BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H21

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACU21468.1|  unknown                                                 190   4e-57   Glycine max [soybeans]
emb|CDP17087.1|  unnamed protein product                                191   5e-56   Coffea canephora [robusta coffee]
gb|KHN19226.1|  DnaJ like subfamily B member 11                         191   5e-56   Glycine soja [wild soybean]
ref|XP_003521587.1|  PREDICTED: dnaJ homolog subfamily B member 11      190   7e-56   Glycine max [soybeans]
ref|XP_003554541.1|  PREDICTED: dnaJ homolog subfamily B member 1...    189   1e-55   Glycine max [soybeans]
gb|KJB41842.1|  hypothetical protein B456_007G123900                    186   2e-55   Gossypium raimondii
gb|KHG25948.1|  DnaJ subfamily B member 11                              189   2e-55   Gossypium arboreum [tree cotton]
gb|KHG17469.1|  DnaJ subfamily B member 11                              189   3e-55   Gossypium arboreum [tree cotton]
gb|KJB41840.1|  hypothetical protein B456_007G123700                    184   6e-55   Gossypium raimondii
ref|XP_009785213.1|  PREDICTED: dnaJ protein ERDJ3B-like                187   1e-54   Nicotiana sylvestris
ref|XP_009606137.1|  PREDICTED: dnaJ protein ERDJ3B-like                187   1e-54   Nicotiana tomentosiformis
gb|KJB41839.1|  hypothetical protein B456_007G123700                    184   1e-54   Gossypium raimondii
ref|XP_006349203.1|  PREDICTED: dnaJ homolog subfamily B member 1...    186   3e-54   Solanum tuberosum [potatoes]
ref|XP_004229405.1|  PREDICTED: dnaJ protein ERDJ3B                     186   3e-54   Solanum lycopersicum
gb|KJB41841.1|  hypothetical protein B456_007G123900                    186   4e-54   Gossypium raimondii
gb|KJB41838.1|  hypothetical protein B456_007G123700                    185   1e-53   Gossypium raimondii
ref|XP_010268041.1|  PREDICTED: dnaJ protein ERDJ3B                     183   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_002275221.1|  PREDICTED: dnaJ protein ERDJ3B                     181   3e-52   Vitis vinifera
ref|XP_008451505.1|  PREDICTED: dnaJ homolog subfamily B member 11      181   4e-52   Cucumis melo [Oriental melon]
ref|XP_004136000.1|  PREDICTED: dnaJ homolog subfamily B member 1...    181   5e-52   Cucumis sativus [cucumbers]
gb|KJB24400.1|  hypothetical protein B456_004G143600                    180   5e-52   Gossypium raimondii
gb|EYU46792.1|  hypothetical protein MIMGU_mgv1a0099882mg               177   6e-52   Erythranthe guttata [common monkey flower]
ref|XP_011079583.1|  PREDICTED: dnaJ protein ERDJ3B                     180   1e-51   Sesamum indicum [beniseed]
gb|KHF99198.1|  DnaJ subfamily B member 11                              178   3e-51   Gossypium arboreum [tree cotton]
ref|XP_009766352.1|  PREDICTED: dnaJ protein ERDJ3B-like                177   1e-50   Nicotiana sylvestris
ref|XP_008797220.1|  PREDICTED: dnaJ homolog subfamily B member 1...    175   2e-50   Phoenix dactylifera
ref|XP_010095300.1|  DnaJ homolog subfamily B member 11                 175   7e-50   Morus notabilis
ref|XP_008797219.1|  PREDICTED: dnaJ homolog subfamily B member 1...    174   9e-50   Phoenix dactylifera
ref|XP_009383732.1|  PREDICTED: dnaJ homolog subfamily B member 1...    174   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009604699.1|  PREDICTED: dnaJ protein ERDJ3B-like                173   4e-49   Nicotiana tomentosiformis
ref|XP_004494412.1|  PREDICTED: dnaJ homolog subfamily B member 1...    173   4e-49   Cicer arietinum [garbanzo]
ref|XP_010914541.1|  PREDICTED: dnaJ protein ERDJ3B                     172   1e-48   Elaeis guineensis
ref|XP_003625951.1|  DnaJ homolog subfamily B member                    171   2e-48   Medicago truncatula
gb|KDO87051.1|  hypothetical protein CISIN_1g0191621mg                  166   3e-48   Citrus sinensis [apfelsine]
ref|XP_006444462.1|  hypothetical protein CICLE_v10020947mg             167   1e-47   
gb|KDP28236.1|  hypothetical protein JCGZ_14007                         169   2e-47   Jatropha curcas
ref|XP_007163164.1|  hypothetical protein PHAVU_001G211800g             167   6e-47   Phaseolus vulgaris [French bean]
ref|XP_006444463.1|  hypothetical protein CICLE_v10020947mg             167   9e-47   Citrus clementina [clementine]
ref|XP_011041488.1|  PREDICTED: dnaJ protein ERDJ3B-like                166   1e-46   Populus euphratica
gb|KCW50098.1|  hypothetical protein EUGRSUZ_K03532                     163   3e-46   Eucalyptus grandis [rose gum]
ref|XP_003519751.1|  PREDICTED: dnaJ homolog subfamily B member 1...    165   3e-46   Glycine max [soybeans]
gb|KHN08649.1|  DnaJ like subfamily B member 11                         165   3e-46   Glycine soja [wild soybean]
ref|XP_006855308.1|  hypothetical protein AMTR_s00057p00065600          165   4e-46   Amborella trichopoda
gb|ABK95286.1|  unknown                                                 165   4e-46   Populus trichocarpa [western balsam poplar]
ref|XP_002320981.2|  DNAJ heat shock family protein                     165   5e-46   
ref|XP_010038274.1|  PREDICTED: dnaJ protein ERDJ3B                     163   2e-45   Eucalyptus grandis [rose gum]
ref|XP_002301501.1|  DNAJ heat shock family protein                     162   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009339791.1|  PREDICTED: dnaJ homolog subfamily B member 11      162   6e-45   Pyrus x bretschneideri [bai li]
ref|XP_011042226.1|  PREDICTED: dnaJ protein ERDJ3B                     162   7e-45   Populus euphratica
ref|XP_009414445.1|  PREDICTED: dnaJ homolog subfamily B member 1...    162   7e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931736.1|  PREDICTED: dnaJ protein ERDJ3B-like                161   1e-44   Elaeis guineensis
ref|XP_010679350.1|  PREDICTED: dnaJ protein ERDJ3B                     160   3e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002439322.1|  hypothetical protein SORBIDRAFT_09g004380          160   4e-44   Sorghum bicolor [broomcorn]
gb|EEE62392.1|  hypothetical protein OsJ_17183                          160   4e-44   Oryza sativa Japonica Group [Japonica rice]
gb|EMS56866.1|  DnaJ homolog subfamily B member 2                       154   5e-44   Triticum urartu
ref|XP_008345236.1|  PREDICTED: dnaJ homolog subfamily B member 1...    159   6e-44   
ref|XP_007200611.1|  hypothetical protein PRUPE_ppa007947mg             159   6e-44   Prunus persica
gb|AFW81378.1|  hypothetical protein ZEAMMB73_185883                    158   9e-44   
ref|XP_009378691.1|  PREDICTED: dnaJ homolog subfamily B member 1...    159   9e-44   Pyrus x bretschneideri [bai li]
ref|XP_008386734.1|  PREDICTED: dnaJ homolog subfamily B member 11      159   1e-43   
ref|XP_008235186.1|  PREDICTED: dnaJ homolog subfamily B member 11      159   1e-43   Prunus mume [ume]
gb|EAY96619.1|  hypothetical protein OsI_18531                          159   1e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_008656126.1|  PREDICTED: dnaJ homolog subfamily B member 1...    158   1e-43   
ref|XP_010523978.1|  PREDICTED: dnaJ protein ERDJ3B-like                157   3e-43   Tarenaya hassleriana [spider flower]
ref|XP_007051071.1|  DNAJ heat shock family protein isoform 2           155   5e-43   
ref|XP_004977083.1|  PREDICTED: dnaJ homolog subfamily B member 1...    157   5e-43   Setaria italica
ref|XP_010468943.1|  PREDICTED: dnaJ protein ERDJ3B                     157   6e-43   Camelina sativa [gold-of-pleasure]
ref|XP_007051070.1|  DNAJ heat shock family protein isoform 1           156   7e-43   
ref|XP_004300467.1|  PREDICTED: dnaJ protein ERDJ3B                     156   8e-43   Fragaria vesca subsp. vesca
emb|CDX67894.1|  BnaA07g19340D                                          156   9e-43   
ref|XP_010512648.1|  PREDICTED: dnaJ protein ERDJ3B-like                156   9e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006293253.1|  hypothetical protein CARUB_v10019587mg             156   9e-43   Capsella rubella
ref|XP_006402365.1|  hypothetical protein EUTSA_v10006078mg             156   1e-42   Eutrema salsugineum [saltwater cress]
ref|XP_008797436.1|  PREDICTED: dnaJ homolog subfamily B member 1...    156   1e-42   Phoenix dactylifera
ref|XP_002878466.1|  DNAJ heat shock family protein                     155   1e-42   Arabidopsis lyrata subsp. lyrata
ref|NP_191819.1|  DNAJ heat shock protein ATERDJ3B                      155   1e-42   Arabidopsis thaliana [mouse-ear cress]
gb|EPS66939.1|  hypothetical protein M569_07836                         152   2e-42   Genlisea aurea
gb|EMT15727.1|  DnaJ homolog subfamily B member 11                      155   2e-42   
dbj|BAK07410.1|  predicted protein                                      155   3e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010544978.1|  PREDICTED: dnaJ protein ERDJ3B                     155   3e-42   Tarenaya hassleriana [spider flower]
ref|XP_010413269.1|  PREDICTED: dnaJ protein ERDJ3B-like                155   4e-42   Camelina sativa [gold-of-pleasure]
ref|XP_002515306.1|  Chaperone protein dnaJ, putative                   154   4e-42   Ricinus communis
pir||S56704  GUT 7-2a protein - common tobacco (fragment)               147   4e-42
emb|CDY63310.1|  BnaC04g54960D                                          154   9e-42   Brassica napus [oilseed rape]
ref|XP_008649372.1|  PREDICTED: dnaJ homolog subfamily B member 1...    153   1e-41   Zea mays [maize]
emb|CDX76646.1|  BnaC08g32320D                                          153   1e-41   
ref|XP_009116921.1|  PREDICTED: dnaJ homolog subfamily B member 11      153   2e-41   Brassica rapa
ref|XP_008355501.1|  PREDICTED: dnaJ homolog subfamily B member 1...    153   2e-41   
emb|CDX89142.1|  BnaA04g00440D                                          152   4e-41   
ref|XP_009138725.1|  PREDICTED: dnaJ homolog subfamily B member 1...    152   4e-41   Brassica rapa
ref|XP_003568885.1|  PREDICTED: dnaJ protein ERDJ3B                     151   7e-41   Brachypodium distachyon [annual false brome]
gb|ACN40755.1|  unknown                                                 148   1e-39   Picea sitchensis
emb|CDY59898.1|  BnaC06g43160D                                          148   1e-39   Brassica napus [oilseed rape]
ref|XP_006655011.1|  PREDICTED: dnaJ homolog subfamily B member 1...    147   2e-39   Oryza brachyantha
gb|KFK35429.1|  hypothetical protein AALP_AA5G283300                    147   5e-39   Arabis alpina [alpine rockcress]
gb|EMT14325.1|  Chaperone protein dnaJ                                  136   2e-37   
ref|XP_004971793.1|  PREDICTED: dnaJ homolog subfamily B member 1...    142   2e-37   Setaria italica
ref|XP_002457785.1|  hypothetical protein SORBIDRAFT_03g013590          138   6e-36   
ref|XP_001767250.1|  predicted protein                                  132   1e-33   
ref|XP_001781245.1|  predicted protein                                  130   5e-33   
gb|AFW80711.1|  hypothetical protein ZEAMMB73_969717                    122   5e-31   
ref|XP_002978653.1|  hypothetical protein SELMODRAFT_109399             124   9e-31   
ref|XP_003079124.1|  Molecular chaperone (DnaJ superfamily) (ISS)       124   2e-30   Ostreococcus tauri
gb|EIE78627.1|  hypothetical protein RO3G_03331                         124   2e-30   Rhizopus delemar RA 99-880
ref|NP_001167838.1|  hypothetical protein precursor                     122   8e-30   Zea mays [maize]
ref|XP_002508960.1|  predicted protein                                  121   1e-29   Micromonas commoda
ref|WP_027303628.1|  molecular chaperone DnaJ                           120   4e-29   Campylobacter upsaliensis
ref|WP_004275721.1|  molecular chaperone DnaJ                           119   1e-28   Campylobacter upsaliensis
ref|WP_004277695.1|  molecular chaperone DnaJ                           119   1e-28   Campylobacter upsaliensis
ref|XP_001417654.1|  predicted protein                                  117   4e-28   Ostreococcus lucimarinus CCE9901
emb|CEJ04661.1|  hypothetical protein RMCBS344292_18616                 117   5e-28   Rhizopus microsporus
ref|WP_035403765.1|  molecular chaperone DnaJ                           117   5e-28   
ref|XP_007514172.1|  predicted protein                                  117   6e-28   Bathycoccus prasinos
ref|WP_021091609.1|  Chaperone protein DnaJ                             116   9e-28   Campylobacter concisus
ref|WP_038454591.1|  molecular chaperone DnaJ                           116   1e-27   Campylobacter iguaniorum
emb|CEI94658.1|  hypothetical protein RMCBS344292_08863                 116   1e-27   Rhizopus microsporus
emb|CEG67475.1|  hypothetical protein RMATCC62417_03901                 116   1e-27   Rhizopus microsporus
ref|XP_001461982.1|  hypothetical protein                               116   1e-27   Paramecium tetraurelia strain d4-2
gb|EPB86033.1|  hypothetical protein HMPREF1544_07193                   115   2e-27   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN05476.1|  conserved hypothetical protein                         116   4e-27   Mucor ambiguus
ref|XP_007000865.1|  hypothetical protein TREMEDRAFT_37064              114   4e-27   Tremella mesenterica DSM 1558
ref|XP_003056063.1|  predicted protein                                  114   5e-27   Micromonas pusilla CCMP1545
ref|WP_013182492.1|  molecular chaperone DnaJ                           114   8e-27   Waddlia chondrophila
ref|XP_007403894.1|  hypothetical protein MELLADRAFT_41574              114   1e-26   Melampsora larici-populina 98AG31
ref|WP_023385405.1|  co-chaperone and heat shock protein                113   2e-26   Campylobacter fetus
ref|WP_009294395.1|  molecular chaperone DnaJ                           113   2e-26   Campylobacter sp. 10_1_50
ref|WP_039628124.1|  molecular chaperone DnaJ                           113   2e-26   Campylobacter lari
ref|WP_021085994.1|  Chaperone protein DnaJ                             113   2e-26   Campylobacter concisus
ref|WP_039641057.1|  molecular chaperone DnaJ                           112   2e-26   Campylobacter lari
ref|WP_039617822.1|  molecular chaperone DnaJ                           112   2e-26   Campylobacter lari
ref|WP_044598559.1|  molecular chaperone DnaJ                           112   3e-26   Campylobacter peloridis
ref|WP_038453740.1|  molecular chaperone DnaJ                           112   3e-26   Campylobacter fetus
ref|WP_009650327.1|  molecular chaperone DnaJ                           112   3e-26   Campylobacter sp. FOBRC14
ref|WP_010031742.1|  molecular chaperone DnaJ                           112   3e-26   Francisella tularensis
ref|WP_025329381.1|  molecular chaperone DnaJ                           112   3e-26   Francisella tularensis
ref|WP_032733700.1|  molecular chaperone DnaJ                           112   3e-26   Francisella tularensis
ref|WP_002849758.1|  molecular chaperone DnaJ                           112   3e-26   Campylobacter fetus
gb|ABI83031.1|  chaperone DnaJ                                          112   3e-26   Francisella tularensis subsp. holarctica OSU18
ref|XP_001775578.1|  predicted protein                                  112   4e-26   
gb|EDO66685.1|  hypothetical protein FTAG_01487                         112   4e-26   Francisella tularensis subsp. holarctica FSC022
ref|XP_001733762.1|  hypothetical protein                               112   4e-26   Entamoeba dispar SAW760
ref|XP_003382633.2|  PREDICTED: dnaJ homolog subfamily B member 6...    109   4e-26   Amphimedon queenslandica
ref|WP_011457462.1|  molecular chaperone DnaJ                           112   5e-26   Francisella tularensis
ref|XP_005649472.1|  DnaJ-domain-containing protein                     111   5e-26   Coccomyxa subellipsoidea C-169
ref|XP_009533175.1|  hypothetical protein PHYSODRAFT_520326             112   5e-26   Phytophthora sojae
ref|XP_002961542.1|  hypothetical protein SELMODRAFT_230025             110   5e-26   
ref|XP_005707432.1|  molecular chaperone DnaJ                           112   6e-26   Galdieria sulphuraria
gb|EBA52748.1|  chaperone dnaJ                                          112   6e-26   Francisella tularensis subsp. holarctica 257
ref|WP_026442492.1|  molecular chaperone DnaJ                           111   7e-26   Acidobacterium ailaaui
ref|XP_001942000.1|  chaperone protein dnaJ                             111   7e-26   Pyrenophora tritici-repentis Pt-1C-BFP
ref|WP_038057826.1|  molecular chaperone DnaJ                           111   8e-26   Thermodesulfobacterium hydrogeniphilum
ref|XP_001647525.1|  predicted protein                                  108   8e-26   Nematostella vectensis
ref|XP_003305156.1|  hypothetical protein PTT_17906                     111   8e-26   
ref|XP_002971272.1|  hypothetical protein SELMODRAFT_231730             110   9e-26   
ref|WP_029520295.1|  molecular chaperone DnaJ                           111   9e-26   Persephonella sp. IF05-L8
ref|WP_003030305.1|  molecular chaperone DnaJ                           111   9e-26   Francisella tularensis
ref|WP_003025467.1|  molecular chaperone DnaJ                           111   9e-26   Francisella tularensis
ref|WP_018136881.1|  molecular chaperone DnaJ                           110   1e-25   Campylobacter curvus
ref|WP_029523125.1|  molecular chaperone DnaJ                           110   1e-25   Persephonella sp. KM09-Lau-8
ref|WP_013666383.1|  molecular chaperone DnaJ                           110   1e-25   Sphingobacterium sp. 21
ref|WP_012830777.1|  molecular chaperone DnaJ                           110   1e-25   Haliangium ochraceum
ref|XP_009775583.1|  PREDICTED: dnaJ homolog subfamily B member 1       110   1e-25   Nicotiana sylvestris
ref|XP_002111260.1|  hypothetical protein TRIADDRAFT_50110              108   1e-25   Trichoplax adhaerens
ref|WP_025323706.1|  hypothetical protein                               110   1e-25   
ref|XP_009590161.1|  PREDICTED: dnaJ homolog subfamily B member 4       110   2e-25   Nicotiana tomentosiformis
gb|KHJ31437.1|  putative chaperone j-domain-containing protein          110   2e-25   Erysiphe necator
ref|XP_002900549.1|  conserved hypothetical protein                     110   2e-25   Phytophthora infestans T30-4
ref|XP_005912448.1|  PREDICTED: dnaJ homolog subfamily B member 6...    107   2e-25   
ref|WP_020074503.1|  molecular chaperone DnaJ [                         109   3e-25   [Clostridium] sporosphaeroides
ref|XP_005912447.1|  PREDICTED: dnaJ homolog subfamily B member 6...    108   3e-25   
ref|WP_026805632.1|  MULTISPECIES: molecular chaperone DnaJ             109   3e-25   Aliiarcobacter faecis
gb|KIZ01675.1|  putative DnaJ subfamily B member 11                     107   4e-25   Monoraphidium neglectum
gb|KDO26257.1|  hypothetical protein SPRG_08333                         107   4e-25   Saprolegnia parasitica CBS 223.65
ref|WP_025842372.1|  molecular chaperone DnaJ                           109   5e-25   Porphyromonas gingivicanis
ref|WP_012507859.1|  molecular chaperone DnaJ                           109   5e-25   Pelodictyon phaeoclathratiforme
gb|EXF56878.1|  dnaJ domain protein                                     103   7e-25   Acinetobacter sp. 1294596
ref|WP_009064669.1|  MULTISPECIES: molecular chaperone DnaJ             108   7e-25   Clostridium
ref|XP_008219853.1|  PREDICTED: dnaJ homolog subfamily B member 1       108   9e-25   Prunus mume [ume]
ref|WP_021687367.1|  chaperone protein DnaJ                             108   9e-25   Treponema lecithinolyticum
ref|XP_005844504.1|  hypothetical protein CHLNCDRAFT_138873             108   9e-25   Chlorella variabilis
ref|WP_006341690.1|  molecular chaperone DnaJ                           108   9e-25   Parachlamydia acanthamoebae
ref|XP_007224208.1|  hypothetical protein PRUPE_ppa017410mg             108   9e-25   Prunus persica
gb|KEZ40705.1|  DnaJ-related protein SCJ1                               108   1e-24   Scedosporium apiospermum
gb|EUN28937.1|  hypothetical protein COCVIDRAFT_94273                   108   1e-24   Bipolaris victoriae FI3
ref|WP_038813597.1|  molecular chaperone DnaJ                           103   1e-24   
emb|CCC93431.1|  putative chaperone protein DNAj                        106   1e-24   Trypanosoma congolense IL3000
ref|XP_007708347.1|  hypothetical protein COCCADRAFT_23062              108   1e-24   Bipolaris zeicola 26-R-13
ref|WP_021093550.1|  Chaperone protein DnaJ                             107   2e-24   Campylobacter concisus
ref|XP_007690934.1|  hypothetical protein COCMIDRAFT_103224             107   2e-24   Bipolaris oryzae ATCC 44560
ref|XP_007697811.1|  hypothetical protein COCSADRAFT_112536             107   2e-24   Bipolaris sorokiniana ND90Pr
ref|XP_005912445.1|  PREDICTED: dnaJ homolog subfamily B member 6...    107   2e-24   Haplochromis burtoni
ref|WP_012001289.1|  molecular chaperone DnaJ                           107   2e-24   Campylobacter concisus
ref|XP_002146527.1|  DnaJ domain protein, putative                      107   2e-24   Talaromyces marneffei ATCC 18224
ref|WP_021089033.1|  Chaperone protein DnaJ                             107   2e-24   Campylobacter concisus
ref|WP_002942545.1|  molecular chaperone DnaJ                           107   2e-24   Campylobacter concisus
ref|WP_021086869.1|  Chaperone protein DnaJ                             107   2e-24   Campylobacter concisus
ref|WP_034967822.1|  molecular chaperone DnaJ                           107   2e-24   
ref|WP_028323014.1|  molecular chaperone DnaJ                           107   2e-24   Desulfatiglans anilini
gb|KFY37293.1|  hypothetical protein V495_07255                         107   2e-24   Pseudogymnoascus sp. VKM F-4514 (FW-929)
ref|WP_035719928.1|  molecular chaperone DnaJ                           107   2e-24   Francisella sp. W12-1067
ref|WP_005052729.1|  chaperone dnaJ                                     107   2e-24   Acinetobacter beijerinckii
gb|KFX91790.1|  hypothetical protein O988_07578                         107   3e-24   Pseudogymnoascus sp. VKM F-3808
ref|WP_041876255.1|  molecular chaperone DnaJ                           107   3e-24   
gb|KFX91092.1|  hypothetical protein V490_06086                         107   3e-24   Pseudogymnoascus sp. VKM F-3557
ref|WP_005060380.1|  chaperone dnaJ                                     106   3e-24   Acinetobacter beijerinckii
emb|CCQ91220.1|  Chaperone protein DnaJ                                 106   4e-24   Nitrospina gracilis 3/211
ref|WP_032729577.1|  molecular chaperone DnaJ                           106   4e-24   Francisella tularensis
gb|KEQ71635.1|  DnaJ-domain-containing protein                          106   4e-24   Aureobasidium namibiae CBS 147.97
ref|WP_014550031.1|  molecular chaperone DnaJ                           106   4e-24   Francisella tularensis
ref|WP_003040062.1|  molecular chaperone DnaJ                           106   4e-24   Francisella tularensis
ref|XP_002541314.1|  conserved hypothetical protein                     106   4e-24   Uncinocarpus reesii 1704
gb|EDN36604.1|  chaperone DnaJ                                          106   4e-24   Francisella tularensis subsp. novicida GA99-3549
gb|ABK90164.1|  chaperone, DnaJ family                                  106   5e-24   Francisella tularensis subsp. novicida U112
gb|EDN38051.1|  chaperone                                               106   5e-24   Francisella tularensis subsp. novicida GA99-3548
ref|WP_004986133.1|  MULTISPECIES: molecular chaperone DnaJ             106   5e-24   Acinetobacter
ref|XP_006969027.1|  predicted protein                                  106   5e-24   Trichoderma reesei QM6a
ref|WP_010962326.1|  molecular chaperone DnaJ                           106   6e-24   Wolbachia
ref|XP_005448984.1|  PREDICTED: dnaJ homolog subfamily B member 6...    104   6e-24   
ref|WP_021084951.1|  Chaperone protein DnaJ                             105   6e-24   Campylobacter concisus
ref|WP_004895889.1|  MULTISPECIES: molecular chaperone DnaJ             105   6e-24   Acinetobacter
ref|WP_004814096.1|  chaperone dnaJ                                     105   6e-24   Acinetobacter schindleri
ref|WP_002803966.1|  molecular chaperone DnaJ                           105   7e-24   Campylobacter coli
ref|WP_002844600.1|  molecular chaperone DnaJ                           105   7e-24   Campylobacter coli
ref|WP_002822701.1|  molecular chaperone DnaJ                           105   7e-24   Campylobacter
ref|XP_005722836.1|  PREDICTED: dnaJ homolog subfamily B member 6...    104   8e-24   
ref|XP_008609054.1|  DnaJ like subfamily B member 6                     103   8e-24   Saprolegnia diclina VS20
ref|XP_001701027.1|  ER DnaJ-like protein 1                             105   8e-24   Chlamydomonas reinhardtii
ref|WP_031988940.1|  molecular chaperone DnaJ                           100   8e-24   
ref|WP_042252321.1|  molecular chaperone DnaJ                           105   8e-24   Nitrospina gracilis
gb|KGO73862.1|  Heat shock protein DnaJ, N-terminal                     105   8e-24   Penicillium italicum
ref|WP_044435460.1|  molecular chaperone DnaJ                           105   8e-24   Acinetobacter ursingii
ref|WP_004728913.1|  chaperone dnaJ                                     105   9e-24   Acinetobacter lwoffii
gb|EHK25741.1|  hypothetical protein TRIVIDRAFT_110873                  105   9e-24   Trichoderma virens Gv29-8
ref|WP_005104999.1|  MULTISPECIES: chaperone dnaJ                       105   9e-24   Acinetobacter
gb|KEQ58931.1|  DnaJ protein-like protein                               105   9e-24   Aureobasidium melanogenum CBS 110374
ref|WP_005220414.1|  chaperone dnaJ                                     105   9e-24   Acinetobacter
ref|WP_003258071.1|  chaperone protein DnaJ                             105   9e-24   
ref|WP_004659709.1|  chaperone dnaJ                                     105   9e-24   Acinetobacter sp. NIPH 236
ref|WP_005157098.1|  chaperone dnaJ                                     105   1e-23   Acinetobacter
ref|WP_039745016.1|  integrase                                          104   1e-23   Geobacter pickeringii
ref|WP_005219116.1|  chaperone dnaJ                                     105   1e-23   Acinetobacter
gb|EKV05021.1|  hypothetical protein PDIP_85130                         105   1e-23   Penicillium digitatum Pd1
ref|XP_004546886.1|  PREDICTED: dnaJ homolog subfamily B member 6...    103   1e-23   
ref|XP_006795119.1|  PREDICTED: dnaJ homolog subfamily B member 6...    103   1e-23   Neolamprologus brichardi [lyretail cichlid]
gb|AIG55894.1|  secreted protein                                        105   1e-23   Achlya hypogyna
gb|EMD95008.1|  hypothetical protein COCHEDRAFT_1191762                 105   1e-23   Bipolaris maydis C5
ref|XP_003066224.1|  DnaJ domain containing protein                     105   1e-23   Coccidioides posadasii C735 delta SOWgp
gb|EFW15653.1|  DnaJ domain-containing protein                          105   1e-23   Coccidioides posadasii str. Silveira
gb|ETL29097.1|  chaperone DnaJ                                          105   1e-23   Phytophthora parasitica
gb|EXW32965.1|  dnaJ domain protein                                     100   1e-23   Acinetobacter baumannii 44327_6
gb|KDO34548.1|  hypothetical protein SPRG_00611                         105   1e-23   Saprolegnia parasitica CBS 223.65
ref|WP_005094779.1|  MULTISPECIES: chaperone dnaJ                       104   1e-23   Acinetobacter
gb|ETI35413.1|  chaperone DnaJ                                          104   1e-23   Phytophthora parasitica P1569
ref|XP_002837728.1|  hypothetical protein                               105   1e-23   Tuber melanosporum Mel28
gb|EPY36788.1|  DnaJ like protein subfamily A member 2                  105   1e-23   Angomonas deanei
ref|XP_008912898.1|  chaperone DnaJ                                     104   2e-23   Phytophthora parasitica INRA-310
gb|EDN34846.1|  chaperone DnaJ                                          105   2e-23   Francisella tularensis subsp. tularensis FSC033
ref|WP_002866254.1|  molecular chaperone DnaJ                           104   2e-23   Campylobacter jejuni
ref|WP_003029556.1|  molecular chaperone DnaJ                           104   2e-23   Francisella tularensis
gb|KIM71425.1|  hypothetical protein PILCRDRAFT_830337                  104   2e-23   Piloderma croceum F 1598
ref|WP_012460096.1|  molecular chaperone DnaJ                           104   2e-23   Sulfurihydrogenibium sp. YO3AOP1
ref|XP_001247100.1|  hypothetical protein CIMG_00871                    105   2e-23   Coccidioides immitis RS
ref|WP_005228114.1|  MULTISPECIES: chaperone dnaJ                       104   2e-23   Acinetobacter
ref|WP_044258509.1|  molecular chaperone DnaJ                           104   2e-23   Campylobacter jejuni
ref|WP_004637270.1|  MULTISPECIES: molecular chaperone DnaJ             104   2e-23   Acinetobacter
ref|WP_016404199.1|  chaperone protein DnaJ                             104   2e-23   
ref|XP_005448983.1|  PREDICTED: dnaJ homolog subfamily B member 6...    103   2e-23   
gb|EPS29196.1|  hypothetical protein PDE_04145                          104   2e-23   Penicillium oxalicum 114-2
gb|KDR76110.1|  hypothetical protein GALMADRAFT_67821                   104   3e-23   Galerina marginata CBS 339.88
gb|KFY28591.1|  hypothetical protein V493_02854                         104   3e-23   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|AAX46634.1|  DnaJ subfamily A member 2                               101   3e-23   Bos taurus [bovine]
ref|WP_044779035.1|  molecular chaperone DnaJ                           103   3e-23   Campylobacter jejuni
ref|XP_003439273.2|  PREDICTED: dnaJ homolog subfamily B member 6...    103   3e-23   Oreochromis niloticus
ref|WP_007548206.1|  molecular chaperone DnaJ                           103   3e-23   Sulfurihydrogenibium yellowstonense
ref|XP_010892343.1|  PREDICTED: dnaJ homolog subfamily B member 6...    103   3e-23   Esox lucius
ref|XP_006795117.1|  PREDICTED: dnaJ homolog subfamily B member 6...    103   3e-23   Neolamprologus brichardi [lyretail cichlid]
ref|XP_008621677.1|  hypothetical protein SDRG_17216                    103   3e-23   Saprolegnia diclina VS20
ref|WP_004280855.1|  MULTISPECIES: molecular chaperone DnaJ             103   4e-23   Acinetobacter
ref|WP_044306155.1|  molecular chaperone DnaJ                           103   4e-23   Campylobacter jejuni
ref|WP_002889787.1|  molecular chaperone DnaJ                           103   4e-23   
ref|WP_002937746.1|  molecular chaperone DnaJ                           103   4e-23   
ref|WP_038815006.1|  molecular chaperone DnaJ                           103   4e-23   
ref|WP_002876774.1|  molecular chaperone DnaJ                           103   4e-23   
ref|WP_002901293.1|  molecular chaperone DnaJ                           103   4e-23   
ref|WP_002867350.1|  molecular chaperone DnaJ                           103   4e-23   
emb|CAG04313.1|  unnamed protein product                              99.0    4e-23   
ref|WP_011049918.1|  molecular chaperone DnaJ                           103   4e-23   
ref|WP_002868544.1|  molecular chaperone DnaJ                           103   4e-23   
ref|XP_010901090.1|  PREDICTED: dnaJ homolog subfamily B member 6...    102   4e-23   
ref|XP_010901089.1|  PREDICTED: dnaJ homolog subfamily B member 6...    102   4e-23   
ref|WP_038817221.1|  molecular chaperone DnaJ                           103   4e-23   
ref|WP_002879671.1|  molecular chaperone DnaJ                           103   4e-23   
ref|WP_002872466.1|  molecular chaperone DnaJ                           103   4e-23   
ref|WP_002853203.1|  molecular chaperone DnaJ                           103   5e-23   
ref|WP_044261544.1|  molecular chaperone DnaJ                           103   5e-23   
ref|WP_002909447.1|  molecular chaperone DnaJ                           103   5e-23   
ref|WP_002874432.1|  molecular chaperone DnaJ                           103   5e-23   
ref|WP_002869665.1|  molecular chaperone DnaJ                           103   5e-23   
ref|WP_002916199.1|  molecular chaperone DnaJ                           103   5e-23   
ref|WP_020836846.1|  molecular chaperone DnaJ                           103   5e-23   
ref|WP_014548645.1|  molecular chaperone DnaJ                           103   5e-23   
ref|WP_032585023.1|  molecular chaperone DnaJ                           103   5e-23   
ref|WP_023273292.1|  chaperone dnaJ                                     103   5e-23   
ref|WP_016646003.1|  chaperone DnaJ                                     103   5e-23   
ref|WP_004691849.1|  chaperone dnaJ                                     103   5e-23   
ref|WP_029920135.1|  molecular chaperone DnaJ                           103   6e-23   
ref|XP_010901088.1|  PREDICTED: dnaJ homolog subfamily B member 6...    102   6e-23   
ref|WP_002933657.1|  molecular chaperone DnaJ                           103   6e-23   
ref|WP_038346415.1|  molecular chaperone DnaJ                           103   7e-23   
ref|WP_005012305.1|  chaperone dnaJ                                     102   7e-23   
ref|XP_010519928.1|  PREDICTED: dnaJ homolog subfamily B member 1       102   7e-23   
ref|XP_010892345.1|  PREDICTED: dnaJ homolog subfamily B member 6...    102   7e-23   
ref|WP_005401440.1|  molecular chaperone DnaJ                           102   8e-23   
ref|WP_004978425.1|  chaperone dnaJ                                     102   8e-23   
ref|XP_002964414.1|  hypothetical protein SELMODRAFT_142303             102   8e-23   
ref|WP_004933585.1|  chaperone dnaJ                                     102   8e-23   
ref|WP_036946993.1|  molecular chaperone DnaJ                           102   9e-23   
ref|XP_002967622.1|  hypothetical protein SELMODRAFT_267144             102   9e-23   
dbj|GAM85678.1|  hypothetical protein ANO11243_036850                   102   1e-22   
emb|CDM27003.1|  Heat shock protein DnaJ                                102   1e-22   
ref|XP_009841741.1|  chaperone DnaJ, variant                            102   1e-22   
ref|WP_014625494.1|  molecular chaperone DnaJ                           102   1e-22   
ref|WP_035161479.1|  molecular chaperone DnaJ                           102   1e-22   
gb|EJP52217.1|  DnaJ domain protein                                   99.0    1e-22   
gb|KEQ90016.1|  DnaJ protein-like protein                               102   1e-22   
ref|WP_039666751.1|  molecular chaperone DnaJ                           102   1e-22   
gb|KFY44877.1|  hypothetical protein V494_01261                         102   2e-22   
ref|XP_009841740.1|  chaperone DnaJ                                     102   2e-22   
gb|KEQ99449.1|  hypothetical protein AUEXF2481DRAFT_45679               102   2e-22   
ref|WP_012280752.1|  molecular chaperone DnaJ                           102   2e-22   
ref|WP_025516689.1|  molecular chaperone DnaJ                           102   2e-22   
ref|WP_013314642.1|  molecular chaperone DnaJ                           102   2e-22   
ref|WP_014208006.1|  molecular chaperone DnaJ                           102   2e-22   
ref|WP_004944612.1|  chaperone dnaJ                                     102   2e-22   
ref|WP_011583481.1|  molecular chaperone DnaJ                           102   2e-22   
ref|WP_004910301.1|  chaperone dnaJ                                     101   2e-22   
ref|WP_024962771.1|  molecular chaperone DnaJ                           101   2e-22   
ref|WP_035736442.1|  molecular chaperone DnaJ                           101   2e-22   
ref|WP_042892134.1|  molecular chaperone DnaJ                           101   2e-22   
ref|WP_035722482.1|  molecular chaperone DnaJ                           101   2e-22   
ref|WP_004673636.1|  MULTISPECIES: chaperone dnaJ                       101   2e-22   
ref|WP_004951083.1|  molecular chaperone DnaJ                           101   2e-22   
ref|WP_005245462.1|  chaperone dnaJ                                     101   2e-22   
gb|KFH68266.1|  hypothetical protein MVEG_05084                         101   2e-22   
ref|WP_004760314.1|  MULTISPECIES: chaperone dnaJ                       101   2e-22   
ref|WP_015360491.1|  chaperone protein DnaJ                             101   2e-22   
ref|WP_004679193.1|  chaperone dnaJ                                     101   2e-22   
ref|WP_004718844.1|  chaperone dnaJ                                     101   2e-22   
ref|WP_043995234.1|  molecular chaperone DnaJ                         97.4    2e-22   
gb|EET21168.1|  chaperone dnaJ                                          101   2e-22   
ref|WP_013922808.1|  molecular chaperone DnaJ                           101   2e-22   
ref|WP_004320126.1|  molecular chaperone DnaJ                           101   2e-22   
emb|CCE28889.1|  related to SCJ1 protein                                101   2e-22   
ref|WP_026472201.1|  molecular chaperone DnaJ                           101   3e-22   
ref|XP_003023539.1|  hypothetical protein TRV_02286                     101   3e-22   
ref|XP_003016952.1|  hypothetical protein ARB_05246                     101   3e-22   
ref|XP_001245446.1|  hypothetical protein CIMG_04887                    101   3e-22   
ref|WP_032030612.1|  molecular chaperone DnaJ                         99.4    3e-22   
gb|EXV51482.1|  chaperone protein DnaJ                                99.4    3e-22   
ref|WP_037027710.1|  molecular chaperone DnaJ                         99.0    3e-22   
ref|WP_044526542.1|  molecular chaperone DnaJ                           101   3e-22   
ref|WP_038603889.1|  molecular chaperone DnaJ                           101   3e-22   
ref|WP_011722557.1|  MULTISPECIES: molecular chaperone DnaJ             101   3e-22   
ref|WP_012109003.1|  molecular chaperone DnaJ                           100   3e-22   
ref|WP_032016720.1|  molecular chaperone DnaJ                           100   3e-22   
ref|WP_009392415.1|  chaperone protein DnaJ                             100   3e-22   
dbj|BAP69498.1|  dnaJ-related protein SCJ1                              100   3e-22   
ref|WP_004749204.1|  chaperone dnaJ                                     100   3e-22   
gb|ELR02825.1|  hypothetical protein GMDG_05761                         101   4e-22   
ref|WP_010113499.1|  molecular chaperone DnaJ                           100   4e-22   
ref|WP_005264524.1|  chaperone dnaJ                                     100   4e-22   
ref|WP_028787683.1|  molecular chaperone DnaJ                           100   4e-22   
dbj|BAO37943.1|  dnaJ-related protein SCJ1                              100   4e-22   
emb|CDS09433.1|  hypothetical protein LRAMOSA10793                      100   4e-22   
ref|XP_003169836.1|  chaperone dnaJ                                     100   4e-22   
ref|WP_023951087.1|  molecular chaperone DnaJ                           100   4e-22   
ref|WP_038697261.1|  molecular chaperone DnaJ                           100   5e-22   
ref|WP_004923086.1|  MULTISPECIES: molecular chaperone DnaJ             100   5e-22   
ref|WP_036883666.1|  molecular chaperone DnaJ                           100   5e-22   
ref|XP_007945118.1|  PREDICTED: dnaJ homolog subfamily B member 5...    100   5e-22   
gb|EGD95125.1|  DnaJ domain-containing protein                          100   5e-22   
ref|XP_002783521.1|  conserved hypothetical protein                     102   5e-22   
ref|XP_008306597.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    100   5e-22   
gb|EGE03811.1|  chaperone dnaJ                                          100   5e-22   
ref|XP_011397086.1|  DnaJ-like protein subfamily B member 11            100   5e-22   
ref|WP_033564478.1|  molecular chaperone DnaJ                           100   5e-22   
ref|NP_596697.3|  DNAJ domain protein Scj1 (predicted)                  100   5e-22   
ref|WP_018341392.1|  molecular chaperone DnaJ                           100   5e-22   
gb|EZF34396.1|  hypothetical protein H101_02055                         100   5e-22   
ref|WP_004780422.1|  chaperone dnaJ                                     100   6e-22   
ref|WP_034171547.1|  molecular chaperone DnaJ                           100   6e-22   
ref|WP_004756847.1|  MULTISPECIES: chaperone dnaJ                       100   6e-22   
emb|CBI22796.3|  unnamed protein product                              99.8    6e-22   
gb|KIC74136.1|  Chaperone protein DnaJ                                  100   6e-22   
ref|XP_003236010.1|  DnaJ domain-containing protein                     100   6e-22   
ref|WP_022298582.1|  chaperone protein DnaJ                             100   6e-22   
ref|WP_004683667.1|  molecular chaperone DnaJ                           100   6e-22   
gb|EZF72587.1|  hypothetical protein H105_05344                         100   6e-22   
ref|WP_034585691.1|  molecular chaperone DnaJ                           100   7e-22   
ref|WP_006389047.1|  molecular chaperone DnaJ                           100   7e-22   
ref|XP_007945117.1|  PREDICTED: dnaJ homolog subfamily B member 5...    100   7e-22   
ref|XP_001826446.2|  DnaJ domain protein                                100   7e-22   
gb|EPP29953.1|  dnaJ domain protein                                   95.1    7e-22   
ref|WP_017402870.1|  MULTISPECIES: molecular chaperone DnaJ             100   7e-22   
ref|XP_002595130.1|  hypothetical protein BRAFLDRAFT_67912            98.2    7e-22   
ref|WP_002119101.1|  MULTISPECIES: molecular chaperone DnaJ             100   7e-22   
dbj|GAM35643.1|  hypothetical protein TCE0_017f04135                    100   8e-22   
ref|WP_003654301.1|  molecular chaperone DnaJ                           100   8e-22   
ref|WP_034703346.1|  molecular chaperone DnaJ                           100   8e-22   
gb|EDL02504.1|  DnaJ (Hsp40) homolog, subfamily B, member 5, isof...    100   8e-22   
ref|WP_028454187.1|  molecular chaperone DnaJ                           100   8e-22   
ref|WP_022830812.1|  molecular chaperone DnaJ                           100   8e-22   
dbj|BAE65313.1|  unnamed protein product                                100   8e-22   
ref|WP_004970338.1|  chaperone dnaJ                                     100   8e-22   
gb|EDL02503.1|  DnaJ (Hsp40) homolog, subfamily B, member 5, isof...    100   8e-22   
gb|EHK39477.1|  hypothetical protein TRIATDRAFT_133312                  100   8e-22   
gb|EDL02506.1|  DnaJ (Hsp40) homolog, subfamily B, member 5, isof...    100   8e-22   
ref|WP_005233191.1|  chaperone dnaJ                                     100   8e-22   
ref|XP_002123973.1|  PREDICTED: dnaJ homolog subfamily B member 6...  99.4    8e-22   
ref|WP_002844425.1|  molecular chaperone DnaJ                           100   8e-22   
gb|EDL02505.1|  DnaJ (Hsp40) homolog, subfamily B, member 5, isof...    100   8e-22   
ref|WP_026866437.1|  molecular chaperone DnaJ                         99.8    9e-22   
ref|WP_020008481.1|  hypothetical protein                             99.8    9e-22   
ref|WP_043019517.1|  molecular chaperone DnaJ                         99.8    9e-22   
ref|NP_001101474.1|  dnaJ homolog subfamily B member 5                99.8    9e-22   
ref|XP_006538173.1|  PREDICTED: dnaJ homolog subfamily B member 5...    100   9e-22   
ref|XP_005769142.1|  hypothetical protein EMIHUDRAFT_48584            95.5    9e-22   
gb|EXU58288.1|  chaperone protein DnaJ                                98.6    9e-22   
ref|WP_019595395.1|  molecular chaperone DnaJ                         99.8    1e-21   
gb|KCB21109.1|  chaperone protein DnaJ                                99.8    1e-21   
gb|KCB32520.1|  chaperone protein DnaJ                                99.8    1e-21   
ref|WP_032052356.1|  molecular chaperone DnaJ                         99.8    1e-21   
ref|WP_005017657.1|  MULTISPECIES: molecular chaperone DnaJ           99.8    1e-21   
ref|WP_019138388.1|  molecular chaperone DnaJ                         99.8    1e-21   
ref|XP_002847128.1|  chaperone protein dnaJ                             100   1e-21   
ref|WP_022264519.1|  chaperone protein DnaJ                           99.8    1e-21   
ref|WP_004649694.1|  chaperone dnaJ                                   99.8    1e-21   
ref|WP_005037805.1|  chaperone dnaJ                                   99.8    1e-21   
ref|WP_008510605.1|  molecular chaperone DnaJ                         99.8    1e-21   
ref|WP_039663141.1|  molecular chaperone DnaJ                         99.8    1e-21   
ref|WP_017391119.1|  molecular chaperone DnaJ                         99.8    1e-21   
ref|WP_038347018.1|  molecular chaperone DnaJ                         98.6    1e-21   
ref|WP_029579023.1|  molecular chaperone DnaJ                         99.8    1e-21   
ref|WP_018678772.1|  molecular chaperone DnaJ                         99.8    1e-21   
gb|AAI66524.1|  Dnajb5 protein                                        99.8    1e-21   
ref|XP_006538172.1|  PREDICTED: dnaJ homolog subfamily B member 5...    100   1e-21   
ref|WP_016139761.1|  chaperone dnaJ                                   99.4    1e-21   
ref|XP_002478817.1|  DnaJ domain protein, putative                    99.8    1e-21   
ref|WP_032971496.1|  molecular chaperone DnaJ                         99.4    1e-21   
ref|WP_028006720.1|  molecular chaperone DnaJ                         99.4    1e-21   
gb|EQE23135.1|  dnaJ domain protein                                   95.9    1e-21   
ref|XP_006538171.1|  PREDICTED: dnaJ homolog subfamily B member 5...    100   1e-21   
ref|WP_034614677.1|  molecular chaperone DnaJ                         99.4    1e-21   
ref|XP_001785714.1|  predicted protein                                99.4    1e-21   
ref|WP_028068254.1|  molecular chaperone DnaJ                         99.4    1e-21   
ref|WP_031990912.1|  molecular chaperone DnaJ                         99.4    1e-21   
ref|XP_006238132.1|  PREDICTED: dnaJ homolog subfamily B member 5...    100   1e-21   
ref|XP_005362109.1|  PREDICTED: dnaJ homolog subfamily B member 5...    100   1e-21   
gb|AIA87238.1|  DnaJ                                                  95.9    2e-21   
ref|XP_001770678.1|  predicted protein                                99.0    2e-21   
gb|ENH81734.1|  DnaJ domain-containing protein                          100   2e-21   
ref|XP_005362110.1|  PREDICTED: dnaJ homolog subfamily B member 5...  99.4    2e-21   
ref|WP_019837347.1|  molecular chaperone DnaJ                         99.0    2e-21   
ref|WP_005664920.1|  chaperone dnaJ                                   99.0    2e-21   
ref|WP_004825793.1|  MULTISPECIES: molecular chaperone DnaJ           99.0    2e-21   
ref|WP_039620466.1|  molecular chaperone DnaJ                         99.0    2e-21   
ref|WP_039575115.1|  molecular chaperone DnaJ                         99.0    2e-21   
ref|WP_003527197.1|  molecular chaperone DnaJ [                       99.0    2e-21   
ref|WP_039649659.1|  molecular chaperone DnaJ                         99.0    2e-21   
ref|WP_031972894.1|  molecular chaperone DnaJ                         98.6    2e-21   
ref|WP_008096229.1|  molecular chaperone DnaJ                         99.0    2e-21   
ref|WP_032021667.1|  molecular chaperone DnaJ                         98.6    2e-21   
ref|WP_020648708.1|  hypothetical protein                             98.6    2e-21   
ref|WP_031952519.1|  molecular chaperone DnaJ                         98.6    2e-21   
ref|XP_002669360.1|  DnaJ heat shock family protein                   98.6    2e-21   
ref|WP_022235668.1|  chaperone protein DnaJ                           99.0    2e-21   
ref|XP_003845298.1|  similar to DnaJ protein                          99.0    2e-21   
ref|WP_001119029.1|  MULTISPECIES: molecular chaperone DnaJ           98.6    2e-21   
ref|WP_032018634.1|  molecular chaperone DnaJ                         98.6    2e-21   
ref|WP_004735597.1|  chaperone dnaJ                                   98.6    2e-21   
ref|WP_001119028.1|  MULTISPECIES: molecular chaperone DnaJ           98.6    2e-21   
ref|WP_015391022.1|  chaperone protein DnaJ                           98.6    2e-21   
ref|WP_004704700.1|  MULTISPECIES: chaperone dnaJ                     98.6    2e-21   
emb|CDH60313.1|  heat shock protein family protein                    98.6    2e-21   
ref|WP_026444231.1|  molecular chaperone DnaJ                         98.6    2e-21   
ref|WP_039625578.1|  molecular chaperone DnaJ                         98.6    3e-21   
ref|WP_021559225.1|  chaperone dnaJ                                   98.6    3e-21   
gb|ACO11336.1|  DnaJ homolog subfamily A member 1                     98.6    3e-21   
dbj|GAD99603.1|  DnaJ domain protein, putative                        99.0    3e-21   
ref|WP_019385688.1|  molecular chaperone DnaJ                         98.6    3e-21   
ref|XP_004031789.1|  hypothetical protein IMG5_138460                 99.8    3e-21   
ref|WP_032049716.1|  molecular chaperone DnaJ                         98.2    3e-21   
ref|WP_038841836.1|  molecular chaperone DnaJ                         98.2    3e-21   
ref|WP_043767321.1|  molecular chaperone DnaJ                         98.2    3e-21   
ref|WP_042965058.1|  molecular chaperone DnaJ                         98.2    3e-21   
ref|WP_043210117.1|  molecular chaperone DnaJ                         98.2    3e-21   
gb|EPY29906.1|  DnaJ like protein subfamily A member 2                98.2    3e-21   
ref|XP_004484029.1|  PREDICTED: dnaJ homolog subfamily B member 5     99.4    3e-21   
gb|EEG23718.1|  chaperone protein DnaJ                                98.2    3e-21   
ref|WP_040437288.1|  molecular chaperone DnaJ [                       98.2    3e-21   



