFGLLTRLEAFKMESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKK  367
            V  FG L   EA+ +E   W                    +T  LS+VV+GASGDLAKKK
Sbjct  40   VYSFGNLNVEEAYDLERNDW--------------------KTTSLSVVVVGASGDLAKKK  79

Query  368  TFPALFNLYHQGFLQSNDVHIFGYAR  445
             FPALF LY++G L   + HIFG+AR
Sbjct  80   IFPALFALYYEGLL-PEEFHIFGFAR  104



>ref|XP_002491203.1| Glucose-6-phosphate dehydrogenase (G6PD), catalyzes the first 
step of the pentose phosphate pathway [Komagataella pastoris 
GS115]
 emb|CAY68923.1| Glucose-6-phosphate dehydrogenase (G6PD), catalyzes the first 
step of the pentose phosphate pathway [Komagataella pastoris 
GS115]
 emb|CCA38673.1| glucose-6-phosphate 1-dehydrogenase [Komagataella pastoris CBS 
7435]
Length=504

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +2

Query  290  DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            D + V   G  +IVV GASGDLAKKKTFPALF LY +G+L SN V I GYAR
Sbjct  3    DTKAVEFVGHTAIVVFGASGDLAKKKTFPALFGLYREGYL-SNKVKIIGYAR  53



>dbj|GAN03829.1| glucose-6-P dehydrogenase [Mucor ambiguus]
Length=512

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G  +I+VLGASGDLAKKKT+PALF LY  GFL  N VHI GYAR
Sbjct  18   GSATIIVLGASGDLAKKKTYPALFGLYRNGFLPEN-VHIVGYAR  60



>emb|CDS06387.1| hypothetical protein LRAMOSA08915 [Absidia idahoensis var. thermophila]
Length=512

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  269  VSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +S+D  +        G ++I+VLGASGDLAKKKT+PALF+L+ +G+L  +D HI GYAR
Sbjct  3    ISSDPISQQVSAELQGSVTIIVLGASGDLAKKKTYPALFSLFQKGYL-PDDTHIIGYAR  60



>dbj|BAJ88465.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +2

Query  299  GVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            GV   G  ++VVLGASGDLAKKKTFPALF L+ QG L  +D+HI GYAR
Sbjct  24   GVELKGETTVVVLGASGDLAKKKTFPALFGLFEQGHL-PDDLHIIGYAR  71



>ref|XP_006460350.1| hypothetical protein AGABI2DRAFT_192087 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV48487.1| hypothetical protein AGABI2DRAFT_192087 [Agaricus bisporus var. 
bisporus H97]
Length=517

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKTFPALF LYHQG L  +DV I GYAR
Sbjct  27   IIVLGASGDLAKKKTFPALFGLYHQGLL-PHDVKIVGYAR  65



>ref|XP_007382144.1| glucose-6-phosphate 1-dehydrogenase [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN10632.1| glucose-6-phosphate 1-dehydrogenase [Punctularia strigosozonata 
HHB-11173 SS5]
Length=519

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKT+PALF LY +GFL + DVHI GYAR
Sbjct  27   IIVLGASGDLAKKKTYPALFGLYQRGFLPT-DVHIVGYAR  65



>ref|XP_009543666.1| hypothetical protein HETIRDRAFT_449546 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW83939.1| hypothetical protein HETIRDRAFT_449546 [Heterobasidion irregulare 
TC 32-1]
Length=512

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKTFPALF LY  GFL   DVHI GYAR
Sbjct  25   IIVLGASGDLAKKKTFPALFGLYRDGFL-PRDVHIVGYAR  63



>gb|AHL26985.1| glucose-6-phosphate 1-dehydrogenase [Volvariella volvacea]
Length=515

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKTFPALF LY QGFL   DV I GYAR
Sbjct  27   IIVLGASGDLAKKKTFPALFGLYRQGFL-PRDVKIVGYAR  65



>ref|XP_007329303.1| hypothetical protein AGABI1DRAFT_113271 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM80037.1| hypothetical protein AGABI1DRAFT_113271 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=517

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKTFPALF LY QGFL   DV I GYAR
Sbjct  27   IIVLGASGDLAKKKTFPALFGLYRQGFL-PRDVKIVGYAR  65



>gb|EKG04538.1| glucose-6-phosphate 1-dehydrogenase, putative [Trypanosoma cruzi]
Length=247

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  320  LSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            L+IVVLGASGDLAKKKTFPALF LY  G L   DV+I GYAR
Sbjct  69   LTIVVLGASGDLAKKKTFPALFQLYCNGML-PRDVNILGYAR  109



>ref|XP_007861864.1| glucose-6-phosphate dehydrogenase [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ59251.1| glucose-6-phosphate dehydrogenase [Gloeophyllum trabeum ATCC 
11539]
Length=515

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKT+PALF LY  GFL   DVHI GYAR
Sbjct  27   IIVLGASGDLAKKKTYPALFGLYKNGFL-PRDVHIVGYAR  65



>gb|EMF11690.1| glucose-6-phosphate dehydrogenase [Sphaerulina musiva SO2202]
Length=511

