BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H22

Length=447
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP09038.1|  unnamed protein product                                103   1e-23   Coffea canephora [robusta coffee]
ref|XP_004250964.1|  PREDICTED: uncharacterized protein LOC101256552  91.3    3e-19   Solanum lycopersicum
ref|XP_009618413.1|  PREDICTED: uncharacterized protein LOC104110593  90.1    7e-19   Nicotiana tomentosiformis
ref|XP_009803866.1|  PREDICTED: uncharacterized protein LOC104249190  89.0    3e-18   Nicotiana sylvestris
ref|XP_008223338.1|  PREDICTED: uncharacterized protein LOC103323...  86.3    2e-17   Prunus mume [ume]
ref|XP_007206561.1|  hypothetical protein PRUPE_ppa019890mg           86.3    2e-17   Prunus persica
ref|XP_010252138.1|  PREDICTED: uncharacterized protein LOC104593819  86.3    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_008223342.1|  PREDICTED: uncharacterized protein LOC103323...  86.3    2e-17   Prunus mume [ume]
ref|XP_009620364.1|  PREDICTED: uncharacterized protein LOC104112207  86.3    2e-17   Nicotiana tomentosiformis
ref|XP_010253216.1|  PREDICTED: uncharacterized protein LOC104594570  85.1    5e-17   
ref|XP_007016455.1|  Uncharacterized protein isoform 1                84.3    9e-17   
gb|KHG00349.1|  Transcription factor SUM-1                            84.0    1e-16   Gossypium arboreum [tree cotton]
gb|KJB55899.1|  hypothetical protein B456_009G100200                  84.0    1e-16   Gossypium raimondii
emb|CAN69364.1|  hypothetical protein VITISV_006045                   82.4    6e-16   Vitis vinifera
ref|XP_004142748.1|  PREDICTED: uncharacterized protein LOC101211670  82.0    8e-16   Cucumis sativus [cucumbers]
ref|XP_008458900.1|  PREDICTED: uncharacterized protein LOC103498168  82.0    9e-16   Cucumis melo [Oriental melon]
ref|XP_002284037.1|  PREDICTED: uncharacterized protein LOC100248455  81.6    1e-15   Vitis vinifera
ref|XP_003633292.1|  PREDICTED: uncharacterized protein LOC100249867  80.9    2e-15   Vitis vinifera
ref|XP_008385139.1|  PREDICTED: uncharacterized protein LOC103447724  80.9    2e-15   Malus domestica [apple tree]
ref|XP_002283778.1|  PREDICTED: uncharacterized protein LOC100253074  80.9    2e-15   Vitis vinifera
ref|XP_009762001.1|  PREDICTED: uncharacterized protein LOC104214083  79.7    3e-15   Nicotiana sylvestris
gb|KJB06676.1|  hypothetical protein B456_001G109100                  80.1    3e-15   Gossypium raimondii
ref|XP_002532293.1|  conserved hypothetical protein                   79.3    7e-15   Ricinus communis
gb|KDP44983.1|  hypothetical protein JCGZ_01483                       79.0    9e-15   Jatropha curcas
ref|XP_011089452.1|  PREDICTED: uncharacterized protein LOC105170399  78.6    1e-14   Sesamum indicum [beniseed]
ref|XP_011461235.1|  PREDICTED: uncharacterized protein LOC101291...  78.6    1e-14   Fragaria vesca subsp. vesca
ref|XP_011461233.1|  PREDICTED: uncharacterized protein LOC101291...  78.2    2e-14   Fragaria vesca subsp. vesca
gb|EYU36263.1|  hypothetical protein MIMGU_mgv1a011694mg              77.8    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_007139239.1|  hypothetical protein PHAVU_008G012900g           77.8    2e-14   Phaseolus vulgaris [French bean]
ref|XP_006603035.1|  PREDICTED: uncharacterized protein LOC102662...  76.3    6e-14   
ref|XP_006574854.1|  PREDICTED: uncharacterized protein LOC100784...  76.3    6e-14   Glycine max [soybeans]
ref|XP_006488301.1|  PREDICTED: uncharacterized protein LOC102610518  76.6    7e-14   Citrus sinensis [apfelsine]
ref|XP_007009365.1|  Pentatricopeptide repeat-containing protein,...  78.2    8e-14   
ref|XP_006424802.1|  hypothetical protein CICLE_v10028872mg           76.3    8e-14   Citrus clementina [clementine]
ref|XP_009353698.1|  PREDICTED: uncharacterized protein LOC103944942  76.3    8e-14   Pyrus x bretschneideri [bai li]
gb|KDO72890.1|  hypothetical protein CISIN_1g036629mg                 76.3    8e-14   Citrus sinensis [apfelsine]
ref|XP_004307538.1|  PREDICTED: uncharacterized protein LOC101294306  76.3    1e-13   Fragaria vesca subsp. vesca
ref|XP_006436013.1|  hypothetical protein CICLE_v10032119mg           75.9    1e-13   Citrus clementina [clementine]
ref|XP_007220066.1|  hypothetical protein PRUPE_ppa025332mg           75.9    1e-13   
ref|XP_008233609.1|  PREDICTED: uncharacterized protein LOC103332636  75.9    1e-13   Prunus mume [ume]
ref|XP_011027862.1|  PREDICTED: uncharacterized protein LOC105128025  75.5    1e-13   Populus euphratica
ref|XP_006378718.1|  hypothetical protein POPTR_0010s21310g           75.5    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011027177.1|  PREDICTED: uncharacterized protein LOC105127533  75.1    2e-13   Populus euphratica
gb|KJB20112.1|  hypothetical protein B456_003G133600                  74.7    3e-13   Gossypium raimondii
gb|KHN13892.1|  hypothetical protein glysoja_016176                   74.3    3e-13   Glycine soja [wild soybean]
ref|XP_002311163.2|  hypothetical protein POPTR_0008s05450g           74.3    4e-13   Populus trichocarpa [western balsam poplar]
ref|XP_002299880.1|  hypothetical protein POPTR_0001s24520g           73.2    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004492124.1|  PREDICTED: uncharacterized protein LOC101499955  72.8    1e-12   Cicer arietinum [garbanzo]
gb|KDP44221.1|  hypothetical protein JCGZ_05688                       72.4    2e-12   Jatropha curcas
ref|XP_010669892.1|  PREDICTED: uncharacterized protein LOC104887013  72.0    3e-12   
ref|XP_011000264.1|  PREDICTED: uncharacterized protein LOC105107884  72.0    3e-12   Populus euphratica
ref|XP_008448398.1|  PREDICTED: uncharacterized protein LOC103490597  71.2    5e-12   Cucumis melo [Oriental melon]
ref|XP_008371593.1|  PREDICTED: uncharacterized protein LOC103434986  70.5    7e-12   
ref|XP_004143104.1|  PREDICTED: uncharacterized protein LOC101220684  70.5    7e-12   
ref|XP_008802763.1|  PREDICTED: uncharacterized protein LOC103716...  69.3    8e-12   Phoenix dactylifera
ref|XP_008370730.1|  PREDICTED: uncharacterized protein LOC103434193  69.3    2e-11   
gb|AES78094.2|  transmembrane protein, putative                       69.7    2e-11   Medicago truncatula
ref|XP_008343543.1|  PREDICTED: uncharacterized protein LOC103406324  69.3    2e-11   
ref|XP_009357714.1|  PREDICTED: uncharacterized protein LOC103948407  68.6    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_008802762.1|  PREDICTED: uncharacterized protein LOC103716...  69.3    3e-11   Phoenix dactylifera
ref|XP_011090081.1|  PREDICTED: uncharacterized protein LOC105170857  67.8    6e-11   Sesamum indicum [beniseed]
ref|XP_009358360.1|  PREDICTED: uncharacterized protein LOC103948985  67.8    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_002314190.1|  hypothetical protein POPTR_0009s03470g           67.8    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011042738.1|  PREDICTED: uncharacterized protein LOC105138381  67.8    1e-10   Populus euphratica
ref|XP_008357486.1|  PREDICTED: uncharacterized protein LOC103421235  67.4    1e-10   Malus domestica [apple tree]
ref|XP_010067398.1|  PREDICTED: uncharacterized protein LOC104454286  66.6    2e-10   Eucalyptus grandis [rose gum]
ref|XP_011091461.1|  PREDICTED: uncharacterized protein LOC105171902  65.9    2e-10   Sesamum indicum [beniseed]
ref|XP_010918393.1|  PREDICTED: uncharacterized protein LOC105042774  67.0    2e-10   
gb|KJB73843.1|  hypothetical protein B456_011G256800                  65.5    2e-10   Gossypium raimondii
gb|KJB73844.1|  hypothetical protein B456_011G256800                  65.5    3e-10   Gossypium raimondii
ref|XP_006345955.1|  PREDICTED: uncharacterized protein LOC102580380  66.2    3e-10   Solanum tuberosum [potatoes]
ref|XP_010922359.1|  PREDICTED: uncharacterized protein LOC105045691  65.9    5e-10   
emb|CDP00076.1|  unnamed protein product                              65.1    9e-10   Coffea canephora [robusta coffee]
ref|XP_004239786.1|  PREDICTED: uncharacterized protein LOC101263027  64.7    1e-09   Solanum lycopersicum
ref|XP_009381069.1|  PREDICTED: uncharacterized protein LOC103969300  63.5    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010108745.1|  hypothetical protein L484_011403                 62.4    1e-08   Morus notabilis
ref|XP_008776689.1|  PREDICTED: uncharacterized protein LOC103696750  62.0    1e-08   Phoenix dactylifera
ref|XP_009625921.1|  PREDICTED: uncharacterized protein LOC104116711  61.6    1e-08   Nicotiana tomentosiformis
gb|EYU18959.1|  hypothetical protein MIMGU_mgv1a012478mg              60.8    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_009416133.1|  PREDICTED: uncharacterized protein LOC103996838  61.6    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685790.1|  PREDICTED: uncharacterized protein LOC104900...  59.7    7e-08   
ref|XP_009769532.1|  PREDICTED: uncharacterized protein LOC104220372  59.3    1e-07   Nicotiana sylvestris
ref|XP_006846119.1|  hypothetical protein AMTR_s00012p00143310        59.3    1e-07   
gb|KJB60678.1|  hypothetical protein B456_009G319200                  55.5    1e-06   Gossypium raimondii
gb|KJB78845.1|  hypothetical protein B456_013G022600                  54.7    3e-06   Gossypium raimondii
gb|EPS57174.1|  hypothetical protein M569_17647                       53.9    3e-06   Genlisea aurea
ref|XP_009384831.1|  PREDICTED: uncharacterized protein LOC103972270  53.9    6e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006280849.1|  hypothetical protein CARUB_v10026835mg           53.1    1e-05   Capsella rubella
ref|XP_010535505.1|  PREDICTED: uncharacterized protein LOC104810787  52.0    3e-05   Tarenaya hassleriana [spider flower]
ref|XP_010520280.1|  PREDICTED: uncharacterized protein LOC104799446  52.0    3e-05   Tarenaya hassleriana [spider flower]
ref|XP_010033140.1|  PREDICTED: uncharacterized protein LOC104422503  51.6    5e-05   Eucalyptus grandis [rose gum]
gb|AFK46332.1|  unknown                                               50.8    6e-05   Lotus japonicus
gb|KFK27464.1|  hypothetical protein AALP_AA8G386500                  50.8    7e-05   Arabis alpina [alpine rockcress]
ref|XP_010454903.1|  PREDICTED: uncharacterized protein LOC104736584  49.7    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010443687.1|  PREDICTED: uncharacterized protein LOC104726517  49.7    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010483553.1|  PREDICTED: uncharacterized protein LOC104762...  49.7    2e-04   
ref|XP_006400971.1|  hypothetical protein EUTSA_v10014249mg           48.9    3e-04   Eutrema salsugineum [saltwater cress]
gb|ACU20158.1|  unknown                                               47.0    3e-04   Glycine max [soybeans]