>gb|ACU21468.1| unknown [Glycine max]
Length=217

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 110/123 (89%), Gaps = 1/123 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MA RG+ LL LL  L YSLIAIA KSYYDILQ+ KGAS++QIKRAYRKLALKYHPD NPG
Sbjct  1    MAPRGATLLFLLCALCYSLIAIAGKSYYDILQLSKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            NEEANKKFAEI+NAYEVLSD EKRNIYDRYGEEGLKQHAAS GGRG GMN QDIFS+FFG
Sbjct  61   NEEANKKFAEISNAYEVLSDSEKRNIYDRYGEEGLKQHAAS-GGRGGGMNFQDIFSTFFG  119

Query  477  GGP  485
            GGP
Sbjct  120  GGP  122



>emb|CDP17087.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   191 bits (485),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 98/104 (94%), Gaps = 1/104 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            IAIAAKSYYDILQVP+GAS++QIKRAYRKLALKYHPD N GNEEANKKFAEINNAYEVLS
Sbjct  21   IAIAAKSYYDILQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLS  80

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
            D EKR+IYDRYGEEGLKQHAAS GGRG GMNIQDIFS FFGGGP
Sbjct  81   DSEKRSIYDRYGEEGLKQHAAS-GGRGGGMNIQDIFSQFFGGGP  123



>gb|KHN19226.1| DnaJ like subfamily B member 11 [Glycine soja]
Length=343

 Score =   191 bits (484),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 110/123 (89%), Gaps = 1/123 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MA RG+ LL LL  L YSLIAIA KSYYDILQ+ KGAS++QIKRAYRKLALKYHPD NPG
Sbjct  1    MAPRGATLLFLLCALCYSLIAIAGKSYYDILQLSKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            NEEANKKFAEI+NAYEVLSD EKRNIYDRYGEEGLKQHAAS GGRG GMN QDIFS+FFG
Sbjct  61   NEEANKKFAEISNAYEVLSDSEKRNIYDRYGEEGLKQHAAS-GGRGGGMNFQDIFSTFFG  119

Query  477  GGP  485
            GGP
Sbjct  120  GGP  122



>ref|XP_003521587.1| PREDICTED: dnaJ homolog subfamily B member 11 [Glycine max]
Length=343

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 110/123 (89%), Gaps = 1/123 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MA RG+ LL LL  L YSLIAIA KSYYDILQ+ KGAS++QIKRAYRKLALKYHPD NPG
Sbjct  1    MAPRGATLLFLLCALCYSLIAIAGKSYYDILQLSKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            NEEANKKFAEI+NAYEVLSD EKRNIYDRYGEEGLKQHAAS GGRG GMN QDIFS+FFG
Sbjct  61   NEEANKKFAEISNAYEVLSDSEKRNIYDRYGEEGLKQHAAS-GGRGGGMNFQDIFSTFFG  119

