BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H20

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009804525.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-65   Nicotiana sylvestris
ref|XP_009612069.1|  PREDICTED: serine/threonine-protein phosphat...    210   2e-64   Nicotiana tomentosiformis
gb|KDO63012.1|  hypothetical protein CISIN_1g016098mg                   207   2e-63   Citrus sinensis [apfelsine]
ref|XP_009612068.1|  PREDICTED: serine/threonine-protein phosphat...    209   3e-63   Nicotiana tomentosiformis
gb|KDO63011.1|  hypothetical protein CISIN_1g016098mg                   207   1e-62   Citrus sinensis [apfelsine]
ref|XP_006445821.1|  hypothetical protein CICLE_v10015516mg             209   2e-62   Citrus clementina [clementine]
ref|XP_006445820.1|  hypothetical protein CICLE_v10015516mg             207   2e-62   Citrus clementina [clementine]
ref|XP_008351677.1|  PREDICTED: serine/threonine-protein phosphat...    205   7e-62   Malus domestica [apple tree]
gb|AFK46352.1|  unknown                                                 205   8e-62   Lotus japonicus
ref|XP_002285694.1|  PREDICTED: serine/threonine-protein phosphat...    204   2e-61   Vitis vinifera
ref|XP_009413315.1|  PREDICTED: serine/threonine-protein phosphat...    204   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417153.1|  PREDICTED: serine/threonine-protein phosphat...    204   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004294990.1|  PREDICTED: serine/threonine-protein phosphat...    202   8e-61   Fragaria vesca subsp. vesca
ref|XP_003524949.1|  PREDICTED: serine/threonine-protein phosphat...    202   8e-61   Glycine max [soybeans]
ref|XP_008449804.1|  PREDICTED: serine/threonine-protein phosphat...    202   8e-61   Cucumis melo [Oriental melon]
ref|XP_007159403.1|  hypothetical protein PHAVU_002G235400g             202   8e-61   Phaseolus vulgaris [French bean]
gb|KJB53655.1|  hypothetical protein B456_009G000500                    199   2e-60   Gossypium raimondii
gb|KJB21840.1|  hypothetical protein B456_004G017300                    198   3e-60   Gossypium raimondii
ref|XP_002304866.1|  type 2A protein phosphatase-3                      201   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_009397685.1|  PREDICTED: serine/threonine-protein phosphat...    201   3e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010044955.1|  PREDICTED: serine/threonine-protein phosphat...    201   3e-60   
gb|KJB21841.1|  hypothetical protein B456_004G017300                    198   5e-60   Gossypium raimondii
gb|KJB21842.1|  hypothetical protein B456_004G017300                    199   5e-60   Gossypium raimondii
ref|XP_008796687.1|  PREDICTED: serine/threonine-protein phosphat...    201   5e-60   Phoenix dactylifera
ref|XP_002299121.1|  type 2A protein phosphatase-3                      200   5e-60   Populus trichocarpa [western balsam poplar]
ref|XP_011025169.1|  PREDICTED: serine/threonine-protein phosphat...    200   7e-60   Populus euphratica
ref|XP_004168224.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    200   8e-60   
gb|KDP26943.1|  hypothetical protein JCGZ_21036                         200   8e-60   Jatropha curcas
ref|XP_009398410.1|  PREDICTED: serine/threonine-protein phosphat...    200   8e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004142163.1|  PREDICTED: serine/threonine-protein phosphat...    200   9e-60   Cucumis sativus [cucumbers]
ref|XP_008789091.1|  PREDICTED: serine/threonine-protein phosphat...    199   1e-59   Phoenix dactylifera
ref|XP_010934485.1|  PREDICTED: serine/threonine-protein phosphat...    199   1e-59   
gb|KJB53653.1|  hypothetical protein B456_009G000500                    199   2e-59   Gossypium raimondii
ref|XP_011048241.1|  PREDICTED: serine/threonine-protein phosphat...    199   2e-59   Populus euphratica
ref|XP_007205603.1|  hypothetical protein PRUPE_ppa009000mg             198   3e-59   Prunus persica
gb|KJB21838.1|  hypothetical protein B456_004G017300                    198   3e-59   Gossypium raimondii
gb|EPS72615.1|  serine/threonine-protein phosphatase                    195   4e-59   Genlisea aurea
ref|XP_006842771.1|  hypothetical protein AMTR_s00133p00104740          197   7e-59   Amborella trichopoda
ref|XP_009389048.1|  PREDICTED: serine/threonine-protein phosphat...    197   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAQ67230.1|  protein phosphatase 2A catalytic subunit                191   1e-58   Nicotiana benthamiana
ref|XP_011086859.1|  PREDICTED: serine/threonine-protein phosphat...    197   1e-58   Sesamum indicum [beniseed]
gb|AAQ67229.1|  protein phosphatase 2A catalytic subunit                190   2e-58   Nicotiana benthamiana
ref|XP_002270378.1|  PREDICTED: serine/threonine-protein phosphat...    197   2e-58   Vitis vinifera
emb|CDP17353.1|  unnamed protein product                                197   2e-58   Coffea canephora [robusta coffee]
ref|XP_004504333.1|  PREDICTED: serine/threonine-protein phosphat...    196   2e-58   Cicer arietinum [garbanzo]
ref|XP_010923345.1|  PREDICTED: serine/threonine-protein phosphat...    196   2e-58   Elaeis guineensis
ref|XP_003629703.1|  Serine/threonine protein phosphatase               196   2e-58   Medicago truncatula
ref|XP_010673507.1|  PREDICTED: serine/threonine-protein phosphat...    196   3e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011093402.1|  PREDICTED: serine/threonine-protein phosphat...    196   4e-58   Sesamum indicum [beniseed]
emb|CDX67748.1|  BnaA07g17880D                                          191   4e-58   
ref|XP_008813487.1|  PREDICTED: serine/threonine-protein phosphat...    191   5e-58   Phoenix dactylifera
emb|CBI32153.3|  unnamed protein product                                195   5e-58   Vitis vinifera
ref|XP_006354151.1|  PREDICTED: serine/threonine-protein phosphat...    194   1e-57   Solanum tuberosum [potatoes]
ref|XP_010257587.1|  PREDICTED: serine/threonine-protein phosphat...    194   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_004228641.1|  PREDICTED: serine/threonine-protein phosphat...    194   1e-57   
ref|XP_008344682.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   2e-57   
ref|XP_008798733.1|  PREDICTED: serine/threonine-protein phosphat...    194   2e-57   Phoenix dactylifera
ref|XP_009603918.1|  PREDICTED: serine/threonine-protein phosphat...    194   2e-57   Nicotiana tomentosiformis
ref|XP_009620868.1|  PREDICTED: serine/threonine-protein phosphat...    193   4e-57   Nicotiana tomentosiformis
ref|XP_011087915.1|  PREDICTED: serine/threonine-protein phosphat...    193   4e-57   Sesamum indicum [beniseed]
ref|XP_003533904.1|  PREDICTED: serine/threonine-protein phosphat...    192   6e-57   Glycine max [soybeans]
gb|ACU23691.1|  unknown                                                 192   6e-57   Glycine max [soybeans]
gb|AFW67295.1|  putative serine/threonine protein phosphatase sup...    186   7e-57   
gb|ACO57639.1|  protein phosphatase 2A catalytic subunit                192   9e-57   Castanea mollissima
ref|XP_009757229.1|  PREDICTED: serine/threonine-protein phosphat...    192   1e-56   Nicotiana sylvestris
gb|AID52922.1|  serine/threonine-protein phosphatase PP2A catalyt...    191   1e-56   Carthamus tinctorius
ref|XP_009782045.1|  PREDICTED: serine/threonine-protein phosphat...    191   3e-56   Nicotiana sylvestris
ref|XP_004229332.1|  PREDICTED: serine/threonine-protein phosphat...    191   3e-56   Solanum lycopersicum
ref|NP_001150187.1|  PP2Ac-2 - Phosphatase 2A isoform 2 belonging...    188   3e-56   
pir||T45670  phosphoprotein phosphatase (EC 3.1.3.16) 2A-4 (versi...    190   3e-56
emb|CDP07661.1|  unnamed protein product                                191   4e-56   Coffea canephora [robusta coffee]
gb|EYU27166.1|  hypothetical protein MIMGU_mgv1a010409mg                190   4e-56   Erythranthe guttata [common monkey flower]
gb|KHN00026.1|  Serine/threonine-protein phosphatase PP2A-3 catal...    190   5e-56   Glycine soja [wild soybean]
ref|XP_010907340.1|  PREDICTED: serine/threonine-protein phosphat...    190   5e-56   Elaeis guineensis
ref|XP_003519014.1|  PREDICTED: serine/threonine-protein phosphat...    190   5e-56   Glycine max [soybeans]
gb|EPS68420.1|  serine/threonine-protein phosphatase                    190   6e-56   Genlisea aurea
ref|XP_009142847.1|  PREDICTED: serine/threonine-protein phosphat...    190   7e-56   Brassica rapa
ref|NP_567066.1|  serine/threonine-protein phosphatase PP2A-3 cat...    190   8e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KJB83434.1|  hypothetical protein B456_013G247500                    188   8e-56   Gossypium raimondii
gb|ABK24697.1|  unknown                                                 189   9e-56   Picea sitchensis
ref|XP_009104146.1|  PREDICTED: serine/threonine-protein phosphat...    189   1e-55   Brassica rapa
ref|XP_010101089.1|  Serine/threonine-protein phosphatase PP2A-3 ...    191   1e-55   
ref|XP_009142071.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-55   Brassica rapa
ref|XP_008813485.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-55   Phoenix dactylifera
gb|KCW48137.1|  hypothetical protein EUGRSUZ_K01869                     187   2e-55   Eucalyptus grandis [rose gum]
ref|XP_011089122.1|  PREDICTED: serine/threonine-protein phosphat...    189   2e-55   Sesamum indicum [beniseed]
gb|KFK35108.1|  hypothetical protein AALP_AA5G237100                    188   2e-55   Arabis alpina [alpine rockcress]
emb|CDX98300.1|  BnaC06g16610D                                          188   3e-55   
emb|CDY14840.1|  BnaC04g48370D                                          188   3e-55   Brassica napus [oilseed rape]
sp|O04860.1|PP2A5_TOBAC  RecName: Full=Serine/threonine-protein p...    188   3e-55   Nicotiana tabacum [American tobacco]