>emb|CDP09038.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M SFSGLGIGLSFVFGCI +GLVAELYYLLW ++RI +RE E  +T+  ++I+YLFC KK
Sbjct  1    MGSFSGLGIGLSFVFGCIFLGLVAELYYLLWWKKRINNREIEDHFTNYAAEISYLFCWKK  60

Query  392  SNSVVT-RTSTQALTTS  439
            SNS  + R  TQ L  S
Sbjct  61   SNSTDSRRNDTQELAAS  77



>ref|XP_004250964.1| PREDICTED: uncharacterized protein LOC101256552 [Solanum lycopersicum]
Length=276

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 9/84 (11%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY------TSIGSDIAY  373
            M+SFSGLGIGLSFVFGCILM LVAELYYLLWVR+RI   ETE +Y      T   +++++
Sbjct  1    MSSFSGLGIGLSFVFGCILMALVAELYYLLWVRKRIPKNETETQYNNNNTTTPCATELSH  60

Query  374  LFCCKKSNSVVTRTSTQALTTSEL  445
            LFC KK    V   S+Q  + +E+
Sbjct  61   LFCWKKPTKNV---SSQQRSNTEM  81



>ref|XP_009618413.1| PREDICTED: uncharacterized protein LOC104110593 [Nicotiana tomentosiformis]
Length=256

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            MA+F  LGIGLSF+ GC+LMG VAELYYLLWV++ I  R TE +YT+  ++++ +FC K+
Sbjct  1    MATFGALGIGLSFLLGCMLMGFVAELYYLLWVKKGISKRPTEDQYTTYPTELSSIFCWKR  60

Query  392  SNSVVTRTSTQALTT  436
            SNS + +  TQ +TT
Sbjct  61   SNS-IRQNGTQKVTT  74



>ref|XP_009803866.1| PREDICTED: uncharacterized protein LOC104249190 [Nicotiana sylvestris]
Length=344

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 4/79 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRD---RETEGEYTSIGSDIAYLFC  382
            MASFSGLGIGLSFVFGCILMGLVAELYYLLWV++RI      +     +S G+++ +LFC
Sbjct  1    MASFSGLGIGLSFVFGCILMGLVAELYYLLWVKKRIPKSESEDEYSSSSSYGTELFHLFC  60

Query  383  CKKSNSVVTRTSTQALTTS  439
             KK NS V+  S+Q L  +
Sbjct  61   WKKPNS-VSNISSQELNNT  78



>ref|XP_008223338.1| PREDICTED: uncharacterized protein LOC103323148 isoform X1 [Prunus 
mume]
Length=309

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M SFSGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E +Y++   ++    C KK
Sbjct  1    MTSFSGLGIGLSLVFGCLLLALVAELYYLLWWKKRITNREIEEDYSNHAKELFQFSCWKK  60

Query  392  SNSVVTRTSTQ  424
             +S+ T +++Q
Sbjct  61   PSSLQTNSNSQ  71



>ref|XP_007206561.1| hypothetical protein PRUPE_ppa019890mg [Prunus persica]
 gb|EMJ07760.1| hypothetical protein PRUPE_ppa019890mg [Prunus persica]
Length=309

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M SFSGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E +Y++   ++    C KK
Sbjct  1    MTSFSGLGIGLSLVFGCLLLALVAELYYLLWWKKRITNREIEEDYSNHAKELFQFSCWKK  60

Query  392  SNSVVTRTSTQ  424
             +S+ T +++Q
Sbjct  61   PSSLQTNSNSQ  71



>ref|XP_010252138.1| PREDICTED: uncharacterized protein LOC104593819 [Nelumbo nucifera]
Length=317

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 4/78 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S SGLGIGLS VFGC+L+ LVAE YYLLW ++RI +RE E +Y+S   ++ YLFC KK
Sbjct  1    MRSLSGLGIGLSLVFGCLLLALVAEFYYLLWWKKRITNREIEEDYSSSTRELFYLFCWKK  60

Query  392  SNSVVTRTSTQALTTSEL  445
             + +    S+ AL   EL
Sbjct  61   PSPL----SSTALNPQEL  74



>ref|XP_008223342.1| PREDICTED: uncharacterized protein LOC103323148 isoform X2 [Prunus 
mume]
Length=303

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M SFSGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E +Y++   ++    C KK
Sbjct  1    MTSFSGLGIGLSLVFGCLLLALVAELYYLLWWKKRITNREIEEDYSNHAKELFQFSCWKK  60

Query  392  SNSVVTRTSTQ  424
             +S+ T +++Q
Sbjct  61   PSSLQTNSNSQ  71



>ref|XP_009620364.1| PREDICTED: uncharacterized protein LOC104112207 [Nicotiana tomentosiformis]
Length=298

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 5/79 (6%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRD---RETEGEYTSIGSDIAYLFC  382
            MASFSGLGIGLSFVFGCILMGLVAELYYLLWV++RI      +     +S G+++ +L C
Sbjct  1    MASFSGLGIGLSFVFGCILMGLVAELYYLLWVKKRIPKSESEDEYSSSSSYGTELFHLLC  60