Query  477  GGP  485
            GGP
Sbjct  120  GGP  122



>ref|XP_003554541.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Glycine max]
 gb|KHN43472.1| DnaJ like subfamily B member 11 [Glycine soja]
Length=343

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MAHRG+ L  LL  + YSLIAIA KSYYDILQ+ KGAS++QIKRAYRKLALKYHPD NPG
Sbjct  1    MAHRGATLFFLLFAICYSLIAIAGKSYYDILQLSKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            NEEANKKFAEI+NAYEVLSD EKRNIYDRYGEEGLKQHAAS GGRG GMN QDIF SFFG
Sbjct  61   NEEANKKFAEISNAYEVLSDSEKRNIYDRYGEEGLKQHAAS-GGRGGGMNFQDIFGSFFG  119

Query  477  GG  482
            GG
Sbjct  120  GG  121



>gb|KJB41842.1| hypothetical protein B456_007G123900 [Gossypium raimondii]
Length=256

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYYDILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLS
Sbjct  20   VAIAGKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            D EKR IYDRYGEEGLKQHAASGG  G G+NIQDIFSSFFGGG
Sbjct  80   DSEKRGIYDRYGEEGLKQHAASGGRGGMGVNIQDIFSSFFGGG  122



>gb|KHG25948.1| DnaJ subfamily B member 11 [Gossypium arboreum]
Length=344

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYYDILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLS
Sbjct  20   VAIAGKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
            D EKR IYDRYGEEGLKQHAASGG  G G+NIQDIFSSFFGGGP
Sbjct  80   DSEKRGIYDRYGEEGLKQHAASGGRGGMGVNIQDIFSSFFGGGP  123



>gb|KHG17469.1| DnaJ subfamily B member 11 [Gossypium arboreum]
Length=344

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYYDILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLS
Sbjct  20   VAIAGKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
            D EKR IYDRYGEEGLKQHAASGG  G G+NIQDIFSSFFGGGP
Sbjct  80   DSEKRGIYDRYGEEGLKQHAASGGRGGMGVNIQDIFSSFFGGGP  123



>gb|KJB41840.1| hypothetical protein B456_007G123700 [Gossypium raimondii]
Length=225

 Score =   184 bits (468),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYYDILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLS
Sbjct  20   VAIAGKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            D EKR IYDRYGEEGLKQHA SGG  G G+NIQDIFSSFFGGG
Sbjct  80   DSEKRGIYDRYGEEGLKQHATSGGRGGMGVNIQDIFSSFFGGG  122



>ref|XP_009785213.1| PREDICTED: dnaJ protein ERDJ3B-like [Nicotiana sylvestris]
Length=343

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            IAIA+KSYYDILQVPKGAS++QIKRAYRKLALKYHPD N GNEEANKKFAEINNAYEVLS
Sbjct  20   IAIASKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            D EKRNIYDR+GEEGLKQHAA GGGRG+GMN+QDIFS FFGGG
Sbjct  80   DSEKRNIYDRHGEEGLKQHAA-GGGRGSGMNMQDIFSQFFGGG  121



>ref|XP_009606137.1| PREDICTED: dnaJ protein ERDJ3B-like [Nicotiana tomentosiformis]
Length=343

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            IAIA+KSYYDILQVPKGAS++QIKRAYRKLALKYHPD N GNEEANKKFAEI+NAYEVLS
Sbjct  20   IAIASKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEISNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            D EKRNIYDRYGEEGLKQHAAS GGRG+GMN+QDIFS FFGGG
Sbjct  80   DSEKRNIYDRYGEEGLKQHAAS-GGRGSGMNMQDIFSQFFGGG  121



>gb|KJB41839.1| hypothetical protein B456_007G123700 [Gossypium raimondii]
Length=245

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYYDILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLS
Sbjct  20   VAIAGKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            D EKR IYDRYGEEGLKQHA SGG  G G+NIQDIFSSFFGGG
Sbjct  80   DSEKRGIYDRYGEEGLKQHATSGGRGGMGVNIQDIFSSFFGGG  122



>ref|XP_006349203.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Solanum tuberosum]
Length=345

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 104/112 (93%), Gaps = 1/112 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            IAIAAKSYYDILQ+PKGAS++QIKRAYRKLALKYHPD N GNEEANKKFAEI+NAYEV+S
Sbjct  21   IAIAAKSYYDILQIPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEISNAYEVIS  80

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeeKI  509
            D EKRNIYDRYGEEGLKQHAAS GGRG GMN+QDIFS FFGGG  EEEEEKI
Sbjct  81   DSEKRNIYDRYGEEGLKQHAAS-GGRGGGMNMQDIFSQFFGGGSMEEEEEKI  131



>ref|XP_004229405.1| PREDICTED: dnaJ protein ERDJ3B [Solanum lycopersicum]
Length=345

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 104/112 (93%), Gaps = 1/112 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            IAIAAKSYYDILQ+PKGAS++QIKRAYRKLALKYHPD N GNEEANKKFAEI+NAYEV+S
Sbjct  21   IAIAAKSYYDILQIPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEISNAYEVIS  80

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeeKI  509
            D EKRNIYDRYGEEGLKQHAAS GGRG GMN+QDIFS FFGGG  EEEEEKI
Sbjct  81   DSEKRNIYDRYGEEGLKQHAAS-GGRGGGMNMQDIFSQFFGGGSMEEEEEKI  131



>gb|KJB41841.1| hypothetical protein B456_007G123900 [Gossypium raimondii]
Length=344

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYYDILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLS
Sbjct  20   VAIAGKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            D EKR IYDRYGEEGLKQHAASGG  G G+NIQDIFSSFFGGG
Sbjct  80   DSEKRGIYDRYGEEGLKQHAASGGRGGMGVNIQDIFSSFFGGG  122



>gb|KJB41838.1| hypothetical protein B456_007G123700 [Gossypium raimondii]
Length=344

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYYDILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLS
Sbjct  20   VAIAGKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            D EKR IYDRYGEEGLKQHA SGG  G G+NIQDIFSSFFGGG
Sbjct  80   DSEKRGIYDRYGEEGLKQHATSGGRGGMGVNIQDIFSSFFGGG  122



>ref|XP_010268041.1| PREDICTED: dnaJ protein ERDJ3B [Nelumbo nucifera]
Length=343

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
              A KSYYDILQV KGAS++QIKRAYRKLALKYHPD N GNEEANKKFAEINNAYEVLSD
Sbjct  21   TFAGKSYYDILQVQKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLSD  80

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
             EKRNIYDRYGEEGLKQHAAS GGRG GMNIQDIFS+FFGGGP
Sbjct  81   REKRNIYDRYGEEGLKQHAAS-GGRGGGMNIQDIFSTFFGGGP  122



>ref|XP_002275221.1| PREDICTED: dnaJ protein ERDJ3B [Vitis vinifera]
 emb|CAN72389.1| hypothetical protein VITISV_040417 [Vitis vinifera]
 emb|CBI36928.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            +IA KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEANKKFAEINNAYEVLSD
Sbjct  22   SIAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLSD  81

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
             EKRNIYDRYGEEGLKQHAASGG  G GMNIQDIFSSFFGGGP
Sbjct  82   NEKRNIYDRYGEEGLKQHAASGGRGGGGMNIQDIFSSFFGGGP  124



>ref|XP_008451505.1| PREDICTED: dnaJ homolog subfamily B member 11 [Cucumis melo]
Length=344

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MAHR +KLL ++  L Y + AIA KSYYDILQV KGASEDQIKRAYRKLALKYHPD N G
Sbjct  1    MAHRRTKLLFVVCALCYVISAIAGKSYYDILQVQKGASEDQIKRAYRKLALKYHPDKNQG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
            NEEAN++FAEI+NAYEVLSDGEKRNIYDRYGEEGLKQHAAS GGRG GMNIQDIFS FF
Sbjct  61   NEEANRRFAEISNAYEVLSDGEKRNIYDRYGEEGLKQHAAS-GGRGGGMNIQDIFSQFF  118



>ref|XP_004136000.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Cucumis sativus]
 ref|XP_004163147.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Cucumis sativus]
 gb|KGN45000.1| hypothetical protein Csa_7G407530 [Cucumis sativus]
Length=344

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MAHR +KLL ++  L Y L AIA KSYYDILQV KGAS+DQIKRAYRKLALKYHPD N G
Sbjct  1    MAHRRTKLLFVVCALCYVLSAIAGKSYYDILQVQKGASDDQIKRAYRKLALKYHPDKNQG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
            NEEANK+FAEI+NAYEVLSDGEKRNIYDRYGEEGLKQHAAS GGRG GMNIQDIFS FF
Sbjct  61   NEEANKRFAEISNAYEVLSDGEKRNIYDRYGEEGLKQHAAS-GGRGGGMNIQDIFSQFF  118



>gb|KJB24400.1| hypothetical protein B456_004G143600 [Gossypium raimondii]
Length=343

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 1/104 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA K+YY+ILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLS
Sbjct  20   VAIAEKNYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
            D +KR+IYDRYGEEGLKQHAA  GG G G+N+QDIFSSFFGGGP
Sbjct  80   DSQKRSIYDRYGEEGLKQHAARAGG-GMGVNMQDIFSSFFGGGP  122



>gb|EYU46792.1| hypothetical protein MIMGU_mgv1a0099882mg, partial [Erythranthe 
guttata]
Length=223

 Score =   177 bits (448),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 110/123 (89%), Gaps = 1/123 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MA R SKLL+L+  LSY LIAIAAKSYYDILQV KGAS++QIKRAYRKLALKYHPD NPG
Sbjct  1    MAQRRSKLLLLVCFLSYYLIAIAAKSYYDILQVQKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFF  473
            NEEANKKFAEINNAYEVLSD EKR IYDRYGEEGLKQHAAS G G G GMNIQDIFSSFF
Sbjct  61   NEEANKKFAEINNAYEVLSDSEKRGIYDRYGEEGLKQHAASGGRGGGGGMNIQDIFSSFF  120

Query  474  GGG  482
            GGG
Sbjct  121  GGG  123



>ref|XP_011079583.1| PREDICTED: dnaJ protein ERDJ3B [Sesamum indicum]
Length=344

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MAHR SKLL+    +SY L A AAKSYYDILQVP+GAS++QIKRAYRKLALKYHPD N G
Sbjct  1    MAHRRSKLLLFFCFVSYCLFAFAAKSYYDILQVPRGASDEQIKRAYRKLALKYHPDKNQG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            NEEANKKFAEINNAYEVLSD EKR IYDRYGE+GLKQHAA+GG  G GMNIQDIFSSFFG
Sbjct  61   NEEANKKFAEINNAYEVLSDSEKRGIYDRYGEDGLKQHAANGGRGGGGMNIQDIFSSFFG  120

Query  477  GGP  485
            GGP
Sbjct  121  GGP  123



>gb|KHF99198.1| DnaJ subfamily B member 11 [Gossypium arboreum]
Length=342

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 96/104 (92%), Gaps = 1/104 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA K+YY+ILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLS
Sbjct  20   VAIAEKNYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
            D +KR+IYDRYGEEGLKQHAA  GG G G+N+ DIFSSFFGGGP
Sbjct  80   DSQKRSIYDRYGEEGLKQHAARAGG-GMGVNMHDIFSSFFGGGP  122



>ref|XP_009766352.1| PREDICTED: dnaJ protein ERDJ3B-like [Nicotiana sylvestris]
Length=346

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  117  MAH-RGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNP  293
            MAH R   +L+L        IAIAAKSYYDILQVPKGAS++QIKRAYRKLALKYHPD NP
Sbjct  1    MAHGRSKLILLLCCLSYTLSIAIAAKSYYDILQVPKGASDEQIKRAYRKLALKYHPDKNP  60

Query  294  GNEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
            GNEEAN KFAEINNAYEVLSD EK+NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFS FF
Sbjct  61   GNEEANTKFAEINNAYEVLSDSEKKNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSQFF  120

Query  474  GGGPNeeeeeKI  509
            GGG  EEEEEKI
Sbjct  121  GGGSMEEEEEKI  132



>ref|XP_008797220.1| PREDICTED: dnaJ homolog subfamily B member 11-like isoform X2 
[Phoenix dactylifera]
Length=298

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 1/98 (1%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            K+YYD+LQVPKGASE+QIKR+YRKLALKYHPD NPGNEEANK+FAEINNAYEVLSD EKR
Sbjct  25   KNYYDVLQVPKGASEEQIKRSYRKLALKYHPDKNPGNEEANKRFAEINNAYEVLSDREKR  84

Query  369  NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            +IYDRYGEEG+KQHA S GGRG GMNIQDIF++FFGGG
Sbjct  85   SIYDRYGEEGVKQHANS-GGRGGGMNIQDIFNNFFGGG  121



>ref|XP_010095300.1| DnaJ homolog subfamily B member 11 [Morus notabilis]
 gb|EXB59329.1| DnaJ homolog subfamily B member 11 [Morus notabilis]
Length=344

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MAHR SKLL L   L Y+L AIA KS+YD+LQVPKGAS++QIKRAYRKLALKYHPD N G
Sbjct  1    MAHRRSKLLFLFCALCYALSAIAGKSFYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            NEEANKKFAEINNAYEVLSD EKRNIYDRYGEEGLKQHAASGGGRG GMNI DIFS+ FG
Sbjct  61   NEEANKKFAEINNAYEVLSDSEKRNIYDRYGEEGLKQHAASGGGRGGGMNINDIFSNLFG  120

Query  477  GG  482
            GG
Sbjct  121  GG  122



>ref|XP_008797219.1| PREDICTED: dnaJ homolog subfamily B member 11-like isoform X1 
[Phoenix dactylifera]
Length=344

 Score =   174 bits (442),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 1/98 (1%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            K+YYD+LQVPKGASE+QIKR+YRKLALKYHPD NPGNEEANK+FAEINNAYEVLSD EKR
Sbjct  25   KNYYDVLQVPKGASEEQIKRSYRKLALKYHPDKNPGNEEANKRFAEINNAYEVLSDREKR  84

Query  369  NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            +IYDRYGEEG+KQHA S GGRG GMNIQDIF++FFGGG
Sbjct  85   SIYDRYGEEGVKQHANS-GGRGGGMNIQDIFNNFFGGG  121



>ref|XP_009383732.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Musa acuminata 
subsp. malaccensis]
Length=354

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 91/103 (88%), Gaps = 1/103 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              +  KSYYD+LQV KGAS++QIKRAYRKLALKYHPD N GNEEANK+FAEINNAYEVLS
Sbjct  30   CVLGGKSYYDVLQVSKGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLS  89

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            D EKRNIYDRYGEEGLKQHAA GGGRG GMNIQDIF+ FFG G
Sbjct  90   DSEKRNIYDRYGEEGLKQHAA-GGGRGPGMNIQDIFNEFFGTG  131



>ref|XP_009604699.1| PREDICTED: dnaJ protein ERDJ3B-like [Nicotiana tomentosiformis]
Length=347

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            IAIAAKSYYDILQV KGAS++QIKRAYRKLALKYHPD N GNEEANKKFAEINNAYEVLS
Sbjct  22   IAIAAKSYYDILQVSKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLS  81

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            D EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFS FFGGG
Sbjct  82   DSEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSQFFGGG  124



>ref|XP_004494412.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Cicer arietinum]
Length=344

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MAHR +KLL LL  L YSL AIAAKSYYDILQV KGAS+DQIKRAYRKLALKYHPD N G
Sbjct  1    MAHRRAKLLFLLCALCYSLHAIAAKSYYDILQVSKGASDDQIKRAYRKLALKYHPDKNQG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            NEEANKKFAEINNAYEVLSD EKR+IYDRYGEEGLKQHAA  GGRG GMN+QDIF+SFFG
Sbjct  61   NEEANKKFAEINNAYEVLSDSEKRSIYDRYGEEGLKQHAAG-GGRGGGMNMQDIFNSFFG  119

Query  477  GGPNeeeeeKI  509
            GG  EEEEEKI
Sbjct  120  GGSMEEEEEKI  130



>ref|XP_010914541.1| PREDICTED: dnaJ protein ERDJ3B [Elaeis guineensis]
Length=344

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            A   K+YYD+LQV KGASE+QIKRAYRKLALKYHPD NPGNEEANK+F EINNAYEVLSD
Sbjct  21   AFGGKNYYDVLQVSKGASEEQIKRAYRKLALKYHPDKNPGNEEANKRFTEINNAYEVLSD  80

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
             EKR+IYDRYGEEG+KQHA+S GGRG GMNIQDIF++ FGGG
Sbjct  81   REKRSIYDRYGEEGVKQHASS-GGRGGGMNIQDIFNNLFGGG  121



>ref|XP_003625951.1| DnaJ homolog subfamily B member [Medicago truncatula]
 gb|AES82169.1| DnaJ heat shock family protein [Medicago truncatula]
 gb|AFK39492.1| unknown [Medicago truncatula]
Length=344

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            AIA KSYYDILQV KGAS+DQIKRAYRKLALKYHPD NPGNEEANKKFAEI+NAYEVLSD
Sbjct  21   AIAVKSYYDILQVSKGASDDQIKRAYRKLALKYHPDKNPGNEEANKKFAEISNAYEVLSD  80

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPNeeeeeKI  509
             EKRNIYD+YGEEGLKQHAA  GGRG GMN+QDIF+SFFGGG  EEEEEKI
Sbjct  81   NEKRNIYDKYGEEGLKQHAAG-GGRGGGMNMQDIFNSFFGGGSMEEEEEKI  130



>gb|KDO87051.1| hypothetical protein CISIN_1g0191621mg, partial [Citrus sinensis]
 gb|KDO87052.1| hypothetical protein CISIN_1g0191621mg, partial [Citrus sinensis]
 gb|KDO87053.1| hypothetical protein CISIN_1g0191621mg, partial [Citrus sinensis]
Length=194

 Score =   166 bits (421),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MAHR ++LL LL  L Y+L  IA KSYY++LQVP+GAS++QIKRAYRKLALKYHPD N G
Sbjct  1    MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAA-SGGGRGAGMNIQDIFSSFF  473
            NEEANK+FAEINNAYEVLSD E RNIYD YGEEGLKQHAA  G G G G+NIQDIFSSFF
Sbjct  61   NEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFF  120

Query  474  GGGP  485
            GGGP
Sbjct  121  GGGP  124



>ref|XP_006444462.1| hypothetical protein CICLE_v10020947mg [Citrus clementina]
 gb|ESR57702.1| hypothetical protein CICLE_v10020947mg [Citrus clementina]
Length=259

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MAHR ++LL LL  L Y+L  IA KSYY++LQVP+GAS++QIKRAYRKLALKYHPD N G
Sbjct  1    MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAA-SGGGRGAGMNIQDIFSSFF  473
            NEEANK+FAEINNAYEVLSD E RNIYD YGEEGLKQHAA  G G G G+NIQDIFSSFF
Sbjct  61   NEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFF  120

Query  474  GGGP  485
            GGGP
Sbjct  121  GGGP  124



>gb|KDP28236.1| hypothetical protein JCGZ_14007 [Jatropha curcas]
Length=346

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 93/104 (89%), Gaps = 1/104 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            IAIA KSYYDILQVPK AS+DQIKRAYRKLALKYHPD NPGNEEANK+FAEINNAYEVLS
Sbjct  21   IAIAGKSYYDILQVPKAASDDQIKRAYRKLALKYHPDKNPGNEEANKRFAEINNAYEVLS  80

Query  354  DGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFFGGG  482
            DGEKRNIYD+YGEEGLKQH AS G G G GMNI D+F  FFGGG
Sbjct  81   DGEKRNIYDKYGEEGLKQHMASGGRGGGMGMNINDLFRDFFGGG  124



>ref|XP_007163164.1| hypothetical protein PHAVU_001G211800g [Phaseolus vulgaris]
 gb|ESW35158.1| hypothetical protein PHAVU_001G211800g [Phaseolus vulgaris]
Length=343

 Score =   167 bits (423),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MAHR  KL  LL  LSYSL AIA KSYYD+LQV KGAS++QIKRAYRKLALKYHPD N G
Sbjct  1    MAHRRIKLFFLLCALSYSLSAIAGKSYYDVLQVSKGASDEQIKRAYRKLALKYHPDKNQG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            NEEANKKFAEINNAYEVLSD EKR IYDRYGEEGLKQHAA  GG G GMN QDIFS+FFG
Sbjct  61   NEEANKKFAEINNAYEVLSDREKRGIYDRYGEEGLKQHAAG-GGGGGGMNFQDIFSTFFG  119

Query  477  GG  482
            GG
Sbjct  120  GG  121



>ref|XP_006444463.1| hypothetical protein CICLE_v10020947mg [Citrus clementina]
 ref|XP_006480056.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Citrus sinensis]
 gb|ESR57703.1| hypothetical protein CICLE_v10020947mg [Citrus clementina]
Length=345

 Score =   167 bits (422),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MAHR ++LL LL  L Y+L  IA KSYY++LQVP+GAS++QIKRAYRKLALKYHPD N G
Sbjct  1    MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAA-SGGGRGAGMNIQDIFSSFF  473
            NEEANK+FAEINNAYEVLSD E RNIYD YGEEGLKQHAA  G G G G+NIQDIFSSFF
Sbjct  61   NEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFF  120

Query  474  GGGP  485
            GGGP
Sbjct  121  GGGP  124



>ref|XP_011041488.1| PREDICTED: dnaJ protein ERDJ3B-like [Populus euphratica]
Length=349

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 92/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            IAIA KSYY++LQVPKGAS++QIKRAYRKLALKYHPD N GNEEAN +FAEINNAYEVLS
Sbjct  24   IAIAGKSYYEVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANLRFAEINNAYEVLS  83

Query  354  DGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFFGGG  482
            D EKRNIYDRYGEEGLKQH AS G G G GMN QDIFS FFGGG
Sbjct  84   DSEKRNIYDRYGEEGLKQHMASGGRGGGGGMNFQDIFSQFFGGG  127



>gb|KCW50098.1| hypothetical protein EUGRSUZ_K03532 [Eucalyptus grandis]
Length=247

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MA+ G KLL LL  L  + IAIA +SYYD+LQVPKGAS++QIKRAYRKLALKYHPD NPG
Sbjct  1    MANPGHKLLFLLCALCSAAIAIAGQSYYDMLQVPKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFF  473
            NEEANKKFA+INNAYEVLSDGEKR IYDRYGEEGLKQHAAS G G G GMNIQDIF S F
Sbjct  61   NEEANKKFADINNAYEVLSDGEKRGIYDRYGEEGLKQHAASGGRGGGMGMNIQDIFESMF  120



>ref|XP_003519751.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Glycine max]
Length=346

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 2/105 (2%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            AIA KSYYD+L++PKGASE+QIKRAYRKLALKYHPD NPGN+EANK+FAEINNAYEVLSD
Sbjct  21   AIAGKSYYDVLEIPKGASEEQIKRAYRKLALKYHPDKNPGNQEANKRFAEINNAYEVLSD  80

Query  357  GEKRNIYDRYGEEGLKQHAA--SGGGRGAGMNIQDIFSSFFGGGP  485
             E+R+IYDRYGEEGLKQHAA    GG G GM  QDIF+SFFGGGP
Sbjct  81   SERRSIYDRYGEEGLKQHAAGGGRGGGGMGMEFQDIFASFFGGGP  125



>gb|KHN08649.1| DnaJ like subfamily B member 11 [Glycine soja]
Length=346

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 2/105 (2%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            AIA KSYYD+L++PKGASE+QIKRAYRKLALKYHPD NPGN+EANK+FAEINNAYEVLSD
Sbjct  21   AIAGKSYYDVLEIPKGASEEQIKRAYRKLALKYHPDKNPGNQEANKRFAEINNAYEVLSD  80

Query  357  GEKRNIYDRYGEEGLKQHAA--SGGGRGAGMNIQDIFSSFFGGGP  485
             E+R+IYDRYGEEGLKQHAA    GG G GM  QDIF+SFFGGGP
Sbjct  81   SERRSIYDRYGEEGLKQHAAGGGRGGGGMGMEFQDIFASFFGGGP  125



>ref|XP_006855308.1| hypothetical protein AMTR_s00057p00065600 [Amborella trichopoda]
 gb|ERN16775.1| hypothetical protein AMTR_s00057p00065600 [Amborella trichopoda]
Length=343

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 91/103 (88%), Gaps = 1/103 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            A+  KS+YDILQVPKGASEDQIKRAYRKLALKYHPD NPGNEEANKKFA+INNAYEVLSD
Sbjct  21   ALPGKSFYDILQVPKGASEDQIKRAYRKLALKYHPDKNPGNEEANKKFADINNAYEVLSD  80

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
             EKR IYDRYGEEGLKQ  A  GGRG GMN QDIF SFFGGGP
Sbjct  81   REKREIYDRYGEEGLKQSQAG-GGRGGGMNFQDIFGSFFGGGP  122



>gb|ABK95286.1| unknown [Populus trichocarpa]
Length=349

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 92/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            IAIA KSYY++LQVPKGAS++QIK+AYRKLALKYHPD N GNEEAN +FAEINNAYEVLS
Sbjct  24   IAIAGKSYYEVLQVPKGASDEQIKKAYRKLALKYHPDKNQGNEEANLRFAEINNAYEVLS  83

Query  354  DGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFFGGG  482
            D EKRNIYDRYGEEGLKQH AS G G G GMN QDIFS FFGGG
Sbjct  84   DSEKRNIYDRYGEEGLKQHMASGGRGGGGGMNFQDIFSQFFGGG  127



>ref|XP_002320981.2| DNAJ heat shock family protein [Populus trichocarpa]
 gb|EEE99296.2| DNAJ heat shock family protein [Populus trichocarpa]
Length=349

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 92/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            IAIA KSYY++LQVPKGAS++QIK+AYRKLALKYHPD N GNEEAN +FAEINNAYEVLS
Sbjct  24   IAIAGKSYYEVLQVPKGASDEQIKKAYRKLALKYHPDKNQGNEEANLRFAEINNAYEVLS  83

Query  354  DGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFFGGG  482
            D EKRNIYDRYGEEGLKQH AS G G G GMN QDIFS FFGGG
Sbjct  84   DSEKRNIYDRYGEEGLKQHMASGGRGGGGGMNFQDIFSQFFGGG  127



>ref|XP_010038274.1| PREDICTED: dnaJ protein ERDJ3B [Eucalyptus grandis]
 gb|KCW50097.1| hypothetical protein EUGRSUZ_K03532 [Eucalyptus grandis]
Length=346

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MA+ G KLL LL  L  + IAIA +SYYD+LQVPKGAS++QIKRAYRKLALKYHPD NPG
Sbjct  1    MANPGHKLLFLLCALCSAAIAIAGQSYYDMLQVPKGASDEQIKRAYRKLALKYHPDKNPG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFF  473
            NEEANKKFA+INNAYEVLSDGEKR IYDRYGEEGLKQHAAS G G G GMNIQDIF S F
Sbjct  61   NEEANKKFADINNAYEVLSDGEKRGIYDRYGEEGLKQHAASGGRGGGMGMNIQDIFESMF  120



>ref|XP_002301501.1| DNAJ heat shock family protein [Populus trichocarpa]
 gb|EEE80774.1| DNAJ heat shock family protein [Populus trichocarpa]
Length=345