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +2

Query  323  SIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +++VLGASGDLAKKKTFPALF L+  GFL   DVHI GYAR
Sbjct  24   TVIVLGASGDLAKKKTFPALFGLFRNGFL-PRDVHIVGYAR  63



>gb|KIM90820.1| hypothetical protein PILCRDRAFT_811308 [Piloderma croceum F 1598]
Length=502

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+V GASGDLAKKKTFPALF LY  GFL   DVHI GYAR
Sbjct  14   IIVFGASGDLAKKKTFPALFGLYKNGFL-PRDVHIVGYAR  52



>emb|CDS08935.1| hypothetical protein LRAMOSA10295 [Absidia idahoensis var. thermophila]
Length=507

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +2

Query  311  TGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +G ++I+VLGASGDLAKKKT+PALF L+  GFL  N  HI GYAR
Sbjct  17   SGFVTIIVLGASGDLAKKKTYPALFKLFRNGFLPEN-THIVGYAR  60



>gb|KDQ64510.1| hypothetical protein JAAARDRAFT_28148 [Jaapia argillacea MUCL 
33604]
Length=515

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVVLGASGDLAKKKT+PALF LY  GFL S  VHI GYAR
Sbjct  27   IVVLGASGDLAKKKTYPALFGLYRNGFLPSG-VHIVGYAR  65



>gb|ABD72518.1| glucose 6-phosphate dehydrogenase [Trypanosoma cruzi]
Length=555

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +2

Query  224  FKMESAQW-CVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQ  400
            + ME+A+    E RG V       +     +  L+IVVLGASGDLAKKKTFPALF LY  
Sbjct  36   YLMENAKKVAAELRGEVCERIPDAVSPELRSRALTIVVLGASGDLAKKKTFPALFQLYCN  95

Query  401  GFLQSNDVHIFGYAR  445
            G L   DV+I GYAR
Sbjct  96   GML-PRDVNILGYAR  109



>ref|XP_820060.1| glucose-6-phosphate 1-dehydrogenase [Trypanosoma cruzi strain 
CL Brener]
 gb|EAN98209.1| glucose-6-phosphate 1-dehydrogenase, putative [Trypanosoma cruzi]
 gb|ABD72517.1| glucose 6-phosphate dehydrogenase [Trypanosoma cruzi]
Length=555

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +2

Query  224  FKMESAQW-CVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQ  400
            + ME+A+    E RG V       +     +  L+IVVLGASGDLAKKKTFPALF LY  
Sbjct  36   YLMENAKKVAAELRGEVCERIPDAVSPELRSRALTIVVLGASGDLAKKKTFPALFQLYCN  95

Query  401  GFLQSNDVHIFGYAR  445
            G L   DV+I GYAR
Sbjct  96   GML-PRDVNILGYAR  109



>ref|XP_807540.1| glucose-6-phosphate 1-dehydrogenase [Trypanosoma cruzi strain 
CL Brener]
 gb|EAN85689.1| glucose-6-phosphate 1-dehydrogenase, putative [Trypanosoma cruzi]
Length=272

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  320  LSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            L+IVVLGASGDLAKKKTFPALF LY  G L   DV+I GYAR
Sbjct  69   LTIVVLGASGDLAKKKTFPALFQLYCNGML-PRDVNILGYAR  109



>gb|KIR88668.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii IND107]
Length=503

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++VLGASGDLAKKKTFPAL+ L+ QGFL   DVHI GYAR
Sbjct  27   VIVLGASGDLAKKKTFPALYALFAQGFL-PKDVHIVGYAR  65



>gb|KIR52019.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii Ru294]
Length=503

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++VLGASGDLAKKKTFPAL+ L+ QGFL   DVHI GYAR
Sbjct  27   VIVLGASGDLAKKKTFPALYALFAQGFL-PKDVHIVGYAR  65



>gb|KIR49166.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii CA1280]
 gb|KIR68188.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii CA1873]
Length=503

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++VLGASGDLAKKKTFPAL+ L+ QGFL   DVHI GYAR
Sbjct  27   VIVLGASGDLAKKKTFPALYALFAQGFL-PKDVHIVGYAR  65



>gb|KIR31719.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii MMRL2647]
 gb|KIR98922.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii 2001/935-1]
Length=503

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++VLGASGDLAKKKTFPAL+ L+ QGFL   DVHI GYAR
Sbjct  27   VIVLGASGDLAKKKTFPALYALFAQGFL-PKDVHIVGYAR  65



>gb|KGB76508.1| glucose-6-phosphate 1-dehydrogenase [Cryptococcus gattii R265]
 gb|KIR27667.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii LA55]
 gb|KIR42009.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii Ram5]
 gb|KIR73166.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii CA1014]
 gb|KIR90057.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii CBS 10090]
 gb|KIY54230.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii 99/473]
Length=503

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++VLGASGDLAKKKTFPAL+ L+ QGFL   DVHI GYAR
Sbjct  27   VIVLGASGDLAKKKTFPALYALFAQGFL-PKDVHIVGYAR  65