ref|NP_565974.1|  serine/threonine-protein phosphatase PP2A-3 cat...    188   3e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDY00569.1|  BnaC04g23560D                                          188   4e-55   
ref|XP_009138958.1|  PREDICTED: serine/threonine-protein phosphat...    188   4e-55   Brassica rapa
gb|KJB83435.1|  hypothetical protein B456_013G247500                    188   4e-55   Gossypium raimondii
ref|XP_007145715.1|  hypothetical protein PHAVU_007G262200g             188   4e-55   Phaseolus vulgaris [French bean]
ref|XP_006402781.1|  hypothetical protein EUTSA_v10006109mg             187   4e-55   Eutrema salsugineum [saltwater cress]
sp|P23778.2|PP2A_BRANA  RecName: Full=Serine/threonine-protein ph...    187   5e-55   Brassica napus [oilseed rape]
prf||1702228B  protein phosphatase 2A                                   187   6e-55
gb|AAD10854.1|  serine/threonine protein phosphatase 2A-3 catalyt...    188   7e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007163032.1|  hypothetical protein PHAVU_001G200300g             187   8e-55   Phaseolus vulgaris [French bean]
emb|CDY66916.1|  BnaC03g72670D                                          187   8e-55   Brassica napus [oilseed rape]
ref|XP_010036522.1|  PREDICTED: serine/threonine-protein phosphat...    187   9e-55   Eucalyptus grandis [rose gum]
emb|CDY69521.1|  BnaCnng63970D                                          187   1e-54   Brassica napus [oilseed rape]
ref|XP_010550105.1|  PREDICTED: serine/threonine-protein phosphat...    187   1e-54   Tarenaya hassleriana [spider flower]
ref|XP_010506078.1|  PREDICTED: serine/threonine-protein phosphat...    187   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_004303366.1|  PREDICTED: serine/threonine-protein phosphat...    187   1e-54   Fragaria vesca subsp. vesca
ref|XP_006411507.1|  hypothetical protein EUTSA_v10016971mg             186   1e-54   Eutrema salsugineum [saltwater cress]
ref|NP_001148686.1|  LOC100282302                                       186   1e-54   Zea mays [maize]
ref|NP_001167654.1|  putative serine/threonine protein phosphatas...    186   1e-54   Zea mays [maize]
ref|XP_004494304.1|  PREDICTED: serine/threonine-protein phosphat...    186   2e-54   Cicer arietinum [garbanzo]
ref|XP_003554484.1|  PREDICTED: serine/threonine-protein phosphat...    186   2e-54   Glycine max [soybeans]
tpg|DAA43580.1|  TPA: putative serine/threonine protein phosphata...    181   2e-54   
ref|XP_003564197.1|  PREDICTED: serine/threonine-protein phosphat...    186   2e-54   Brachypodium distachyon [annual false brome]
ref|XP_006650755.1|  PREDICTED: serine/threonine-protein phosphat...    186   2e-54   Oryza brachyantha
gb|EAY92250.1|  hypothetical protein OsI_13970                          185   3e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_010524038.1|  PREDICTED: serine/threonine-protein phosphat...    186   3e-54   Tarenaya hassleriana [spider flower]
ref|XP_008370945.1|  PREDICTED: serine/threonine-protein phosphat...    186   3e-54   Malus domestica [apple tree]
ref|XP_004144671.1|  PREDICTED: serine/threonine-protein phosphat...    186   3e-54   Cucumis sativus [cucumbers]
ref|XP_008442200.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-54   Cucumis melo [Oriental melon]
ref|NP_001051627.1|  Os03g0805300                                       185   4e-54   
ref|XP_007029090.1|  Phosphatase 2A-4                                   185   4e-54   Theobroma cacao [chocolate]
dbj|BAJ93161.1|  predicted protein                                      185   4e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG38746.1|  PP2Ac-2 - Phosphatase 2A isoform 2 belonging to f...    185   5e-54   Zea mays [maize]
gb|KDO70825.1|  hypothetical protein CISIN_1g021077mg                   182   5e-54   Citrus sinensis [apfelsine]
ref|XP_008387207.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-53   Malus domestica [apple tree]
ref|XP_004981369.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-53   Setaria italica
gb|KJB16487.1|  hypothetical protein B456_002G232300                    182   1e-53   Gossypium raimondii
ref|XP_002531165.1|  protein phsophatase-2a, putative                   184   1e-53   Ricinus communis
dbj|BAA92699.1|  type 2A protein phosphatase-3                          184   1e-53   Vicia faba [broad bean]
ref|XP_003638109.1|  Serine/threonine protein phosphatase               184   2e-53   
gb|KJB61941.1|  hypothetical protein B456_009G392700                    183   2e-53   Gossypium raimondii
ref|XP_003558732.1|  PREDICTED: serine/threonine-protein phosphat...    183   2e-53   Brachypodium distachyon [annual false brome]
gb|KDP21900.1|  hypothetical protein JCGZ_03038                         183   3e-53   Jatropha curcas
gb|KDO70826.1|  hypothetical protein CISIN_1g021077mg                   181   3e-53   Citrus sinensis [apfelsine]
ref|XP_009133540.1|  PREDICTED: serine/threonine-protein phosphat...    183   3e-53   Brassica rapa
ref|XP_001766933.1|  predicted protein                                  182   4e-53   
ref|XP_002966246.1|  hypothetical protein SELMODRAFT_270568             182   4e-53   Selaginella moellendorffii
ref|XP_006364157.1|  PREDICTED: serine/threonine-protein phosphat...    182   4e-53   Solanum tuberosum [potatoes]
gb|KDO70823.1|  hypothetical protein CISIN_1g021077mg                   181   4e-53   Citrus sinensis [apfelsine]
ref|XP_002309283.1|  hypothetical protein POPTR_0006s21080g             182   5e-53   Populus trichocarpa [western balsam poplar]
gb|KJB16486.1|  hypothetical protein B456_002G232300                    182   7e-53   Gossypium raimondii
ref|XP_001766934.1|  predicted protein                                  182   7e-53   
ref|XP_003521515.1|  PREDICTED: serine/threonine-protein phosphat...    182   8e-53   Glycine max [soybeans]
ref|XP_001766048.1|  predicted protein                                  181   1e-52   
ref|XP_011039506.1|  PREDICTED: serine/threonine-protein phosphat...    181   1e-52   Populus euphratica
ref|XP_004228954.1|  PREDICTED: serine/threonine-protein phosphat...    181   2e-52   Solanum lycopersicum
ref|XP_002322743.1|  hypothetical protein POPTR_0016s06190g             181   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_006429942.1|  hypothetical protein CICLE_v10012259mg             181   2e-52   
ref|XP_002465801.1|  hypothetical protein SORBIDRAFT_01g046020          181   2e-52   
ref|XP_008241162.1|  PREDICTED: serine/threonine-protein phosphat...    181   2e-52   Prunus mume [ume]
emb|CAA07471.1|  PP2A1 protein                                          181   2e-52   Catharanthus roseus [chatas]
ref|XP_006429941.1|  hypothetical protein CICLE_v10012259mg             181   2e-52   Citrus clementina [clementine]
ref|NP_001130096.1|  uncharacterized protein LOC100191189               181   2e-52   Zea mays [maize]
ref|XP_007202275.1|  hypothetical protein PRUPE_ppa008946mg             181   2e-52   Prunus persica
ref|NP_001149212.1|  PP2Ac-5 - Phosphatase 2A isoform 5 belonging...    181   3e-52   Zea mays [maize]
gb|ACG34764.1|  PP2Ac-5 - Phosphatase 2A isoform 5 belonging to f...    180   4e-52   Zea mays [maize]
ref|XP_004985576.1|  PREDICTED: serine/threonine-protein phosphat...    180   4e-52   Setaria italica
ref|XP_003578345.1|  PREDICTED: serine/threonine-protein phosphat...    180   5e-52   Brachypodium distachyon [annual false brome]
gb|ABO16371.1|  serine/threonine-protein phosphatase PP2A-1 catal...    179   7e-52   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001049084.1|  Os03g0167700                                       179   1e-51   
ref|NP_001189732.1|  serine/threonine-protein phosphatase PP2A-3 ...    174   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649459.1|  PREDICTED: serine/threonine-protein phosphat...    179   1e-51   Oryza brachyantha
gb|EMT31063.1|  Serine/threonine-protein phosphatase PP2A-4 catal...    179   1e-51   
gb|KCW52394.1|  hypothetical protein EUGRSUZ_J01802                     176   1e-51   Eucalyptus grandis [rose gum]
gb|EMS59938.1|  Serine/threonine-protein phosphatase PP2A-4 catal...    180   1e-51   Triticum urartu
gb|KCW52395.1|  hypothetical protein EUGRSUZ_J01802                     177   1e-51   Eucalyptus grandis [rose gum]
gb|EMS47396.1|  Serine/threonine-protein phosphatase PP2A-2 catal...    176   4e-51   Triticum urartu
ref|XP_004983161.1|  PREDICTED: putative serine/threonine-protein...    177   4e-51   Setaria italica
ref|XP_010032900.1|  PREDICTED: serine/threonine-protein phosphat...    176   1e-50   Eucalyptus grandis [rose gum]
sp|P0C5D7.1|PP2A4_ORYSI  RecName: Full=Putative serine/threonine-...    176   1e-50   Oryza sativa Indica Group [Indian rice]
ref|NP_001064578.1|  Os10g0410600                                       176   1e-50   
ref|XP_006661767.1|  PREDICTED: serine/threonine-protein phosphat...    176   2e-50   Oryza brachyantha
ref|XP_002467261.1|  hypothetical protein SORBIDRAFT_01g022230          176   2e-50   Sorghum bicolor [broomcorn]
gb|KDO70820.1|  hypothetical protein CISIN_1g021077mg                   175   5e-50   Citrus sinensis [apfelsine]
ref|NP_001150190.1|  PP2Ac-4 - Phosphatase 2A isoform 4 belonging...    174   9e-50   Zea mays [maize]
gb|KHG30742.1|  Serine/threonine-protein phosphatase PP2A-4 catal...    175   1e-49   Gossypium arboreum [tree cotton]
gb|AAQ67227.1|  protein phosphatase 2A catalytic subunit                167   1e-49   Nicotiana benthamiana
ref|XP_009794958.1|  PREDICTED: serine/threonine-protein phosphat...    167   2e-49   Nicotiana sylvestris
ref|XP_010524846.1|  PREDICTED: serine/threonine-protein phosphat...    172   3e-49   Tarenaya hassleriana [spider flower]
gb|ACT53402.1|  protein phosphatase 2Ac                                 171   5e-49   Brassica juncea [brown mustard]
gb|EPS58516.1|  serine/threonine-protein phosphatase                    163   6e-48   Genlisea aurea
ref|XP_775087.1|  hypothetical protein CNBE3610                         169   9e-48   Cryptococcus neoformans var. neoformans B-3501A