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 92/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYY++LQVPKGAS++QIKRAYRKLALKYHPD N GNEEAN +FAEI+NAYEVLS
Sbjct  20   VAIAGKSYYEVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANLRFAEISNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFFGGG  482
            D EKRNIYDR+GEEGLKQH AS G G G GMN QDIFS FFGGG
Sbjct  80   DSEKRNIYDRHGEEGLKQHMASGGRGGGGGMNFQDIFSQFFGGG  123



>ref|XP_009339791.1| PREDICTED: dnaJ homolog subfamily B member 11 [Pyrus x bretschneideri]
Length=351

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 91/100 (91%), Gaps = 2/100 (2%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            KSYY+ILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLSD EKR
Sbjct  29   KSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLSDSEKR  88

Query  369  NIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFFGGG  482
            NIYDRYGEEGLKQHAAS   GG G GMNI DIFS FFGGG
Sbjct  89   NIYDRYGEEGLKQHAASGGRGGGGMGMNINDIFSEFFGGG  128



>ref|XP_011042226.1| PREDICTED: dnaJ protein ERDJ3B [Populus euphratica]
Length=345

 Score =   162 bits (409),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYY++LQVP+GAS+ QIKRAYRKLALKYHPD N GNEEAN +FAEINNAYEVLS
Sbjct  20   VAIAGKSYYEVLQVPRGASDVQIKRAYRKLALKYHPDKNQGNEEANLRFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFFGGG  482
            D EKRNIYDR+GEEGLKQH AS G G G GMN QDIFS FFGGG
Sbjct  80   DSEKRNIYDRHGEEGLKQHMASGGRGGGGGMNFQDIFSQFFGGG  123



>ref|XP_009414445.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Musa acuminata 
subsp. malaccensis]
Length=344

 Score =   162 bits (409),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            KSYYD+LQVPKGASEDQIKRAYRKLALKYHPD N GNEEANK+FAEINNAYEVLSD EKR
Sbjct  25   KSYYDVLQVPKGASEDQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSEKR  84

Query  369  NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             IYDRYGEEGLKQ+A   GGRG+GMNIQDIF+SFFG G N
Sbjct  85   KIYDRYGEEGLKQYAGG-GGRGSGMNIQDIFNSFFGNGQN  123



>ref|XP_010931736.1| PREDICTED: dnaJ protein ERDJ3B-like [Elaeis guineensis]
Length=346

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            A+  K+YYD+LQV KGASE+QIKRAYRKLALKYHPD NPGNE+ANK+FAEINNAYEVLSD
Sbjct  21   ALGGKNYYDVLQVSKGASEEQIKRAYRKLALKYHPDKNPGNEDANKRFAEINNAYEVLSD  80

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
             EKR+IYDRYGEEG+KQH AS GG G GMN+QDIF+SFFGGG
Sbjct  81   REKRSIYDRYGEEGVKQH-ASRGGGGGGMNMQDIFNSFFGGG  121



>ref|XP_010679350.1| PREDICTED: dnaJ protein ERDJ3B [Beta vulgaris subsp. vulgaris]
Length=348

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 89/101 (88%), Gaps = 2/101 (2%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPD N GNEEANKKFAEINNAYEVL+D
Sbjct  23   AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDKNQGNEEANKKFAEINNAYEVLTD  82

Query  357  GEKRNIYDRYGEEGLKQHAA--SGGGRGAGMNIQDIFSSFF  473
            GEKR IYDRYGEEGLKQ+AA    GG G GM  QDIFS FF
Sbjct  83   GEKRKIYDRYGEEGLKQYAASGGRGGSGGGMGFQDIFSQFF  123



>ref|XP_002439322.1| hypothetical protein SORBIDRAFT_09g004380 [Sorghum bicolor]
 gb|EES17752.1| hypothetical protein SORBIDRAFT_09g004380 [Sorghum bicolor]
Length=350

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYYD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEANK+FAEINNAYEVL+
Sbjct  24   VAIAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEANKRFAEINNAYEVLT  83

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
            D EKR IYDRYGEEGLKQ      G G GMNIQDIFSSFF
Sbjct  84   DQEKRKIYDRYGEEGLKQFQGG-RGGGGGMNIQDIFSSFF  122



>gb|EEE62392.1| hypothetical protein OsJ_17183 [Oryza sativa Japonica Group]
Length=347

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            A+A KSYYD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEANK+FAEINNAYE+L+D
Sbjct  20   AVAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPNNEEANKRFAEINNAYEILTD  79

Query  357  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFF  473
             EKR IYDRYGEEGLKQ  A  G G G GMNIQDIFSSFF
Sbjct  80   QEKRKIYDRYGEEGLKQFQAQGGRGGGGGMNIQDIFSSFF  119



>gb|EMS56866.1| DnaJ homolog subfamily B member 2 [Triticum urartu]
Length=165

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            IA KS+YD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEA K+FAEINNAYEVL+D 
Sbjct  38   IARKSFYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEATKRFAEINNAYEVLTDQ  97

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSS  467
            EKR IYDRYGEEGLKQ     GG G GMN+QDIFSS
Sbjct  98   EKRKIYDRYGEEGLKQFQGGRGGGGGGMNMQDIFSS  133



>ref|XP_008345236.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Malus domestica]
Length=352

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 3/101 (3%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            KSYY+ILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLSD EKR
Sbjct  29   KSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLSDSEKR  88

Query  369  NIYDRYGEEGLKQHAAS---GGGRGAGMNIQDIFSSFFGGG  482
            +IYDRYGEEGLKQHAA+   GGG G GMNI DIFS FFGGG
Sbjct  89   SIYDRYGEEGLKQHAATGGRGGGGGMGMNINDIFSEFFGGG  129



>ref|XP_007200611.1| hypothetical protein PRUPE_ppa007947mg [Prunus persica]
 gb|EMJ01810.1| hypothetical protein PRUPE_ppa007947mg [Prunus persica]
Length=350

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 93/104 (89%), Gaps = 3/104 (3%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            AIA KSYY+ILQVPKGAS++QIKRAYRKLALKYHPD N GNEEANKKFA+INNAYEVLSD
Sbjct  24   AIAGKSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFADINNAYEVLSD  83

Query  357  GEKRNIYDRYGEEGLKQHAAS---GGGRGAGMNIQDIFSSFFGG  479
             EKR+IYDRYGEEGLKQHAAS   GGG G GMNI DIF+ FFGG
Sbjct  84   SEKRSIYDRYGEEGLKQHAASGGRGGGGGMGMNINDIFADFFGG  127



>gb|AFW81378.1| hypothetical protein ZEAMMB73_185883 [Zea mays]
Length=321

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYYD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEANK+FAEINNAYEVL+
Sbjct  24   VAIAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEANKRFAEINNAYEVLT  83

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
            D EK+ IYDRYGEEGLKQ      G G GMNIQDIFSSFF
Sbjct  84   DQEKKKIYDRYGEEGLKQFQGG-RGSGGGMNIQDIFSSFF  122



>ref|XP_009378691.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Pyrus x bretschneideri]
Length=352

 Score =   159 bits (402),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 3/101 (3%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            KSYY+ILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLSD EKR
Sbjct  29   KSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLSDSEKR  88

Query  369  NIYDRYGEEGLKQHAAS---GGGRGAGMNIQDIFSSFFGGG  482
            +IYDRYGEEGLKQHAA+   GGG G GMNI DIFS FFGGG
Sbjct  89   SIYDRYGEEGLKQHAATGGRGGGGGMGMNINDIFSEFFGGG  129



>ref|XP_008386734.1| PREDICTED: dnaJ homolog subfamily B member 11 [Malus domestica]
Length=351

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            KSYY+ILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLSD EKR
Sbjct  29   KSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLSDSEKR  88

Query  369  NIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFFGGG  482
            NIYDRYGE+GL QHAAS   GG G GMNI DIFS FFGGG
Sbjct  89   NIYDRYGEDGLXQHAASGGRGGGGMGMNINDIFSEFFGGG  128



>ref|XP_008235186.1| PREDICTED: dnaJ homolog subfamily B member 11 [Prunus mume]
Length=350

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 92/104 (88%), Gaps = 3/104 (3%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            AIA KSYY+ILQVPKGAS++QIKRAYRKLALKYHPD N GNEEANKKFA+INNAYEVLSD
Sbjct  24   AIAGKSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANKKFADINNAYEVLSD  83

Query  357  GEKRNIYDRYGEEGLKQHAAS---GGGRGAGMNIQDIFSSFFGG  479
             EKR IYDRYGEEGLKQHAAS   GGG G GMNI DIF+ FFGG
Sbjct  84   SEKRGIYDRYGEEGLKQHAASGGRGGGGGMGMNINDIFADFFGG  127



>gb|EAY96619.1| hypothetical protein OsI_18531 [Oryza sativa Indica Group]
Length=347

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
             +A KSYYD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEANK+FAEINNAYE+L+D
Sbjct  20   TVAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPNNEEANKRFAEINNAYEILTD  79

Query  357  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFF  473
             EKR IYDRYGEEGLKQ  A  G G G GMNIQDIFSSFF
Sbjct  80   QEKRKIYDRYGEEGLKQFQAQGGRGGGGGMNIQDIFSSFF  119



>ref|XP_008656126.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Zea mays]
 gb|AFW81379.1| hypothetical protein ZEAMMB73_185883 [Zea mays]
Length=350

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +AIA KSYYD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEANK+FAEINNAYEVL+
Sbjct  24   VAIAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEANKRFAEINNAYEVLT  83

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
            D EK+ IYDRYGEEGLKQ      G G GMNIQDIFSSFF
Sbjct  84   DQEKKKIYDRYGEEGLKQFQGG-RGSGGGMNIQDIFSSFF  122



>ref|XP_010523978.1| PREDICTED: dnaJ protein ERDJ3B-like [Tarenaya hassleriana]
Length=346

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 90/104 (87%), Gaps = 2/104 (2%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
             +A KSYYD+LQVP+GAS++QIKRAYRKLALKYHPD N GNEEAN+KFAEINNAYEVLSD
Sbjct  21   VLAGKSYYDMLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANRKFAEINNAYEVLSD  80

Query  357  GEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFFGGG  482
            GEKR IYD+YGEEGLKQ AA+   GG   G+NIQDIF  FFGGG
Sbjct  81   GEKREIYDKYGEEGLKQFAANGGRGGGMGGINIQDIFGQFFGGG  124



>ref|XP_007051071.1| DNAJ heat shock family protein isoform 2 [Theobroma cacao]
 gb|EOX95228.1| DNAJ heat shock family protein isoform 2 [Theobroma cacao]
Length=296

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            A A KSYY+ILQVP+GAS++QIKRAYRKLALKYHPD NPGNEEA+K+FAEINNAYEVLSD
Sbjct  21   AFAGKSYYEILQVPRGASDEQIKRAYRKLALKYHPDKNPGNEEADKRFAEINNAYEVLSD  80

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQD  455
             EKR IYDRYGE+GLKQHAASGG  G G N++D
Sbjct  81   SEKRGIYDRYGEDGLKQHAASGGRGGMGSNLED  113



>ref|XP_004977083.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Setaria italica]
Length=349

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            AIA KSYYD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEA K+FAEINNAYEVL+D
Sbjct  25   AIAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPNNEEATKRFAEINNAYEVLTD  84

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
             EKR IYDRYGEEGLKQ     GG G GMNIQDIFSSFF
Sbjct  85   QEKRKIYDRYGEEGLKQFQGR-GGGGGGMNIQDIFSSFF  122



>ref|XP_010468943.1| PREDICTED: dnaJ protein ERDJ3B [Camelina sativa]
Length=346

 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEA +KFAEINNAYEVLS
Sbjct  20   CVLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFFGGG  482
            D EKR IY++YGEEGLKQ AA+   GG G GMN+QDIFSSFFGGG
Sbjct  80   DEEKREIYNKYGEEGLKQFAANGGRGGGGGGMNMQDIFSSFFGGG  124



>ref|XP_007051070.1| DNAJ heat shock family protein isoform 1 [Theobroma cacao]
 gb|EOX95227.1| DNAJ heat shock family protein isoform 1 [Theobroma cacao]
Length=344

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            A A KSYY+ILQVP+GAS++QIKRAYRKLALKYHPD NPGNEEA+K+FAEINNAYEVLSD
Sbjct  21   AFAGKSYYEILQVPRGASDEQIKRAYRKLALKYHPDKNPGNEEADKRFAEINNAYEVLSD  80

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQD  455
             EKR IYDRYGE+GLKQHAASGG  G G N++D
Sbjct  81   SEKRGIYDRYGEDGLKQHAASGGRGGMGSNLED  113



>ref|XP_004300467.1| PREDICTED: dnaJ protein ERDJ3B [Fragaria vesca subsp. vesca]
Length=342

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 101/114 (89%), Gaps = 3/114 (3%)
 Frame = +3

Query  177  AIAA-KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            AIAA KSYY+ILQVPKGAS++QIKRAYRKLALKYHPD N GNEEAN++FA+INNAYEVLS
Sbjct  15   AIAAGKSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANQRFADINNAYEVLS  74

Query  354  DGEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFFGGGPNeeeeeKI  509
            D EKR+IYDRYGE+GLKQHAAS   GG G GMNI DIF+ FFGGG + EEE+KI
Sbjct  75   DSEKRSIYDRYGEDGLKQHAASGGRGGGGMGMNINDIFADFFGGGRSAEEEDKI  128



>emb|CDX67894.1| BnaA07g19340D [Brassica napus]
Length=327

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              IA KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD NPGN+EA +KFA+INNAYEVLS
Sbjct  20   CVIAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNPGNDEATRKFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFF  473
            D EKR IY++YGEEGLKQHAA+ G G G GMN+QDIFS FF
Sbjct  80   DEEKREIYNKYGEEGLKQHAANGGRGGGGGMNMQDIFSQFF  120



>ref|XP_010512648.1| PREDICTED: dnaJ protein ERDJ3B-like [Camelina sativa]
Length=347

 Score =   156 bits (395),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 92/106 (87%), Gaps = 3/106 (3%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEA +KFAEINNAYEVLS
Sbjct  20   CVLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS---GGGRGAGMNIQDIFSSFFGGG  482
            D EKR IY++YGEEGLKQ AA+   GGG G GMN+QDIFSSFFGGG
Sbjct  80   DEEKREIYNKYGEEGLKQFAANGGRGGGGGGGMNMQDIFSSFFGGG  125



>ref|XP_006293253.1| hypothetical protein CARUB_v10019587mg [Capsella rubella]
 gb|EOA26151.1| hypothetical protein CARUB_v10019587mg [Capsella rubella]
Length=345

 Score =   156 bits (395),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEA +KFAEINNAYEVLS
Sbjct  20   CVLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFFGGG  482
            D EKR IY++YGEEGLKQ +A+ G G G GMN+QDIFSSFFGGG
Sbjct  80   DEEKREIYNKYGEEGLKQFSANGGRGGGGGMNMQDIFSSFFGGG  123



>ref|XP_006402365.1| hypothetical protein EUTSA_v10006078mg [Eutrema salsugineum]
 gb|ESQ43818.1| hypothetical protein EUTSA_v10006078mg [Eutrema salsugineum]
Length=346

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              ++ KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEAN+KFAEINNAYEVLS
Sbjct  20   CVLSGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEANRKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFFGGG  482
            D EKR IY++YGEEGLKQ AA+   GG G GMN+QDIFS FFGGG
Sbjct  80   DEEKREIYNKYGEEGLKQFAANGGRGGGGGGMNMQDIFSQFFGGG  124



>ref|XP_008797436.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Phoenix dactylifera]
Length=344

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            A+  K+YYD+LQV  GASE+QIKRAYRKLALKYHPD NPGNEEANK+FAEI+NAYEVLSD
Sbjct  21   ALGGKNYYDVLQVSTGASEEQIKRAYRKLALKYHPDKNPGNEEANKRFAEISNAYEVLSD  80

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
             EKR+IYDRYGEEG+KQHA+S GGRG G NIQDIF+SFFGGG
Sbjct  81   REKRSIYDRYGEEGVKQHASS-GGRGGGRNIQDIFNSFFGGG  121



>ref|XP_002878466.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54725.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEA +KFAEINNAYEVLS
Sbjct  20   CVLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFFGGG  482
            D EKR IY++YGEEGLKQ +A+   GG G GMN+QDIFSSFFGGG
Sbjct  80   DEEKREIYNKYGEEGLKQFSANGGRGGGGGGMNMQDIFSSFFGGG  124



>ref|NP_191819.1| DNAJ heat shock protein ATERDJ3B [Arabidopsis thaliana]
 sp|Q9LZK5.1|DNJ19_ARATH RecName: Full=DnaJ protein ERDJ3B; AltName: Full=Chaperone protein 
dnaJ 19; Short=AtDjB19; Short=AtJ19; AltName: Full=Endoplasmic 
reticulum dnaJ domain-containing protein 3B; Short=AtERdj3B; 
AltName: Full=Protein SCJ1 homolog ERDJ3B; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB83110.1| putative protein [Arabidopsis thaliana]
 gb|AAM19802.1| AT3g62600/F26K9_30 [Arabidopsis thaliana]
 gb|AAM65179.1| unknown [Arabidopsis thaliana]
 gb|AAM78044.1| At3g62600/F26K9_30 [Arabidopsis thaliana]
 gb|AEE80368.1| DNAJ heat shock family protein [Arabidopsis thaliana]
Length=346

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEA +KFAEINNAYEVLS
Sbjct  20   CVLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFFGGG  482
            D EKR IY++YGEEGLKQ +A+   GG G GMN+QDIFSSFFGGG
Sbjct  80   DEEKREIYNKYGEEGLKQFSANGGRGGGGGGMNMQDIFSSFFGGG  124



>gb|EPS66939.1| hypothetical protein M569_07836, partial [Genlisea aurea]
Length=244

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MAHR S LL+LL  LS  L AIAAKSYYDILQV +GASEDQIKR+YRKLAL+YHPD NPG
Sbjct  1    MAHRRSTLLLLLCALSCYLGAIAAKSYYDILQVSRGASEDQIKRSYRKLALQYHPDKNPG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDI  458
            NEEANKKFAEINNAYEVL D EKR IYD YGEEGLKQHAA GG  G GMNIQDI
Sbjct  61   NEEANKKFAEINNAYEVLIDSEKRQIYDSYGEEGLKQHAAGGGRAGGGMNIQDI  114



>gb|EMT15727.1| DnaJ homolog subfamily B member 11 [Aegilops tauschii]
Length=350

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
             I  KS+YD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEA K+FAEINNAYEVL+D
Sbjct  24   VIEGKSFYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEATKRFAEINNAYEVLTD  83

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
             EKR IYDRYGEEGLKQ     GG G GMN+QDIFSSFF
Sbjct  84   QEKRKIYDRYGEEGLKQFQGGRGGGGGGMNMQDIFSSFF  122



>dbj|BAK07410.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=350

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
             I  KS+YD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEA K+FAEINNAYEVL+D
Sbjct  24   VIEGKSFYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEATKRFAEINNAYEVLTD  83

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
             EKR +YDRYGEEGLKQ     GG G GMN+QDIFSSFF
Sbjct  84   QEKRKVYDRYGEEGLKQFQGGRGGGGGGMNMQDIFSSFF  122



>ref|XP_010544978.1| PREDICTED: dnaJ protein ERDJ3B [Tarenaya hassleriana]
Length=346

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            IA+A KSYYD+LQVP+GAS++QIKRAYRKLALKYHPD N GNEEAN+KFAEINNAYEVLS
Sbjct  20   IALAGKSYYDVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANRKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFFGGG  482
            D EKR IY++YGEEGLKQ AA+   GG   G+NI+DIF  FFGGG
Sbjct  80   DSEKREIYNKYGEEGLKQFAANGGRGGGTGGINIEDIFGQFFGGG  124



>ref|XP_010413269.1| PREDICTED: dnaJ protein ERDJ3B-like [Camelina sativa]
Length=346

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 2/105 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              +A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEA +KFAEINNAYEVLS
Sbjct  20   CVLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFFGGG  482
            D EKR IY++YGEEGLKQ AA+   GG G GMN+QDIF SFFGGG
Sbjct  80   DEEKREIYNKYGEEGLKQFAANGGRGGGGGGMNMQDIFGSFFGGG  124



>ref|XP_002515306.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF47290.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=345

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 102/119 (86%), Gaps = 1/119 (1%)
 Frame = +3

Query  117  MAHRGskllvlllclsyslIAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPG  296
            MA+R +KLL LL  LSY L  I+AKSYYD+LQVPK AS++QIKRAYRKLALKYHPD NPG
Sbjct  1    MAYRKAKLLFLLCALSYVLSVISAKSYYDVLQVPKSASDEQIKRAYRKLALKYHPDKNPG  60

Query  297  NEEANKKFAEINNAYEVLSDGEKRNIYDRYGEEGLKQH-AASGGGRGAGMNIQDIFSSF  470
            NEEANK+FAEINNAYEVLSD EKRNIYDRYGEEG+KQH A  G G G GMNIQD+FS F
Sbjct  61   NEEANKRFAEINNAYEVLSDSEKRNIYDRYGEEGIKQHMAGGGRGGGMGMNIQDLFSFF  119



>pir||S56704 GUT 7-2a protein - common tobacco (fragment)
Length=88

 Score =   147 bits (370),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  213  VPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNIYDRYGE  392
            VPKGAS++QIKRAYRKLALKYHPD NPGNEEAN KFAEINNAYEVLSD EK+NIYDRYGE
Sbjct  1    VPKGASDEQIKRAYRKLALKYHPDKNPGNEEANTKFAEINNAYEVLSDSEKKNIYDRYGE  60

Query  393  EGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            EGLKQHAASGGGRGAGMNIQDIFS FFG
Sbjct  61   EGLKQHAASGGGRGAGMNIQDIFSQFFG  88



>emb|CDY63310.1| BnaC04g54960D [Brassica napus]
Length=347

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              IA KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEA +KFA+INNAYEVLS
Sbjct  20   CVIAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFF  473
            D EKR IY++YGEEGLKQHAAS   GG G GMN+QDIFS FF
Sbjct  80   DEEKREIYNKYGEEGLKQHAASGGRGGGGGGMNMQDIFSQFF  121



>ref|XP_008649372.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Zea mays]
 gb|AFW77262.1| hypothetical protein ZEAMMB73_740805 [Zea mays]
Length=350

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            AIA KSYYD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEANK+FAEINNAYEVL+D
Sbjct  25   AIAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEANKRFAEINNAYEVLTD  84

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
             EKR IYD+YGEEGLKQ     GG G GMNIQDIF +FF
Sbjct  85   QEKRKIYDQYGEEGLKQFQGG-GGGGGGMNIQDIFRNFF  122



>emb|CDX76646.1| BnaC08g32320D [Brassica napus]
Length=346

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 87/101 (86%), Gaps = 1/101 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
               A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEA +KFAEINNAYEVLS
Sbjct  20   CVFAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFF  473
            D EKR +Y+RYGEEGLKQHAA+ G G G GMN+QDIFS FF
Sbjct  80   DEEKREVYNRYGEEGLKQHAANGGRGGGGGMNMQDIFSQFF  120



>ref|XP_009116921.1| PREDICTED: dnaJ homolog subfamily B member 11 [Brassica rapa]
 emb|CDY11430.1| BnaA09g39960D [Brassica napus]
Length=346

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 87/101 (86%), Gaps = 1/101 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
               A KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEA +KFAEINNAYEVLS
Sbjct  20   CVFAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDIFSSFF  473
            D EKR +Y+RYGEEGLKQHAA+ G G G GMN+QDIFS FF
Sbjct  80   DEEKREVYNRYGEEGLKQHAANGGRGGGGGMNMQDIFSQFF  120



>ref|XP_008355501.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Malus domestica]
Length=352

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%), Gaps = 3/101 (3%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            KSYY+ILQVPKGAS++QIKRAYRKLALKYHPD NPGNEEANK+FA+INNAYEVLSD EKR
Sbjct  29   KSYYEILQVPKGASDEQIKRAYRKLALKYHPDKNPGNEEANKRFADINNAYEVLSDSEKR  88

Query  369  NIYDRYGEEGLKQHAAS---GGGRGAGMNIQDIFSSFFGGG  482
            +IYDRYG  GL QHAA+   GGG G GMNI DIFS FFGGG
Sbjct  89   SIYDRYGXXGLXQHAATGGRGGGGGMGMNINDIFSEFFGGG  129



>emb|CDX89142.1| BnaA04g00440D [Brassica napus]
Length=347

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              IA KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEA +KFA+INNAYEVLS
Sbjct  20   CVIAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFF  473
            D EKR IY++YGEEGLKQHAA+   GG G GMN+QDIFS FF
Sbjct  80   DEEKREIYNKYGEEGLKQHAANGGRGGGGGGMNMQDIFSQFF  121



>ref|XP_009138725.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Brassica 
rapa]
Length=347

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              IA KSYYD+LQVPKGAS++QIKRAYRKLALKYHPD N GNEEA +KFA+INNAYEVLS
Sbjct  20   CVIAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFF  473
            D EKR IY++YGEEGLKQHAA+   GG G GMN+QDIFS FF
Sbjct  80   DEEKREIYNKYGEEGLKQHAANGGRGGGGGGMNMQDIFSQFF  121



>ref|XP_003568885.1| PREDICTED: dnaJ protein ERDJ3B [Brachypodium distachyon]
Length=350

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            I  KS+YD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEA K+FAEINNAYEVL+D 
Sbjct  25   IEGKSFYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEATKRFAEINNAYEVLTDQ  84

Query  360  EKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFF  473
            EKR IYDRYGEEGLKQ      GG G GMN+QDIFSSFF
Sbjct  85   EKRKIYDRYGEEGLKQFQGGGRGGGGGGMNMQDIFSSFF  123



>gb|ACN40755.1| unknown [Picea sitchensis]
Length=349

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 84/95 (88%), Gaps = 1/95 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            +IA K+ YD+LQVPKGASEDQ+K+AYRKLALKYHPD NPGNEEA K+FAEINNAYEVL+D
Sbjct  21   SIAGKNLYDVLQVPKGASEDQMKKAYRKLALKYHPDKNPGNEEATKRFAEINNAYEVLTD  80

Query  357  GEKRNIYDRYGEEGLKQHAAS-GGGRGAGMNIQDI  458
             EKR IYDRYGEEGLKQHAAS GG  G GMN QDI
Sbjct  81   REKREIYDRYGEEGLKQHAASGGGRGGGGMNFQDI  115



>emb|CDY59898.1| BnaC06g43160D [Brassica napus]
Length=347

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 86/102 (84%), Gaps = 2/102 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              I   SYYD+LQVPKGAS++ IKRAYRKLALKYHPD NPGN+EA +KFA+INNAYEVLS
Sbjct  20   CVIRVFSYYDVLQVPKGASDEHIKRAYRKLALKYHPDKNPGNDEATRKFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS--GGGRGAGMNIQDIFSSFF  473
            D EKR IY++YGEEGLKQHAA+   GG G GMN+QDIFS FF
Sbjct  80   DEEKREIYNKYGEEGLKQHAANGGRGGGGGGMNMQDIFSQFF  121



>ref|XP_006655011.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Oryza brachyantha]
Length=346