>ref|XP_003195210.1| glucose-6-phosphate 1-dehydrogenase [Cryptococcus gattii WM276]
 gb|ADV23423.1| Glucose-6-phosphate 1-dehydrogenase, putative [Cryptococcus gattii 
WM276]
 gb|KIR77946.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii EJB2]
 gb|KIY32028.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii E566]
 gb|KJE00106.1| glucose-6-phosphate dehydrogenase [Cryptococcus gattii NT-10]
Length=503

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++VLGASGDLAKKKTFPAL+ L+ QGFL   DVHI GYAR
Sbjct  27   VIVLGASGDLAKKKTFPALYALFAQGFL-PKDVHIVGYAR  65



>emb|CDH58020.1| glucose-6-phosphate 1-dehydrogenase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=507

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++I+VLGASGDLAKKKT+PALF L+  GFL  N  HI GYAR
Sbjct  18   GFVTIIVLGASGDLAKKKTYPALFKLFRNGFLPEN-THIVGYAR  60



>emb|CDS09438.1| hypothetical protein LRAMOSA10798 [Absidia idahoensis var. thermophila]
Length=514

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = +2

Query  311  TGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +G  +IVVLGASGDLAK+KT+PALF L+  GFL +N  HI GYAR
Sbjct  17   SGFATIVVLGASGDLAKRKTYPALFKLFRNGFLPAN-THIIGYAR  60



>gb|KII95192.1| hypothetical protein PLICRDRAFT_96946 [Plicaturopsis crispa FD-325 
SS-3]
Length=515

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVV GASGDLAKKKT+PALF LY  GFL   DVHI GYAR
Sbjct  27   IVVFGASGDLAKKKTYPALFGLYKSGFL-PRDVHIVGYAR  65



>gb|EMS22982.1| glucose-6-phosphate 1-dehydrogenase [Rhodosporidium toruloides 
NP11]
 emb|CDR44260.1| RHTO0S09e01750g1_1 [Rhodosporidium toruloides]
Length=517

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +2

Query  323  SIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +IVV GASGDLAKKKTFPALF LY+ GFL S D+ I GYAR
Sbjct  33   TIVVAGASGDLAKKKTFPALFGLYNNGFLPS-DIRIIGYAR  72



>gb|ESS60775.1| glucose-6-phosphate dehydrogenase [Trypanosoma cruzi Dm28c]
Length=375

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  320  LSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            L+IVVLGASGDLAKKKTFPALF LY  G L   DV+I GYAR
Sbjct  69   LTIVVLGASGDLAKKKTFPALFQLYCNGML-PRDVNILGYAR  109



>ref|XP_005647602.1| glucose-6-phosphate dehydrogenase 1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23058.1| glucose-6-phosphate dehydrogenase 1 [Coccomyxa subellipsoidea 
C-169]
Length=519

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  320  LSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            LS++VLGASGDLAKKKTFPALF L+ +GFL  N + I GYAR
Sbjct  31   LSVIVLGASGDLAKKKTFPALFTLFKKGFLPKN-LRIIGYAR  71



>gb|KIM46170.1| hypothetical protein M413DRAFT_441239 [Hebeloma cylindrosporum 
h7]
Length=515

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVVLGASGDLAKKKTFPALF LY QGFL   D  I GYAR
Sbjct  27   IVVLGASGDLAKKKTFPALFALYRQGFL-PRDCKIIGYAR  65



>ref|XP_001837181.1| glucose-6-phosphate 1-dehydrogenase [Coprinopsis cinerea okayama7#130]
 gb|EAU84798.1| glucose-6-phosphate 1-dehydrogenase [Coprinopsis cinerea okayama7#130]
Length=515

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKTFPALF LY QGFL   D  I GYAR
Sbjct  27   IIVLGASGDLAKKKTFPALFGLYRQGFL-PRDTKIVGYAR  65



>emb|CEP07228.1| hypothetical protein [Parasitella parasitica]
Length=508

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++I+VLGASGDLAKKKTFPALF L+  GFL +N   I GYAR
Sbjct  17   GAVTIIVLGASGDLAKKKTFPALFGLFRNGFLPAN-TRIVGYAR  59



>emb|CEI98049.1| Putative Glucose-6-phosphate 1-dehydrogenase [Rhizopus microsporus]
Length=508

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++I+VLGASGDLAKKKT+PALF LY  GFL  N   I GYAR
Sbjct  18   GSVTIIVLGASGDLAKKKTYPALFGLYRNGFLPEN-TRIIGYAR  60



>emb|CEG67451.1| Putative Glucose-6-phosphate 1-dehydrogenase [Rhizopus microsporus]
 emb|CEI93601.1| Putative Glucose-6-phosphate 1-dehydrogenase [Rhizopus microsporus]
Length=508

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++I+VLGASGDLAKKKT+PALF LY  GFL  N   I GYAR
Sbjct  18   GSVTIIVLGASGDLAKKKTYPALFGLYRNGFLPEN-TRIIGYAR  60



>ref|XP_572045.1| glucose-6-phosphate 1-dehydrogenase [Cryptococcus neoformans 
var. neoformans JEC21]
 ref|XP_774503.1| hypothetical protein CNBG1480 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL19856.1| hypothetical protein CNBG1480 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW44738.1| glucose-6-phosphate 1-dehydrogenase, putative [Cryptococcus neoformans 
var. neoformans JEC21]
Length=504