ref|XP_570929.1|  protein phosphatase type 2A                           169   9e-48   Cryptococcus neoformans var. neoformans JEC21
gb|KHG29677.1|  Serine/threonine-protein phosphatase PP2A catalyt...    167   1e-47   Gossypium arboreum [tree cotton]
gb|EYU28672.1|  hypothetical protein MIMGU_mgv1a0106401mg               162   1e-47   Erythranthe guttata [common monkey flower]
ref|XP_006439708.1|  hypothetical protein CICLE_v100212822mg            164   2e-47   
ref|XP_003194363.1|  serine/threonine protein phosphatase 2A, cat...    167   3e-47   Cryptococcus gattii WM276
gb|KIR84922.1|  serine/threonine-protein phosphatase PP2A catalyt...    167   3e-47   Cryptococcus gattii VGIV IND107
gb|KDO69851.1|  hypothetical protein CISIN_1g021898mg                   163   4e-47   Citrus sinensis [apfelsine]
ref|XP_009617643.1|  PREDICTED: serine/threonine-protein phosphat...    166   8e-47   Nicotiana tomentosiformis
gb|KJB39864.1|  hypothetical protein B456_007G034300                    164   1e-46   Gossypium raimondii
gb|AAQ67228.1|  protein phosphatase 2A catalytic subunit                158   2e-46   Nicotiana benthamiana
gb|KJB39865.1|  hypothetical protein B456_007G034300                    165   3e-46   Gossypium raimondii
gb|AAL84295.1|AC073556_12  serine/threonine protein phosphatase P...    166   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|KDP31176.1|  hypothetical protein JCGZ_11552                         164   4e-46   Jatropha curcas
ref|XP_011086438.1|  PREDICTED: serine/threonine-protein phosphat...    164   4e-46   Sesamum indicum [beniseed]
gb|KDO69850.1|  hypothetical protein CISIN_1g021898mg                   163   4e-46   Citrus sinensis [apfelsine]
gb|KJB39863.1|  hypothetical protein B456_007G034300                    164   4e-46   Gossypium raimondii
gb|KHG01412.1|  Serine/threonine-protein phosphatase PP2A catalyt...    164   4e-46   Gossypium arboreum [tree cotton]
gb|KJB14785.1|  hypothetical protein B456_002G142800                    162   5e-46   Gossypium raimondii
dbj|BAO57273.1|  protein phosphatase 2A                                 164   5e-46   Ipomoea nil [qian niu]
ref|XP_007099755.1|  Phosphatase 2A-2 isoform 2                         163   5e-46   
ref|XP_007005885.1|  hypothetical protein TREMEDRAFT_74197              164   7e-46   Tremella mesenterica DSM 1558
ref|XP_011042637.1|  PREDICTED: serine/threonine-protein phosphat...    164   7e-46   Populus euphratica
ref|XP_007099754.1|  Phosphatase 2A-2 isoform 1                         164   7e-46   
gb|EEE58392.1|  hypothetical protein OsJ_09554                          166   8e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002511484.1|  protein phsophatase-2a, putative                   163   9e-46   Ricinus communis
ref|XP_002314628.1|  type 2A protein phosphtase-II                      163   9e-46   
ref|XP_010272152.1|  PREDICTED: serine/threonine-protein phosphat...    163   9e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010548215.1|  PREDICTED: serine/threonine-protein phosphat...    163   1e-45   Tarenaya hassleriana [spider flower]
gb|KFM58898.1|  hypothetical protein X975_00926                         157   1e-45   Stegodyphus mimosarum
gb|ACO09577.1|  Serine/threonine-protein phosphatase 2A catalytic...    157   1e-45   Osmerus mordax
ref|XP_011043021.1|  PREDICTED: serine/threonine-protein phosphat...    163   1e-45   Populus euphratica
ref|XP_011034152.1|  PREDICTED: serine/threonine-protein phosphat...    163   1e-45   Populus euphratica
ref|XP_002980611.1|  hypothetical protein SELMODRAFT_178363             163   1e-45   Selaginella moellendorffii
ref|XP_002976892.1|  hypothetical protein SELMODRAFT_175936             163   1e-45   
ref|XP_002311784.1|  type 2A protein phosphtase-II                      163   1e-45   
ref|XP_009369391.1|  PREDICTED: serine/threonine-protein phosphat...    163   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_008374500.1|  PREDICTED: serine/threonine-protein phosphat...    163   1e-45   Malus domestica [apple tree]
ref|NP_001046300.1|  Os02g0217600                                       163   2e-45   
ref|XP_006476703.1|  PREDICTED: serine/threonine-protein phosphat...    163   2e-45   Citrus sinensis [apfelsine]
gb|KDO69849.1|  hypothetical protein CISIN_1g021898mg                   162   2e-45   Citrus sinensis [apfelsine]
gb|KJB61146.1|  hypothetical protein B456_009G346100                    160   2e-45   Gossypium raimondii
ref|XP_011028671.1|  PREDICTED: serine/threonine-protein phosphat...    162   2e-45   Populus euphratica
ref|XP_002318007.1|  type 2A protein phosphatase-2                      162   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_002321547.1|  type 2A protein phosphatase-2                      162   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_007209386.1|  hypothetical protein PRUPE_ppa009100mg             162   3e-45   Prunus persica
gb|KJB14786.1|  hypothetical protein B456_002G142800                    160   3e-45   Gossypium raimondii
gb|KIZ04641.1|  protein phosphatase 2 (formerly 2A), catalytic su...    166   3e-45   Monoraphidium neglectum
ref|XP_010795259.1|  PREDICTED: serine/threonine-protein phosphat...    156   3e-45   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010683355.1|  PREDICTED: serine/threonine-protein phosphat...    162   3e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010044680.1|  PREDICTED: serine/threonine-protein phosphat...    162   4e-45   Eucalyptus grandis [rose gum]
ref|XP_001430431.1|  hypothetical protein                               158   4e-45   Paramecium tetraurelia strain d4-2
gb|EAW63433.1|  protein phosphatase 2 (formerly 2A), catalytic su...    156   4e-45   Homo sapiens [man]
ref|XP_009623853.1|  PREDICTED: serine/threonine-protein phosphat...    162   4e-45   Nicotiana tomentosiformis
ref|XP_010552612.1|  PREDICTED: serine/threonine-protein phosphat...    161   5e-45   Tarenaya hassleriana [spider flower]
ref|XP_010532914.1|  PREDICTED: serine/threonine-protein phosphat...    161   5e-45   Tarenaya hassleriana [spider flower]
ref|XP_010087741.1|  Serine/threonine-protein phosphatase PP2A ca...    161   6e-45   Morus notabilis
ref|XP_006843155.1|  hypothetical protein AMTR_s00146p00037590          161   6e-45   Amborella trichopoda
ref|XP_002888746.1|  hypothetical protein ARALYDRAFT_476122             161   6e-45   
ref|XP_010418840.1|  PREDICTED: serine/threonine-protein phosphat...    160   6e-45   
gb|KJB77098.1|  hypothetical protein B456_012G120200                    161   6e-45   Gossypium raimondii
ref|XP_006302599.1|  hypothetical protein CARUB_v10020704mg             161   6e-45   Capsella rubella
ref|XP_010255666.1|  PREDICTED: serine/threonine-protein phosphat...    161   7e-45   Nelumbo nucifera [Indian lotus]
gb|KDO82671.1|  hypothetical protein CISIN_1g021866mg                   160   7e-45   Citrus sinensis [apfelsine]
gb|AJC01347.1|  serine/threonine-protein phosphatase                    161   7e-45   Myrciaria dubia [camu-camu]
ref|XP_010511000.1|  PREDICTED: serine/threonine-protein phosphat...    161   8e-45   Camelina sativa [gold-of-pleasure]
emb|CDP00244.1|  unnamed protein product                                161   8e-45   Coffea canephora [robusta coffee]
ref|XP_010551478.1|  PREDICTED: serine/threonine-protein phosphat...    161   8e-45   Tarenaya hassleriana [spider flower]
gb|AAA91806.1|  protein phosphatase 2A                                  161   9e-45   Oryza sativa Indica Group [Indian rice]
gb|ABK22353.1|  unknown                                                 160   9e-45   Picea sitchensis
ref|XP_006357225.1|  PREDICTED: serine/threonine-protein phosphat...    160   9e-45   Solanum tuberosum [potatoes]
ref|XP_010043842.1|  PREDICTED: serine/threonine-protein phosphat...    160   9e-45   Eucalyptus grandis [rose gum]
ref|XP_009799076.1|  PREDICTED: serine/threonine-protein phosphat...    160   1e-44   Nicotiana sylvestris
gb|KHG03103.1|  Serine/threonine-protein phosphatase PP2A catalyt...    160   1e-44   Gossypium arboreum [tree cotton]
ref|XP_004299619.1|  PREDICTED: serine/threonine-protein phosphat...    160   1e-44   Fragaria vesca subsp. vesca
gb|KJB14787.1|  hypothetical protein B456_002G142800                    160   1e-44   Gossypium raimondii
ref|XP_007044439.1|  Phosphatase 2A-2                                   160   1e-44   Theobroma cacao [chocolate]
ref|NP_001233804.1|  protein phosphatase 2A catalytic subunit           160   1e-44   Solanum lycopersicum
ref|XP_004146760.1|  PREDICTED: serine/threonine-protein phosphat...    160   1e-44   Cucumis sativus [cucumbers]
ref|XP_003532043.1|  PREDICTED: serine/threonine-protein phosphat...    160   1e-44   
ref|XP_010470181.1|  PREDICTED: serine/threonine-protein phosphat...    160   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006417465.1|  hypothetical protein EUTSA_v10008290mg             160   2e-44   Eutrema salsugineum [saltwater cress]
ref|XP_006302601.1|  hypothetical protein CARUB_v10020707mg             160   2e-44   Capsella rubella
gb|KDP21266.1|  hypothetical protein JCGZ_21737                         160   2e-44   Jatropha curcas
ref|XP_002892571.1|  protein phosphatase 2a-2                           160   2e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_006483298.1|  PREDICTED: serine/threonine-protein phosphat...    160   2e-44   Citrus sinensis [apfelsine]
ref|XP_010491190.1|  PREDICTED: serine/threonine-protein phosphat...    160   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_005649021.1|  Metallo-dependent phosphatase                      160   2e-44   Coccomyxa subellipsoidea C-169
ref|NP_172514.1|  protein phosphatase 2A-2                              160   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351820.1|  PREDICTED: serine/threonine-protein phosphat...    160   2e-44   