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            A+A KSYYD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEA K+FAEINNAYEVL+D
Sbjct  19   AVAGKSYYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPNNEEATKRFAEINNAYEVLTD  78

Query  357  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDI  458
             EKR IYDRYGEEGLKQ  A  G G G GMNIQDI
Sbjct  79   QEKRKIYDRYGEEGLKQFQAQGGRGGGGGMNIQDI  113



>gb|KFK35429.1| hypothetical protein AALP_AA5G283300 [Arabis alpina]
Length=348

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 88/103 (85%), Gaps = 3/103 (3%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
              +A KSYYD+LQVPKGA+++QIKRAYRKLALKYHPD N GNEEA +KFA+INNAYEVLS
Sbjct  20   CVLAGKSYYDVLQVPKGATDEQIKRAYRKLALKYHPDKNQGNEEATRKFADINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQHAAS---GGGRGAGMNIQDIFSSFF  473
            D EKR IY++YGEEGLKQ AA+   GGG G GMN+QDIFS FF
Sbjct  80   DEEKREIYNKYGEEGLKQFAANGGRGGGGGGGMNMQDIFSQFF  122



>gb|EMT14325.1| Chaperone protein dnaJ [Aegilops tauschii]
Length=125

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            KS+YD+LQVPKGASEDQIKR+YRKLALKYHPD NP NEEA K+FAEINNAYEVL+D EKR
Sbjct  5    KSFYDVLQVPKGASEDQIKRSYRKLALKYHPDKNPDNEEATKRFAEINNAYEVLTDQEKR  64

Query  369  NIYDRYGEEGLKQ  407
             IYDRYGEEGLKQ
Sbjct  65   KIYDRYGEEGLKQ  77



>ref|XP_004971793.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Setaria italica]
Length=349

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
             +A  SYYDILQV K ASE+QIKRAYRKLALKYHPD NP NEEA+ +FAEINNAYEVL D
Sbjct  22   TLAGTSYYDILQVSKDASEEQIKRAYRKLALKYHPDKNPNNEEADTRFAEINNAYEVLMD  81

Query  357  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSSFFGG  479
             EKR +YD YGE+GLKQ      GG G  MN + +FS+FFGG
Sbjct  82   QEKRKVYDWYGEDGLKQFQGERSGGGGRTMNFKHVFSNFFGG  123



>ref|XP_002457785.1| hypothetical protein SORBIDRAFT_03g013590 [Sorghum bicolor]
 gb|EES02905.1| hypothetical protein SORBIDRAFT_03g013590 [Sorghum bicolor]
Length=343

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            A+A KSYY+ILQV KGASED+IKRAYRKLALKYHPD NP NEEA+++F EINNAYEVL++
Sbjct  21   ALAGKSYYEILQVSKGASEDKIKRAYRKLALKYHPDKNPNNEEADRQFTEINNAYEVLTN  80

Query  357  GEKRNIYDRYGEEGLKQ-HAASGGGRGAGMNIQDIFSS  467
             EKR +YD YGEEGL+Q H     G G  MNI+ +FS+
Sbjct  81   QEKRKVYDWYGEEGLEQSHGRHSDGDGHAMNIEHVFSN  118



>ref|XP_001767250.1| predicted protein [Physcomitrella patens]
 gb|EDQ67931.1| predicted protein [Physcomitrella patens]
Length=349

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +  A KSYYDILQV + AS+DQIKR+YRKLALK+HPD NPGNEEA KKFAEINNAYEVLS
Sbjct  20   LVSAGKSYYDILQVSRQASDDQIKRSYRKLALKFHPDKNPGNEEATKKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLKQH  410
            D EKR IYD+YGEEGL++H
Sbjct  80   DKEKRGIYDQYGEEGLREH  98



>ref|XP_001781245.1| predicted protein [Physcomitrella patens]
 gb|EDQ53943.1| predicted protein [Physcomitrella patens]
Length=349

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +  A KSYYDILQV K A++DQIKRAYRKLALK+HPD NPGNEEA KKFAEINNAYEVLS
Sbjct  20   VVSAGKSYYDILQVSKQATDDQIKRAYRKLALKFHPDKNPGNEEATKKFAEINNAYEVLS  79

Query  354  DGEKRNIYDRYGEEGLK  404
            D EKR +YD+YGEEGLK
Sbjct  80   DREKRGVYDQYGEEGLK  96



>gb|AFW80711.1| hypothetical protein ZEAMMB73_969717 [Zea mays]
Length=222

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 80/103 (78%), Gaps = 6/103 (6%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            ++A KSYY+ILQVPKGASE+QIKRAYRKLALKYHPD NP NEEA ++FAEIN+AYEVL+D
Sbjct  21   SLAGKSYYEILQVPKGASEEQIKRAYRKLALKYHPDKNPNNEEAGRRFAEINDAYEVLTD  80

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
             +KR   D +GEE L ++     GR   ++++ +FS+  GG P
Sbjct  81   RKKRKADDWHGEEDLAKYM----GRAMKVDVEYVFSN--GGSP  117



>ref|XP_002978653.1| hypothetical protein SELMODRAFT_109399, partial [Selaginella 
moellendorffii]
 ref|XP_002984588.1| hypothetical protein SELMODRAFT_120820, partial [Selaginella 
moellendorffii]
 gb|EFJ14233.1| hypothetical protein SELMODRAFT_120820, partial [Selaginella 
moellendorffii]
 gb|EFJ20100.1| hypothetical protein SELMODRAFT_109399, partial [Selaginella 
moellendorffii]
Length=320

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            KSYY+IL+V K ASE QIKRAYRKLALKYHPD NPGNEEANKKF E+ NAYEVL D EKR
Sbjct  1    KSYYEILEVSKSASESQIKRAYRKLALKYHPDKNPGNEEANKKFTELTNAYEVLIDEEKR  60

Query  369  NIYDRYGEEGLKQ  407
             IYD++GEEGLKQ
Sbjct  61   QIYDKFGEEGLKQ  73



>ref|XP_003079124.1| Molecular chaperone (DnaJ superfamily) (ISS) [Ostreococcus tauri]
 emb|CAL53782.1| HSP40/DnaJ peptide-binding [Ostreococcus tauri]
Length=383

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            +Y  L V + A E QIKRAYRKLALKYHPD NP +E A KKF EI +AYE LSD EKR I
Sbjct  35   HYATLGVSRHADESQIKRAYRKLALKYHPDKNPNDETAKKKFTEIGHAYETLSDQEKRKI  94

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFS  464
            YDRYGEEG+KQH AS GGRG G   QDIFS
Sbjct  95   YDRYGEEGVKQHEAS-GGRGGGHAAQDIFS  123



>gb|EIE78627.1| hypothetical protein RO3G_03331 [Rhizopus delemar RA 99-880]
Length=382

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            I  AA+ YYD+L VP+ A + QIKR Y+KL+  YHPD NPG+ EA +KF E+ NAYEVL 
Sbjct  18   IVCAARDYYDVLDVPRDAPKAQIKRHYKKLSRVYHPDKNPGDNEAEQKFMELANAYEVLM  77

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            D EKR IYDRYGEEGLKQ+   GGG     +  DIFS FFGGG
Sbjct  78   DDEKRAIYDRYGEEGLKQNQNGGGG-NPFHDPFDIFSHFFGGG  119



>ref|NP_001167838.1| hypothetical protein precursor [Zea mays]
 gb|ACN26252.1| unknown [Zea mays]
 gb|AFW80710.1| hypothetical protein ZEAMMB73_969717 [Zea mays]
Length=377

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 80/103 (78%), Gaps = 6/103 (6%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            ++A KSYY+ILQVPKGASE+QIKRAYRKLALKYHPD NP NEEA ++FAEIN+AYEVL+D
Sbjct  21   SLAGKSYYEILQVPKGASEEQIKRAYRKLALKYHPDKNPNNEEAGRRFAEINDAYEVLTD  80

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
             +KR   D +GEE L ++     GR   ++++ +FS+  GG P
Sbjct  81   RKKRKADDWHGEEDLAKYM----GRAMKVDVEYVFSN--GGSP  117



>ref|XP_002508960.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70218.1| predicted protein [Micromonas sp. RCC299]
Length=355

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  183  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGE  362
            +A  YY  L + +GAS+DQIKRAYRKLALKYHPD NPGNEEA  KFA+I NAYEVLSD E
Sbjct  24   SAADYYKTLGLNRGASDDQIKRAYRKLALKYHPDKNPGNEEAASKFADIGNAYEVLSDAE  83

Query  363  KRNIYDRYGEEGLKQHA  413
            KR IYDR+GEEG+KQHA
Sbjct  84   KRQIYDRHGEEGVKQHA  100



>ref|WP_027303628.1| molecular chaperone DnaJ [Campylobacter upsaliensis]
Length=371

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  192  SYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRN  371
            SYY+IL++ + A ++ IK+AYRKLALKYHPD N G++EA  KF  IN AYEVLSD EKR 
Sbjct  4    SYYEILEITQSADKESIKKAYRKLALKYHPDRNQGDKEAEDKFKLINEAYEVLSDDEKRA  63

Query  372  IYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            IYDRYG+E LK  A    G G   +I+DIF+SFFG G
Sbjct  64   IYDRYGKEALKSRAGGSAGFGDFEDIRDIFTSFFGEG  100



>ref|WP_004275721.1| molecular chaperone DnaJ [Campylobacter upsaliensis]
 gb|EAL53001.1| dnaJ protein [Campylobacter upsaliensis RM3195]
Length=371

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  192  SYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRN  371
            SYY+IL++ + A ++ IK+AYRKLALKYHPD N G++EA  KF  IN AYEVLSD EKR 
Sbjct  4    SYYEILEITQSADKESIKKAYRKLALKYHPDRNQGDKEAEDKFKLINEAYEVLSDDEKRA  63

Query  372  IYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            IYDRYG+E LK  A    G G   +I+DIF+SFFG G
Sbjct  64   IYDRYGKEALKGRAGGSAGFGDFEDIRDIFTSFFGEG  100



>ref|WP_004277695.1| molecular chaperone DnaJ [Campylobacter upsaliensis]
 gb|EFU71606.1| chaperone DnaJ [Campylobacter upsaliensis JV21]
Length=371

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  192  SYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRN  371
            SYY+IL++ + A ++ IK+AYRKLALKYHPD N G++EA  KF  IN AYEVLSD EKR 
Sbjct  4    SYYEILEITQSADKESIKKAYRKLALKYHPDRNQGDKEAEDKFKLINEAYEVLSDDEKRA  63

Query  372  IYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            IYDRYG+E LK  A    G G   +I+DIF+SFFG G
Sbjct  64   IYDRYGKEALKGRAGGSAGFGDFEDIRDIFTSFFGEG  100



>ref|XP_001417654.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95947.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=372

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +   A  YY  L V +GA E QIKRAYRKLALKYHPD NP +E A KKF EI+ AYEVLS
Sbjct  24   VCARASDYYAALGVSRGAEESQIKRAYRKLALKYHPDKNPNDERAKKKFTEISQAYEVLS  83

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFS  464
            D EKR+IYDRYGE+G+KQH  SGG    G   QDIFS
Sbjct  84   DKEKRSIYDRYGEDGVKQHEQSGG--RGGGGAQDIFS  118



>emb|CEJ04661.1| hypothetical protein RMCBS344292_18616 [Rhizopus microsporus]
Length=383

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            ++AK YY IL VP+ A + QIKR Y+KL+  YHPD NPGNEEA++KF EI NAYEVL D 
Sbjct  20   VSAKDYYSILDVPRDAPKAQIKRHYKKLSRVYHPDKNPGNEEASQKFMEIANAYEVLMDD  79

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            EKR IYDRYGEEGLKQ    GGG     +  DIFS FFGGG
Sbjct  80   EKRAIYDRYGEEGLKQ-NQGGGGGNPFHDPFDIFSHFFGGG  119



>ref|WP_035403765.1| molecular chaperone DnaJ [Chlorobium sp. GBChlB]
 gb|KER09366.1| molecular chaperone DnaJ [Chlorobium sp. GBChlB]
Length=383

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 77/104 (74%), Gaps = 4/104 (4%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YYD+L + +GAS D +KR+YRKLA++YHPD NPGN+EA +KF EIN AYEVLS+ 
Sbjct  1    MAKRDYYDVLGIKRGASSDDVKRSYRKLAMQYHPDRNPGNKEAEEKFKEINEAYEVLSND  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRG-AGMNIQDIFSSF---FGG  479
            EKR  YD++G  G+   AAS GG   AG ++ DIFS+F   FGG
Sbjct  61   EKRRRYDQFGHAGVGTSAASDGGNPFAGRDMSDIFSAFGDIFGG  104



>ref|XP_007514172.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15609.1| predicted protein [Bathycoccus prasinos]
Length=475

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +3

Query  186  AKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEK  365
            AK YY IL V +GA E QIKRAYRKLALKYHPD NPG+++A  KF E++NAYEVL+D EK
Sbjct  137  AKDYYSILGVARGAPESQIKRAYRKLALKYHPDKNPGDDKAKSKFEELSNAYEVLTDEEK  196

Query  366  RNIYDRYGEEGLKQH  410
            R IYDR+GEEGLKQH
Sbjct  197  RQIYDRHGEEGLKQH  211



>ref|WP_021091609.1| Chaperone protein DnaJ [Campylobacter concisus]
 gb|ERJ25136.1| Chaperone protein DnaJ [Campylobacter concisus ATCC 51562]
Length=380

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ + AS D+IK+A+R+LALKYHPD N G++EA  KF +IN AY+VLSD +KR+I
Sbjct  5    YYEILEISRNASGDEIKKAFRRLALKYHPDRNSGDKEAELKFKQINEAYQVLSDEQKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            YDRYG+EGL+    SGGG  A  ++ DIF SFFGGG
Sbjct  65   YDRYGKEGLEGRFGSGGGFSADFDLSDIFDSFFGGG  100



>ref|WP_038454591.1| molecular chaperone DnaJ [Campylobacter iguaniorum]
 gb|AII15013.1| co-chaperone and heat shock protein [Campylobacter iguaniorum]
Length=365

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ + A  D IK+AYRKLALKYHPD N G++EA +KF +IN AYEVLS+ EKR I
Sbjct  5    YYEILEISRDADGDTIKKAYRKLALKYHPDRNQGDKEAEEKFKKINEAYEVLSNEEKRGI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
            YDRYG++GL      GG   A  ++ DIFSSFFGGG N
Sbjct  65   YDRYGKDGLNSSGGFGGFE-ADFDLGDIFSSFFGGGFN  101



>emb|CEI94658.1| hypothetical protein RMCBS344292_08863 [Rhizopus microsporus]
Length=383

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            ++AK YY IL VP+ A + QIKR Y+KL+  YHPD NPGN+EA++KF EI NAYEVL D 
Sbjct  20   VSAKDYYSILDVPRDAPKAQIKRHYKKLSRVYHPDKNPGNDEASQKFMEIANAYEVLMDD  79

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            EKR IYDRYGEEGLKQ    GGG     +  DIFS FFGGG
Sbjct  80   EKRAIYDRYGEEGLKQ-NQGGGGGNPFHDPFDIFSHFFGGG  119



>emb|CEG67475.1| hypothetical protein RMATCC62417_03901 [Rhizopus microsporus]
Length=383

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            ++AK YY IL VP+ A + QIKR Y+KL+  YHPD NPGN+EA++KF EI NAYEVL D 
Sbjct  20   VSAKDYYSILDVPRDAPKAQIKRHYKKLSRVYHPDKNPGNDEASQKFMEIANAYEVLMDD  79

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            EKR IYDRYGEEGLKQ    GGG     +  DIFS FFGGG
Sbjct  80   EKRAIYDRYGEEGLKQ-NQGGGGGNPFHDPFDIFSHFFGGG  119



>ref|XP_001461982.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK94609.1| unnamed protein product [Paramecium tetraurelia]
Length=478

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = +3

Query  186  AKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGE  362
             + YY +L V +GAS+DQIK+A++KL+LKYHPD   GN EE+ K+F +I NAYE+L D E
Sbjct  16   CQDYYQLLGVQRGASDDQIKKAFKKLSLKYHPDKAKGNKEESEKQFQKIVNAYEILKDPE  75

Query  363  KRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            +R +YD+YGEEGLK+H      +    N  D+FS FFGGG
Sbjct  76   QRQVYDKYGEEGLKEHTQRQQQKQGHFNYNDVFSRFFGGG  115



>gb|EPB86033.1| hypothetical protein HMPREF1544_07193 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=366

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = +3

Query  183  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGE  362
            AAK YYDIL VP+ A + QIKR ++KL+  YHPD N G+E A++KF EI NAYEVL D E
Sbjct  22   AAKDYYDILDVPRDAQKAQIKRHFKKLSRVYHPDKNDGDEAASQKFMEIANAYEVLMDDE  81

Query  363  KRNIYDRYGEEGLKQHAASGGGRGAGM-NIQDIFSSFFGGG  482
            KR+IYDRYGEEGLKQ+   G G G G  +  DIFS FFGGG
Sbjct  82   KRSIYDRYGEEGLKQNGGQGRGGGGGFHDAFDIFSHFFGGG  122



>dbj|GAN05476.1| conserved hypothetical protein [Mucor ambiguus]
Length=562

 Score =   116 bits (291),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            ++AK YYDIL VP+ A + QIKR ++KL+  YHPD N G+E A++KF EI NAYEVL D 
Sbjct  20   VSAKDYYDILDVPRDAQKAQIKRHFKKLSRVYHPDKNAGDEAASQKFMEIANAYEVLMDD  79

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGM-NIQDIFSSFFGGG  482
            EKR+IYDRYGEEGLKQ+   G G G G  +  DIFS FFGGG
Sbjct  80   EKRSIYDRYGEEGLKQNGGQGRGGGGGFHDAFDIFSHFFGGG  121



>ref|XP_007000865.1| hypothetical protein TREMEDRAFT_37064 [Tremella mesenterica DSM 
1558]
 gb|EIW72947.1| hypothetical protein TREMEDRAFT_37064 [Tremella mesenterica DSM 
1558]
Length=375

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 3/102 (3%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
             IAA+S Y IL + K AS+  IK+AYRKL+ KYHPD+NP +E A+++F E++ AYEVLSD
Sbjct  18   CIAAESLYQILGLRKDASDADIKKAYRKLSKKYHPDINP-DEAAHERFIEVSKAYEVLSD  76

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
             E R IYDR+G+ GLKQH A    +G G N  D+F+ FFGGG
Sbjct  77   TETRTIYDRHGDAGLKQHEAQ--KQGGGRNPHDVFAHFFGGG  116



>ref|XP_003056063.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59439.1| predicted protein [Micromonas pusilla CCMP1545]
Length=373

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 72/101 (71%), Gaps = 3/101 (3%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +A     YY  L V +GAS+ QIKRAYRKLALKYHPD N G+++A   FAEI+NAYEVLS
Sbjct  48   LAPLRTDYYKTLAVDRGASDIQIKRAYRKLALKYHPDKNKGDQKAAGNFAEISNAYEVLS  107

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            + EKR +YD+YGE+G++QH       G G +  DIFS FFG
Sbjct  108  NKEKRRVYDQYGEDGVRQHDTRS---GQGRHQHDIFSQFFG  145



>ref|WP_013182492.1| molecular chaperone DnaJ [Waddlia chondrophila]
 gb|ADI38784.1| Chaperone protein dnaJ [Waddlia chondrophila WSU 86-1044]
 emb|CCB91097.1| chaperone protein dnaJ [Waddlia chondrophila 2032/99]
Length=382

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 72/110 (65%), Gaps = 14/110 (13%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY++L + K AS D+IK+AYRK+ALKYHPD N G+ EA KKF EI+ AYEVLSD +KR +
Sbjct  4    YYEVLGISKNASSDEIKKAYRKMALKYHPDRNSGDAEAEKKFKEISEAYEVLSDDQKRQL  63

Query  375  YDRYGEEGLKQHAASGG--------------GRGAGMNIQDIFSSFFGGG  482
            YDRYG++GL+    SGG              G   GM    IF SFFGGG
Sbjct  64   YDRYGKDGLRGAGMSGGPGFASMDEALRTFMGAFGGMGADSIFDSFFGGG  113



>ref|XP_007403894.1| hypothetical protein MELLADRAFT_41574 [Melampsora larici-populina 
98AG31]
 gb|EGG12956.1| hypothetical protein MELLADRAFT_41574 [Melampsora larici-populina 
98AG31]
Length=397

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 3/96 (3%)
 Frame = +3

Query  186  AKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEK  365
            A   Y  L V + A+E +IKRAYRKL+ ++HPD NPGN++A +KF E+ NAYE+LSD EK
Sbjct  27   ATDPYKSLGVNRNANEKEIKRAYRKLSKRWHPDKNPGNKDAEQKFLEVGNAYEILSDPEK  86

Query  366  RNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
            R+IYD+YGEEGLK+H A GGG G      DIFS FF
Sbjct  87   RSIYDKYGEEGLKRHQAQGGGGGDPF---DIFSRFF  119



>ref|WP_023385405.1| co-chaperone and heat shock protein [Campylobacter fetus]
 gb|AGZ81970.1| co-chaperone and heat shock protein [Campylobacter fetus subsp. 
testudinum 03-427]
 gb|AJB45706.1| molecular chaperone DnaJ [Campylobacter fetus subsp. testudinum]
Length=362

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 5/95 (5%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL+V + A  + IK+AYRKLALKYHPD N G++EA +KF  IN AYE+LSD  KR+I
Sbjct  5    YYEILEVSRDADGETIKKAYRKLALKYHPDRNQGDKEAEEKFKRINEAYEILSDENKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGG  479
            YDRYG++GL     SG G   G ++ DIFSSFFGG
Sbjct  65   YDRYGKDGL-----SGSGFDEGFDLGDIFSSFFGG  94



>ref|WP_009294395.1| molecular chaperone DnaJ [Campylobacter sp. 10_1_50]
 gb|EHL90404.1| chaperone DnaJ [Campylobacter sp. 10_1_50]
Length=380

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ + AS D+IK+A+RKLALKYHPD N G++EA +KF +IN AY+VLSD +KR+I
Sbjct  5    YYEILEISRNASGDEIKKAFRKLALKYHPDRNAGDKEAEQKFKQINEAYQVLSDEQKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSS  467
            YDRYG+EGL+    S GG  A  ++ DIF S
Sbjct  65   YDRYGKEGLEGRFGSSGGFSADFDLSDIFDS  95



>ref|WP_039628124.1| molecular chaperone DnaJ [Campylobacter lari]
 gb|AJD03067.1| co-chaperone and heat shock protein [Campylobacter lari CCUG 
22395]
Length=373

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = +3

Query  192  SYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRN  371
            +YY+IL++ + + ++ IK+AYRK+ALKYHPD N G++EA +KF  +N AYEVLS+ EKR+
Sbjct  4    NYYEILEISQTSDKETIKKAYRKMALKYHPDRNQGDKEAEEKFKLVNEAYEVLSNDEKRS  63

Query  372  IYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGG  482
            IYDRYG+EGLK  A  GG  G G +++ DIFSSFFG G
Sbjct  64   IYDRYGKEGLKGQA--GGFSGFGDVDLGDIFSSFFGDG  99



>ref|WP_021085994.1| Chaperone protein DnaJ [Campylobacter concisus]
 gb|ERJ23067.1| Chaperone protein DnaJ [Campylobacter concisus UNSW1]
Length=380

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ + AS D+IK+A+RKLALKYHPD N G++EA +KF +IN AY+VLSD +KR+I
Sbjct  5    YYEILEISRNASGDEIKKAFRKLALKYHPDRNAGDKEAEQKFKQINEAYQVLSDEQKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSS  467
            YDRYG+EGL+    S GG  A  ++ DIF S
Sbjct  65   YDRYGKEGLEGRFGSSGGFSADFDLSDIFDS  95



>ref|WP_039641057.1| molecular chaperone DnaJ [Campylobacter lari]
 gb|AJD06029.1| co-chaperone and heat shock protein [Campylobacter lari RM16712]
Length=373

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = +3

Query  192  SYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRN  371
            +YY+IL++ + + ++ IK+AYRK+ALKYHPD N G++EA +KF  +N AYEVLS+ EKR+
Sbjct  4    NYYEILEISQTSDKETIKKAYRKMALKYHPDRNQGDKEAEEKFKLVNEAYEVLSNDEKRS  63

Query  372  IYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGG  482
            IYDRYG+EGLK  A  GG  G G +++ DIFSSFFG G
Sbjct  64   IYDRYGKEGLKGQA--GGFSGFGDVDLGDIFSSFFGDG  99



>ref|WP_039617822.1| molecular chaperone DnaJ [Campylobacter lari]
 gb|AJD04548.1| co-chaperone and heat shock protein [Campylobacter lari RM16701]
Length=373

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = +3

Query  192  SYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRN  371
            +YY+IL++ + + ++ IK+AYRK+ALKYHPD N G++EA +KF  +N AYEVLS+ EKR+
Sbjct  4    NYYEILEISQTSDKETIKKAYRKMALKYHPDRNQGDKEAEEKFKLVNEAYEVLSNDEKRS  63

Query  372  IYDRYGEEGLKQHAASGGGRGAG-MNIQDIFSSFFGGG  482
            IYDRYG+EGLK  A  GG  G G +++ DIFSSFFG G
Sbjct  64   IYDRYGKEGLKGQA--GGFSGFGDVDLGDIFSSFFGDG  99



>ref|WP_044598559.1| molecular chaperone DnaJ [Campylobacter peloridis]
 gb|AJC84439.1| co-chaperone and heat shock protein [Campylobacter peloridis 
LMG 23910]
Length=372

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +3

Query  192  SYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRN  371
            SYY+IL++ K + ++ IK+AYRK+ALKYHPD N GN+EA  +F  +N AYEVLS+ EKR+
Sbjct  4    SYYEILEISKTSDKETIKKAYRKMALKYHPDRNQGNKEAEDRFKLVNEAYEVLSNDEKRS  63

Query  372  IYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            IYDRYG+EGLK  A+  GG     ++ DIFSSFF  G
Sbjct  64   IYDRYGKEGLKGQASGFGGFN-DFDLGDIFSSFFEEG  99



>ref|WP_038453740.1| molecular chaperone DnaJ [Campylobacter fetus]
 gb|AIR79053.1| co-chaperone and heat shock protein [Campylobacter fetus subsp. 
fetus 04/554]
Length=362

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 5/95 (5%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL+V + A  + IK+AYRKLALKYHPD N G++EA +KF  IN AYE+LSD  KR+I
Sbjct  5    YYEILEVSRDADGETIKKAYRKLALKYHPDRNQGDKEAEEKFKRINEAYEILSDENKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGG  479
            YDRYG++GL     SG G   G ++ DIFSSFFGG
Sbjct  65   YDRYGKDGL-----SGSGFDDGFDLGDIFSSFFGG  94



>ref|WP_009650327.1| molecular chaperone DnaJ [Campylobacter sp. FOBRC14]
 gb|EJP75733.1| chaperone protein DnaJ [Campylobacter sp. FOBRC14]
Length=370