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++VLGASGDLAKKKTFPALF L+ QG L   DVHI GYAR
Sbjct  28   VIVLGASGDLAKKKTFPALFALFTQGLL-PKDVHIVGYAR  66



>gb|AFR96471.1| glucose-6-phosphate dehydrogenase [Cryptococcus neoformans var. 
grubii H99]
Length=504

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++VLGASGDLAKKKTFPALF L+ QG L   DVHI GYAR
Sbjct  28   VIVLGASGDLAKKKTFPALFALFTQGLL-PKDVHIVGYAR  66



>pdb|4E9I|A Chain A, Glucose-6-P Dehydrogenase (Apo Form) From Trypanosoma 
Cruzi
 pdb|4E9I|B Chain B, Glucose-6-P Dehydrogenase (Apo Form) From Trypanosoma 
Cruzi
 pdb|4E9I|C Chain C, Glucose-6-P Dehydrogenase (Apo Form) From Trypanosoma 
Cruzi
 pdb|4E9I|D Chain D, Glucose-6-P Dehydrogenase (Apo Form) From Trypanosoma 
Cruzi
 pdb|4EM5|A Chain A, Trypanosoma Cruzi Glucose-6-P Dehydrogenase In Complex 
With G6p
 pdb|4EM5|B Chain B, Trypanosoma Cruzi Glucose-6-P Dehydrogenase In Complex 
With G6p
 pdb|4EM5|C Chain C, Trypanosoma Cruzi Glucose-6-P Dehydrogenase In Complex 
With G6p
 pdb|4EM5|D Chain D, Trypanosoma Cruzi Glucose-6-P Dehydrogenase In Complex 
With G6p
Length=541

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  320  LSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            L+IVVLGASGDLAKKKTFPALF LY  G L   DV+I GYAR
Sbjct  55   LTIVVLGASGDLAKKKTFPALFQLYCNGML-PRDVNILGYAR  95



>gb|ABD72519.1| glucose 6-phosphate dehydrogenase [Trypanosoma cruzi]
Length=555

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  320  LSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            L+IVVLGASGDLAKKKTFPALF LY  G L   DV+I GYAR
Sbjct  69   LTIVVLGASGDLAKKKTFPALFQLYCNGML-PRDVNILGYAR  109



>gb|KIY96886.1| glucose-6-phosphate 1-dehydrogenase [Monoraphidium neglectum]
Length=432

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  317  CLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
             LSIVVLGASGDLAKKK FPALF LY++G L  N V  +GYAR
Sbjct  74   SLSIVVLGASGDLAKKKIFPALFALYYEGLLPPN-VQFYGYAR  115



>gb|EKG04547.1| glucose-6-phosphate 1-dehydrogenase, putative [Trypanosoma cruzi]
Length=589

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  320  LSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            L+IVVLGASGDLAKKKTFPALF LY  G L   DV+I GYAR
Sbjct  103  LTIVVLGASGDLAKKKTFPALFQLYCNGML-PRDVNILGYAR  143



>ref|XP_002393942.1| hypothetical protein MPER_06249 [Moniliophthora perniciosa FA553]
 gb|EEB94872.1| hypothetical protein MPER_06249 [Moniliophthora perniciosa FA553]
Length=265

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKT PALF LY QGFL   DV I GYAR
Sbjct  27   IIVLGASGDLAKKKTLPALFGLYTQGFL-PRDVKIVGYAR  65



>gb|KIJ70545.1| hypothetical protein HYDPIDRAFT_105287 [Hydnomerulius pinastri 
MD-312]
Length=515

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVV GASGDLAKKKT+PALF LY  G+L   DVHI GYAR
Sbjct  28   IVVFGASGDLAKKKTYPALFGLYRNGYL-PKDVHIVGYAR  66



>ref|XP_007315621.1| hypothetical protein SERLADRAFT_461153 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO01904.1| hypothetical protein SERLA73DRAFT_177514 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO27530.1| hypothetical protein SERLADRAFT_461153 [Serpula lacrymans var. 
lacrymans S7.9]
Length=515

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVV GASGDLAKKKT+PALF LY  G+L   DVHI GYAR
Sbjct  28   IVVFGASGDLAKKKTYPALFGLYRNGYL-PKDVHIVGYAR  66



>dbj|BAB96757.1| glucose-6-phosphate dehydrogenase 1 [Chlorella vulgaris]
Length=521

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +2

Query  299  GVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G +E  CL+IVV GASGDLA+KKT+PAL  L+  GFL SN V I GYAR
Sbjct  28   GFSEELCLTIVVAGASGDLARKKTYPALQFLFQHGFLPSN-VAIIGYAR  75



>gb|EPB88420.1| glucose-6-phosphate 1-dehydrogenase [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=509

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++I+VLGASGDLAKKKTFPALF L+  GFL  N   I GYAR
Sbjct  17   GAVTIIVLGASGDLAKKKTFPALFGLFRNGFLPGN-TRIVGYAR  59



>emb|CCD42343.1| similar to glucose-6-phosphate-1-dehydrogenase [Botrytis cinerea 
T4]
Length=210