Query  383  CKKSNSVVTRTSTQALTTS  439
             KK NSV    S+Q L ++
Sbjct  61   WKKPNSV--NVSSQELNST  77



>ref|XP_010253216.1| PREDICTED: uncharacterized protein LOC104594570 [Nelumbo nucifera]
Length=312

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 4/78 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S LGIGLS VFGC+L+ LVAELYYLLW ++R  +RE E +Y++   ++ YLFCCKK
Sbjct  1    MRSLSSLGIGLSLVFGCLLLALVAELYYLLWWKKRTTNREIEDDYSNSVRELFYLFCCKK  60

Query  392  SNSVVTRTSTQALTTSEL  445
             + +    S+ AL   EL
Sbjct  61   PSLL----SSTALNPQEL  74



>ref|XP_007016455.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007016456.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY34074.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY34075.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=311

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M SFSGLGIGLS VFGC+L+ LVAELYYLLW ++RI   E E +Y++   ++ +LFC KK
Sbjct  1    MTSFSGLGIGLSLVFGCLLLALVAELYYLLWWKKRIASSEVEDDYSNYAKELIHLFCWKK  60

Query  392  S  394
            S
Sbjct  61   S  61



>gb|KHG00349.1| Transcription factor SUM-1 [Gossypium arboreum]
Length=313

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M SFSGLGIGLS VFGC+++ LVAELYYLLW ++RI + E E +YT+   D+  L C KK
Sbjct  15   MKSFSGLGIGLSLVFGCLVLALVAELYYLLWWKKRIANAEVEYDYTNYAKDLVQLLCWKK  74

Query  392  SNSVVTRT  415
            S S+   T
Sbjct  75   SASLHATT  82



>gb|KJB55899.1| hypothetical protein B456_009G100200 [Gossypium raimondii]
 gb|KJB55900.1| hypothetical protein B456_009G100200 [Gossypium raimondii]
Length=294

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M SFSGLGIGLS VFGC+++ LVAELYYLLW ++RI + E E +YT+   D+  L C KK
Sbjct  1    MKSFSGLGIGLSLVFGCLVLALVAELYYLLWWKKRIANAEVEYDYTNYAKDLVQLLCWKK  60

Query  392  SNSVVTRT  415
            S S+   T
Sbjct  61   SASLHATT  68



>emb|CAN69364.1| hypothetical protein VITISV_006045 [Vitis vinifera]
Length=313

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            MASFSGLGI LS VFGC+L+ LVAELYYLLW ++RI +RE E +Y++   ++ Y+FC K+
Sbjct  1    MASFSGLGICLSLVFGCLLLALVAELYYLLWWKKRITNREIEYDYSNXAKELFYIFCWKR  60

Query  392  S  394
             
Sbjct  61   P  61



>ref|XP_004142748.1| PREDICTED: uncharacterized protein LOC101211670 [Cucumis sativus]
 ref|XP_004172466.1| PREDICTED: uncharacterized protein LOC101227394 [Cucumis sativus]
 gb|KGN51289.1| hypothetical protein Csa_5G512960 [Cucumis sativus]
Length=323

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS +FGC+ + LVAELYYLLW ++R  DR+ E +Y+S   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSVIFGCLFLALVAELYYLLWWKKRFTDRDVENDYSSPARELFYMFCWKR  60

Query  392  SNSVV-TRTSTQALTTS  439
            S+S+  T  + Q L++S
Sbjct  61   SSSLSHTALNPQDLSSS  77



>ref|XP_008458900.1| PREDICTED: uncharacterized protein LOC103498168 [Cucumis melo]
Length=323

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS +FGC+ + LVAELYYLLW ++R  DR+ E +Y+S   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSVIFGCLFLALVAELYYLLWWKKRFTDRDVENDYSSPARELFYMFCWKR  60

Query  392  SNSVV-TRTSTQALTTS  439
            S+S+  T  + Q L++S
Sbjct  61   SSSLSHTALNPQDLSSS  77



>ref|XP_002284037.1| PREDICTED: uncharacterized protein LOC100248455 [Vitis vinifera]
Length=319

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            MASFSGLGI LS VFGC+L+ LVAELYYLLW ++RI +RE E +Y++   ++ Y+FC K+
Sbjct  1    MASFSGLGICLSLVFGCLLLALVAELYYLLWWKKRITNREIEYDYSNCAKELFYIFCWKR  60

Query  392  S  394
             
Sbjct  61   P  61



>ref|XP_003633292.1| PREDICTED: uncharacterized protein LOC100249867 [Vitis vinifera]
Length=321

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 53/78 (68%), Gaps = 4/78 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+L+ LVAELYYLLW ++R+   E E +Y+S   ++ Y++C KK
Sbjct  1    MRSLSSVGLGLSIVFGCLLLALVAELYYLLWWKKRLTSTEMEDDYSSPARELLYMYCWKK  60

Query  392  SNSVVTRTSTQALTTSEL  445
             +S+ +R    AL   EL
Sbjct  61   PSSLSSR----ALNPQEL  74



>ref|XP_008385139.1| PREDICTED: uncharacterized protein LOC103447724 [Malus domestica]
Length=312

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 5/83 (6%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYT-----SIGSDIAYL  376
            M SF GLGIGL  VFGC+L+GLVAELYYLLW ++RI +RE E E       S   +I + 
Sbjct  1    MTSFRGLGIGLGIVFGCLLLGLVAELYYLLWGKKRITNREIEEEEDDGYIISHAKEIFHF  60

Query  377  FCCKKSNSVVTRTSTQALTTSEL  445
             C KK NS  TR++  + +   L
Sbjct  61   NCFKKPNSFHTRSNGNSNSHENL  83



>ref|XP_002283778.1| PREDICTED: uncharacterized protein LOC100253074 [Vitis vinifera]
Length=321

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 53/78 (68%), Gaps = 4/78 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+L+ LVAELYYLLW ++R+   E E +Y+S   ++ Y++C KK
Sbjct  1    MRSLSSVGLGLSIVFGCLLLALVAELYYLLWWKKRLTSTEMEDDYSSPARELLYMYCWKK  60

Query  392  SNSVVTRTSTQALTTSEL  445
             +S+ +R    AL   EL
Sbjct  61   PSSLSSR----ALNPQEL  74



>ref|XP_009762001.1| PREDICTED: uncharacterized protein LOC104214083 [Nicotiana sylvestris]
Length=243

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 10/78 (13%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            MA+F  LGIGLSF+ GC+LMG VAELYY+LWV++ I  R TE         ++ +FC KK
Sbjct  1    MATFGALGIGLSFLLGCMLMGFVAELYYILWVKKGISKRPTE---------LSSIFCWKK  51

Query  392  SNSVVTRTSTQALTTSEL  445
            SNS V +  TQ +TT E+
Sbjct  52   SNS-VRKNGTQEVTTIEI  68



>gb|KJB06676.1| hypothetical protein B456_001G109100 [Gossypium raimondii]
 gb|KJB06677.1| hypothetical protein B456_001G109100 [Gossypium raimondii]
Length=298

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M SFSGL IGLS VFGC+L+ LVAELYYLLW ++RI   + E +Y +   ++  LFC KK
Sbjct  1    MTSFSGLSIGLSLVFGCLLLALVAELYYLLWWKKRIISSQVEDDYNNYAKELVQLFCWKK  60

Query  392  SNSVVTRT  415
            S S+   T
Sbjct  61   SASLHAST  68



>ref|XP_002532293.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30077.1| conserved hypothetical protein [Ricinus communis]
Length=322

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VF C+L+ LVAELYYLLW +RRI +RE   +Y+S   ++ Y+FC KK
Sbjct  1    MKSLSSVGLGLSIVFACLLLALVAELYYLLWWKRRITNREIGDDYSSPARELFYMFCLKK  60

Query  392  SNSV  403
             +S+
Sbjct  61   PSSL  64



>gb|KDP44983.1| hypothetical protein JCGZ_01483 [Jatropha curcas]
Length=314

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+L+ L+AELYYLLW +RR  +RE   +Y+S   ++ Y+FC KK
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALIAELYYLLWWKRRFTNREIGDDYSSPARELFYMFCLKK  60

Query  392  SNSV  403
             +S+
Sbjct  61   PSSL  64



>ref|XP_011089452.1| PREDICTED: uncharacterized protein LOC105170399 [Sesamum indicum]
Length=289