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ K AS D+IK+AYRKLALKYHPD N GN+EA  KF  +N AY+VLSD +KR I
Sbjct  5    YYEILEISKNASGDEIKKAYRKLALKYHPDRNAGNKEAEDKFKLVNEAYQVLSDDKKREI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            YDRYG+EGL   +   GG GA  +I DIFSSFFG
Sbjct  65   YDRYGKEGLSGVSGF-GGFGADFDISDIFSSFFG  97



>ref|WP_010031742.1| molecular chaperone DnaJ [Francisella tularensis]
 gb|AFX70850.1| chaperone protein DnaJ [Francisella tularensis subsp. holarctica 
F92]
 gb|AJI51467.1| chaperone protein DnaJ [Francisella tularensis subsp. holarctica]
 gb|AJI64718.1| chaperone protein DnaJ [Francisella tularensis subsp. holarctica]
 gb|AJI66994.1| chaperone protein DnaJ [Francisella tularensis subsp. holarctica]
Length=371

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  1    MQQKCYYEILNVSKTASGVEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G     +DIF +FFGGG +
Sbjct  61   SKRSRYDQFGHAGVNQQSGFGGTGG----FEDIFDTFFGGGTS  99



>ref|WP_025329381.1| molecular chaperone DnaJ [Francisella tularensis]
 gb|AHH46575.1| molecular chaperone DnaJ [Francisella tularensis subsp. holarctica 
PHIT-FT049]
Length=371

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  1    MQQKCYYEILNVSKTASGVEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G     +DIF +FFGGG +
Sbjct  61   SKRSRYDQFGHAGVNQQSGFGGTGG----FEDIFDTFFGGGTS  99



>ref|WP_032733700.1| molecular chaperone DnaJ [Francisella tularensis]
 gb|KIP31369.1| chaperone protein DnaJ [Francisella tularensis subsp. holarctica]
Length=371

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  1    MQQKCYYEILNVSKTASGIEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G     +DIF +FFGGG +
Sbjct  61   SKRSRYDQFGHAGVNQQSGFGGTGG----FEDIFDTFFGGGTS  99



>ref|WP_002849758.1| molecular chaperone DnaJ [Campylobacter fetus]
 gb|ABK82511.1| chaperone protein DnaJ [Campylobacter fetus subsp. fetus 82-40]
 gb|EGU24205.1| chaperone protein DnaJ [Campylobacter fetus subsp. venerealis 
NCTC 10354]
 gb|AHE94435.1| co-chaperone and heat shock protein [Campylobacter fetus subsp. 
venerealis cfvi03/293]
 emb|CDF64771.1| chaperone protein DnaJ [Campylobacter fetus subsp. venerealis 
str. 84-112]
 gb|AIR80805.1| co-chaperone and heat shock protein [Campylobacter fetus subsp. 
venerealis 97/608]
Length=362

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 5/95 (5%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL+V + A  + IK+AYRKLALKYHPD N G++EA +KF  IN AYE+LSD  KR+I
Sbjct  5    YYEILEVSRDADGETIKKAYRKLALKYHPDRNQGDKEAEEKFKRINEAYEILSDENKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGG  479
            YDRYG++GL     SG G   G ++ DIFSSFFGG
Sbjct  65   YDRYGKDGL-----SGSGFDDGFDLGDIFSSFFGG  94



>gb|ABI83031.1| chaperone DnaJ [Francisella tularensis subsp. holarctica OSU18]
 gb|ABU61733.2| chaperone protein DnaJ [Francisella tularensis subsp. holarctica 
FTNF002-00]
Length=392

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  22   MQQKCYYEILNVSKTASGVEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  81

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G     +DIF +FFGGG +
Sbjct  82   SKRSRYDQFGHAGVNQQSGFGGTGG----FEDIFDTFFGGGTS  120



>ref|XP_001775578.1| predicted protein [Physcomitrella patens]
 gb|EDQ59661.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 76/111 (68%), Gaps = 16/111 (14%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YY +L+VPK A+ED +K+AYRKLA+K+HPD NP N +EA  KF +I+ AYEVLSD +KR 
Sbjct  5    YYSVLKVPKTATEDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSDPQKRI  64

Query  372  IYDRYGEEGLKQHAA-----------SGGGRGA----GMNIQDIFSSFFGG  479
            IYD+ GEEGLK HAA           +GGG  A      N +DIF+ FFGG
Sbjct  65   IYDQEGEEGLKGHAAHPGSSHGYSNGAGGGPNAFRFNPRNAEDIFAEFFGG  115



>gb|EDO66685.1| hypothetical protein FTAG_01487 [Francisella tularensis subsp. 
holarctica FSC022]
Length=392

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  22   MQQKCYYEILNVSKTASGIEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  81

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G     +DIF +FFGGG +
Sbjct  82   SKRSRYDQFGHAGVNQQSGFGGTGG----FEDIFDTFFGGGTS  120



>ref|XP_001733762.1| hypothetical protein [Entamoeba dispar SAW760]
 gb|EDR30058.1| hypothetical protein, conserved [Entamoeba dispar SAW760]
Length=401

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 6/94 (6%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+ L VP  AS+DQIK+AYRKLA+KYHPD NPG++ A +KF E++ AY VLSD EKR +
Sbjct  7    YYNSLGVPADASDDQIKKAYRKLAIKYHPDKNPGDKNAEEKFKEVSEAYAVLSDHEKREM  66

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            YDRYG+EGL++     GG G G ++ DIF+ FFG
Sbjct  67   YDRYGKEGLEK-----GGMG-GFDMNDIFAQFFG  94



>ref|XP_003382633.2| PREDICTED: dnaJ homolog subfamily B member 6-like [Amphimedon 
queenslandica]
Length=223

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 71/102 (70%), Gaps = 6/102 (6%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVL  350
            +A    SYY+ L + K A+E++IK+AYRKLALK+HPD N  N EEA+KKF EI  AYEVL
Sbjct  1    MASGDTSYYETLGLSKNATEEEIKKAYRKLALKWHPDKNQDNVEEADKKFKEIAEAYEVL  60

Query  351  SDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
             D EKR++YDRYG+EGLKQ     GG G      DIF  FFG
Sbjct  61   KDPEKRSLYDRYGKEGLKQ-----GGFGGHAAASDIFEQFFG  97



>ref|WP_011457462.1| molecular chaperone DnaJ [Francisella tularensis]
 sp|P48207.1|DNAJ_FRATU RecName: Full=Chaperone protein DnaJ [Francisella tularensis]
 sp|Q2A327.1|DNAJ_FRATH RecName: Full=Chaperone protein DnaJ [Francisella tularensis 
subsp. holarctica LVS]
 gb|AAA69562.1| putative [Francisella tularensis]
 emb|CAJ79631.1| Chaperone protein dnaJ (heat shock protein 70 family cofactor) 
[Francisella tularensis subsp. holarctica LVS]
 gb|AJI59258.1| chaperone protein DnaJ [Francisella tularensis subsp. holarctica 
LVS]
Length=371

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL + K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  1    MQQKCYYEILNISKTASGVEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G     +DIF +FFGGG +
Sbjct  61   SKRSRYDQFGHAGVNQQSGFGGTGG----FEDIFDTFFGGGTS  99



>ref|XP_005649472.1| DnaJ-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24928.1| DnaJ-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=341

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 72/101 (71%), Gaps = 8/101 (8%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEE----ANKKFAEINNAY  341
            +    K +YD+LQVPKGAS+  IKR+YRKLAL+YHPD   G EE    A KKFAEI+ AY
Sbjct  1    MITCRKDFYDVLQVPKGASDSLIKRSYRKLALQYHPDKVKGTEEEKTAAAKKFAEISYAY  60

Query  342  EVLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFS  464
            EVLSD EKR IYDRYGEEGLKQ    GGG GA     DIFS
Sbjct  61   EVLSDDEKRRIYDRYGEEGLKQRDQGGGGGGAA----DIFS  97



>ref|XP_009533175.1| hypothetical protein PHYSODRAFT_520326 [Phytophthora sojae]
 gb|EGZ10430.1| hypothetical protein PHYSODRAFT_520326 [Phytophthora sojae]
Length=365

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 75/103 (73%), Gaps = 5/103 (5%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +A A K YY++L V + AS  +IKRA+RKL+LK+HPD NPG+E A KKFAE+ +AY+VLS
Sbjct  17   LAAAGKDYYEVLGVSRDASSAEIKRAFRKLSLKHHPDKNPGDENAAKKFAEVASAYDVLS  76

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            D EK+  YDRYGEEGL     S  G G G +  DIFS FFGGG
Sbjct  77   DDEKKAKYDRYGEEGL-----SNSGGGGGHDPFDIFSQFFGGG  114



>ref|XP_002961542.1| hypothetical protein SELMODRAFT_230025 [Selaginella moellendorffii]
 gb|EFJ36802.1| hypothetical protein SELMODRAFT_230025 [Selaginella moellendorffii]
Length=294

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 16/111 (14%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YY +L+V K A+ED +K+AYRKLA+K+HPD NP N +EA  KF +I+ AYEVLSD +KR 
Sbjct  5    YYSVLKVDKNATEDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSDPQKRT  64

Query  372  IYDRYGEEGLKQHA----ASGG---GRGAGMNI--------QDIFSSFFGG  479
            IYD+YGEEGLK       A+GG     GAG N+        +DIF+ FFGG
Sbjct  65   IYDQYGEEGLKGQVPPPGATGGTNFANGAGPNVFVFNPRNAEDIFAEFFGG  115



>ref|XP_005707432.1| molecular chaperone DnaJ [Galdieria sulphuraria]
 gb|EME30912.1| molecular chaperone DnaJ [Galdieria sulphuraria]
Length=417

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 9/98 (9%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            K YY++L VP  AS+D+IK+AYRKLA+K HPD   G+EE   KF E+  A+EVLSD EKR
Sbjct  17   KKYYELLGVPTNASKDEIKKAYRKLAVKLHPDKG-GDEE---KFKEVTRAFEVLSDDEKR  72

Query  369  NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
             +YD YGEEGL Q      G GA MN +DIF +FFGGG
Sbjct  73   RVYDEYGEEGLSQQ-----GLGASMNAEDIFEAFFGGG  105



>gb|EBA52748.1| chaperone dnaJ [Francisella tularensis subsp. holarctica 257]
 gb|AFT92943.1| chaperone protein DnaJ [Francisella tularensis subsp. holarctica 
FSC200]
Length=392

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL + K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  22   MQQKCYYEILNISKTASGVEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  81

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G     +DIF +FFGGG +
Sbjct  82   SKRSRYDQFGHAGVNQQSGFGGTGG----FEDIFDTFFGGGTS  120



>ref|WP_026442492.1| molecular chaperone DnaJ [Acidobacterium sp. PMMR2]
Length=378

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +    YY+IL V + ASE ++K AYRKLA+KYHPD NPGN+EA +KF E + AY+VLSD 
Sbjct  7    VTKADYYEILGVSRSASEQELKAAYRKLAMKYHPDRNPGNKEAEEKFKECSEAYQVLSDP  66

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGM-NIQDIFSSFFG  476
            +KR  YDRYG  G+   AAS G   AGM ++ DIF  FFG
Sbjct  67   QKRAAYDRYGHAGVSGAAASNGDPFAGMPDLGDIFGDFFG  106



>ref|XP_001942000.1| chaperone protein dnaJ [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU44719.1| chaperone protein dnaJ [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=420

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            + + A+ YY +L + K ASE +IK+AYR L+ KYHPD NPG++EA KKF E+  AYEVLS
Sbjct  17   LVVGAEDYYKLLGLKKDASEREIKKAYRTLSKKYHPDKNPGDDEAGKKFVEVAEAYEVLS  76

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGG  479
            + E R IYD+YG +G++QH   GG R    +  D+FS FFGG
Sbjct  77   EKETRKIYDQYGHDGIQQHKQGGGPR-QQHDPFDLFSRFFGG  117



>ref|WP_038057826.1| molecular chaperone DnaJ [Thermodesulfobacterium hydrogeniphilum]
Length=378

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%), Gaps = 2/101 (2%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A K YY IL +P+ A++++IKRAYR+LALKYHPD NPG++EA +KF EI+ AYEVLSD 
Sbjct  1    MAYKDYYAILGIPRNATQEEIKRAYRRLALKYHPDKNPGDKEAEEKFKEISEAYEVLSDP  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFG  476
            EKR IYD YG  GLK    SG    + +     DIF  FFG
Sbjct  61   EKRAIYDNYGYSGLKSSGYSGFEDISDIFKTFSDIFEDFFG  101



>ref|XP_001647525.1| predicted protein [Nematostella vectensis]
 gb|EDO35736.1| predicted protein [Nematostella vectensis]
Length=225

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 9/100 (9%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YYDIL+VP+ ASE  IK++YRKLALK+HPD NP N EEA +KF EI+ AYEVLSD ++R+
Sbjct  4    YYDILEVPRSASEQDIKKSYRKLALKWHPDKNPQNKEEAERKFKEISEAYEVLSDSKRRD  63

Query  372  IYDRYGEEGLKQHAASGGGRGAGMNIQ-----DIFSSFFG  476
            +YDRYG++GL     +GG    G N       +IF  FFG
Sbjct  64   VYDRYGKDGL---TGNGGHTDFGFNFHFRTPDEIFRDFFG  100



>ref|XP_003305156.1| hypothetical protein PTT_17906 [Pyrenophora teres f. teres 0-1]
 gb|EFQ86745.1| hypothetical protein PTT_17906 [Pyrenophora teres f. teres 0-1]
Length=420

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            + + A+ YY +L + K ASE +IK+AYR L+ KYHPD NPG++EA KKF E+  AYEVLS
Sbjct  17   LVVGAEDYYKLLGLKKDASEREIKKAYRTLSKKYHPDKNPGDDEAGKKFVEVAEAYEVLS  76

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGG  479
            + E R IYD+YG +G++QH   GG R    +  D+FS FFGG
Sbjct  77   EKETRKIYDQYGHDGIQQHKQGGGPR-QQHDPFDLFSRFFGG  117



>ref|XP_002971272.1| hypothetical protein SELMODRAFT_231730 [Selaginella moellendorffii]
 gb|EFJ27870.1| hypothetical protein SELMODRAFT_231730 [Selaginella moellendorffii]
Length=311

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 16/111 (14%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YY +L+V K A+ED +K+AYRKLA+K+HPD NP N +EA  KF +I+ AYEVLSD +KR 
Sbjct  5    YYSVLKVDKNATEDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSDPQKRT  64

Query  372  IYDRYGEEGLKQHA----ASGG---GRGAGMNI--------QDIFSSFFGG  479
            IYD+YGEEGLK       A+GG     GAG N+        +DIF+ FFGG
Sbjct  65   IYDQYGEEGLKGQVPPPGATGGTNFANGAGPNVFVFNPRNAEDIFAEFFGG  115



>ref|WP_029520295.1| molecular chaperone DnaJ [Persephonella sp. IF05-L8]
Length=378

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 77/119 (65%), Gaps = 24/119 (20%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A K YY+IL V + A++D+IK+AYR+LA KYHPD+NP N+EA +KF EI+ AY+VLSD 
Sbjct  1    MAKKDYYEILGVSRNATQDEIKKAYRRLARKYHPDLNPNNKEAEEKFKEISEAYQVLSDP  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAG------------MNIQDI------FSSFFGGG  482
            EKR +YD++G      HAA  G  GAG            MNI DI      F+ FFGGG
Sbjct  61   EKRKLYDQFG------HAAFSGASGAGAEEGFSGFGGFGMNIDDILEDLFNFTDFFGGG  113



>ref|WP_003030305.1| molecular chaperone DnaJ [Francisella tularensis]
 sp|A4IX29.1|DNAJ_FRATW RecName: Full=Chaperone protein DnaJ [Francisella tularensis 
subsp. tularensis WY96-3418]
 gb|ABO46481.1| chaperone protein DnaJ [Francisella tularensis subsp. tularensis 
WY96-3418]
 gb|EKM91670.1| chaperone protein DnaJ [Francisella tularensis subsp. tularensis 
70102010]
 gb|EKM93014.1| chaperone protein DnaJ [Francisella tularensis subsp. tularensis 
80700103]
 gb|EMI59782.1| chaperone protein DnaJ [Francisella tularensis subsp. tularensis 
3571]
 gb|KFJ65080.1| chaperone protein DnaJ [Francisella tularensis]
 gb|AJI62195.1| chaperone protein DnaJ [Francisella tularensis subsp. tularensis]
Length=371

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA++YHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  1    MQQKCYYEILNVSKTASGVEIKRAYRKLAMEYHPDRNPGDKEAEIKFKEISEAYEILSDD  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G     +DIF +FFGGG +
Sbjct  61   SKRSRYDQFGHAGVNQQSGFGGTGG----FEDIFDTFFGGGTS  99



>ref|WP_003025467.1| molecular chaperone DnaJ [Francisella tularensis]
 gb|EKM87757.1| chaperone protein DnaJ [Francisella tularensis subsp. tularensis 
831]
 gb|EKM88092.1| chaperone protein DnaJ [Francisella tularensis subsp. tularensis 
AS_713]
 gb|EKT90136.1| chaperone protein DnaJ [Francisella tularensis subsp. tularensis 
70001275]
Length=371

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA++YHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  1    MQQKCYYEILNVSKTASGVEIKRAYRKLAMEYHPDRNPGDKEAEIKFKEISEAYEILSDD  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G     +DIF +FFGGG +
Sbjct  61   SKRSRYDQFGHAGVNQQSGFGGTGG----FEDIFDTFFGGGTS  99



>ref|WP_018136881.1| molecular chaperone DnaJ [Campylobacter curvus]
Length=370

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ K AS D+IK+AYRKLALKYHPD N GN+EA  KF  +N AY+VLSD +KR I
Sbjct  5    YYEILEISKNASGDEIKKAYRKLALKYHPDRNAGNKEAEDKFKLVNEAYQVLSDDKKREI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            YDRYG+EGL   +   GG GA  +I DIFSSFFG
Sbjct  65   YDRYGKEGLSGASGF-GGFGADFDISDIFSSFFG  97



>ref|WP_029523125.1| molecular chaperone DnaJ [Persephonella sp. KM09-Lau-8]
Length=378

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 77/119 (65%), Gaps = 24/119 (20%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A K YY+IL V + A++D+IK+AYR+LA KYHPD+NP N+EA +KF EI+ AY+VLSD 
Sbjct  1    MAKKDYYEILGVSRNATQDEIKKAYRRLARKYHPDLNPNNKEAEEKFKEISEAYQVLSDP  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGA------------GMNIQDI------FSSFFGGG  482
            EKR +YD++G      HAA  G  GA            GMNI DI      F+ FFGGG
Sbjct  61   EKRKLYDQFG------HAAFSGASGAGAEESFSGFGGFGMNIDDILEDLFNFTDFFGGG  113



>ref|WP_013666383.1| molecular chaperone DnaJ [Sphingobacterium sp. 21]
 gb|ADZ79663.1| Chaperone protein dnaJ [Sphingobacterium sp. 21]
Length=381

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 73/104 (70%), Gaps = 7/104 (7%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YYD+L V K A + +IK AYRKLA+KYHPD NP N+EA +KF E   AYEVLS+ 
Sbjct  1    MAKRDYYDVLGVSKNAEQAEIKSAYRKLAIKYHPDKNPNNKEAEEKFKEAAEAYEVLSNP  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF---FGGG  482
            EKR  YDR+G  G     ++ GG G GMN++DIFS+F   FGGG
Sbjct  61   EKRQRYDRFGHAG----NSASGGYGGGMNMEDIFSNFGDIFGGG  100



>ref|WP_012830777.1| molecular chaperone DnaJ [Haliangium ochraceum]
 ref|YP_003270078.1| chaperone protein DnaJ [Haliangium ochraceum DSM 14365]
 gb|ACY18185.1| chaperone protein DnaJ [Haliangium ochraceum DSM 14365]
Length=371

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            + YYD+L V K AS   +KRAYR+LA+K+HPD NP + +A +KF E  +AY VL+D EKR
Sbjct  2    RDYYDVLGVSKDASRSDLKRAYRRLAMKFHPDQNPDDPQAEEKFKEAADAYAVLADDEKR  61

Query  369  NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF  470
            +IYDRYG EGL+Q   SG G GAG N++DIFS+F
Sbjct  62   SIYDRYGHEGLRQ---SGRGAGAG-NMEDIFSAF  91



>ref|XP_009775583.1| PREDICTED: dnaJ homolog subfamily B member 1 [Nicotiana sylvestris]
Length=325

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 2/98 (2%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YY++L V K A++D +K+AYRKLA+K+HPD NP N +EA  +F +I+ AYE+LSD +KR 
Sbjct  5    YYNVLNVGKTATDDDLKKAYRKLAMKWHPDKNPNNKKEAEAQFKQISEAYEILSDPQKRQ  64

Query  372  IYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
            +YD+YGEEGLK    S G  G   N +DIF+ FFG  P
Sbjct  65   VYDQYGEEGLKDM-PSPGSSGNPRNAEDIFAEFFGSSP  101



>ref|XP_002111260.1| hypothetical protein TRIADDRAFT_50110 [Trichoplax adhaerens]
 gb|EDV27264.1| hypothetical protein TRIADDRAFT_50110 [Trichoplax adhaerens]
Length=234

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNE-EANKKFAEINNAYEVLSDGEK  365
            K YY+IL V K AS + IK+AYRKLALK+HPD NP N+ EA  KF EI+ AYEVLSD EK
Sbjct  5    KEYYEILHVEKTASAEAIKKAYRKLALKWHPDKNPDNQKEAELKFKEISEAYEVLSDSEK  64

Query  366  RNIYDRYGEEGLK-QHAASGGGRGAGMNIQDIFSSFFGG  479
            R +YD+YG+ GL+  + +SGG      +  DIF SFFGG
Sbjct  65   RAMYDKYGKAGLQGDYGSSGGFEFTFSDPMDIFRSFFGG  103



>ref|WP_025323706.1| hypothetical protein [Deferrisoma camini]
Length=380

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            K YY+IL V +GAS D+IK+AYRK+ALKYHPD NPG++EA ++F     AYEVLSD EKR
Sbjct  3    KDYYEILGVARGASTDEIKKAYRKMALKYHPDRNPGDKEAEERFKLCAEAYEVLSDPEKR  62

Query  369  NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF  470
             +YD YGEEGL       G RG     +DIFS+F
Sbjct  63   RLYDAYGEEGLSSRGVHHGFRG----FEDIFSAF  92



>ref|XP_009590161.1| PREDICTED: dnaJ homolog subfamily B member 4 [Nicotiana tomentosiformis]
 ref|XP_009590162.1| PREDICTED: dnaJ homolog subfamily B member 4 [Nicotiana tomentosiformis]
 ref|XP_009590163.1| PREDICTED: dnaJ homolog subfamily B member 4 [Nicotiana tomentosiformis]
 ref|XP_009590164.1| PREDICTED: dnaJ homolog subfamily B member 4 [Nicotiana tomentosiformis]
 ref|XP_009590165.1| PREDICTED: dnaJ homolog subfamily B member 4 [Nicotiana tomentosiformis]
Length=325

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 2/98 (2%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YY++L V K A++D +K+AYRKLA+K+HPD NP N +EA  +F +I+ AYE+LSD +KR 
Sbjct  5    YYNVLNVGKTATDDDLKKAYRKLAMKWHPDKNPNNKKEAEAQFKQISEAYEILSDPQKRQ  64

Query  372  IYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGP  485
            +YD+YGEEGLK    S G  G   N +DIF+ FFG  P
Sbjct  65   VYDQYGEEGLK-DMPSPGSSGNPRNAEDIFAEFFGSSP  101



>gb|KHJ31437.1| putative chaperone j-domain-containing protein [Erysiphe necator]
Length=417

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 71/105 (68%), Gaps = 2/105 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            I    + YY +L V + AS  +IKRAYR+L+ KYHPD NPG+ EA KKFA++   YE LS
Sbjct  16   IVTCEEDYYKLLGVTRDASIKEIKRAYRQLSKKYHPDKNPGDNEAKKKFAKVAEVYEALS  75

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGG-GP  485
            D E R IYD YG EG+K+  + GGGRG   +  D+FS FFGG GP
Sbjct  76   DQEMRRIYDDYGHEGVKKQ-SQGGGRGGYQDPMDLFSRFFGGRGP  119



>ref|XP_002900549.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY59864.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=368

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 5/99 (5%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            ++A K YY++L V + AS  +IKRA+RKL+LK+HPD NPG+E A +KFAE+  AY+VLSD
Sbjct  20   SVAGKDYYEVLGVSRDASSAEIKRAFRKLSLKHHPDKNPGDESAAQKFAEVAGAYDVLSD  79

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
             +KRN YDRYGEEGL     + GG G G +  DIFS FF
Sbjct  80   EDKRNKYDRYGEEGLN----NAGGDG-GHDPFDIFSQFF  113



>ref|XP_005912448.1| PREDICTED: dnaJ homolog subfamily B member 6-B-like isoform X4 
[Haplochromis burtoni]
Length=198

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 68/103 (66%), Gaps = 8/103 (8%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YYDIL+V K A+++ IK+AYRKLALK+HPD NP N +EA K+F E++ AYEVLSD  KRN
Sbjct  4    YYDILRVEKNATQEDIKKAYRKLALKWHPDKNPNNKDEAEKRFKELSEAYEVLSDESKRN  63

Query  372  IYDRYGEEGL-------KQHAASGGGRGAGMNIQDIFSSFFGG  479
            +YDRYG+EGL         H    G      N  D+F  FF G
Sbjct  64   VYDRYGKEGLSGGGGGGGGHYDHFGSSFTFRNPDDVFREFFSG  106



>ref|WP_020074503.1| molecular chaperone DnaJ [[Clostridium] sporosphaeroides]
Length=383

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 75/102 (74%), Gaps = 7/102 (7%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            + YY+++ VPK ASED+IK+AYRKLA +YHPD+NPG++ A  KF E+N AYEVLSD EK+
Sbjct  5    RDYYEVMGVPKNASEDEIKKAYRKLAKQYHPDLNPGDKTAEAKFKEVNEAYEVLSDQEKK  64

Query  369  NIYDRYGEEGLKQHAASGGGRGAG-----MNIQDIFSSFFGG  479
              YD++G  G+  +   GGG GA      +++ DIF+SFFGG
Sbjct  65   ARYDQFGHAGVDPNF--GGGPGASPFDGDIDLGDIFNSFFGG  104



>ref|XP_005912447.1| PREDICTED: dnaJ homolog subfamily B member 6-B-like isoform X3 
[Haplochromis burtoni]
Length=247

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 68/102 (67%), Gaps = 7/102 (7%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YYDIL+V K A+++ IK+AYRKLALK+HPD NP N +EA K+F E++ AYEVLSD  KRN
Sbjct  4    YYDILRVEKNATQEDIKKAYRKLALKWHPDKNPNNKDEAEKRFKELSEAYEVLSDESKRN  63

Query  372  IYDRYGEEGLK------QHAASGGGRGAGMNIQDIFSSFFGG  479
            +YDRYG+EGL        H    G      N  D+F  FF G
Sbjct  64   VYDRYGKEGLSGGGGGGGHYDHFGSSFTFRNPDDVFREFFSG  105



>ref|WP_026805632.1| MULTISPECIES: molecular chaperone DnaJ [Arcobacter]
Length=369