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKTFPALF LY   FL   DV I GYAR
Sbjct  25   IIVLGASGDLAKKKTFPALFGLYRNQFL-PKDVRIIGYAR  63



>gb|KIJ56677.1| hypothetical protein M422DRAFT_22833 [Sphaerobolus stellatus 
SS14]
Length=522

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVV GASGDLAKKKT+PALF LY QGFL  + VHI GYAR
Sbjct  34   IVVFGASGDLAKKKTYPALFGLYRQGFL-PDGVHIVGYAR  72



>gb|KIZ06619.1| glucose-6-phosphate 1-dehydrogenase [Monoraphidium neglectum]
Length=549

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  320  LSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            LS+VVLGASGDLAKKK FPALF LY++G L  N V  FGYAR
Sbjct  63   LSVVVLGASGDLAKKKIFPALFALYYEGLLPPN-VQFFGYAR  103



>gb|KDR83724.1| hypothetical protein GALMADRAFT_219554 [Galerina marginata CBS 
339.88]
Length=515

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKTFPALF LY QGFL   D  I GYAR
Sbjct  27   IIVLGASGDLAKKKTFPALFALYRQGFL-PRDCKIVGYAR  65



>emb|CDI55460.1| probable ZWF1-glucose-6-phosphate dehydrogenase [Melanopsichium 
pennsylvanicum 4]
Length=502

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVVLGASGDLAKKKTFPALFNL+  G L  N  HI GYAR
Sbjct  15   IVVLGASGDLAKKKTFPALFNLFRLGLL-PNTTHIVGYAR  53



>gb|KIK48890.1| hypothetical protein CY34DRAFT_797680 [Suillus luteus UH-Slu-Lm8-n1]
Length=513

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVV GASGDLAKKKT+PALF LY  G+L   DVHI GYAR
Sbjct  25   IVVFGASGDLAKKKTYPALFGLYSNGYL-PKDVHIVGYAR  63



>dbj|GAN05145.1| glucose-6-phosphate 1-dehydrogenase [Mucor ambiguus]
Length=603

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++I+VLGASGDLAKKKTFPALF L+  GFL  N   I GYAR
Sbjct  17   GAVTIIVLGASGDLAKKKTFPALFGLFRNGFLPGN-TRIVGYAR  59



>emb|CDJ26843.1| Glucose-6-phosphate dehydrogenase, putative [Eimeria mitis]
Length=779

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +2

Query  293  IEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I  ++ET  LS+VV GASGDLAK+KT+PALF+L+ +G L  N VHI G+AR
Sbjct  347  ILSMSETHHLSVVVFGASGDLAKRKTYPALFSLFCEGLLPPN-VHIVGFAR  396



>ref|XP_007338064.1| glucose-6-P dehydrogenase [Auricularia delicata TFB-10046 SS5]
 gb|EJD53731.1| glucose-6-P dehydrogenase [Auricularia delicata TFB-10046 SS5]
Length=508

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +2

Query  323  SIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +I+VLGASGDLAKKKT+PALF LY  GFL    VHI GYAR
Sbjct  21   TIIVLGASGDLAKKKTYPALFGLYKMGFLPKG-VHIVGYAR  60



>gb|EIE81093.1| hypothetical protein RO3G_05798 [Rhizopus delemar RA 99-880]
Length=1060

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  320  LSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            L+I+VLGASGDLAKKKTFPA+F+LY  GFL  N   + GYAR
Sbjct  574  LTIIVLGASGDLAKKKTFPAIFSLYKDGFLPKN-TEVLGYAR  614



>emb|CCX30776.1| Similar to Glucose-6-phosphate 1-dehydrogenase; acc. no. P48826 
[Pyronema omphalodes CBS 100304]
Length=511

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +2

Query  323  SIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++VVLGASGDLAKKKTFPALF LY   FL   D HI GYAR
Sbjct  24   TVVVLGASGDLAKKKTFPALFGLYRNNFL-PKDCHIVGYAR  63



>ref|XP_007268445.1| glucose-6-P dehydrogenase [Fomitiporia mediterranea MF3/22]
 gb|EJD01168.1| glucose-6-P dehydrogenase [Fomitiporia mediterranea MF3/22]
Length=507

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +2

Query  329  VVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +VLGASGDLAKKKTFPALF LY  G+L  N VHI GYAR
Sbjct  22   IVLGASGDLAKKKTFPALFGLYSMGYL-PNGVHIVGYAR  59



>ref|XP_010450423.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase 1, chloroplastic 
[Camelina sativa]
Length=575

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = +2

Query  227  KMESAQWCVEKRGLV--SNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQ  400
            ++ES+  C      +  S D   +  G  E   LSI V+GASGDLAKKK FPALF L+++
Sbjct  57   QLESSNGCATNFASLQDSGDHLTEEHGTKEESTLSITVVGASGDLAKKKIFPALFALFYE  116

Query  401  GFLQSNDVHIFGYAR  445
            G L   D  +FGYAR
Sbjct  117  GCL-PQDFTVFGYAR  130



>emb|CAM82769.1| glucose-6-phosphate-1-dehydrogenase [Nidula niveotomentosa]
Length=215