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 52/82 (63%), Gaps = 14/82 (17%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRI----RDRETEGEYTSIGSDIAYLF  379
            M SFSGLGIGLSFVFGCILMGLV ELYY LW ++R+      RE E        D ++LF
Sbjct  1    MGSFSGLGIGLSFVFGCILMGLVGELYYFLWWKKRVGYTSSTREIE--------DFSFLF  52

Query  380  CCKK--SNSVVTRTSTQALTTS  439
            C K+  S S  +  STQ LT S
Sbjct  53   CWKRPSSTSFNSAGSTQELTNS  74



>ref|XP_011461235.1| PREDICTED: uncharacterized protein LOC101291610 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=308

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCC-K  388
            M S SGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E E  S    + + F C K
Sbjct  1    MTSLSGLGIGLSLVFGCLLLALVAELYYLLWWKKRITNREIEDENYSNQPKVLFQFSCFK  60

Query  389  KSNSVVT  409
            K +S+ T
Sbjct  61   KPSSLQT  67



>ref|XP_011461233.1| PREDICTED: uncharacterized protein LOC101291610 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011461234.1| PREDICTED: uncharacterized protein LOC101291610 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=321

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCC-K  388
            M S SGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E E  S    + + F C K
Sbjct  1    MTSLSGLGIGLSLVFGCLLLALVAELYYLLWWKKRITNREIEDENYSNQPKVLFQFSCFK  60

Query  389  KSNSVVT  409
            K +S+ T
Sbjct  61   KPSSLQT  67



>gb|EYU36263.1| hypothetical protein MIMGU_mgv1a011694mg [Erythranthe guttata]
Length=273

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M SFSGLGIGLSFVFGCILMGLV ELYYLLW +++I    T    +    D ++ FC + 
Sbjct  1    MGSFSGLGIGLSFVFGCILMGLVGELYYLLWWKKKIIANSTNSSSSRENDDFSFHFCWRN  60

Query  392  SNSVVTRTSTQALTTS  439
             +S     ST  LT S
Sbjct  61   PSSF---RSTAQLTNS  73



>ref|XP_007139239.1| hypothetical protein PHAVU_008G012900g [Phaseolus vulgaris]
 gb|ESW11233.1| hypothetical protein PHAVU_008G012900g [Phaseolus vulgaris]
Length=283

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS +FGC+L+ LVAE+YYLLW ++RI +RE E +Y +   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSIIFGCLLLALVAEVYYLLWWKKRITNREIENDYGNPVKELFYMFCWKR  60

Query  392  SNSVVTRTSTQALTTSEL  445
             +S   R +  + T  EL
Sbjct  61   PSSSSLRQT--SFTPPEL  76



>ref|XP_006603035.1| PREDICTED: uncharacterized protein LOC102662096 isoform X1 [Glycine 
max]
 ref|XP_006603036.1| PREDICTED: uncharacterized protein LOC102662096 isoform X2 [Glycine 
max]
Length=283

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS +FGC+L+ LVAE+YYLLW ++RI +RE E  Y +   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSIIFGCLLLALVAEVYYLLWWKKRITNREIENNYGNPVKELFYMFCWKR  60

Query  392  SNSVVTRTSTQALTTSEL  445
             +S   R ++   T  EL
Sbjct  61   PSSSSLRQTS--FTPPEL  76



>ref|XP_006574854.1| PREDICTED: uncharacterized protein LOC100784512 isoform X1 [Glycine 
max]
 gb|KHN27223.1| hypothetical protein glysoja_025507 [Glycine soja]
Length=285

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS +FGC+L+ LVAE+YYLLW ++RI +RE E +Y +   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSIIFGCLLLALVAEVYYLLWWKKRITNREIENDYGNPVKELFYMFCWKR  60

Query  392  SNSVVTRTST  421
             +S   R ++
Sbjct  61   PSSSSLRQTS  70



>ref|XP_006488301.1| PREDICTED: uncharacterized protein LOC102610518 [Citrus sinensis]
Length=314

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDR-ETEGEYTSIGSD-IAYLFCC  385
            MASFSGLGIGLS VFGC+ + LVAELYY+LW ++RI  R E E EY +   +    LFC 
Sbjct  1    MASFSGLGIGLSLVFGCLFLALVAELYYVLWWKKRINHRQEIEDEYGNYAKEYFIQLFCW  60

Query  386  KKSNSV  403
            KK +S+
Sbjct  61   KKPSSL  66



>ref|XP_007009365.1| Pentatricopeptide repeat-containing protein, putative [Theobroma 
cacao]
 gb|EOY18175.1| Pentatricopeptide repeat-containing protein, putative [Theobroma 
cacao]
Length=488

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 53/78 (68%), Gaps = 4/78 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+++ LVAELYYLLW ++R+  R+ E +Y++   +  Y+FC K+
Sbjct  171  MKSLSSVGLGLSIVFGCLVLALVAELYYLLWWKKRLTSRDIENDYSNPAREFFYMFCWKR  230

Query  392  SNSVVTRTSTQALTTSEL  445
            S+S+    S  AL   E+
Sbjct  231  SSSM----SHTALNPQEI  244



>ref|XP_006424802.1| hypothetical protein CICLE_v10028872mg [Citrus clementina]
 gb|ESR38042.1| hypothetical protein CICLE_v10028872mg [Citrus clementina]
Length=314

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDR-ETEGEYTSIGSD-IAYLFCC  385
            MASFSGLGIGLS VFGC+ + LVAELYY+LW ++RI  R E E EY +   +    LFC 
Sbjct  1    MASFSGLGIGLSLVFGCLFLALVAELYYVLWWKKRINHRQEIEDEYGNYAKEYFIQLFCW  60

Query  386  KKSNSV  403
            KK +S+
Sbjct  61   KKPSSL  66



>ref|XP_009353698.1| PREDICTED: uncharacterized protein LOC103944942 [Pyrus x bretschneideri]
Length=312

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 50/83 (60%), Gaps = 5/83 (6%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYT-----SIGSDIAYL  376
            M SFSGLGIGL  VFGC+L+ LVAELYYLLW ++RI +RE E E       S   +I   
Sbjct  1    MTSFSGLGIGLGVVFGCLLLALVAELYYLLWGKKRITNREIEEEEDDGYIRSHAKEIFQF  60

Query  377  FCCKKSNSVVTRTSTQALTTSEL  445
             C KK NS  T ++  + +   L
Sbjct  61   NCFKKPNSFHTSSNGNSNSHQNL  83



>gb|KDO72890.1| hypothetical protein CISIN_1g036629mg [Citrus sinensis]
Length=314

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDR-ETEGEYTSIGSD-IAYLFCC  385
            MASFSGLGIGLS VFGC+ + LVAELYY+LW ++RI  R E E EY +   +    LFC 
Sbjct  1    MASFSGLGIGLSLVFGCLFLALVAELYYVLWWKKRINHRQEIEDEYGNYAKEYFIQLFCW  60

Query  386  KKSNSV  403
            KK +S+
Sbjct  61   KKPSSL  66



>ref|XP_004307538.1| PREDICTED: uncharacterized protein LOC101294306 [Fragaria vesca 
subsp. vesca]
Length=332

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R+ +R+ E +Y+S   ++ Y+FC ++
Sbjct  1    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRLTNRDIEDDYSSPSKEVFYMFCWRR  60

Query  392  SNSVVTR--TSTQALTTS  439
            ++  ++    S Q L +S
Sbjct  61   TSKSLSHMAQSPQQLCSS  78



>ref|XP_006436013.1| hypothetical protein CICLE_v10032119mg [Citrus clementina]
 ref|XP_006486089.1| PREDICTED: uncharacterized protein LOC102616127 [Citrus sinensis]
 gb|ESR49253.1| hypothetical protein CICLE_v10032119mg [Citrus clementina]
 gb|KDO67646.1| hypothetical protein CISIN_1g041532mg [Citrus sinensis]
Length=323

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 51/78 (65%), Gaps = 4/78 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+L+ L+AELYYLLW ++R   RE E +Y++   +  Y+FC ++
Sbjct  1    MKSLSSVGLGLSVVFGCLLLALIAELYYLLWWKKRFTRREIESDYSNPAREFLYMFCLRR  60