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY++L++ K A +  IK+AYRKLA++YHPD NPG+ EA +KF  IN AY+VLSD EKR+I
Sbjct  6    YYELLEIEKSADKTVIKKAYRKLAMQYHPDKNPGDSEAEEKFKAINEAYQVLSDDEKRSI  65

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            YDRYG+ GL+ H   G G G   ++  IF   FG G
Sbjct  66   YDRYGKAGLEGHGQRGSGFGGFDDLGSIFEEMFGFG  101



>gb|KIZ01675.1| putative DnaJ subfamily B member 11 [Monoraphidium neglectum]
Length=210

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 4/78 (5%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNE----EANKKFAEINNAY  341
            +A A KSYYD+L VPK ASE QIKR+YRKLAL+YHPD   G+E    EA K+FA+IN+AY
Sbjct  22   VAFAKKSYYDVLNVPKQASEQQIKRSYRKLALQYHPDKVSGSEEQKAEAAKRFADINHAY  81

Query  342  EVLSDGEKRNIYDRYGEE  395
            E LSD EKR IYD+YGEE
Sbjct  82   ETLSDPEKREIYDQYGEE  99



>gb|KDO26257.1| hypothetical protein SPRG_08333 [Saprolegnia parasitica CBS 223.65]
Length=209

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNE-EANKKFAEINNAYEVLSDGEKRN  371
            YYD+L VPK AS D+IK+AYRKLA+KYHPD NP N+ EA KKF EI  AY VLSD EKR 
Sbjct  4    YYDVLGVPKTASADEIKKAYRKLAIKYHPDKNPDNQDEAEKKFKEIGEAYSVLSDEEKRT  63

Query  372  IYDRYGEEGLKQHAASGGGRGAGMNIQ---DIFSSFFGG  479
             YDR+G+ G+    ++GGG     N Q   +IF +FFGG
Sbjct  64   TYDRFGKAGVNGQ-SNGGGMHPNFNAQNAEEIFQAFFGG  101



>ref|WP_025842372.1| molecular chaperone DnaJ [Porphyromonas gingivicanis]
Length=384

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            + YY+IL V KGASED++K+AYRK+A+KYHPD NPG++EA +KF E+  AY+VLSD +KR
Sbjct  5    RDYYEILGVSKGASEDELKKAYRKMAIKYHPDKNPGDKEAEEKFKEVAEAYDVLSDTDKR  64

Query  369  NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFS  464
              YDR+G  G+  +  SGG    GM+++DIFS
Sbjct  65   ARYDRFGHAGV-DNMGSGGYAAGGMSMEDIFS  95



>ref|WP_012507859.1| molecular chaperone DnaJ [Pelodictyon phaeoclathratiforme]
 gb|ACF43367.1| chaperone protein DnaJ [Pelodictyon phaeoclathratiforme BU-1]
Length=394

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            + YY++L V + A++D+IK+AYRKLAL++HPD NP N++A + F E+N AYEVLS+ +KR
Sbjct  3    REYYEVLGVGRTATKDEIKKAYRKLALQFHPDKNPDNKDAEEHFKEVNEAYEVLSNDDKR  62

Query  369  NIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF  470
              YD+YG  G+   AASGG  G G ++ DIFS+F
Sbjct  63   RRYDQYGHAGVGSSAASGGQPGGGADLNDIFSAF  96



>gb|EXF56878.1| dnaJ domain protein [Acinetobacter baumannii 1294596]
Length=122

 Score =   103 bits (258),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 70/104 (67%), Gaps = 3/104 (3%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E + AYEVLSD 
Sbjct  1    MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNPEAEEKFKEASEAYEVLSDS  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF---FGGG  482
            EKR++YDR G    +      GG   G + +DIFS F   FGG 
Sbjct  61   EKRSMYDRMGHSAFEGGFGGAGGGFGGFSAEDIFSQFGDIFGGA  104



>ref|WP_009064669.1| MULTISPECIES: molecular chaperone DnaJ [Clostridium]
 gb|EJF39355.1| chaperone protein DnaJ [Clostridium sp. MSTE9]
Length=383

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 75/102 (74%), Gaps = 7/102 (7%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            + YY+++ VPK AS+D+IK+AYRKLA +YHPD+NPG++ A  KF E+N AYEVLSD EK+
Sbjct  5    RDYYEVMGVPKNASDDEIKKAYRKLAKQYHPDLNPGDKTAEAKFKEVNEAYEVLSDQEKK  64

Query  369  NIYDRYGEEGLKQHAASGGGRGAG-----MNIQDIFSSFFGG  479
              YD++G  G+  +   GGG GA      +++ DIF+SFFGG
Sbjct  65   ARYDQFGHAGVDPNF--GGGPGASPFDGDIDLGDIFNSFFGG  104



>ref|XP_008219853.1| PREDICTED: dnaJ homolog subfamily B member 1 [Prunus mume]
Length=334

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 10/107 (9%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YY++L+V + A+ED +K+AYR+LA+K+HPD NP N +EA  KF +I+ AYEVLSD +KR 
Sbjct  5    YYNVLKVNRNATEDDLKKAYRRLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSDSQKRA  64

Query  372  IYDRYGEEGLK------QHAASGGGRGAGM---NIQDIFSSFFGGGP  485
            IYD+YGEEGLK      ++A   GG   G    N +DIF+ FFG  P
Sbjct  65   IYDQYGEEGLKDMPPPERYANGNGGGSKGFNPRNAEDIFAEFFGSSP  111



>ref|WP_021687367.1| chaperone protein DnaJ [Treponema lecithinolyticum]
 gb|ERJ93156.1| chaperone protein DnaJ [Treponema lecithinolyticum ATCC 700332]
Length=375

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V KGA++D+IK+ YRKLA+KYHPD NPGN+EA  KF E   AYEVLSD 
Sbjct  1    MAKRDYYEVLGVQKGATKDEIKKGYRKLAVKYHPDKNPGNKEAEDKFKEATEAYEVLSDD  60

Query  360  EKRNIYDRYGEEGLK-QHAASGGGRGAGMNIQDIFSSFFGG  479
            +KR IYD+YG  GL+   A SGG +G      D F   FGG
Sbjct  61   QKRQIYDQYGFAGLEGMGAGSGGAQGFSHAFHD-FEDLFGG  100



>ref|XP_005844504.1| hypothetical protein CHLNCDRAFT_138873 [Chlorella variabilis]
 gb|EFN52402.1| hypothetical protein CHLNCDRAFT_138873 [Chlorella variabilis]
Length=364

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 73/97 (75%), Gaps = 6/97 (6%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEE----ANKKFAEINNAYEVLSD  356
            + YYDILQVP+ A++ QIKRAYRKLALK HPD   G+EE    A +KFA++++AYEVL+D
Sbjct  22   RDYYDILQVPRSATDAQIKRAYRKLALKMHPDKVQGSEEEKKAAAQKFADVSHAYEVLTD  81

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSS  467
             EKR +YDRYGEEGLKQ    GG  G G + QDIFS 
Sbjct  82   AEKRKVYDRYGEEGLKQMGNGGG--GGGGSAQDIFSQ  116



>ref|WP_006341690.1| molecular chaperone DnaJ [Parachlamydia acanthamoebae]
 gb|EFB41002.1| hypothetical protein pah_c161o003 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB87406.1| chaperone protein dnaJ [Parachlamydia acanthamoebae UV-7]
 gb|KIA76902.1| Chaperone protein DnaJ [Parachlamydia acanthamoebae]
Length=383

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+ L+V + A++D+IK+AYRK+ALKYHPD NPG+ E+ KKF EI+ AYEVLSD  KR +
Sbjct  4    YYNTLEVQRNATQDEIKKAYRKMALKYHPDKNPGDAESEKKFKEISEAYEVLSDTNKRQL  63

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFG  476
            YDRYG+EG++  +A+GG   + M  ++   +F G
Sbjct  64   YDRYGKEGVQGASAAGGASYSSM--EEALRTFMG  95



>ref|XP_007224208.1| hypothetical protein PRUPE_ppa017410mg [Prunus persica]
 gb|EMJ25407.1| hypothetical protein PRUPE_ppa017410mg [Prunus persica]
Length=334

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 10/107 (9%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YY++L+V + A+ED +K+AYR+LA+K+HPD NP N +EA  KF +I+ AYEVLSD +KR 
Sbjct  5    YYNVLKVNRNATEDDLKKAYRRLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSDSQKRA  64

Query  372  IYDRYGEEGLK------QHAASGGGRGAGM---NIQDIFSSFFGGGP  485
            IYD+YGEEGLK      ++A   GG   G    N +DIF+ FFG  P
Sbjct  65   IYDQYGEEGLKDMPPPERYANGNGGGSKGFNPRNAEDIFAEFFGSSP  111



>gb|KEZ40705.1| DnaJ-related protein SCJ1 [Scedosporium apiospermum]
Length=417

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 3/106 (3%)
 Frame = +3

Query  174  IAIAAKSYYD---ILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYE  344
            + + A+ YY    +L + + AS+  IK AYRKL+ KYHPD NP +  A  KF E++ AYE
Sbjct  16   LVLCAEDYYKASLVLGISRDASDKAIKSAYRKLSKKYHPDKNPNDSTAKDKFVEVSEAYE  75

Query  345  VLSDGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
             LSD E R IYD+YG EG+K H  SGGG G   +  D+FS FFGGG
Sbjct  76   ALSDPELRRIYDQYGHEGVKSHKESGGGGGRRQDPFDLFSRFFGGG  121



>gb|EUN28937.1| hypothetical protein COCVIDRAFT_94273 [Bipolaris victoriae FI3]
Length=420

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            + I A+ YY +L + K ASE QIK+AYR L+ KYHPD NPGNEEAN+KF EI  AYEVL 
Sbjct  17   LVIGAEDYYKLLGLEKDASERQIKKAYRNLSKKYHPDKNPGNEEANQKFVEIAEAYEVLI  76

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGR  431
            + E R IYD+YG EG++QH   GG R
Sbjct  77   EKETRKIYDQYGHEGIQQHKQGGGPR  102



>ref|WP_038813597.1| molecular chaperone DnaJ, partial [Campylobacter jejuni]
Length=140

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +3

Query  192  SYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRN  371
            SYY+IL++ + A ++ IK+AYRK+ALKYHPD N G++EA  KF  +N AYEVLS+ EKR 
Sbjct  4    SYYEILEITQNADKETIKKAYRKMALKYHPDRNQGDKEAEDKFKLVNEAYEVLSNDEKRA  63

Query  372  IYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFGGG  482
            IYDRYG++ LK         G G   ++ DIFSSFFG G
Sbjct  64   IYDRYGKDALKGGGFGSSSSGFGGFEDLGDIFSSFFGEG  102



>emb|CCC93431.1| putative chaperone protein DNAj, partial [Trypanosoma congolense 
IL3000]
Length=267

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 68/98 (69%), Gaps = 5/98 (5%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +    YY++L V   ASE+ IKRAYR+LAL+YHPD NPGNEEA   F +I +AYE LSD 
Sbjct  2    VKETEYYELLGVAVDASENDIKRAYRRLALRYHPDKNPGNEEAADMFKKIGHAYETLSDT  61

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
            EKR+IYD++G++GL     SG G  A  +  DIFS FF
Sbjct  62   EKRHIYDQHGKDGL-----SGSGGDADFDASDIFSMFF  94



>ref|XP_007708347.1| hypothetical protein COCCADRAFT_23062 [Bipolaris zeicola 26-R-13]
 gb|EUC37348.1| hypothetical protein COCCADRAFT_23062 [Bipolaris zeicola 26-R-13]
Length=420

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            + + A+ YY +L + K ASE QIK+AYR L+ KYHPD NPGNEEAN+KF EI  AYEVL 
Sbjct  17   LVVGAEDYYKLLGLEKDASERQIKKAYRNLSKKYHPDKNPGNEEANQKFVEIAEAYEVLI  76

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGR  431
            + E R IYD+YG EG++QH   GG R
Sbjct  77   EKETRKIYDQYGHEGIQQHKQGGGPR  102



>ref|WP_021093550.1| Chaperone protein DnaJ [Campylobacter concisus]
 gb|ERJ30871.1| Chaperone protein DnaJ [Campylobacter concisus UNSW2]
Length=382

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ + AS D+IK+A+RKLALKYHPD N G++EA +KF +IN AY+VLSD +KR+I
Sbjct  5    YYEILEISRNASGDEIKKAFRKLALKYHPDRNAGDKEAEQKFKQINEAYQVLSDEQKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSS  467
            YDRYG+EGL+    SGGG  A  ++ DIF S
Sbjct  65   YDRYGKEGLEGRFGSGGGFSADFDLSDIFDS  95



>ref|XP_007690934.1| hypothetical protein COCMIDRAFT_103224 [Bipolaris oryzae ATCC 
44560]
 gb|EUC42559.1| hypothetical protein COCMIDRAFT_103224 [Bipolaris oryzae ATCC 
44560]
Length=420

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            + + A+ YY +L + K ASE QIK+AYR L+ KYHPD NPGNEEAN+KF EI  AYEVL 
Sbjct  17   LVVGAEDYYKLLGLEKDASERQIKKAYRNLSKKYHPDKNPGNEEANQKFVEIAEAYEVLI  76

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGR  431
            + E R IYD+YG EG++QH   GG R
Sbjct  77   EKETRKIYDQYGHEGIQQHKQGGGPR  102



>ref|XP_007697811.1| hypothetical protein COCSADRAFT_112536 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD66279.1| hypothetical protein COCSADRAFT_112536 [Bipolaris sorokiniana 
ND90Pr]
Length=420

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            + + A+ YY +L + K ASE QIK+AYR L+ KYHPD NPGNEEAN+KF EI  AYEVL 
Sbjct  17   LVVGAEDYYKLLGLEKDASERQIKKAYRNLSKKYHPDKNPGNEEANQKFVEIAEAYEVLI  76

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGR  431
            + E R IYD+YG EG++QH   GG R
Sbjct  77   EKETRKIYDQYGHEGIQQHKQGGGPR  102



>ref|XP_005912445.1| PREDICTED: dnaJ homolog subfamily B member 6-B-like isoform X1 
[Haplochromis burtoni]
 ref|XP_005912446.1| PREDICTED: dnaJ homolog subfamily B member 6-B-like isoform X2 
[Haplochromis burtoni]
Length=321

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 68/103 (66%), Gaps = 8/103 (8%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YYDIL+V K A+++ IK+AYRKLALK+HPD NP N +EA K+F E++ AYEVLSD  KRN
Sbjct  4    YYDILRVEKNATQEDIKKAYRKLALKWHPDKNPNNKDEAEKRFKELSEAYEVLSDESKRN  63

Query  372  IYDRYGEEGLK-------QHAASGGGRGAGMNIQDIFSSFFGG  479
            +YDRYG+EGL         H    G      N  D+F  FF G
Sbjct  64   VYDRYGKEGLSGGGGGGGGHYDHFGSSFTFRNPDDVFREFFSG  106



>ref|WP_012001289.1| molecular chaperone DnaJ [Campylobacter concisus]
 ref|YP_001466288.1| chaperone protein DnaJ [Campylobacter concisus 13826]
 gb|EAT98183.1| chaperone protein DnaJ [Campylobacter concisus 13826]
Length=380

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ + AS D+IK+A+RKLALKYHPD N G++EA +KF +IN AY+VLSD +KR+I
Sbjct  5    YYEILEISRNASGDEIKKAFRKLALKYHPDRNAGDKEAEQKFKQINEAYQVLSDEQKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSS  467
            YDRYG+EGL+    SGGG  A  ++ DIF S
Sbjct  65   YDRYGKEGLEGRFGSGGGFSADFDLSDIFDS  95



>ref|XP_002146527.1| DnaJ domain protein, putative [Talaromyces marneffei ATCC 18224]
 gb|EEA25980.1| DnaJ domain protein, putative [Talaromyces marneffei ATCC 18224]
 gb|KFX47418.1| DnaJ-related protein spj1 [Talaromyces marneffei PM1]
Length=427

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            + + A+ YY IL V K A+E  IKRAYR L+ K+HPD NPG+E A KKF +I  AYEVLS
Sbjct  18   LTLCAEDYYKILGVDKSAAERDIKRAYRTLSKKFHPDKNPGDESAKKKFVDIAEAYEVLS  77

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
                R IYD+YG EGL+QH   G   G   +  D+FS FF
Sbjct  78   TSSTRKIYDQYGHEGLEQHKQGGNRGGHAGDPFDLFSRFF  117



>ref|WP_021089033.1| Chaperone protein DnaJ [Campylobacter concisus]
 gb|ERJ29280.1| Chaperone protein DnaJ [Campylobacter concisus ATCC 51561]
Length=380

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ + AS D+IK+A+RKLALKYHPD N G++EA +KF +IN AY+VLSD +KR+I
Sbjct  5    YYEILEISRNASGDEIKKAFRKLALKYHPDRNAGDKEAEQKFKQINEAYQVLSDEQKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSS  467
            YDRYG+EGL+    SGGG  A  ++ DIF S
Sbjct  65   YDRYGKEGLEGRFGSGGGFSADFDLSDIFDS  95



>ref|WP_002942545.1| molecular chaperone DnaJ [Campylobacter concisus]
 gb|EIF06274.1| Chaperone protein DnaJ [Campylobacter concisus UNSWCD]
Length=380

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ + AS D+IK+A+RKLALKYHPD N G++EA +KF +IN AY+VLSD +KR+I
Sbjct  5    YYEILEISRNASGDEIKKAFRKLALKYHPDRNAGDKEAEQKFKQINEAYQVLSDEQKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSS  467
            YDRYG+EGL+    SGGG  A  ++ DIF S
Sbjct  65   YDRYGKEGLEGRFGSGGGFSADFDLSDIFDS  95



>ref|WP_021086869.1| Chaperone protein DnaJ [Campylobacter concisus]
 gb|ERJ30705.1| Chaperone protein DnaJ [Campylobacter concisus UNSWCS]
Length=380

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ + AS D+IK+A+RKLALKYHPD N G++EA +KF +IN AY+VLSD +KR+I
Sbjct  5    YYEILEISRNASGDEIKKAFRKLALKYHPDRNAGDKEAEQKFKQINEAYQVLSDEQKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIFSS  467
            YDRYG+EGL+    SGGG  A  ++ DIF S
Sbjct  65   YDRYGKEGLEGRFGSGGGFSADFDLSDIFDS  95



>ref|WP_034967822.1| molecular chaperone DnaJ [Campylobacter mucosalis]
 gb|KEA46144.1| molecular chaperone DnaJ [Campylobacter mucosalis]
Length=373

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 74/101 (73%), Gaps = 3/101 (3%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ K A  D++K+AYRKLALKYHPD N G++EA +KF  +N AY+VLSD +KR I
Sbjct  5    YYEILEISKTADGDELKKAYRKLALKYHPDRNQGDKEAEEKFKLVNEAYQVLSDPQKREI  64

Query  375  YDRYGEEGL---KQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
            YDRYG+EGL          GG GA  ++ DIFSSFFGGG +
Sbjct  65   YDRYGKEGLNGAGGGFGGFGGFGADFDLGDIFSSFFGGGTS  105



>ref|WP_028323014.1| molecular chaperone DnaJ [Desulfatiglans anilini]
Length=372

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 5/97 (5%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L VPK A +D IKRAYR+LALKYHPD NPGN EA + F E   AYEVL D 
Sbjct  1    MAKRDYYEVLGVPKNAGDDDIKRAYRQLALKYHPDRNPGNREAEEHFKEAAEAYEVLRDH  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF  470
            EKR IYDR+G  GL+    +G         +DIFSSF
Sbjct  61   EKRQIYDRFGHAGLENKGFTGFS-----GFEDIFSSF  92



>gb|KFY37293.1| hypothetical protein V495_07255 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY62077.1| hypothetical protein V497_02584 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=432

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +3

Query  183  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGE  362
             A+ +Y +L + K AS   IKRAYR L+ K+HPD NPG+E A +KF EI  AYE LSD E
Sbjct  18   CAEDFYKLLGIDKQASTSDIKRAYRSLSKKFHPDKNPGDETAKQKFVEIAEAYEALSDTE  77

Query  363  KRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
             R IYD+YG EGL+QH A GGG     +  D+FS FF
Sbjct  78   TRQIYDKYGHEGLQQH-AQGGGHQQHHDPFDLFSRFF  113



>ref|WP_035719928.1| molecular chaperone DnaJ [Francisella sp. W12-1067]
Length=374

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 70/98 (71%), Gaps = 1/98 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  + YY+IL V K A   +IKR+YRKLA+KYHPD NPG+++A  KF EI+ AYEVLSD 
Sbjct  1    MQQRCYYEILNVSKTADITEIKRSYRKLAMKYHPDRNPGDKQAEVKFKEISEAYEVLSDK  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
            +KR+ YD++G  G+ Q A +G   G G + +DIF +FF
Sbjct  61   QKRSRYDQFGHAGVNQQAGNGSAGGFG-SFEDIFDTFF  97



>ref|WP_005052729.1| chaperone dnaJ [Acinetobacter beijerinckii]
 gb|ENW06114.1| chaperone dnaJ [Acinetobacter beijerinckii ANC 3835]
Length=371

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E + AYEVLSDG
Sbjct  1    MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEASEAYEVLSDG  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF---FGG  479
            EKR++YDR G    +     GGG G G + +DIFS F   FGG
Sbjct  61   EKRSMYDRAGHSAFEGGYGGGGGYGGGFSAEDIFSQFGDIFGG  103



>gb|KFX91790.1| hypothetical protein O988_07578 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=432

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +3

Query  183  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGE  362
             A+ +Y +L + K AS   IKRAYR L+ K+HPD NPG+E A +KF EI  AYE LSD E
Sbjct  18   CAEDFYKLLGIDKQASTSDIKRAYRSLSKKFHPDKNPGDETAKQKFVEIAEAYEALSDTE  77

Query  363  KRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
             R IYD+YG EGL+QH A GGG     +  D+FS FF
Sbjct  78   TRQIYDKYGHEGLQQH-AQGGGHQQHHDPFDLFSRFF  113



>ref|WP_041876255.1| molecular chaperone DnaJ [Marinimicrobia bacterium SCGC AAA257-N23]
Length=379

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 72/113 (64%), Gaps = 16/113 (14%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKR  368
            + YYDIL+V K AS+D+IK+AYRK+A+KYHPD NPGN+E+  KF E   AY VL+D EK+
Sbjct  3    RDYYDILEVNKNASKDEIKKAYRKIAMKYHPDKNPGNKESESKFKEAAEAYSVLTDDEKK  62

Query  369  NIYDRYGEEGLKQHAASGGGRGAGMNIQDI---------------FSSFFGGG  482
             IYD+YG +GLK     GG  G G +  DI               FS FFGGG
Sbjct  63   TIYDQYGHDGLKG-TRFGGFSGTGFDPFDIFESVFGGRGGFGGIDFSEFFGGG  114



>gb|KFX91092.1| hypothetical protein V490_06086 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=432

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +3

Query  183  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGE  362
             A+ +Y +L + K AS   IKRAYR L+ K+HPD NPG+E A +KF EI  AYE LSD E
Sbjct  18   CAEDFYKLLGIDKQASTSDIKRAYRSLSKKFHPDKNPGDETAKQKFVEIAEAYEALSDTE  77

Query  363  KRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
             R IYD+YG EGL+QH A GGG     +  D+FS FF
Sbjct  78   TRQIYDKYGHEGLQQH-AQGGGHQQHHDPFDLFSRFF  113



>ref|WP_005060380.1| chaperone dnaJ [Acinetobacter beijerinckii]
 gb|ENW07288.1| chaperone dnaJ [Acinetobacter beijerinckii CIP 110307]
Length=371

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E + AYEVLSDG
Sbjct  1    MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEASEAYEVLSDG  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF---FGG  479
            EKR++YDR G    +     GGG G G + +DIFS F   FGG
Sbjct  61   EKRSMYDRAGHSAFEGGFGGGGGFGGGFSAEDIFSQFGDIFGG  103



>emb|CCQ91220.1| Chaperone protein DnaJ [Nitrospina gracilis 3/211]
Length=363

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 71/105 (68%), Gaps = 2/105 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            + +  + YY+IL+V + ASE ++K+AYR++ALKYHPD NPG++EA +KF E + AYEVL 
Sbjct  3    VLMVKRDYYEILEVSREASEAELKKAYRQMALKYHPDKNPGDKEAEEKFKEASEAYEVLR  62

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFGGG  482
            D EKR +YD++G EGLK     G      +     DIF  FFGGG
Sbjct  63   DAEKRRVYDQFGHEGLKGQGFGGFSGFEDIFSTFGDIFGDFFGGG  107



>ref|WP_032729577.1| molecular chaperone DnaJ [Francisella tularensis]
 gb|KFJ66397.1| chaperone protein DnaJ [Francisella tularensis subsp. novicida]
 gb|AJI45055.1| chaperone protein DnaJ [Francisella tularensis subsp. novicida 
F6168]
 gb|AJJ46618.1| chaperone protein DnaJ [Francisella tularensis subsp. tularensis]
Length=374

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  1    MQQKCYYEILNVSKTASGVEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G G   +DIF +FFGGG +
Sbjct  61   SKRSRYDQFGHAGVNQQSGFGGAGGFGGF-EDIFDTFFGGGTS  102



>gb|KEQ71635.1| DnaJ-domain-containing protein [Aureobasidium pullulans var. 
namibiae CBS 147.97]
Length=410

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +A+ A+ YY +L + + ASE ++K+AYR L+ KYHPD NPG+E A KKF E+  AYE LS
Sbjct  16   VALCAEDYYKLLGIERDASERELKKAYRTLSKKYHPDKNPGDETAQKKFVEVAEAYEALS  75

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFS  464
            + E R IYD+YG EGLKQH    GG   G N  D+FS
Sbjct  76   EAETRKIYDQYGHEGLKQHKE--GGHRQGGNPFDLFS  110



>ref|WP_014550031.1| molecular chaperone DnaJ [Francisella tularensis]
 gb|AEE87712.1| Chaperone protein DnaJ [Francisella cf. novicida Fx1]
 gb|AJI73288.1| chaperone protein DnaJ [Francisella tularensis subsp. novicida 
D9876]
Length=374

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  1    MQQKCYYEILNVSKTASGVEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G G   +DIF +FFGGG +
Sbjct  61   SKRSRYDQFGHAGVNQQSGFGGAGGFGGF-EDIFDTFFGGGTS  102



>ref|WP_003040062.1| molecular chaperone DnaJ [Francisella tularensis]
 gb|EDX19687.1| chaperone protein DnaJ [Francisella tularensis subsp. novicida 
FTE]
 gb|EDZ90688.1| chaperone protein DnaJ [Francisella tularensis subsp. novicida 
FTG]
 gb|AJI61973.1| chaperone protein DnaJ [Francisella tularensis subsp. novicida 
U112]
Length=374

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  1    MQQKCYYEILNVSKTASGVEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G G   +DIF +FFGGG +
Sbjct  61   SKRSRYDQFGHAGVNQQSGFGGAGGFGGF-EDIFDTFFGGGTS  102



>ref|XP_002541314.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gb|EEP75981.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
Length=413

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 66/100 (66%), Gaps = 2/100 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
             A+ A+ YY IL + K ASE  IKRAYR L+ KYHPD NPGN+ A++KF +I  AY+VLS
Sbjct  18   FALCAEDYYKILGLDKSASERDIKRAYRTLSKKYHPDKNPGNDSAHQKFVDIAEAYDVLS  77