gb|EJY75821.1|  Serine/threonine-protein phosphatase 2A catalytic...    160   2e-44   Oxytricha trifallax
ref|XP_002268216.2|  PREDICTED: serine/threonine-protein phosphat...    160   2e-44   Vitis vinifera
gb|KDD76350.1|  calcineurin-like phosphoesterase                        160   2e-44   Helicosporidium sp. ATCC 50920
ref|XP_006390941.1|  hypothetical protein EUTSA_v10018921mg             159   3e-44   Eutrema salsugineum [saltwater cress]
gb|KHN03182.1|  Serine/threonine-protein phosphatase PP2A-2 catal...    159   3e-44   Glycine soja [wild soybean]
ref|XP_008393084.1|  PREDICTED: serine/threonine-protein phosphat...    159   3e-44   
ref|XP_001448656.1|  hypothetical protein                               160   3e-44   Paramecium tetraurelia strain d4-2
gb|KHG02533.1|  Serine/threonine-protein phosphatase PP2A-2 catal...    159   3e-44   Gossypium arboreum [tree cotton]
emb|CDQ69727.1|  unnamed protein product                                154   3e-44   
gb|EYU22454.1|  hypothetical protein MIMGU_mgv1a010646mg                159   3e-44   
gb|KJB61147.1|  hypothetical protein B456_009G346100                    159   3e-44   
ref|XP_009113275.1|  PREDICTED: serine/threonine-protein phosphat...    159   3e-44   
gb|KHG16162.1|  Serine/threonine-protein phosphatase PP2A-2 catal...    159   3e-44   
ref|XP_008446281.1|  PREDICTED: serine/threonine-protein phosphat...    159   3e-44   
ref|XP_003551996.1|  PREDICTED: serine/threonine-protein phosphat...    159   3e-44   
ref|NP_001141022.1|  putative serine/threonine protein phosphatas...    159   3e-44   
gb|ACG37926.1|  PP2Ac-1 - Phosphatase 2A isoform 1 belonging to f...    159   3e-44   
emb|CDX93426.1|  BnaA06g06220D                                          159   3e-44   
gb|EIE91508.1|  serine/threonine-protein phosphatase PP2A catalyt...    159   4e-44   
ref|NP_974050.1|  serine/threonine-protein phosphatase PP2A-1 cat...    158   5e-44   
ref|XP_004135212.1|  PREDICTED: serine/threonine-protein phosphat...    159   5e-44   
gb|KJB61148.1|  hypothetical protein B456_009G346100                    159   5e-44   
emb|CDY37977.1|  BnaC05g07970D                                          159   5e-44   
gb|KFK40853.1|  hypothetical protein AALP_AA2G049800                    159   5e-44   
gb|KEH27777.1|  serine/threonine protein phosphatase 2A                 156   6e-44   
emb|CDW76188.1|  serine threonine-protein phosphatase 2a catalyti...    160   6e-44   
ref|XP_002911364.1|  serine/threonine protein phosphatase PP2A ca...    159   6e-44   
ref|XP_007869110.1|  serine/threonine specific protein phosphatas...    159   6e-44   
gb|KFK43336.1|  hypothetical protein AALP_AA1G111600                    159   6e-44   
ref|NP_001057926.1|  Os06g0574500                                       159   7e-44   
ref|XP_002886653.1|  hypothetical protein ARALYDRAFT_475327             159   7e-44   
gb|KHN01141.1|  Serine/threonine-protein phosphatase PP2A catalyt...    158   7e-44   
ref|XP_004951436.1|  PREDICTED: serine/threonine-protein phosphat...    158   7e-44   
ref|XP_009799942.1|  PREDICTED: serine/threonine-protein phosphat...    158   7e-44   
ref|XP_009615626.1|  PREDICTED: serine/threonine-protein phosphat...    158   8e-44   
ref|XP_010470997.1|  PREDICTED: serine/threonine-protein phosphat...    158   8e-44   
gb|ACR36870.1|  unknown                                                 155   8e-44   
pdb|4IYP|C  Chain C, Structure Of The Npp2ac-alpha4 Complex             154   9e-44   
ref|XP_010512062.1|  PREDICTED: serine/threonine-protein phosphat...    158   9e-44   
emb|CDY30909.1|  BnaC09g14970D                                          158   9e-44   
ref|XP_002453535.1|  hypothetical protein SORBIDRAFT_04g007570          158   9e-44   
ref|XP_004297688.1|  PREDICTED: serine/threonine-protein phosphat...    158   9e-44   
ref|XP_007153880.1|  hypothetical protein PHAVU_003G072600g             158   1e-43   
ref|NP_001130798.1|  uncharacterized protein LOC100191902               158   1e-43   
ref|XP_006392226.1|  hypothetical protein EUTSA_v10023605mg             158   1e-43   
ref|XP_004966031.1|  PREDICTED: serine/threonine-protein phosphat...    158   1e-43   
ref|XP_003571683.1|  PREDICTED: serine/threonine-protein phosphat...    158   1e-43   
gb|ADQ64556.1|  hypothetical protein                                    154   1e-43   
ref|XP_007383083.1|  serine/threonine specific protein phosphatas...    158   1e-43   
gb|KIL67678.1|  hypothetical protein M378DRAFT_102278                   158   1e-43   
ref|XP_007157552.1|  hypothetical protein PHAVU_002G078800g             158   1e-43   
gb|KIK62970.1|  hypothetical protein GYMLUDRAFT_222705                  158   1e-43   
gb|KFK41421.1|  hypothetical protein AALP_AA2G128600                    158   1e-43   
ref|NP_176192.1|  serine/threonine-protein phosphatase PP2A-1 cat...    158   1e-43   
ref|XP_003519250.1|  PREDICTED: serine/threonine-protein phosphat...    158   1e-43   
ref|XP_002267386.1|  PREDICTED: serine/threonine-protein phosphat...    158   1e-43   
gb|EPY31862.1|  hypothetical protein STCU_03162                         153   1e-43   
ref|XP_011071048.1|  PREDICTED: serine/threonine-protein phosphat...    158   1e-43   
emb|CDY34892.1|  BnaA09g48180D                                          157   2e-43   
ref|XP_009118255.1|  PREDICTED: serine/threonine-protein phosphat...    157   2e-43   
ref|XP_010936554.1|  PREDICTED: serine/threonine-protein phosphat...    157   2e-43   
ref|XP_003633814.1|  PREDICTED: serine/threonine-protein phosphat...    157   2e-43   
gb|ACH46250.1|  putative phosphatase 2A lytic subunit                   154   2e-43   
ref|XP_008221491.1|  PREDICTED: serine/threonine-protein phosphat...    157   2e-43   
ref|XP_007223170.1|  hypothetical protein PRUPE_ppa009114mg             157   2e-43   
gb|ABR18118.1|  unknown                                                 157   2e-43   
gb|KIO34267.1|  hypothetical protein M407DRAFT_13487                    157   2e-43   
ref|XP_007257809.1|  PREDICTED: serine/threonine-protein phosphat...    155   2e-43   
ref|NP_177154.1|  serine/threonine protein phosphatase 2A               157   2e-43   
emb|CAA58573.1|  phosphoprotein phosphatase                             157   2e-43   
gb|AGJ50597.1|  PP2A                                                    157   2e-43   
ref|XP_002477733.1|  serine/threonine protein phosphatase 2A            157   2e-43   
ref|XP_002958867.1|  protein phosphatase 2A catalytic subunit           153   2e-43   
ref|XP_008808922.1|  PREDICTED: serine/threonine-protein phosphat...    157   2e-43   
ref|XP_003517887.1|  PREDICTED: serine/threonine-protein phosphat...    157   3e-43   
ref|XP_001427149.1|  hypothetical protein                               157   3e-43   
ref|XP_003032067.1|  protein phosphatase 2A                             157   3e-43   
gb|EJY78544.1|  Serine/threonine-protein phosphatase 2A catalytic...    157   3e-43   
ref|XP_010915172.1|  PREDICTED: serine/threonine-protein phosphat...    157   3e-43   
gb|KIY43923.1|  Metallo-dependent phosphatase                           157   3e-43   
ref|XP_006438528.1|  hypothetical protein CICLE_v10032215mg             157   3e-43   
ref|XP_007765800.1|  protein phosphatase 2A                             157   3e-43   
gb|KEP45992.1|  serine/threonine-protein phosphatase                    157   4e-43   
gb|EFA78478.1|  protein phosphatase 2A catalytic subunit                157   4e-43   
ref|XP_002472635.1|  serine threonine protein phosphatase 2A            156   4e-43   
ref|XP_961818.2|  serine/threonine-protein phosphatase PP2A catal...    157   4e-43   
gb|EIE89788.1|  serine/threonine-protein phosphatase 2A catalytic...    157   4e-43   
ref|XP_635791.1|  protein phosphatase 2A catalytic subunit              156   4e-43   
gb|KIP08248.1|  hypothetical protein PHLGIDRAFT_88532                   156   4e-43   
gb|KDO63013.1|  hypothetical protein CISIN_1g016098mg                   156   4e-43   
gb|AAC72838.1|  protein phosphatase 2A catalytic subunit                156   4e-43   
ref|XP_011445937.1|  PREDICTED: serine/threonine-protein phosphat...    155   4e-43   
emb|CCX32781.1|  Similar to Serine/threonine-protein phosphatase ...    157   4e-43   
ref|XP_007362612.1|  serine threonine protein phosphatase 2A            156   5e-43   
ref|XP_006363544.1|  PREDICTED: serine/threonine-protein phosphat...    156   5e-43   
ref|XP_010498965.1|  PREDICTED: serine/threonine-protein phosphat...    156   5e-43   
ref|XP_001783244.1|  predicted protein                                  156   5e-43   
gb|KFH64085.1|  serine/threonine-protein phosphatase PP2A catalyt...    156   5e-43   
ref|XP_004277185.1|  PREDICTED: serine/threonine-protein phosphat...    154   5e-43   
ref|XP_010477768.1|  PREDICTED: serine/threonine-protein phosphat...    156   5e-43   
gb|KIJ52556.1|  hypothetical protein M422DRAFT_58693                    156   6e-43   
ref|XP_011395856.1|  Serine/threonine-protein phosphatase PP2A-2 ...    156   6e-43   
ref|XP_007846003.1|  serine threonine-protein phosphatase pp2a ca...    156   6e-43   
ref|XP_007410287.1|  hypothetical protein MELLADRAFT_71938              156   6e-43   
ref|XP_009545536.1|  hypothetical protein HETIRDRAFT_439708             156   6e-43   
gb|KIM33250.1|  hypothetical protein M408DRAFT_151672                   156   6e-43   
ref|XP_010460215.1|  PREDICTED: serine/threonine-protein phosphat...    156   7e-43   
ref|XP_005066558.1|  PREDICTED: serine/threonine-protein phosphat...    155   7e-43   
ref|XP_008793272.1|  PREDICTED: serine/threonine-protein phosphat...    156   7e-43   
ref|XP_007299661.1|  serine/threonine specific protein phosphatas...    156   7e-43   
ref|XP_008039498.1|  serine threonine protein phosphatase 2A            155   7e-43   
ref|XP_008389561.1|  PREDICTED: serine/threonine-protein phosphat...    156   7e-43   