Query  392  SNSVVTRTSTQALTTSEL  445
             +S+    S  AL   +L
Sbjct  61   PSSL----SHSALNPQKL  74



>ref|XP_007220066.1| hypothetical protein PRUPE_ppa025332mg [Prunus persica]
 gb|EMJ21265.1| hypothetical protein PRUPE_ppa025332mg [Prunus persica]
Length=321

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R  +RE E +Y+S   ++ Y FC ++
Sbjct  1    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRFTNREIENDYSSPQKELFYTFCWRR  60

Query  392  SNSV  403
            ++S+
Sbjct  61   NSSL  64



>ref|XP_008233609.1| PREDICTED: uncharacterized protein LOC103332636 [Prunus mume]
Length=324

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R  +RE E +Y+S   ++ Y FC ++
Sbjct  4    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRFTNREIENDYSSPQKELFYTFCWRR  63

Query  392  SNSV  403
            ++S+
Sbjct  64   NSSL  67



>ref|XP_011027862.1| PREDICTED: uncharacterized protein LOC105128025 [Populus euphratica]
Length=316

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+L+ LVAELYYLLW ++R  ++E  G+Y+S   ++ ++FC +K
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAELYYLLWWKKRFANKEIGGDYSSPTRELFFMFCLRK  60

Query  392  SNSV  403
             +S+
Sbjct  61   PSSL  64



>ref|XP_006378718.1| hypothetical protein POPTR_0010s21310g [Populus trichocarpa]
 gb|ERP56515.1| hypothetical protein POPTR_0010s21310g [Populus trichocarpa]
Length=316

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+L+ LVAELYYLLW +RR  ++E   +Y+S   ++ ++FC +K
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAELYYLLWWKRRFANKEIGDDYSSPARELFFMFCLRK  60

Query  392  SNSV  403
             +S+
Sbjct  61   PSSL  64



>ref|XP_011027177.1| PREDICTED: uncharacterized protein LOC105127533 [Populus euphratica]
 ref|XP_011027178.1| PREDICTED: uncharacterized protein LOC105127533 [Populus euphratica]
Length=316

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+L+ LVAELYYLLW +RR+ ++E   +Y+S   ++ ++FC +K
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAELYYLLWWKRRLANKEIGDDYSSPARELFFMFCLRK  60

Query  392  SNSV  403
             +++
Sbjct  61   PSTL  64



>gb|KJB20112.1| hypothetical protein B456_003G133600 [Gossypium raimondii]
Length=303

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR--IRDRETEGEYTSIGSDIAYLFCC  385
            M SFSGLGIGLS VFGC+ + LVAELYYLLW +++  +   + E +Y+    ++ +LFC 
Sbjct  1    MTSFSGLGIGLSLVFGCLFLALVAELYYLLWWKKKRIVSSSQVEDDYSKYAKELIHLFCW  60

Query  386  KKSNSV  403
            KKS+ +
Sbjct  61   KKSSPL  66



>gb|KHN13892.1| hypothetical protein glysoja_016176 [Glycine soja]
Length=283

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS +FGC+L+ LVAE+YYL W ++RI +RE E  Y +   ++ Y+FC K+
Sbjct  1    MKSLSSVGLGLSIIFGCLLLALVAEVYYLPWWKKRITNREIENNYGNPVKELFYMFCWKR  60

Query  392  SNSVVTRTSTQALTTSEL  445
             +S   R +  + T  EL
Sbjct  61   PSSSSLRQT--SFTPPEL  76



>ref|XP_002311163.2| hypothetical protein POPTR_0008s05450g [Populus trichocarpa]
 gb|EEE88530.2| hypothetical protein POPTR_0008s05450g [Populus trichocarpa]
Length=316

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+L+ LVAELYYLLW ++R  ++E   +Y+S   ++ ++FC +K
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAELYYLLWWKKRFANKEIGDDYSSPARELFFMFCLRK  60

Query  392  SNSV  403
             +S+
Sbjct  61   PSSL  64



>ref|XP_002299880.1| hypothetical protein POPTR_0001s24520g [Populus trichocarpa]
 gb|EEE84685.1| hypothetical protein POPTR_0001s24520g [Populus trichocarpa]
Length=313

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDR--ETEGEY-TSIGSDIAYLFC  382
            M SFSGLG+GLS VFGC L+ LVAEL+YLLW ++R+ +R  E E +Y +S   +  +L C
Sbjct  1    MVSFSGLGLGLSLVFGCFLLALVAELFYLLWWKKRVTNRKVEEEDDYSSSYAKEFFHLIC  60

Query  383  CKKSNSVVTRTSTQALTTSE  442
             KK++S+ +  +   +   E
Sbjct  61   WKKASSLRSNITQDGVREPE  80



>ref|XP_004492124.1| PREDICTED: uncharacterized protein LOC101499955 [Cicer arietinum]
Length=278

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M S S +G+GLS VFGC+L+ LVAE+YYLLW ++RI  RE E +  +   +I ++FC K 
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAEVYYLLWWKKRIIKREIENDNVNPMKEIFHMFCWKT  60

Query  392  SNSVVTRTS  418
            S++  T  +
Sbjct  61   SSTSFTPPN  69



>gb|KDP44221.1| hypothetical protein JCGZ_05688 [Jatropha curcas]
Length=311

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (68%), Gaps = 3/74 (4%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETE--GEYTS-IGSDIAYLFC  382
            M SFSGLGIGLS VFGC+L+ LVAELYYLL+ ++R+ +RE E   +Y+S    +  +L C
Sbjct  1    MGSFSGLGIGLSLVFGCLLLALVAELYYLLFWKKRVANREIEENEDYSSNYAKEFFHLIC  60

Query  383  CKKSNSVVTRTSTQ  424
             KK  S +   ST 
Sbjct  61   WKKHTSHLQGNSTN  74



>ref|XP_010669892.1| PREDICTED: uncharacterized protein LOC104887013 [Beta vulgaris 
subsp. vulgaris]
Length=316

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 3/73 (4%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYT--SIGSDIAYLFCC  385
            M S S +G+GLS VF C+L+ L+AE+YYLLW +RRI  RE + +Y   +   D  Y+FCC
Sbjct  3    MKSLSRVGLGLSVVFTCLLLALIAEIYYLLWWKRRIFKREIKDDYNTRNTSKDYFYMFCC  62

Query  386  K-KSNSVVTRTST  421
            K +SN+     ST
Sbjct  63   KTQSNASALNIST  75



>ref|XP_011000264.1| PREDICTED: uncharacterized protein LOC105107884 [Populus euphratica]
Length=319

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDR--ETEGEY-TSIGSDIAYLFC  382
            M SFSGLG+GLS VFGC L+ LVAEL+YLLW ++R+ +R  E E +Y +S   +  +L C
Sbjct  7    MISFSGLGLGLSLVFGCFLLALVAELFYLLWWKKRVTNRKVEEEDDYSSSYAKEFFHLIC  66

Query  383  CKKSNSVVTRTSTQALTTSE  442
             KK++S  ++ +   +   E
Sbjct  67   WKKASSFRSKITQGGVREPE  86



>ref|XP_008448398.1| PREDICTED: uncharacterized protein LOC103490597 [Cucumis melo]
Length=295

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR-IRDRETEGEYTSIGSDIAYLFC  382
            M SFSGLGIGLS VFGC+L  LVAELYYLLW ++R I   + E E+T+   +  +L C
Sbjct  1    MTSFSGLGIGLSLVFGCLLFALVAELYYLLWWKKRSITSSQAEDEFTNYAKEFFHLIC  58



>ref|XP_008371593.1| PREDICTED: uncharacterized protein LOC103434986 [Malus domestica]
 ref|XP_008343565.1| PREDICTED: uncharacterized protein LOC103406346 [Malus domestica]
Length=280

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY-TSIGSDIAYLFCCK  388
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R   RE +  Y +S   +I Y+FC +
Sbjct  4    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRFTSREIDSGYSSSPQKEIFYMFCWR  63

Query  389  KSNSVVTRTST  421
            +S    +R  T
Sbjct  64   RSTCTPSRNPT  74



>ref|XP_004143104.1| PREDICTED: uncharacterized protein LOC101220684 [Cucumis sativus]
 gb|KGN47164.1| hypothetical protein Csa_6G191280 [Cucumis sativus]
Length=295

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR-IRDRETEGEYTSIGSDIAYLFC  382
            M SFSGLGIGLS VFGC+L  LVAELYYLLW ++R I     E E+T+   +  +L C
Sbjct  1    MTSFSGLGIGLSLVFGCLLFALVAELYYLLWWKKRSITSSHVEDEFTNYAKEFFHLIC  58