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
                R IYD+YG EGL+QH   GG      +  D+FS FF
Sbjct  78   TSSTRKIYDKYGHEGLQQHKQGGG--APTHDPFDLFSRFF  115



>gb|EDN36604.1| chaperone DnaJ [Francisella tularensis subsp. novicida GA99-3549]
Length=395

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  22   MQQKCYYEILNVSKTASGVEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  81

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G G   +DIF +FFGGG +
Sbjct  82   SKRSRYDQFGHAGVNQQSGFGGAGGFGGF-EDIFDTFFGGGTS  123



>gb|ABK90164.1| chaperone, DnaJ family [Francisella novicida U112]
Length=395

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  22   MQQKCYYEILNVSKTASGVEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  81

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G G   +DIF +FFGGG +
Sbjct  82   SKRSRYDQFGHAGVNQQSGFGGAGGFGGF-EDIFDTFFGGGTS  123



>gb|EDN38051.1| chaperone [Francisella tularensis subsp. novicida GA99-3548]
Length=395

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  K YY+IL V K AS  +IKRAYRKLA+KYHPD NPG++EA  KF EI+ AYE+LSD 
Sbjct  22   MQQKCYYEILNVSKTASGVEIKRAYRKLAMKYHPDRNPGDKEAEIKFKEISEAYEILSDD  81

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGGPN  488
             KR+ YD++G  G+ Q +  GG  G G   +DIF +FFGGG +
Sbjct  82   SKRSRYDQFGHAGVNQQSGFGGAGGFGGF-EDIFDTFFGGGTS  123



>ref|WP_004986133.1| MULTISPECIES: molecular chaperone DnaJ [Acinetobacter]
 gb|ENV74646.1| chaperone dnaJ [Acinetobacter ursingii DSM 16037 = CIP 107286]
 gb|ENV78124.1| chaperone dnaJ [Acinetobacter ursingii ANC 3649]
 gb|ENX45696.1| chaperone dnaJ [Acinetobacter ursingii NIPH 706]
 gb|EXD32428.1| chaperone protein DnaJ [Acinetobacter baumannii 479375]
Length=371

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E + AYEVLSDG
Sbjct  1    MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEASEAYEVLSDG  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF---FGG  479
            EKR++YDR G    +     G G   G + +DIFS F   FGG
Sbjct  61   EKRSMYDRMGHNAFEGGYGGGSGGFGGFSAEDIFSQFGDIFGG  103



>ref|XP_006969027.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR45121.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETR98206.1| DnaJ-domain-containing protein [Trichoderma reesei RUT C-30]
Length=413

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +A+ A+ +Y +L V K AS+ Q+K+AYR+L+ K+HPD NPG+E A++KF  ++ AYEVLS
Sbjct  16   LAVCAEDFYKVLGVDKSASDKQLKQAYRQLSKKFHPDKNPGDETAHEKFVLVSEAYEVLS  75

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGG  479
            D E R +YDRYG EG+K H    GG G G +  D+FS FFGG
Sbjct  76   DSELRKVYDRYGHEGVKSHRQG-GGGGGGGDPFDLFSRFFGG  116



>ref|WP_010962326.1| molecular chaperone DnaJ [Wolbachia endosymbiont of Drosophila 
melanogaster]
 sp|Q73IV4.1|DNAJ_WOLPM RecName: Full=Chaperone protein DnaJ [Wolbachia endosymbiont 
of Drosophila melanogaster]
 gb|AAS13806.1| dnaJ protein [Wolbachia endosymbiont of Drosophila melanogaster]
 gb|ERN56109.1| chaperone protein DnaJ [Wolbachia pipientis wMelPop]
Length=372

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 7/96 (7%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            ++ K YYD+L+V + AS D+IK+AY+KLAL+YHPD NPGN+EA +KF E+  AYEVLSD 
Sbjct  1    MSKKDYYDLLEVGRNASIDEIKKAYKKLALRYHPDRNPGNQEAEEKFKEVTAAYEVLSDS  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRG--AGMNIQDIF  461
            EKR  YDRYG EG     ASGG +G  +  +  DIF
Sbjct  61   EKRAGYDRYGHEG-----ASGGFQGFSSAGDFSDIF  91



>ref|XP_005448984.1| PREDICTED: dnaJ homolog subfamily B member 6-B-like isoform X3 
[Oreochromis niloticus]
Length=243

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 15/106 (14%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YY IL V K A+++ IK+AYRKLALK+HPD NP N +EA KKF E++ AYEVLSD  KRN
Sbjct  4    YYQILGVQKNATQEDIKKAYRKLALKWHPDKNPDNKDEAEKKFKELSEAYEVLSDESKRN  63

Query  372  IYDRYGEEGLK----------QHAASGGGRGAGMNIQDIFSSFFGG  479
            +YDRYG+EGL            H +S   R    N +D+F  FFGG
Sbjct  64   VYDRYGKEGLSGGGGGGGGHYDHFSSFTFR----NPEDVFREFFGG  105



>ref|WP_021084951.1| Chaperone protein DnaJ [Campylobacter concisus]
 gb|ERJ21458.1| Chaperone protein DnaJ [Campylobacter concisus UNSW3]
Length=380

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRNI  374
            YY+IL++ + AS D+IK+A+RKLALKYHPD N G++EA +KF +IN AY+VLSD +KR+I
Sbjct  5    YYEILEISRNASGDEIKKAFRKLALKYHPDRNAGDKEAEQKFKQINEAYQVLSDEQKRSI  64

Query  375  YDRYGEEGLKQHAASGGGRGAGMNIQDIF  461
            YDRYG+EGL+    SGGG  A  ++ DIF
Sbjct  65   YDRYGKEGLEGRFGSGGGFSADFDLSDIF  93



>ref|WP_004895889.1| MULTISPECIES: molecular chaperone DnaJ [Acinetobacter]
 gb|EIM38171.1| chaperone protein DnaJ [Acinetobacter sp. HA]
 gb|EIM38345.1| chaperone protein DnaJ [Acinetobacter sp. HA]
 gb|ENV43207.1| chaperone dnaJ [Acinetobacter schindleri CIP 107287]
Length=370

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 74/108 (69%), Gaps = 7/108 (6%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E + AYEVLSD 
Sbjct  1    MAKRDYYEVLGVAKTASDDEIKKAYRKLAMKYHPDRNPDNPEAEEKFKEASEAYEVLSDS  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF-------FGGG  482
            EKR++YDR G +  +     GGG G G + +DIFS F       FGGG
Sbjct  61   EKRSMYDRMGHQAFEGGMGGGGGFGGGFSAEDIFSQFGDIFGGAFGGG  108



>ref|WP_004814096.1| chaperone dnaJ [Acinetobacter schindleri]
 gb|ENV13426.1| chaperone dnaJ [Acinetobacter schindleri NIPH 900]
Length=370

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 74/108 (69%), Gaps = 7/108 (6%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E + AYEVLSD 
Sbjct  1    MAKRDYYEVLGVAKTASDDEIKKAYRKLAMKYHPDRNPDNPEAEEKFKEASEAYEVLSDS  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF-------FGGG  482
            EKR++YDR G +  +     GGG G G + +DIFS F       FGGG
Sbjct  61   EKRSMYDRMGHQAFEGGMGGGGGFGGGFSAEDIFSQFGDIFGGAFGGG  108



>ref|WP_002803966.1| molecular chaperone DnaJ [Campylobacter coli]
 gb|EIA60973.1| chaperone protein DnaJ [Campylobacter coli 86119]
 gb|EIB08212.1| chaperone protein DnaJ [Campylobacter coli LMG 9860]
 gb|AHK73571.1| molecular chaperone DnaJ [Campylobacter coli RM1875]
Length=374

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  192  SYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRN  371
            SYY+IL++ + A +D IK+AYRK+ALKYHPD N G++EA  KF  +N AYEVLS+ EKR 
Sbjct  4    SYYEILEITQSADKDTIKKAYRKMALKYHPDRNQGDKEAEDKFKLVNEAYEVLSNEEKRA  63

Query  372  IYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFGGG  482
            IYDRYG++ LK      GG G G   ++ DIFSS FGGG
Sbjct  64   IYDRYGKDALKGGGFGSGGAGFGGFEDLGDIFSSIFGGG  102



>ref|WP_002844600.1| molecular chaperone DnaJ [Campylobacter coli]
 gb|EIB12303.1| chaperone protein DnaJ [Campylobacter coli H9]
Length=374

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  192  SYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRN  371
            SYY+IL++ + A +D IK+AYRK+ALKYHPD N G++EA  KF  +N AYEVLS+ EKR 
Sbjct  4    SYYEILEITQSADKDTIKKAYRKMALKYHPDRNQGDKEAEDKFKLVNEAYEVLSNEEKRA  63

Query  372  IYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFGGG  482
            IYDRYG++ LK      GG G G   ++ DIFSS FGGG
Sbjct  64   IYDRYGKDALKGGGFGSGGAGFGGFEDLGDIFSSIFGGG  102



>ref|WP_002822701.1| molecular chaperone DnaJ [Campylobacter coli]
 gb|EIA85758.1| chaperone protein DnaJ [Campylobacter coli 202/04]
 gb|EIA92485.1| chaperone protein DnaJ [Campylobacter coli 317/04]
 gb|AHK76482.1| molecular chaperone DnaJ [Campylobacter coli RM4661]
Length=374

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  192  SYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGEKRN  371
            SYY+IL++ + A +D IK+AYRK+ALKYHPD N G++EA  KF  +N AYEVLS+ EKR 
Sbjct  4    SYYEILEITQSADKDTIKKAYRKMALKYHPDRNQGDKEAEDKFKLVNEAYEVLSNEEKRA  63

Query  372  IYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFGGG  482
            IYDRYG++ LK      GG G G   ++ DIFSS FGGG
Sbjct  64   IYDRYGKDALKGGGFGSGGAGFGGFEDLGDIFSSIFGGG  102



>ref|XP_005722836.1| PREDICTED: dnaJ homolog subfamily B member 6-like isoform X2 
[Pundamilia nyererei]
Length=246

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YY IL V K A+++ IK+AYRKLALK+HPD NP N +EA K+F E++ AYEVLSD  KRN
Sbjct  4    YYHILGVEKNATQEDIKKAYRKLALKWHPDKNPENKDEAEKRFKELSEAYEVLSDESKRN  63

Query  372  IYDRYGEEGLK------QHAASGGGRGAGMNIQDIFSSFFGG  479
            +YDRYG+EGL        H    G      N  D+F  FFGG
Sbjct  64   VYDRYGKEGLSGGGGGGGHYDHFGSSFTFRNPDDVFREFFGG  105



>ref|XP_008609054.1| DnaJ like subfamily B member 6 [Saprolegnia diclina VS20]
 gb|EQC37534.1| DnaJ like subfamily B member 6 [Saprolegnia diclina VS20]
Length=206

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 69/99 (70%), Gaps = 5/99 (5%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNE-EANKKFAEINNAYEVLSDGEKRN  371
            YYD+L V K AS D+IK+AYRKLA+KYHPD NP N+ EA KKF EI  AY VLSD EKR 
Sbjct  4    YYDVLGVAKTASADEIKKAYRKLAIKYHPDKNPDNQDEAEKKFKEIGEAYSVLSDEEKRT  63

Query  372  IYDRYGEEGLKQHAASGGGRGAGMNIQ---DIFSSFFGG  479
             YDR+G+ G+    ++GGG     N Q   +IF +FFGG
Sbjct  64   TYDRFGKAGVNGQ-SNGGGMHPNFNAQNAEEIFQAFFGG  101



>ref|XP_001701027.1| ER DnaJ-like protein 1 [Chlamydomonas reinhardtii]
 gb|EDP07281.1| ER DnaJ-like protein 1 [Chlamydomonas reinhardtii]
Length=350

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 64/76 (84%), Gaps = 4/76 (5%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEE----ANKKFAEINNAYEV  347
            ++AK YY++LQVPKGASE Q+KRAYRKLAL+YHPD   G E+    A+++FA+IN+AYEV
Sbjct  25   VSAKDYYELLQVPKGASEAQLKRAYRKLALQYHPDKVTGTEDEKKVASQRFADINHAYEV  84

Query  348  LSDGEKRNIYDRYGEE  395
            LSD EKR IYD+YGE+
Sbjct  85   LSDPEKRKIYDQYGED  100



>ref|WP_031988940.1| molecular chaperone DnaJ, partial [Acinetobacter baumannii]
 gb|EXW38300.1| dnaJ domain protein, partial [Acinetobacter baumannii 44327_6]
Length=101

 Score =   100 bits (249),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E + AYE+LSD 
Sbjct  1    MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEASEAYEILSDS  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF  470
            EKR++YDR G    +      GG   G + +DIFS F
Sbjct  61   EKRSMYDRMGHNAFEGGFGGAGGGFGGFSAEDIFSQF  97



>ref|WP_042252321.1| molecular chaperone DnaJ [Nitrospina gracilis]
Length=359

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 70/103 (68%), Gaps = 2/103 (2%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +  + YY+IL+V + ASE ++K+AYR++ALKYHPD NPG++EA +KF E + AYEVL D 
Sbjct  1    MVKRDYYEILEVSREASEAELKKAYRQMALKYHPDKNPGDKEAEEKFKEASEAYEVLRDA  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGM--NIQDIFSSFFGGG  482
            EKR +YD++G EGLK     G      +     DIF  FFGGG
Sbjct  61   EKRRVYDQFGHEGLKGQGFGGFSGFEDIFSTFGDIFGDFFGGG  103



>gb|KGO73862.1| Heat shock protein DnaJ, N-terminal [Penicillium italicum]
Length=421

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            + IAA+ YY +L + K ASE  IKRAYR L+ KYHPD NPG++ A +KF EI +AY+VLS
Sbjct  18   VVIAAEDYYKVLGLAKSASERDIKRAYRTLSKKYHPDKNPGDDTAREKFVEIADAYDVLS  77

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
                R +YD++G +G++QH   GG  G G +  D+FS FF
Sbjct  78   SSTLRKVYDQHGHDGVEQH-RKGGAAGGGHDPFDLFSRFF  116



>ref|WP_044435460.1| molecular chaperone DnaJ [Acinetobacter ursingii]
Length=371

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E + AYE+LSDG
Sbjct  1    MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEASEAYEILSDG  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF---FGG  479
            EKR++YDR G    +     G G   G + +DIFS F   FGG
Sbjct  61   EKRSMYDRMGHNAFEGGYGGGSGGFGGFSAEDIFSQFGDIFGG  103



>ref|WP_004728913.1| chaperone dnaJ [Acinetobacter lwoffii]
 gb|ENU64073.1| chaperone dnaJ [Acinetobacter lwoffii NIPH 715]
Length=372

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E   AYEVLSDG
Sbjct  1    MAKRDYYEVLGVAKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEAAEAYEVLSDG  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF  470
            EKR++YDR G +  +     GGG G G + +DIFS F
Sbjct  61   EKRSMYDRMGHQAFEGGMGGGGGFGGGFSAEDIFSQF  97



>gb|EHK25741.1| hypothetical protein TRIVIDRAFT_110873 [Trichoderma virens Gv29-8]
Length=413

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +A  A+ +Y +L V K A++ Q+K AYR+L+ KYHPD NPG+E A++KF +++ AYEVLS
Sbjct  16   LAFCAEDFYKLLGVDKSATDKQLKSAYRQLSKKYHPDKNPGDETAHEKFVQVSEAYEVLS  75

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGG  479
            D E R +YDRYG EG+K H    GG G G +  D+FS FFGG
Sbjct  76   DSELRKVYDRYGHEGVKSHRQG-GGGGGGGDPFDLFSRFFGG  116



>ref|WP_005104999.1| MULTISPECIES: chaperone dnaJ [Acinetobacter]
 gb|ENW27089.1| chaperone dnaJ [Acinetobacter lwoffii CIP 70.31]
 gb|ENW28645.1| chaperone dnaJ [Acinetobacter lwoffii NIPH 478]
 gb|ENX26294.1| chaperone dnaJ [Acinetobacter sp. CIP 64.7]
Length=372

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E   AYEVLSDG
Sbjct  1    MAKRDYYEVLGVAKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEAAEAYEVLSDG  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF  470
            EKR++YDR G +  +     GGG G G + +DIFS F
Sbjct  61   EKRSMYDRMGHQAFEGGMGGGGGFGGGFSAEDIFSQF  97



>gb|KEQ58931.1| DnaJ protein-like protein [Aureobasidium melanogenum CBS 110374]
Length=412

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            +A+ A+ YY +L + K ASE ++K+AYR L+ KYHPD NPG+E   KKF EI  AYE LS
Sbjct  16   VALCAEDYYKLLGIDKNASERELKKAYRTLSKKYHPDKNPGDETVQKKFVEIAEAYEALS  75

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFS  464
            + E R IYD+YG EGLKQH    GG   G N  D+FS
Sbjct  76   EPETRKIYDQYGHEGLKQHKE--GGHRQGGNPFDLFS  110



>ref|WP_005220414.1| chaperone dnaJ [Acinetobacter sp. CIP 101934]
 gb|ENX03769.1| chaperone dnaJ [Acinetobacter sp. CIP 101934]
Length=370

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E + AYEVLSD 
Sbjct  1    MAKRDYYEVLGVAKTASDDEIKKAYRKLAMKYHPDRNPDNPEAEEKFKEASEAYEVLSDS  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF---FGG  479
            EKR++YDR G +  +     GGG G G + +DIFS F   FGG
Sbjct  61   EKRSMYDRMGHQAFEGGMGGGGGFGGGFSAEDIFSQFGDIFGG  103



>ref|WP_003258071.1| chaperone protein DnaJ [Pseudomonas putida]
 gb|EJT84812.1| chaperone protein DnaJ [Pseudomonas putida S11]
Length=375

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 70/106 (66%), Gaps = 4/106 (4%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            ++ + YY++L V +GASE  +K+AYR+LA+KYHPD NPG++E+  KF E N AYEVLSD 
Sbjct  1    MSKRDYYEVLGVERGASESDLKKAYRRLAMKYHPDRNPGDKESEDKFKEANEAYEVLSDA  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDI----FSSFFGGGP  485
             KR  +D+YG  G+      GG    G N  DI    FS FFGGGP
Sbjct  61   SKRAAFDQYGHAGVDPSMGGGGAGFGGANFSDIFGDVFSDFFGGGP  106



>ref|WP_004659709.1| chaperone dnaJ [Acinetobacter sp. NIPH 236]
 gb|ENU27783.1| chaperone dnaJ [Acinetobacter sp. NIPH 236]
Length=371

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E   AYEVLSDG
Sbjct  1    MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEAAEAYEVLSDG  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF---FGG  479
            EKR++YDR G    +     GGG G G + +DIFS F   FGG
Sbjct  61   EKRSMYDRAGHSAFEGGFGGGGGFGGGFSAEDIFSQFGDIFGG  103



>ref|WP_005157098.1| chaperone dnaJ [Acinetobacter sp. NIPH 284]
 gb|ENW84222.1| chaperone dnaJ [Acinetobacter sp. NIPH 284]
Length=372

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E   AYEVLSDG
Sbjct  1    MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEAAEAYEVLSDG  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF---FGG  479
            EKR++YDR G    +     GGG G G + +DIFS F   FGG
Sbjct  61   EKRSMYDRAGHSAFEGGFGGGGGFGGGFSAEDIFSQFGDIFGG  103



>ref|WP_039745016.1| integrase [Geobacter pickeringii]
 gb|AJE04745.1| integrase [Geobacter pickeringii]
Length=296

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 10/97 (10%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A K YY++L + KGASED+IK+AYRKLALKYHPD NPGN+EA  +F EIN AY VLSD 
Sbjct  1    MAQKDYYEVLGIKKGASEDEIKKAYRKLALKYHPDKNPGNKEAEDRFKEINEAYAVLSDA  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF  470
            +KR  YD++G  G  Q  +           +DIF  F
Sbjct  61   QKRAQYDQFGSSGFHQRYSQ----------EDIFRGF  87



>ref|WP_005219116.1| chaperone dnaJ [Acinetobacter sp. ANC 3862]
 gb|ENW98328.1| chaperone dnaJ [Acinetobacter sp. ANC 3862]
Length=372

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E   AYEVLSDG
Sbjct  1    MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEAAEAYEVLSDG  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF---FGG  479
            EKR++YDR G    +     GGG G G + +DIFS F   FGG
Sbjct  61   EKRSMYDRAGHSAFEGGFGGGGGFGGGFSAEDIFSQFGDIFGG  103



>gb|EKV05021.1| hypothetical protein PDIP_85130 [Penicillium digitatum Pd1]
 gb|EKV13467.1| hypothetical protein PDIG_38490 [Penicillium digitatum PHI26]
Length=421

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            + IAA+ YY +L + K ASE  IKRAYR L+ KYHPD NPG++ A +KF EI +AY+VLS
Sbjct  18   VVIAAEDYYKVLGIAKSASEKDIKRAYRTLSKKYHPDKNPGDDSAREKFVEIADAYDVLS  77

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
                R +YD+YG +G++QH   G   G G +  D+FS FF
Sbjct  78   SSTLRKVYDQYGHDGVEQH-RKGEAAGGGHDPFDLFSRFF  116



>ref|XP_004546886.1| PREDICTED: dnaJ homolog subfamily B member 6-B-like isoform X2 
[Maylandia zebra]
Length=245

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 8/105 (8%)
 Frame = +3

Query  189  KSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEK  365
            + YY IL V K A+++ IK+AYRKLALK+HPD NP N +EA K+F E++ AYEVLSD  K
Sbjct  2    EDYYHILGVEKNATQEDIKKAYRKLALKWHPDKNPENKDEAEKRFKELSEAYEVLSDESK  61

Query  366  RNIYDRYGEEGLK-------QHAASGGGRGAGMNIQDIFSSFFGG  479
            RN+YDRYG+EGL         H    G      N  D+F  FFGG
Sbjct  62   RNVYDRYGKEGLSGGGGGGGGHYDHFGSSFTFRNPDDVFREFFGG  106



>ref|XP_006795119.1| PREDICTED: dnaJ homolog subfamily B member 6-B-like isoform X3 
[Neolamprologus brichardi]
Length=248

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = +3

Query  195  YYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGN-EEANKKFAEINNAYEVLSDGEKRN  371
            YY IL V K A+++ IK+AYRKLALK+HPD NP N +EA K+F E++ AYEVLSD  KRN
Sbjct  4    YYQILGVQKNATQEDIKKAYRKLALKWHPDKNPDNKDEAEKRFKELSEAYEVLSDESKRN  63

Query  372  IYDRYGEEGLK---------QHAASGGGRGAGMNIQDIFSSFFGG  479
            +YDRYG+EGL           H    G      N  D+F  FFGG
Sbjct  64   VYDRYGKEGLSGGGGGGGGGGHYDHFGSSFTFRNPDDVFREFFGG  108



>gb|AIG55894.1| secreted protein [Achlya hypogyna]
Length=371

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = +3

Query  183  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGE  362
            A +  Y++L + + AS  +IK+A+RKL+LK HPD NPG+E+A KKF+E+ +AYEVLSD E
Sbjct  24   AGRDLYEVLGISRDASSPEIKKAFRKLSLKLHPDKNPGDEDAAKKFSEVASAYEVLSDAE  83

Query  363  KRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFFGGG  482
            KR  YD YGE+GLK++     G G G +  DIFS FFGGG
Sbjct  84   KRKKYDMYGEDGLKENGGG--GGGGGHDPFDIFSQFFGGG  121



>gb|EMD95008.1| hypothetical protein COCHEDRAFT_1191762 [Bipolaris maydis C5]
 gb|ENI01703.1| hypothetical protein COCC4DRAFT_43190 [Bipolaris maydis ATCC 
48331]
Length=420

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +3

Query  174  IAIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLS  353
            + + A+ YY +L + K ASE QIK+AYR L+ K+HPD NPGNE+AN+KF EI  AYEVL 
Sbjct  17   LVVGAEDYYKLLGLEKDASERQIKKAYRNLSKKFHPDKNPGNEQANQKFVEIAEAYEVLI  76

Query  354  DGEKRNIYDRYGEEGLKQHAASGGGR  431
            + E R IYD+YG EG++QH   GG R
Sbjct  77   EKETRKIYDQYGHEGIQQHKQGGGPR  102



>ref|XP_003066224.1| DnaJ domain containing protein [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER24079.1| DnaJ domain containing protein [Coccidioides posadasii C735 delta 
SOWgp]
Length=413

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = +3

Query  183  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGE  362
             A+ YY +L + K ASE  IKRAYR L+ KYHPD NPG+E A++KF +I  AY+VLS   
Sbjct  22   CAEDYYKVLGIDKSASERDIKRAYRTLSKKYHPDKNPGDESAHQKFVDIAEAYDVLSTAS  81

Query  363  KRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
             R IYD+YG EGLKQH   GG      +  D+FS FF
Sbjct  82   TRKIYDKYGHEGLKQHKEGGG--APTHDPFDLFSRFF  116



>gb|EFW15653.1| DnaJ domain-containing protein [Coccidioides posadasii str. Silveira]
Length=413

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = +3

Query  183  AAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDGE  362
             A+ YY +L + K ASE  IKRAYR L+ KYHPD NPG+E A++KF +I  AY+VLS   
Sbjct  22   CAEDYYKVLGIDKSASERDIKRAYRTLSKKYHPDKNPGDESAHQKFVDIAEAYDVLSTAS  81

Query  363  KRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
             R IYD+YG EGLKQH   GG      +  D+FS FF
Sbjct  82   TRKIYDKYGHEGLKQHKEGGG--APTHDPFDLFSRFF  116



>gb|ETL29097.1| chaperone DnaJ [Phytophthora parasitica]
 gb|ETL82321.1| chaperone DnaJ [Phytophthora parasitica]
Length=368

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 5/99 (5%)
 Frame = +3

Query  177  AIAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSD  356
            ++A K YY++L V + AS  +IKRA+RKL+LK+HPD NPG+E A KKFAE+ +AY+VLSD
Sbjct  20   SVAGKDYYEVLGVSRDASSAEIKRAFRKLSLKHHPDKNPGDENAAKKFAEVASAYDVLSD  79

Query  357  GEKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSFF  473
             EK++ YDRYGEEGL     +  G G G +  DIFS FF
Sbjct  80   EEKKSKYDRYGEEGL-----NNAGGGGGHDPFDIFSQFF  113



>gb|EXW32965.1| dnaJ domain protein, partial [Acinetobacter baumannii 44327_6]
Length=137

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  180  IAAKSYYDILQVPKGASEDQIKRAYRKLALKYHPDMNPGNEEANKKFAEINNAYEVLSDG  359
            +A + YY++L V K AS+D+IK+AYRKLA+KYHPD NP N EA +KF E + AYE+LSD 
Sbjct  1    MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNAEAEEKFKEASEAYEILSDS  60

Query  360  EKRNIYDRYGEEGLKQHAASGGGRGAGMNIQDIFSSF  470
            EKR++YDR G    +      GG   G + +DIFS F
Sbjct  61   EKRSMYDRMGHNAFEGGFGGAGGGFGGFSAEDIFSQF  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115