ref|XP_004489948.1|  PREDICTED: serine/threonine-protein phosphat...    156   7e-43   
ref|XP_009148370.1|  PREDICTED: serine/threonine-protein phosphat...    155   8e-43   
gb|ACJ84632.1|  unknown                                                 153   8e-43   
gb|AAC00174.1|  serine-threonine phosphoprotein phosphatase             156   8e-43   
dbj|GAC74885.1|  serine-threonine protein kinase FUSED                  154   8e-43   
ref|XP_001744851.1|  hypothetical protein                               155   8e-43   
ref|XP_011111811.1|  hypothetical protein H072_6008                     156   8e-43   
emb|CDW89994.1|  protein phosphatase 2 (formerly 2a) catalytic al...    156   8e-43   
emb|CDY52461.1|  BnaCnng22530D                                          155   9e-43   
ref|XP_008573329.1|  PREDICTED: serine/threonine-protein phosphat...    154   9e-43   
gb|ETE61972.1|  Serine/threonine-protein phosphatase 2A catalytic...    155   9e-43   
dbj|BAJ95732.1|  predicted protein                                      155   1e-42   
gb|EMT24255.1|  Serine/threonine-protein phosphatase PP2A-3 catal...    155   1e-42   
gb|ESA17989.1|  hypothetical protein GLOINDRAFT_344832                  155   1e-42   
gb|EMD33918.1|  serine/threonine specific protein phosphatase Sit4      155   1e-42   
gb|AAH19161.1|  Ppp2cb protein                                          155   1e-42   
ref|XP_007393725.1|  hypothetical protein PHACADRAFT_171678             155   1e-42   
gb|EPZ36333.1|  Serine/threonine-protein phosphatase PP2A catalyt...    155   1e-42   
emb|CAG12590.1|  unnamed protein product                                155   1e-42   
emb|CAJ81477.1|  novel protein similar to PPP2CB                        153   1e-42   
gb|EPB88713.1|  serine/threonine-protein phosphatase PP2A catalyt...    155   1e-42   
gb|KDQ57121.1|  hypothetical protein JAAARDRAFT_178689                  155   1e-42   
dbj|BAA92697.1|  type 2A protein phosphatase-1                          155   1e-42   
gb|ABE98242.1|  protein phosphatase-2A catalytic subunit-like           155   1e-42   
gb|ELU08354.1|  hypothetical protein CAPTEDRAFT_227677                  155   1e-42   
ref|XP_003613484.1|  Serine/threonine protein phosphatase               155   1e-42   
ref|XP_002128830.1|  PREDICTED: serine/threonine-protein phosphat...    155   1e-42   
ref|XP_006305436.1|  hypothetical protein CARUB_v10009845mg             155   1e-42   
gb|EFB23009.1|  hypothetical protein PANDA_009683                       154   1e-42   
dbj|GAM22091.1|  hypothetical protein SAMD00019534_052660               155   2e-42   
ref|XP_008796690.1|  PREDICTED: serine/threonine-protein phosphat...    154   2e-42   
emb|CCG84297.1|  protein of unknown function                            155   2e-42   
ref|XP_007427938.1|  PREDICTED: serine/threonine-protein phosphat...    155   2e-42   
emb|CDY11632.1|  BnaC06g31070D                                          155   2e-42   
ref|XP_009410769.1|  PREDICTED: serine/threonine-protein phosphat...    154   2e-42   
ref|XP_002437193.1|  hypothetical protein SORBIDRAFT_10g022710          155   2e-42   
sp|Q9ZSE4.1|PP2A_HEVBR  RecName: Full=Serine/threonine-protein ph...    155   2e-42   
ref|XP_006270096.1|  PREDICTED: serine/threonine-protein phosphat...    155   2e-42   
gb|EIE75824.1|  serine/threonine-protein phosphatase PP2A catalyt...    155   2e-42   
gb|EFB24270.1|  hypothetical protein PANDA_000749                       154   2e-42   
gb|KIY67267.1|  protein phosphatase 2A                                  155   2e-42   
gb|ACO10114.1|  Serine/threonine-protein phosphatase 2A catalytic...    155   2e-42   
ref|XP_003327105.2|  serine/threonine-protein phosphatase PP2A ca...    155   2e-42   
gb|EHK98729.1|  putative Serine/threonine-protein phosphatase PP2...    154   2e-42   
gb|ENN77718.1|  hypothetical protein YQE_05789                          155   2e-42   
ref|XP_004855515.1|  PREDICTED: serine/threonine-protein phosphat...    159   2e-42   
gb|KJA26315.1|  hypothetical protein HYPSUDRAFT_84648                   154   2e-42   
ref|XP_004509911.1|  PREDICTED: serine/threonine-protein phosphat...    154   2e-42   
gb|KIK99987.1|  hypothetical protein PAXRUDRAFT_396446                  154   2e-42   
ref|XP_009105672.1|  PREDICTED: serine/threonine-protein phosphat...    154   2e-42   
ref|NP_001140690.1|  putative serine/threonine protein phosphatas...    154   2e-42   
ref|XP_003458480.1|  PREDICTED: serine/threonine-protein phosphat...    154   2e-42   
ref|XP_007318279.1|  hypothetical protein SERLADRAFT_467271             154   2e-42   
ref|XP_011445935.1|  PREDICTED: serine/threonine-protein phosphat...    155   2e-42   
ref|XP_007342998.1|  serine/threonine specific protein phosphatas...    154   2e-42   
ref|XP_005187514.1|  PREDICTED: serine/threonine-protein phosphat...    154   2e-42   
gb|AFK46519.1|  unknown                                                 152   2e-42   
ref|XP_003974579.1|  PREDICTED: serine/threonine-protein phosphat...    154   2e-42   
gb|KIM64365.1|  hypothetical protein SCLCIDRAFT_648195                  154   2e-42   
dbj|GAM16955.1|  hypothetical protein SAMD00019534_001300               154   2e-42   
ref|NP_989274.1|  serine/threonine-protein phosphatase 2A catalyt...    154   2e-42   
ref|XP_006125471.1|  PREDICTED: serine/threonine-protein phosphat...    155   2e-42   
gb|KIM39844.1|  hypothetical protein M413DRAFT_185413                   154   2e-42   
ref|XP_001602506.2|  PREDICTED: serine/threonine-protein phosphat...    154   3e-42   
ref|XP_006034057.1|  PREDICTED: serine/threonine-protein phosphat...    155   3e-42   
ref|XP_001565606.2|  putative serine/threonine protein kinase (fr...    149   3e-42   
gb|AAD01261.1|  serine/threonine phosphatase                            154   3e-42   
ref|XP_004342697.1|  serine/threonine-protein phosphatase 2A cata...    154   3e-42   
ref|XP_006631847.1|  PREDICTED: serine/threonine-protein phosphat...    154   3e-42   
ref|NP_001069325.1|  serine/threonine-protein phosphatase 2A cata...    154   3e-42   
ref|XP_007255313.1|  PREDICTED: serine/threonine-protein phosphat...    154   3e-42   
ref|NP_001187331.1|  serine/threonine-protein phosphatase 2a cata...    154   3e-42   
emb|CAC11129.1|  protein phosphatase 2A                                 154   3e-42   
ref|XP_002841530.1|  hypothetical protein                               154   3e-42   
ref|NP_998458.1|  serine/threonine-protein phosphatase 2A catalyt...    154   3e-42   
ref|XP_008589496.1|  PREDICTED: serine/threonine-protein phosphat...    154   3e-42   
ref|XP_004024154.1|  protein phosphatase 2a catalytic subunit, pu...    154   3e-42   
ref|NP_990455.1|  serine/threonine-protein phosphatase 2A catalyt...    154   3e-42   
pdb|2NYL|C  Chain C, Crystal Structure Of Protein Phosphatase 2a ...    154   3e-42   
ref|XP_003499698.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
ref|XP_005143054.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
ref|XP_002064646.1|  GK23721                                            154   4e-42   
gb|EWC47930.1|  serine phosphatase PP2A catalytic subunit               155   4e-42   
ref|XP_008084272.1|  Metallo-dependent phosphatase                      154   4e-42   
ref|XP_003474926.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    154   4e-42   
pdb|3P71|C  Chain C, Crystal Structure Of The Complex Of Lcmt-1 A...    154   4e-42   
ref|XP_011506056.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
gb|KIK28983.1|  hypothetical protein PISMIDRAFT_561914                  154   4e-42   
ref|XP_002920874.2|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
ref|NP_058736.1|  serine/threonine-protein phosphatase 2A catalyt...    154   4e-42   
ref|XP_008777210.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
ref|XP_006731701.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
ref|XP_002819017.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
ref|XP_007940880.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
gb|AAV38333.1|  protein phosphatase 2 (formerly 2A), catalytic su...    154   4e-42   
ref|NP_001095177.1|  serine/threonine-protein phosphatase 2A cata...    154   4e-42   
ref|XP_007904127.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
ref|XP_007610461.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
dbj|BAG52434.1|  unnamed protein product                                154   4e-42   
ref|XP_008334702.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
ref|XP_004383442.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
ref|XP_006884185.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
ref|XP_001363791.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
gb|EGW07748.1|  Serine/threonine-protein phosphatase 2A catalytic...    154   4e-42   
ref|XP_010887911.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
ref|XP_007532203.1|  PREDICTED: serine/threonine-protein phosphat...    154   4e-42   
gb|KDE04491.1|  serine/threonine-protein phosphatase PP2A catalyt...    154   4e-42   
gb|AAL35904.1|  protein phosphatase type 2A catalytic subunit           154   5e-42   
ref|XP_001879170.1|  serine/threonine specific protein phosphatas...    154   5e-42   
ref|XP_008339966.1|  PREDICTED: serine/threonine-protein phosphat...    154   5e-42   
ref|XP_006459500.1|  serine/threonine specific protein phosphatas...    154   5e-42   
gb|KII85024.1|  hypothetical protein PLICRDRAFT_166486                  154   5e-42   
gb|KIK34641.1|  hypothetical protein CY34DRAFT_625675                   154   5e-42   
gb|KIJ66888.1|  hypothetical protein HYDPIDRAFT_149936                  154   5e-42   
dbj|BAA92698.1|  type 2A protein phosphatase-2                          154   5e-42   
ref|XP_003285474.1|  protein phosphatase 2A catalytic subunit           154   5e-42   
ref|XP_005100173.1|  PREDICTED: serine/threonine-protein phosphat...    154   5e-42   