>ref|XP_008802763.1| PREDICTED: uncharacterized protein LOC103716515 isoform X2 [Phoenix 
dactylifera]
Length=172

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M   S LGIGL  V G + + L AELYYL W ++R  +R+ E  YTS G ++ YLFC KK
Sbjct  1    MGRLSSLGIGLILVSGFLFLALAAELYYLFWWKKRGANRDIEDNYTSPGRELLYLFCWKK  60

Query  392  SNSV-VTRTSTQALTTS  439
             +S+  T  + Q ++TS
Sbjct  61   PSSLSPTALNPQEISTS  77



>ref|XP_008370730.1| PREDICTED: uncharacterized protein LOC103434193 [Malus domestica]
Length=273

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY-TSIGSDIAYLFCCK  388
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R  +RE +  Y +S   +I Y+FC +
Sbjct  4    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRFTNREIDNGYSSSPQKEIFYMFCWR  63

Query  389  KSNSVVTRTST  421
            +S    ++  T
Sbjct  64   RSTCTSSQNPT  74



>gb|AES78094.2| transmembrane protein, putative [Medicago truncatula]
Length=293

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 5/80 (6%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGS--DIAYLFCC  385
            M S S +G+GLS VFGC+L+ LVAE+YYLLW +++I  RE E +Y +     ++ Y+FC 
Sbjct  1    MKSLSSVGLGLSIVFGCLLLALVAEVYYLLWWKKKIIKREIENDYGNGNPLKELFYMFCW  60

Query  386  KKSNSVVTRTSTQALTTSEL  445
            K+ ++ + +T     T  EL
Sbjct  61   KRPSTSLRQT---GFTPPEL  77



>ref|XP_008343543.1| PREDICTED: uncharacterized protein LOC103406324 [Malus domestica]
Length=273

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY-TSIGSDIAYLFCCK  388
            M S S +G+GLS VFGC+ + L+AELYYLLW ++R  +RE +  Y +S   +I Y+FC +
Sbjct  4    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKRFTNREIDNGYSSSPQKEIFYMFCWR  63

Query  389  KSNSVVTRTST  421
            +S    ++  T
Sbjct  64   RSTCTSSQNPT  74



>ref|XP_009357714.1| PREDICTED: uncharacterized protein LOC103948407 [Pyrus x bretschneideri]
Length=280

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY-TSIGSDIAYLFCCK  388
            M S S +G+GLS VFGC+ + L+AELYYLLW +++   RE +  Y +S   +I Y+FC +
Sbjct  4    MKSLSSVGLGLSVVFGCLFLALIAELYYLLWWKKKFTSREIDSGYSSSPQKEIFYMFCWR  63

Query  389  KSNSVVTRTST  421
            +S    +R  T
Sbjct  64   RSTCTSSRNPT  74



>ref|XP_008802762.1| PREDICTED: uncharacterized protein LOC103716515 isoform X1 [Phoenix 
dactylifera]
Length=328

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M   S LGIGL  V G + + L AELYYL W ++R  +R+ E  YTS G ++ YLFC KK
Sbjct  1    MGRLSSLGIGLILVSGFLFLALAAELYYLFWWKKRGANRDIEDNYTSPGRELLYLFCWKK  60

Query  392  SNSV-VTRTSTQALTTS  439
             +S+  T  + Q ++TS
Sbjct  61   PSSLSPTALNPQEISTS  77



>ref|XP_011090081.1| PREDICTED: uncharacterized protein LOC105170857 [Sesamum indicum]
Length=274

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR  316
            M SFSG+GIGLSFVFGCILMGLVAE+YYLLW ++R
Sbjct  1    MGSFSGVGIGLSFVFGCILMGLVAEVYYLLWWKKR  35



>ref|XP_009358360.1| PREDICTED: uncharacterized protein LOC103948985 [Pyrus x bretschneideri]
Length=322

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 6/75 (8%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY------TSIGSDIAY  373
            M S SGLGIGLS VFGC+L+ LVAELYYLLW ++RI +RE E E       ++   +I  
Sbjct  1    MTSLSGLGIGLSVVFGCLLLALVAELYYLLWWKKRITNREIEEEEDDDYISSNQAKEIFQ  60

Query  374  LFCCKKSNSVVTRTS  418
              C KK NS+ T ++
Sbjct  61   FNCFKKPNSLHTSSN  75



>ref|XP_002314190.1| hypothetical protein POPTR_0009s03470g [Populus trichocarpa]
 gb|EEE88145.1| hypothetical protein POPTR_0009s03470g [Populus trichocarpa]
Length=312

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETE---GEYTSIGSDIAYLFC  382
            M SFS LGIGL  VFGC+L+ +VAELYYLLW ++RI +RE E   G  ++      +L C
Sbjct  1    MTSFSELGIGLGLVFGCLLLAIVAELYYLLWWKKRISNREVEEDDGYSSNYAKGFFHLIC  60

Query  383  CKKSN  397
             KK +
Sbjct  61   WKKPS  65



>ref|XP_011042738.1| PREDICTED: uncharacterized protein LOC105138381 [Populus euphratica]
Length=312

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 3/65 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETE---GEYTSIGSDIAYLFC  382
            M SFS LGIGL  VFGC+L+ +VAELYYLLW ++RI +RE E   G  ++  +   +L C
Sbjct  1    MTSFSELGIGLGLVFGCLLLAIVAELYYLLWWKKRISNREVEEDDGYSSNYATGFFHLIC  60

Query  383  CKKSN  397
             KK +
Sbjct  61   WKKPS  65



>ref|XP_008357486.1| PREDICTED: uncharacterized protein LOC103421235 [Malus domestica]
Length=322

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY------TSIGSDIAY  373
            M S SGLGIGLS VFGC+L+ LVAELYYLLW ++R+ +RE E E       ++   +I  
Sbjct  1    MTSLSGLGIGLSVVFGCLLLALVAELYYLLWWKKRVTNREIEEEEDDDYISSNHAKEIFQ  60

Query  374  LFCCKKSNSVVTRTSTQALTTSEL  445
              C KK NS+ T ++  + +   L
Sbjct  61   FNCFKKPNSLHTSSNRNSNSHENL  84



>ref|XP_010067398.1| PREDICTED: uncharacterized protein LOC104454286 [Eucalyptus grandis]
 gb|KCW65522.1| hypothetical protein EUGRSUZ_G02923 [Eucalyptus grandis]
 gb|KCW65523.1| hypothetical protein EUGRSUZ_G02923 [Eucalyptus grandis]
Length=284

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 5/79 (6%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGS-DIAYLFCCK  388
            M S SG+G+GLS VFGC+++ L AE YYLL  ++R  +R  E  Y +  + ++ ++FCCK
Sbjct  1    MKSLSGIGLGLSVVFGCLVLALFAEFYYLLCWKKRFTNRTIEEGYNNTPTKELLHIFCCK  60

Query  389  KSNSVVTRTSTQALTTSEL  445
            K +S+    S  AL   EL
Sbjct  61   KPSSL----SQTALNPQEL  75



>ref|XP_011091461.1| PREDICTED: uncharacterized protein LOC105171902 [Sesamum indicum]
Length=243

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 12/75 (16%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRE-----------TEGEYTSIG  358
            M S SG+GIGLS VFGC+L+ LVAELYYLLW ++R+  ++           T  +  +  
Sbjct  1    MKSLSGVGIGLSLVFGCLLLALVAELYYLLWWKKRVMSKKRSSSSSSSNQVTTHQIPAET  60

Query  359  SDIAYLF-CCKKSNS  400
                Y+F CC+K  S
Sbjct  61   PQFCYMFWCCRKPTS  75



>ref|XP_010918393.1| PREDICTED: uncharacterized protein LOC105042774 [Elaeis guineensis]
Length=328

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M   S LGIGLS V G + + L AELYYL W ++R  + + E  YT+ G ++ YLFC KK
Sbjct  1    MRRLSSLGIGLSLVSGFLFLALAAELYYLFWWKKRGANGDIEDNYTNPGRELLYLFCWKK  60

Query  392  SNSV-VTRTSTQALTTS  439
             +S+  T  + Q ++TS
Sbjct  61   PSSLSSTALNPQEISTS  77



>gb|KJB73843.1| hypothetical protein B456_011G256800 [Gossypium raimondii]
Length=201