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKT PALF LY Q FL   DV I GYAR
Sbjct  45   IIVLGASGDLAKKKTLPALFGLYRQHFL-PRDVKIVGYAR  83



>ref|XP_003036452.1| hypothetical protein SCHCODRAFT_254896 [Schizophyllum commune 
H4-8]
 gb|EFJ01550.1| hypothetical protein SCHCODRAFT_254896 [Schizophyllum commune 
H4-8]
Length=482

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+V GASGDLAKKKTFPALF L+ Q FL   DVHI GYAR
Sbjct  27   IIVAGASGDLAKKKTFPALFRLFRQNFL-PRDVHIVGYAR  65



>ref|XP_003036454.1| hypothetical protein SCHCODRAFT_12537 [Schizophyllum commune 
H4-8]
 gb|EFJ01552.1| hypothetical protein SCHCODRAFT_12537 [Schizophyllum commune 
H4-8]
Length=506

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+V GASGDLAKKKTFPALF L+ Q FL   DVHI GYAR
Sbjct  27   IIVAGASGDLAKKKTFPALFRLFRQNFL-PRDVHIVGYAR  65



>ref|XP_007675790.1| hypothetical protein BAUCODRAFT_450434 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC97383.1| hypothetical protein BAUCODRAFT_450434 [Baudoinia compniacensis 
UAMH 10762]
Length=519

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVVLGASGDLAKKKTFPALF L+  GFL   DV I GYAR
Sbjct  27   IVVLGASGDLAKKKTFPALFGLFRNGFL-PKDVKIIGYAR  65



>emb|CDK25966.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=502

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +2

Query  323  SIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            SIVV GASGDLAKKKTFPALF L+ +G+L S   HI GYAR
Sbjct  12   SIVVFGASGDLAKKKTFPALFGLFREGYL-SKTSHIIGYAR  51



>emb|CCM02497.1| predicted protein [Fibroporia radiculosa]
Length=510

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKT+PALF LY  GFL    VHI GYAR
Sbjct  21   IIVLGASGDLAKKKTYPALFGLYRMGFLPKG-VHIVGYAR  59



>emb|CEI98845.1| Putative Glucose-6-phosphate 1-dehydrogenase [Rhizopus microsporus]
Length=508

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++IVVLGASGDLAKKKTFPALF+LY  GFL      I GYAR
Sbjct  20   GGITIVVLGASGDLAKKKTFPALFSLYKDGFLPEK-TEIVGYAR  62



>emb|CEI99397.1| Putative Glucose-6-phosphate 1-dehydrogenase [Rhizopus microsporus]
Length=508

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++IVVLGASGDLAKKKTFPALF+LY  GFL      I GYAR
Sbjct  20   GGITIVVLGASGDLAKKKTFPALFSLYKDGFLPEK-TEIVGYAR  62



>emb|CEG74632.1| Putative Glucose-6-phosphate 1-dehydrogenase [Rhizopus microsporus]
Length=508

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++IVVLGASGDLAKKKTFPALF+LY  GFL      I GYAR
Sbjct  20   GGITIVVLGASGDLAKKKTFPALFSLYKDGFLPEK-TEIVGYAR  62



>emb|CEG79627.1| Putative Glucose-6-phosphate 1-dehydrogenase [Rhizopus microsporus]
Length=508

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  314  GCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            G ++IVVLGASGDLAKKKTFPALF+LY  GFL      I GYAR
Sbjct  20   GGITIVVLGASGDLAKKKTFPALFSLYKDGFLPEK-TEIVGYAR  62



>ref|XP_504275.1| YALI0E22649p [Yarrowia lipolytica]
 emb|CAG79872.1| YALI0E22649p [Yarrowia lipolytica CLIB122]
Length=498

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +2

Query  323  SIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +IVVLGASGDLAKKKTFPALF LY  G L  N V I GYAR
Sbjct  13   TIVVLGASGDLAKKKTFPALFGLYRNGLLPKN-VEIIGYAR  52



>gb|EME43509.1| glucose-6-phosphate dehydrogenase-like protein [Dothistroma septosporum 
NZE10]
Length=511

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVVLGASGDLAKKKTFPALF L+  GFL   DV I GYAR
Sbjct  25   IVVLGASGDLAKKKTFPALFGLFRNGFL-PKDVKIVGYAR  63



>emb|CDM31934.1| Glucose-6-phosphate 1-dehydrogenase [Penicillium roqueforti FM164]
Length=496

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVVLGASGDLAKKKTFPALF L+   FL   D+HI GYAR
Sbjct  24   IVVLGASGDLAKKKTFPALFGLFRNKFL-PKDIHIVGYAR  62



>gb|EDK39626.2| hypothetical protein PGUG_03724 [Meyerozyma guilliermondii ATCC 
6260]
Length=501

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  320  LSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +SIVV GASGDLAKKKTFPALF L+ QG L ++ V IFGYAR
Sbjct  9    VSIVVFGASGDLAKKKTFPALFGLFRQGQLPAS-VKIFGYAR  49



>ref|XP_001484343.1| hypothetical protein PGUG_03724 [Meyerozyma guilliermondii ATCC 
6260]
Length=501