>ref|XP_009804525.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit isoform X3 [Nicotiana sylvestris]
Length=233

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MD VPSSA+HGNLDEQIAQLMQCKPLSEQEVR LCEKAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MDPVPSSASHGNLDEQIAQLMQCKPLSEQEVRGLCEKAKEILMEESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>ref|XP_009612069.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009804523.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit isoform X2 [Nicotiana sylvestris]
Length=248

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MD VPSSA+HGNLDEQIAQLMQCKPLSEQEVR LCEKAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MDPVPSSASHGNLDEQIAQLMQCKPLSEQEVRGLCEKAKEILMEESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>gb|KDO63012.1| hypothetical protein CISIN_1g016098mg [Citrus sinensis]
Length=260

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 103/105 (98%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+DSVPS++ HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG
Sbjct  2    SLDSVPSNS-HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_009612068.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009804522.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit isoform X1 [Nicotiana sylvestris]
 sp|Q9XGH7.1|PP2A_TOBAC RecName: Full=Serine/threonine-protein phosphatase PP2A catalytic 
subunit [Nicotiana tabacum]
 emb|CAB46506.1| protein phosphatase 2A catalytic subunit [Nicotiana tabacum]
Length=312

 Score =   209 bits (531),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MD VPSSA+HGNLDEQIAQLMQCKPLSEQEVR LCEKAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MDPVPSSASHGNLDEQIAQLMQCKPLSEQEVRGLCEKAKEILMEESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>gb|KDO63011.1| hypothetical protein CISIN_1g016098mg [Citrus sinensis]
Length=307

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 103/105 (98%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+DSVPS++ HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG
Sbjct  2    SLDSVPSNS-HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_006445821.1| hypothetical protein CICLE_v10015516mg [Citrus clementina]
 ref|XP_006492714.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X1 [Citrus sinensis]
 gb|ESR59061.1| hypothetical protein CICLE_v10015516mg [Citrus clementina]
 gb|KDO63009.1| hypothetical protein CISIN_1g016098mg [Citrus sinensis]
Length=395

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 103/105 (98%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+DSVPS++ HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG
Sbjct  2    SLDSVPSNS-HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_006445820.1| hypothetical protein CICLE_v10015516mg [Citrus clementina]
 ref|XP_006445822.1| hypothetical protein CICLE_v10015516mg [Citrus clementina]
 ref|XP_006492715.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X2 [Citrus sinensis]
 gb|ESR59060.1| hypothetical protein CICLE_v10015516mg [Citrus clementina]
 gb|ESR59062.1| hypothetical protein CICLE_v10015516mg [Citrus clementina]
 gb|KDO63010.1| hypothetical protein CISIN_1g016098mg [Citrus sinensis]
Length=313

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 103/105 (98%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+DSVPS++ HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG
Sbjct  2    SLDSVPSNS-HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_008351677.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Malus domestica]
 ref|XP_008384402.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Malus domestica]
 ref|XP_009375523.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Pyrus x bretschneideri]
 ref|XP_009364118.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Pyrus x bretschneideri]
Length=311

 Score =   205 bits (522),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 102/104 (98%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MDSVPS++ HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MDSVPSNS-HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMEESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>gb|AFK46352.1| unknown [Lotus japonicus]
Length=311