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRD-RETEGEYTSIGSDIAYLFCCK  388
            M S S +G+GLS VF C+ + L+ ELYYLLW ++R+   R+ E +Y +  S++ Y+FC K
Sbjct  1    MKSLSSVGLGLSIVFCCLFLALIIELYYLLWWKKRLTSTRDIENDYNNPASELFYMFCWK  60

Query  389  KS  394
            K+
Sbjct  61   KT  62



>gb|KJB73844.1| hypothetical protein B456_011G256800 [Gossypium raimondii]
Length=259

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRD-RETEGEYTSIGSDIAYLFCCK  388
            M S S +G+GLS VF C+ + L+ ELYYLLW ++R+   R+ E +Y +  S++ Y+FC K
Sbjct  1    MKSLSSVGLGLSIVFCCLFLALIIELYYLLWWKKRLTSTRDIENDYNNPASELFYMFCWK  60

Query  389  KS  394
            K+
Sbjct  61   KT  62



>ref|XP_006345955.1| PREDICTED: uncharacterized protein LOC102580380 [Solanum tuberosum]
Length=300

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 48/80 (60%), Gaps = 4/80 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY--TSIGSDIAYLFCC  385
            M S S +G+ LS VFGC+L+ L+AELYYLLW + RI     E  Y  +S   +  Y+FC 
Sbjct  1    MKSLSSVGLALSVVFGCLLLALIAELYYLLWWKNRILKTNLEDGYSNSSKAREFCYMFCG  60

Query  386  KKSNSVVTRTSTQALTTSEL  445
            K S + +  T T AL + E+
Sbjct  61   KPSTTSL--TPTNALKSQEI  78



>ref|XP_010922359.1| PREDICTED: uncharacterized protein LOC105045691 [Elaeis guineensis]
Length=328

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M   S L IGLS V G + + L AELYYL W ++R  +R+ E  YTS   ++ YLFC KK
Sbjct  1    MGHLSSLRIGLSLVSGFLFLALAAELYYLFWWKKREPNRDIEANYTSPVRELLYLFCWKK  60

Query  392  SNSV-VTRTSTQALTTS  439
             +S   T  + Q ++TS
Sbjct  61   PSSQSPTALNPQEISTS  77



>emb|CDP00076.1| unnamed protein product [Coffea canephora]
Length=327

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRET-EGEYTSIGS---DIAYLF  379
            M S S +G+GLS VFGC+ + L AELYYLLW ++RI +R   E  Y+S G+   +  Y  
Sbjct  1    MKSLSSVGLGLSLVFGCLFLALAAELYYLLWWKKRIPNRHNIEDGYSSTGTVAKESFYKL  60

Query  380  CCKKSNSV  403
            C KK +S+
Sbjct  61   CWKKPSSL  68



>ref|XP_004239786.1| PREDICTED: uncharacterized protein LOC101263027 [Solanum lycopersicum]
Length=301

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEY--TSIGSDIAYLFCC  385
            M S S +G+ LS VFGC+L+ L+AELYYLLW + RI     E  Y  +S   +  ++FC 
Sbjct  1    MKSLSSVGLALSVVFGCLLLALIAELYYLLWWKNRILKTNLEDGYSNSSKAREFCFMFCG  60

Query  386  KKSNSVVTRTSTQALTTSEL  445
            K S + +T  S  AL + E+
Sbjct  61   KPSTTSLTPPSN-ALKSQEI  79



>ref|XP_009381069.1| PREDICTED: uncharacterized protein LOC103969300 [Musa acuminata 
subsp. malaccensis]
Length=295

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 42/78 (54%), Gaps = 4/78 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M     LG+GLS + GCI + LVAE YY  W ++R   R+ E  Y+S   ++  LFC KK
Sbjct  1    MKPLGCLGVGLSLISGCIFLALVAEFYYFFWWKKRGSSRDVEENYSSPVKELPDLFCWKK  60

Query  392  SNSVVTRTSTQALTTSEL  445
              S+    S  AL   E+
Sbjct  61   PTSL----SPTALKPQEI  74



>ref|XP_010108745.1| hypothetical protein L484_011403 [Morus notabilis]
 gb|EXC20159.1| hypothetical protein L484_011403 [Morus notabilis]
Length=332

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 7/81 (9%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGE---YTSIGSDIAYLFC  382
            M S S +GIGLS VF C+ + L+AELYYL W ++R+    +E E   Y S   ++ Y+FC
Sbjct  1    MKSLSSVGIGLSVVFSCLFLALIAELYYLFWWKKRLITNRSEIENHDYISPAKELFYMFC  60

Query  383  CKKSNSVVTRTSTQALTTSEL  445
             +K ++     S  AL   E+
Sbjct  61   WRKHSAF----SHSALNPQEI  77



>ref|XP_008776689.1| PREDICTED: uncharacterized protein LOC103696750 [Phoenix dactylifera]
Length=320

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M   S LGIGLS V G + + L AELYYL W ++R  + + E  YT+ G ++  LFC KK
Sbjct  1    MRRLSSLGIGLSLVSGFLFLALAAELYYLFWWKKRGANGDIEDNYTNPGRELLCLFCWKK  60

Query  392  SNSV-VTRTSTQALTTS  439
             +S+  T  + Q ++TS
Sbjct  61   PSSLSSTALNPQEISTS  77



>ref|XP_009625921.1| PREDICTED: uncharacterized protein LOC104116711 [Nicotiana tomentosiformis]
Length=302

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 4/79 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAY-LFCCK  388
            M S S +G+ LS VFGC+L+ L+AELYYLLW + RI     E  Y+S  +   + +FC K
Sbjct  1    MKSLSSVGLALSLVFGCLLLALIAELYYLLWWKNRIVKTSLEDGYSSNKAKEFFCMFCVK  60

Query  389  KSNSVVTRTSTQALTTSEL  445
             S S+    S  AL + E+
Sbjct  61   PSTSL---NSNIALKSQEI  76



>gb|EYU18959.1| hypothetical protein MIMGU_mgv1a012478mg [Erythranthe guttata]
Length=249

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRI  319
            M SFSGL IGLSFVFGCILMGL  ELYYLLW ++++
Sbjct  1    MGSFSGLVIGLSFVFGCILMGLFLELYYLLWWKKKM  36



>ref|XP_009416133.1| PREDICTED: uncharacterized protein LOC103996838 [Musa acuminata 
subsp. malaccensis]
Length=322

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCKK  391
            M   S LGIGLS V GC+ + LVAELYYLLW ++R   RE + +  S   ++ YL C +K
Sbjct  1    MRPLSSLGIGLSLVSGCLFLALVAELYYLLWWKKR-SSREVDHDSRSPAGELLYLCCWRK  59

Query  392  SNSV-VTRTSTQALTTS  439
             +S+  T  + + +TTS
Sbjct  60   PSSLSSTALNPRDMTTS  76



>ref|XP_010685790.1| PREDICTED: uncharacterized protein LOC104900135 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010685791.1| PREDICTED: uncharacterized protein LOC104900135 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=303

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRI---RDRETEGEYTSIGSDIAYLF  379
            M   SGLGI LS VFGC+L+ LVAELYYLL W ++RI        + +Y++   ++ YLF
Sbjct  1    MTILSGLGIVLSLVFGCLLLALVAELYYLLWWKKQRIIGNTSNRIDQDYSTHAKEMFYLF  60

Query  380  CCKKS  394
            C  K 
Sbjct  61   CWDKP  65



>ref|XP_009769532.1| PREDICTED: uncharacterized protein LOC104220372 [Nicotiana sylvestris]
Length=296

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 4/79 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAY-LFCCK  388
            M S S +G+ LS VFGC+L+ L+AELYYLLW + RI     E  Y+S  +   + +FC K
Sbjct  1    MKSLSSVGLVLSVVFGCLLLALIAELYYLLWWKNRIVKTSLEDGYSSNKAKEFFCMFCIK  60

Query  389  KSNSVVTRTSTQALTTSEL  445
             S S+    S  AL + E+
Sbjct  61   PSTSL---NSNIALKSQEI  76



>ref|XP_006846119.1| hypothetical protein AMTR_s00012p00143310 [Amborella trichopoda]
 gb|ERN07794.1| hypothetical protein AMTR_s00012p00143310 [Amborella trichopoda]
Length=385

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRE-TEGEYTSIGSDIAYLFCCK  388
            M S SGLGIGLS VFG +L+ L AELYY+LW ++R   RE  E EY+S   ++ YL C K
Sbjct  1    MRSLSGLGIGLSLVFGFLLLALFAELYYVLWWKKRENHRELDEEEYSSSAREMLYLLCWK  60