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  320  LSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +SIVV GASGDLAKKKTFPALF L+ QG L ++ V IFGYAR
Sbjct  9    VSIVVFGASGDLAKKKTFPALFGLFRQGQLPAS-VKIFGYAR  49



>dbj|GAA99092.1| hypothetical protein E5Q_05781 [Mixia osmundae IAM 14324]
 gb|KEI39195.1| hypothetical protein L969DRAFT_94274 [Mixia osmundae IAM 14324]
Length=506

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +2

Query  323  SIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            SIVVLGASGDLAKKKTFPALF L+  GFL  N + I GYAR
Sbjct  22   SIVVLGASGDLAKKKTFPALFGLFFNGFLPPN-LQIVGYAR  61



>ref|XP_007366094.1| glucose-6-P dehydrogenase [Dichomitus squalens LYAD-421 SS1]
 gb|EJF61265.1| glucose-6-P dehydrogenase [Dichomitus squalens LYAD-421 SS1]
Length=517

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVVLGASGDLAKKKT+PALF LY  GFL   DV I GYAR
Sbjct  30   IVVLGASGDLAKKKTYPALFGLYRMGFL-PRDVKIVGYAR  68



>ref|XP_008035704.1| glucose-6-P dehydrogenase [Trametes versicolor FP-101664 SS1]
 gb|EIW61924.1| glucose-6-P dehydrogenase [Trametes versicolor FP-101664 SS1]
Length=518

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVVLGASGDLAKKKT+PALF LY  GFL   DV I GYAR
Sbjct  31   IVVLGASGDLAKKKTYPALFGLYRMGFL-PRDVKIVGYAR  69



>gb|EJU06130.1| glucose-6-P dehydrogenase [Dacryopinax sp. DJM-731 SS1]
Length=507

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLA+KKTFPALF L+ QG+L    VHI GYAR
Sbjct  21   IIVLGASGDLAQKKTFPALFTLFRQGYLPKG-VHIVGYAR  59



>emb|CDR40666.1| CYFA0S05e03048g1_1 [Cyberlindnera fabianii]
Length=497

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  323  SIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +IVV GASGDLAKKKTFPALF L+ +G+L S+ V I+GYAR
Sbjct  10   AIVVFGASGDLAKKKTFPALFGLFREGYL-SDTVKIYGYAR  49



>gb|ABF29698.1| glucose-6-phosphate dehydrogenase [Populus suaveolens]
Length=46

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = +2

Query  230  MESAQWCVEKRGLVSNDSF-ADIEGVTETGCLSIVVLGASGDLAKK  364
            M S QW VEKR  + NDSF  + E   E+GCLSI+VLGASGDLAKK
Sbjct  1    MGSGQWLVEKRSGLENDSFLNEHETAPESGCLSIIVLGASGDLAKK  46



>gb|KDQ28957.1| hypothetical protein PLEOSDRAFT_1088946 [Pleurotus ostreatus 
PC15]
Length=514

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKTFPALF LY Q FL   DV I GYAR
Sbjct  27   IIVLGASGDLAKKKTFPALFALYRQQFL-PRDVKIVGYAR  65



>ref|XP_002953022.1| hypothetical protein VOLCADRAFT_82038 [Volvox carteri f. nagariensis]
 gb|EFJ45944.1| hypothetical protein VOLCADRAFT_82038 [Volvox carteri f. nagariensis]
Length=593

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 46/86 (53%), Gaps = 21/86 (24%)
 Frame = +2

Query  188  VIEFGLLTRLEAFKMESAQWCVEKRGLVSNDSFADIEGVTETGCLSIVVLGASGDLAKKK  367
            V  FG L   EA+ +E   W                    +   LS+VV+GASGDLAKKK
Sbjct  76   VFSFGNLNVEEAYDLERNDW--------------------DATSLSVVVVGASGDLAKKK  115

Query  368  TFPALFNLYHQGFLQSNDVHIFGYAR  445
             FPALF LY++G L   + H++G+AR
Sbjct  116  IFPALFALYYEGLLPP-EFHVYGFAR  140



>ref|XP_007844618.1| glucose-6-phosphate 1-dehydrogenase [Moniliophthora roreri MCA 
2997]
 gb|ESK96019.1| glucose-6-phosphate 1-dehydrogenase [Moniliophthora roreri MCA 
2997]
Length=515

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            ++VLGASGDLAKKKT PALF LY QGFL   DV I GYAR
Sbjct  27   VIVLGASGDLAKKKTLPALFGLYTQGFL-PRDVKIVGYAR  65



>gb|KDN50955.1| hypothetical protein RSAG8_00584, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=508

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            IVVLGASGDLAKKKTFPALF LY  G+L    VHI GYAR
Sbjct  22   IVVLGASGDLAKKKTFPALFGLYKIGYLPEG-VHIVGYAR  60



>ref|XP_001386049.2| Glucose-6-phosphate 1-dehydrogenase [Scheffersomyces stipitis 
CBS 6054]
 gb|ABN68020.2| Glucose-6-phosphate 1-dehydrogenase [Scheffersomyces stipitis 
CBS 6054]
Length=499