 Score =   205 bits (522),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 102/104 (98%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MDSVPS++ HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MDSVPSNS-HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMEESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>ref|XP_002285694.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Vitis vinifera]
 emb|CAN78260.1| hypothetical protein VITISV_016121 [Vitis vinifera]
 emb|CBI16499.3| unnamed protein product [Vitis vinifera]
Length=314

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S D VPSS  HGNLDEQI+QLMQCKPLSEQEVR+LCEKAKEILM+ESNVQPVKSPVTICG
Sbjct  2    SFDPVPSSNNHGNLDEQISQLMQCKPLSEQEVRMLCEKAKEILMEESNVQPVKSPVTICG  61

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_009413315.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Musa acuminata subsp. malaccensis]
Length=322

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S++ +P+S  HGNLDEQIAQLMQCKPLSEQEVR+LCEKAKE+LM+ESNVQPVKSPVTICG
Sbjct  2    SVNPIPASVTHGNLDEQIAQLMQCKPLSEQEVRMLCEKAKEVLMEESNVQPVKSPVTICG  61

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_009417153.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Musa acuminata subsp. malaccensis]
Length=314

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+++VP+SA+HGNLDEQI+QLMQCKPL EQEVR+LCEKAKE+LM+ESNVQPVKSPVTICG
Sbjct  2    SVNTVPASASHGNLDEQISQLMQCKPLPEQEVRMLCEKAKEVLMEESNVQPVKSPVTICG  61

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_004294990.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Fragaria vesca subsp. vesca]
Length=311

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 101/104 (97%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MDSVPS++ HGNLDEQIAQLMQCKPLSEQEVR LCEKAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MDSVPSNS-HGNLDEQIAQLMQCKPLSEQEVRGLCEKAKEILMEESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>ref|XP_003524949.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Glycine max]
 ref|XP_003531237.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Glycine max]
 gb|KHN47965.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Glycine 
soja]
Length=311

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MDSVPS++ HGNLDEQI+QLMQCKPLSEQEVRVLC+KAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MDSVPSNS-HGNLDEQISQLMQCKPLSEQEVRVLCDKAKEILMEESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>ref|XP_008449804.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Cucumis melo]
 ref|XP_008449806.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Cucumis melo]
 ref|XP_008449807.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Cucumis melo]
Length=311

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 101/104 (97%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MDSV SS +HGNLDEQI+QLMQCKPL+EQEVRVLCEKAKEILMDESNVQPVKSPVTICGD
Sbjct  1    MDSV-SSNSHGNLDEQISQLMQCKPLNEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>ref|XP_007159403.1| hypothetical protein PHAVU_002G235400g [Phaseolus vulgaris]
 gb|ESW31397.1| hypothetical protein PHAVU_002G235400g [Phaseolus vulgaris]
Length=311

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 102/104 (98%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MDSVPS++ HGNLDEQI+QLMQCKPLSEQEVRVLC+KAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MDSVPSNS-HGNLDEQISQLMQCKPLSEQEVRVLCDKAKEILMEESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>gb|KJB53655.1| hypothetical protein B456_009G000500 [Gossypium raimondii]
Length=220

 Score =   199 bits (505),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M+S   S +HGNLDEQI+QLMQCKPLSEQEVR LC+KAKEILMDESNVQPVKSPVTICGD
Sbjct  1    MESSVGSNSHGNLDEQISQLMQCKPLSEQEVRALCDKAKEILMDESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>gb|KJB21840.1| hypothetical protein B456_004G017300 [Gossypium raimondii]
Length=226

 Score =   198 bits (504),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M S   S +HGNLDEQI+QLMQCKPL+EQEVRVLC+KAKEILMDESNVQPVKSPVTICGD
Sbjct  1    MTSSVDSNSHGNLDEQISQLMQCKPLAEQEVRVLCDKAKEILMDESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>ref|XP_002304866.1| type 2A protein phosphatase-3 [Populus trichocarpa]
 ref|XP_006386056.1| hypothetical protein POPTR_0003s21320g [Populus trichocarpa]
 gb|EEE79845.1| type 2A protein phosphatase-3 [Populus trichocarpa]
 gb|ERP63853.1| hypothetical protein POPTR_0003s21320g [Populus trichocarpa]
Length=313

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+DSV +S  HGNLDEQI+QLMQCKPLSEQEVR LCEKAKEILMDESNVQPVKSPVTICG
Sbjct  2    SLDSV-ASNTHGNLDEQISQLMQCKPLSEQEVRALCEKAKEILMDESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_009397685.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Musa acuminata subsp. malaccensis]
Length=314

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S  +VP+  +HGNL+EQIAQLMQCKPLSEQEVRVLCEKAKE+LM+ESNVQPVKSPVTICG
Sbjct  2    SAKAVPAPNSHGNLEEQIAQLMQCKPLSEQEVRVLCEKAKEVLMEESNVQPVKSPVTICG  61

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_010044955.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Eucalyptus grandis]
 gb|KCW87086.1| hypothetical protein EUGRSUZ_B03620 [Eucalyptus grandis]
Length=313

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 103/105 (98%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+DSVP+++ HGN+DE+I+QLMQCKPLSEQEVRVLCEKAKEILM+ESNVQPVKSPVTICG
Sbjct  2    SLDSVPANS-HGNIDEEISQLMQCKPLSEQEVRVLCEKAKEILMEESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>gb|KJB21841.1| hypothetical protein B456_004G017300 [Gossypium raimondii]
Length=237

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M S   S +HGNLDEQI+QLMQCKPL+EQEVRVLC+KAKEILMDESNVQPVKSPVTICGD
Sbjct  1    MTSSVDSNSHGNLDEQISQLMQCKPLAEQEVRVLCDKAKEILMDESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>gb|KJB21842.1| hypothetical protein B456_004G017300 [Gossypium raimondii]
Length=261

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M S   S +HGNLDEQI+QLMQCKPL+EQEVRVLC+KAKEILMDESNVQPVKSPVTICGD
Sbjct  1    MTSSVDSNSHGNLDEQISQLMQCKPLAEQEVRVLCDKAKEILMDESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>ref|XP_008796687.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit isoform X1 [Phoenix dactylifera]
 ref|XP_008796689.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit isoform X1 [Phoenix dactylifera]
Length=313

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 101/105 (96%), Gaps = 1/105 (1%)
 Frame = +1

Query  217  MDSVPSSAA-HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            M + P++A+ HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILM+ESNVQPVKSPVTICG
Sbjct  1    MSANPATASSHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMEESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_002299121.1| type 2A protein phosphatase-3 [Populus trichocarpa]
 gb|EEE83926.1| type 2A protein phosphatase-3 [Populus trichocarpa]
Length=313

 Score =   200 bits (509),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 101/105 (96%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+DSV ++ AHGNLDE+I+QLMQCKPLSEQEVR LCEKAKEILMDESNVQPVKSPVTICG
Sbjct  2    SLDSV-ATNAHGNLDEEISQLMQCKPLSEQEVRALCEKAKEILMDESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_011025169.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit [Populus euphratica]
Length=313

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+DSV ++  HGNLDEQI+QLMQCKPLSEQEVR LCEKAKEILMDESNVQPVKSPVTICG
Sbjct  2    SLDSV-ATNTHGNLDEQISQLMQCKPLSEQEVRALCEKAKEILMDESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_004168224.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
PP2A-3 catalytic subunit-like [Cucumis sativus]
Length=311

 Score =   200 bits (508),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MDS+ SS +HGNLDEQI+QLMQCKPL+EQEVRVLC+KAKEILMDESNVQPVKSPVTICGD
Sbjct  1    MDSL-SSNSHGNLDEQISQLMQCKPLNEQEVRVLCDKAKEILMDESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>gb|KDP26943.1| hypothetical protein JCGZ_21036 [Jatropha curcas]
Length=313

 Score =   200 bits (508),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+DSVPS+  HGNLDEQI QLMQCKPLSEQEVR LCEKAKEILM+ESNVQPVKSPVTICG
Sbjct  2    SLDSVPSNT-HGNLDEQINQLMQCKPLSEQEVRGLCEKAKEILMEESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_009398410.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Musa acuminata subsp. malaccensis]
Length=314

 Score =   200 bits (508),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S +++P+   HGNLDEQI QLMQCKPLSEQEVRVLCEKAKE+LM+ESNVQPVKSPVTICG
Sbjct  2    SANALPAPTRHGNLDEQIEQLMQCKPLSEQEVRVLCEKAKEVLMEESNVQPVKSPVTICG  61

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_004142163.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Cucumis sativus]
 gb|KGN54075.1| hypothetical protein Csa_4G280520 [Cucumis sativus]
Length=311

 Score =   200 bits (508),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MDS+ SS +HGNLDEQI+QLMQCKPL+EQEVRVLC+KAKEILMDESNVQPVKSPVTICGD
Sbjct  1    MDSL-SSNSHGNLDEQISQLMQCKPLNEQEVRVLCDKAKEILMDESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>ref|XP_008789091.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Phoenix dactylifera]
Length=313

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S +  P+S+ HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILM+ESNVQPVKSPVTICG
Sbjct  2    SANPAPASS-HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMEESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_010934485.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit isoform X1 [Elaeis guineensis]
Length=313

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S +  P+S+ HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILM+ESNVQPVKSPVTICG
Sbjct  2    SANPAPASS-HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMEESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>gb|KJB53653.1| hypothetical protein B456_009G000500 [Gossypium raimondii]
Length=312