Query  389  KSNSVVTRT  415
            K +S+ + T
Sbjct  61   KPHSLSSDT  69



>gb|KJB60678.1| hypothetical protein B456_009G319200 [Gossypium raimondii]
Length=249

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIR  322
            M S S +G+GLS VFGC+++ L+AE+YYLLW + R+R
Sbjct  1    MKSLSSVGLGLSIVFGCLVLALIAEVYYLLWWKNRLR  37



>gb|KJB78845.1| hypothetical protein B456_013G022600 [Gossypium raimondii]
Length=260

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 33/59 (56%), Gaps = 10/59 (17%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTSIGSDIAYLFCCK  388
            M S S +GIGLS  F  +L+ LV ELYYLLW ++R+  R           D  Y+FC K
Sbjct  1    MKSLSSVGIGLSIAFASLLLALVGELYYLLWWKKRLTSR----------RDFFYMFCLK  49



>gb|EPS57174.1| hypothetical protein M569_17647 [Genlisea aurea]
Length=221

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 40/76 (53%), Gaps = 1/76 (1%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR-IRDRETEGEYTSIGSDIAYLFCCK  388
            M SFSGLGI LSFVFG IL+G+V EL YLLW ++R +    T      I   +       
Sbjct  1    MRSFSGLGIVLSFVFGLILIGVVGELLYLLWWKKRCVHPNTTTAASGEISGKVRIFGSFL  60

Query  389  KSNSVVTRTSTQALTT  436
            ++N    R +   L T
Sbjct  61   RNNPTSERRNPDDLET  76



>ref|XP_009384831.1| PREDICTED: uncharacterized protein LOC103972270 [Musa acuminata 
subsp. malaccensis]
Length=293

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGEYTS--IGSDIAYLFCC  385
            M S SGLGIG+S V GC+ + LVAEL YL W  R+I D + E    +      + +LFC 
Sbjct  1    MRSLSGLGIGVSVVSGCLFLALVAELCYLFWW-RKISDGDMEDRCRACLPAKGLVHLFCW  59

Query  386  KKSNSV  403
            KK +S+
Sbjct  60   KKPHSL  65



>ref|XP_006280849.1| hypothetical protein CARUB_v10026835mg [Capsella rubella]
 gb|EOA13747.1| hypothetical protein CARUB_v10026835mg [Capsella rubella]
Length=307

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 8/72 (11%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR-------DRETEGEYTSIGSDI  367
            M + SGLGIGLS VFG +L+ LVAE+YYLL W + + R       + + E ++     ++
Sbjct  1    MKTISGLGIGLSLVFGFLLLALVAEVYYLLRWKKHKKRVISQESEEEKEEEQHNGYAKEL  60

Query  368  AYLFCCKKSNSV  403
              LFC KK  S+
Sbjct  61   IQLFCFKKPQSL  72



>ref|XP_010535505.1| PREDICTED: uncharacterized protein LOC104810787 [Tarenaya hassleriana]
Length=299

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 10/74 (14%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIRDR---------ETEGEYTSIGS  361
            M +  GL IGLS VFGC+L+ LVAE+YYLL W + +   R         + E        
Sbjct  1    MKTVGGLAIGLSLVFGCLLLALVAEVYYLLRWNKNKKSKRVISQESEEEKEEEHNNGYAK  60

Query  362  DIAYLFCCKKSNSV  403
            D+  LFC KK  S+
Sbjct  61   DLIQLFCFKKPQSL  74



>ref|XP_010520280.1| PREDICTED: uncharacterized protein LOC104799446 [Tarenaya hassleriana]
Length=295

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 10/74 (14%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIRDR---------ETEGEYTSIGS  361
            M + S LGIGLS VFGC+L+ LVAE+YYL  W + +   R         + E        
Sbjct  1    MKTVSELGIGLSLVFGCLLLALVAEVYYLFRWKKNKKSKRIMSQESEEEKEEEHNNGYAK  60

Query  362  DIAYLFCCKKSNSV  403
            D+  LFC KK  S+
Sbjct  61   DLIQLFCFKKPQSL  74



>ref|XP_010033140.1| PREDICTED: uncharacterized protein LOC104422503 [Eucalyptus grandis]
 gb|KCW52692.1| hypothetical protein EUGRSUZ_J02060 [Eucalyptus grandis]
Length=322

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 41/77 (53%), Gaps = 6/77 (8%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLLWVRRR------IRDRETEGEYTSIGSDIAY  373
            MA+  GLG+ LS VFGC+ +  +AE+ Y+ W +RR      + D   E +YT    +   
Sbjct  1    MAASCGLGLVLSIVFGCLFLAFLAEVSYVFWWKRRRVASSSVADVPEEEDYTKYAKEFLQ  60

Query  374  LFCCKKSNSVVTRTSTQ  424
            L C K+ +S    T+ +
Sbjct  61   LICWKRPSSFQHPTNAK  77



>gb|AFK46332.1| unknown [Lotus japonicus]
Length=245

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
 Frame = +2

Query  218  SFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETEGE-YTSIGSDIAYLFCCKK-  391
            S SGL I LS  FGC L+ L AEL YLLW ++R    ETE E +++    +    C K  
Sbjct  2    SLSGLVIALSVAFGCFLLALAAELCYLLWWKKRRTHTETEEEDHSNDAKGLLNGVCWKAP  61

Query  392  --SNSVVTRTSTQALTTSE  442
              +NSV  R+S     + E
Sbjct  62   STTNSVTVRSSEPENKSHE  80



>gb|KFK27464.1| hypothetical protein AALP_AA8G386500 [Arabis alpina]
Length=282

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 9/73 (12%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR------DRETEGEYTSIG--SD  364
            M + SGLGIGLS VFG +L+ LVAE+YYLL W + + R      + E E E   IG   +
Sbjct  1    MKTISGLGIGLSLVFGFLLLALVAEIYYLLRWKKHKKRVISQESEEEREEEQQQIGYAKE  60

Query  365  IAYLFCCKKSNSV  403
            +  LFC KK  S+
Sbjct  61   LIQLFCFKKPQSL  73



>ref|XP_010454903.1| PREDICTED: uncharacterized protein LOC104736584 [Camelina sativa]
Length=302

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR  322
            M + SGLGIGLS VFG +L+ LVAE+YYLL W + + R
Sbjct  1    MKTISGLGIGLSLVFGFLLLALVAEVYYLLRWKKHKKR  38



>ref|XP_010443687.1| PREDICTED: uncharacterized protein LOC104726517 [Camelina sativa]
Length=306

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR  322
            M + SGLGIGLS VFG +L+ LVAE+YYLL W + + R
Sbjct  1    MKTISGLGIGLSLVFGFLLLALVAEVYYLLRWKKHKKR  38



>ref|XP_010483553.1| PREDICTED: uncharacterized protein LOC104762045 isoform X1 [Camelina 
sativa]
 ref|XP_010483554.1| PREDICTED: uncharacterized protein LOC104762045 isoform X2 [Camelina 
sativa]
Length=307

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR  322
            M + SGLGIGLS VFG +L+ LVAE+YYLL W + + R
Sbjct  1    MKTISGLGIGLSLVFGFLLLALVAEVYYLLRWKKHKKR  38



>ref|XP_006400971.1| hypothetical protein EUTSA_v10014249mg [Eutrema salsugineum]
 gb|ESQ42424.1| hypothetical protein EUTSA_v10014249mg [Eutrema salsugineum]
Length=294

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 8/72 (11%)
 Frame = +2

Query  212  MASFSGLGIGLSFVFGCILMGLVAELYYLL-WVRRRIR-----DRETEGEYTSIG--SDI  367
            M + SGLGIGLS VFG +L+ L AE+YYLL W + + R       E + E   IG   ++
Sbjct  1    MKTISGLGIGLSLVFGFLLLALAAEVYYLLRWKKHKKRVISQESEEEKEEEEQIGYAKEL  60

Query  368  AYLFCCKKSNSV  403
              LFC KK  S+
Sbjct  61   IQLFCFKKPQSL  72



>gb|ACU20158.1| unknown [Glycine max]
Length=128

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  218  SFSGLGIGLSFVFGCILMGLVAELYYLLWVRRRIRDRETE  337
            SF GL I LS VFGC+L+ L A+LYY LW ++R    + E
Sbjct  2    SFGGLSIALSLVFGCLLLALRAQLYYFLWWKKRRTQMDIE  41



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555551523900