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +2

Query  323  SIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            +IVV GASGDLAKKKTFPALF L+ +G L S+DV I GYAR
Sbjct  11   TIVVFGASGDLAKKKTFPALFGLFREGHL-SSDVKIIGYAR  50



>gb|KJA30260.1| hypothetical protein HYPSUDRAFT_32409 [Hypholoma sublateritium 
FD-334 SS-4]
Length=515

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKTFPALF L+ QGFL   D  I GYAR
Sbjct  27   IIVLGASGDLAKKKTFPALFALFRQGFL-PRDAKIVGYAR  65



>emb|CCW67650.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=565

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  272  SNDSFADIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            S +  A + G      LSIV+ GASGDLAKKKTFPALF+LY  G L   +++I GYAR
Sbjct  59   STEILAKVSGKVTERPLSIVLFGASGDLAKKKTFPALFDLYCDGLL-PREINIVGYAR  115



>ref|XP_007927065.1| hypothetical protein MYCFIDRAFT_56496 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME81975.1| hypothetical protein MYCFIDRAFT_56496 [Pseudocercospora fijiensis 
CIRAD86]
Length=512

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKTFPALF L+  GFL   DV I GYAR
Sbjct  26   IIVLGASGDLAKKKTFPALFGLFRNGFL-PRDVKIVGYAR  64



>gb|AGG11544.1| hypothetical protein, partial [Trypanosomatidae sp. TS-2013]
Length=566

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  302  VTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            V +   LSIVVLGASGDLAKKKTFPALF LY  G L    V+I GYAR
Sbjct  71   VLDERALSIVVLGASGDLAKKKTFPALFQLYCNGLLPPK-VNIVGYAR  117



>ref|XP_007303038.1| glucose-6-P dehydrogenase [Stereum hirsutum FP-91666 SS1]
 gb|EIM88432.1| glucose-6-P dehydrogenase [Stereum hirsutum FP-91666 SS1]
Length=508

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+V GASGDLAKKKTFPALF LY  GFL   DV I GYAR
Sbjct  21   IIVFGASGDLAKKKTFPALFGLYRDGFL-PRDVKIVGYAR  59



>gb|EUC57752.1| glucose-6-phosphate 1-dehydrogenase [Rhizoctonia solani AG-3 
Rhs1AP]
 gb|KEP50323.1| glucose-6-phosphate 1-dehydrogenase [Rhizoctonia solani 123E]
Length=508

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  326  IVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            I+VLGASGDLAKKKTFPALF LY  G+L    VHI GYAR
Sbjct  22   IIVLGASGDLAKKKTFPALFGLYKIGYLPEG-VHIIGYAR  60



>gb|EXU96667.1| glucose-6-phosphate 1-dehydrogenase [Metarhizium robertsii]
Length=505

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +2

Query  323  SIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            SIVVLGASGDLAKKKT+PALF LY   FL   DV I GYAR
Sbjct  17   SIVVLGASGDLAKKKTYPALFGLYRNQFL-PKDVRIIGYAR  56



>ref|XP_007813860.1| Glucose-6-phosphate 1-dehydrogenase (G6PD) [Metarhizium acridum 
CQMa 102]
 gb|EFY86442.1| Glucose-6-phosphate 1-dehydrogenase (G6PD) [Metarhizium acridum 
CQMa 102]
Length=505

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +2

Query  323  SIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            SIVVLGASGDLAKKKT+PALF LY   FL   DV I GYAR
Sbjct  17   SIVVLGASGDLAKKKTYPALFGLYRNQFL-PKDVRIIGYAR  56



>gb|KDO81817.1| hypothetical protein CISIN_1g007745mg [Citrus sinensis]
Length=589

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = +2

Query  272  SNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            SND+   D+ G   T  +SI V+GASGDLAKKK FPALF LY++GFL  +   IFGYAR
Sbjct  88   SNDAAGFDMNGDEST--VSITVVGASGDLAKKKIFPALFALYYEGFLPKH-FTIFGYAR  143



>ref|XP_006484164.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=589

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = +2

Query  272  SNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            SND+   D+ G   T  +SI V+GASGDLAKKK FPALF LY++GFL  +   IFGYAR
Sbjct  88   SNDAAGFDMNGDEST--VSITVVGASGDLAKKKIFPALFALYYEGFLPKH-FTIFGYAR  143



>gb|KDO81818.1| hypothetical protein CISIN_1g007745mg [Citrus sinensis]
Length=591

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = +2

Query  272  SNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            SND+   D+ G   T  +SI V+GASGDLAKKK FPALF LY++GFL  +   IFGYAR
Sbjct  90   SNDAAGFDMNGDEST--VSITVVGASGDLAKKKIFPALFALYYEGFLPKH-FTIFGYAR  145



>ref|XP_006484163.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=591

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = +2

Query  272  SNDSFA-DIEGVTETGCLSIVVLGASGDLAKKKTFPALFNLYHQGFLQSNDVHIFGYAR  445
            SND+   D+ G   T  +SI V+GASGDLAKKK FPALF LY++GFL  +   IFGYAR
Sbjct  90   SNDAAGFDMNGDEST--VSITVVGASGDLAKKKIFPALFALYYEGFLPKH-FTIFGYAR  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557830460880