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M+S   S +HGNLDEQI+QLMQCKPLSEQEVR LC+KAKEILMDESNVQPVKSPVTICGD
Sbjct  1    MESSVGSNSHGNLDEQISQLMQCKPLSEQEVRALCDKAKEILMDESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>ref|XP_011048241.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Populus euphratica]
 ref|XP_011010678.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Populus euphratica]
Length=313

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+DSV ++  HGNLDE+I+QLMQCKPLSEQEVR LCEKAKEILMDESNVQPVKSPVTICG
Sbjct  2    SLDSV-ATNTHGNLDEEISQLMQCKPLSEQEVRALCEKAKEILMDESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_007205603.1| hypothetical protein PRUPE_ppa009000mg [Prunus persica]
 ref|XP_008239817.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Prunus mume]
 gb|EMJ06802.1| hypothetical protein PRUPE_ppa009000mg [Prunus persica]
Length=311

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 100/104 (96%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MD+VPS++ HGNLDEQIAQLMQCKPLSE EVR LCEKAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MDAVPSNS-HGNLDEQIAQLMQCKPLSEPEVRGLCEKAKEILMEESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>gb|KJB21838.1| hypothetical protein B456_004G017300 [Gossypium raimondii]
 gb|KJB21843.1| hypothetical protein B456_004G017300 [Gossypium raimondii]
Length=312

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M S   S +HGNLDEQI+QLMQCKPL+EQEVRVLC+KAKEILMDESNVQPVKSPVTICGD
Sbjct  1    MTSSVDSNSHGNLDEQISQLMQCKPLAEQEVRVLCDKAKEILMDESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>gb|EPS72615.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=226

 Score =   195 bits (496),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            +++AHGNLDEQIAQLM+CKPLSE EVR LCEKAKEILM+ESNVQPVKSPVTICGDIHGQF
Sbjct  7    ATSAHGNLDEQIAQLMECKPLSEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_006842771.1| hypothetical protein AMTR_s00133p00104740 [Amborella trichopoda]
 gb|ERN04446.1| hypothetical protein AMTR_s00133p00104740 [Amborella trichopoda]
Length=312

 Score =   197 bits (502),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M   P S +HGNLD QI+QLMQCKPLSEQEVRVLCEKAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MSVDPVSNSHGNLDAQISQLMQCKPLSEQEVRVLCEKAKEILMEESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>ref|XP_009389048.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Musa acuminata subsp. malaccensis]
Length=314

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+++V +  +HGNLDEQIAQLMQCKPLSE EVRVLCEKAKE+LM+ESNVQPVKSPVTICG
Sbjct  2    SVNAVLAPNSHGNLDEQIAQLMQCKPLSEPEVRVLCEKAKEVLMEESNVQPVKSPVTICG  61

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>gb|AAQ67230.1| protein phosphatase 2A catalytic subunit [Nicotiana benthamiana]
Length=120

 Score =   191 bits (484),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +1

Query  208  MSSMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTI  387
            MSS D V +S   GNLDE+I+QLMQCKPLSE +VR LCEKAKEILM+ESNVQPVKSPVTI
Sbjct  1    MSSSDLVAASTP-GNLDERISQLMQCKPLSEPDVRALCEKAKEILMEESNVQPVKSPVTI  59

Query  388  CGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            CGDIHGQFHDLAELFRIGG+CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   CGDIHGQFHDLAELFRIGGQCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_011086859.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Sesamum indicum]
Length=313

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  226  VPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHG  405
            + +++ HGNLDEQIAQLMQCKPLSE EVR LCEKAKEILMDESNVQPVKSPVTICGDIHG
Sbjct  5    LAAASTHGNLDEQIAQLMQCKPLSEPEVRALCEKAKEILMDESNVQPVKSPVTICGDIHG  64

Query  406  QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  65   QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>gb|AAQ67229.1| protein phosphatase 2A catalytic subunit [Nicotiana benthamiana]
Length=119

 Score =   190 bits (483),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +1

Query  208  MSSMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTI  387
            MSS D V +S   GNLDEQI+QLMQCKPLS+ +VR LCEKAKEILM+ESNVQPVKSPVTI
Sbjct  1    MSSSDLVAASTP-GNLDEQISQLMQCKPLSKPDVRALCEKAKEILMEESNVQPVKSPVTI  59

Query  388  CGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            CGDIHGQFHDLAELFRIGG+CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   CGDIHGQFHDLAELFRIGGQCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_002270378.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Vitis vinifera]
Length=313

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 99/105 (94%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            SMD + SS +HGNLD QI+QLMQCKPLSEQEVR LCEKAKEILM+ESNVQPVKSPVTICG
Sbjct  2    SMDLI-SSDSHGNLDAQISQLMQCKPLSEQEVRTLCEKAKEILMEESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>emb|CDP17353.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 101/109 (93%), Gaps = 2/109 (2%)
 Frame = +1

Query  208  MSSMDSVPS--SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPV  381
            MSS  +VPS  S   G+LDEQI+QLMQCKPLSEQEVR+LCEKAKEILMDESNVQPVKSPV
Sbjct  1    MSSDSAVPSPGSVHGGSLDEQISQLMQCKPLSEQEVRLLCEKAKEILMDESNVQPVKSPV  60

Query  382  TICGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            TICGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   TICGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  109



>ref|XP_004504333.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X1 [Cicer arietinum]
 ref|XP_004504334.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X2 [Cicer arietinum]
Length=308

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S +HGNLDEQI+QLMQCKPLSEQEVRVLC+KAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  3    SNSHGNLDEQISQLMQCKPLSEQEVRVLCDKAKEILMEESNVQPVKSPVTICGDIHGQFH  62

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  100



>ref|XP_010923345.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like isoform X1 [Elaeis guineensis]
 ref|XP_010923346.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like isoform X1 [Elaeis guineensis]
 ref|XP_010923347.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like isoform X1 [Elaeis guineensis]
Length=313

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 99/105 (94%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S +  P+S+ HGNLDEQIAQLMQCKPL EQEVRVLCEKAKEILM+ESNVQPV+SPVTICG
Sbjct  2    SANPAPASS-HGNLDEQIAQLMQCKPLPEQEVRVLCEKAKEILMEESNVQPVQSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_003629703.1| Serine/threonine protein phosphatase [Medicago truncatula]
 gb|AET04179.1| serine/threonine protein phosphatase 2A [Medicago truncatula]
Length=308

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S +HGNLDEQI+QLMQCKPLSEQEVRVLC+KAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  3    SNSHGNLDEQISQLMQCKPLSEQEVRVLCDKAKEILMEESNVQPVKSPVTICGDIHGQFH  62

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  100



>ref|XP_010673507.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Beta vulgaris subsp. vulgaris]
Length=313

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 97/105 (92%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S D V SS  H NLDEQI QLMQCKPLSEQEVR+LCEKAKEILMDESNVQPVKSPVTICG
Sbjct  2    SFDPV-SSNTHHNLDEQIGQLMQCKPLSEQEVRMLCEKAKEILMDESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_011093402.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Sesamum indicum]
Length=313

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            ++  HGNLDEQIAQLMQCKPLSE EVR LCEKAKEILMDESNVQPVKSPVTICGDIHGQF
Sbjct  7    AARTHGNLDEQIAQLMQCKPLSEPEVRALCEKAKEILMDESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>emb|CDX67748.1| BnaA07g17880D [Brassica napus]
Length=177

 Score =   191 bits (486),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 96/104 (92%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M+S P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGD
Sbjct  1    MNSAPTDAT-LDLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>ref|XP_008813487.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X3 [Phoenix dactylifera]
Length=166

 Score =   191 bits (484),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            + +HGNLDEQI+QLM CKPLSEQEVRVLC KAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  5    ANSHGNLDEQISQLMHCKPLSEQEVRVLCGKAKEILMEESNVQPVKSPVTICGDIHGQFH  64

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGK PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  65   DLAELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLV  102



>emb|CBI32153.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   195 bits (496),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            SS +HGNLD QI+QLMQCKPLSEQEVR LCEKAKEILM+ESNVQPVKSPVTICGDIHGQF
Sbjct  5    SSDSHGNLDAQISQLMQCKPLSEQEVRTLCEKAKEILMEESNVQPVKSPVTICGDIHGQF  64

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  65   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>ref|XP_006354151.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Solanum tuberosum]
Length=313

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 99/105 (94%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+D V SS+  GNLDEQIAQLMQCKPLSEQEV+ LC+KAKEILMDESNVQPVKSPVTICG
Sbjct  2    SLDPVVSSS-QGNLDEQIAQLMQCKPLSEQEVKGLCQKAKEILMDESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_010257587.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Nelumbo nucifera]
Length=313

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 100/105 (95%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+D VPS++ HG+LDE I+QLMQCKPLSEQEVR LC+KAKEILM+ESNVQPVKSPVTICG
Sbjct  2    SVDPVPSNS-HGHLDEHISQLMQCKPLSEQEVRALCDKAKEILMEESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_004228641.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Solanum lycopersicum]
Length=313

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 99/105 (94%), Gaps = 1/105 (1%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+D V SS+  GNLDEQIAQLMQCKPLSEQEV+ LC+KAKEILMDESNVQPVKSPVTICG
Sbjct  2    SLDPVVSSS-QGNLDEQIAQLMQCKPLSEQEVKGLCQKAKEILMDESNVQPVKSPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_008344682.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Malus domestica]
Length=366

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 1/95 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MDSVPS++ HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MDSVPSNS-HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMEESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYY  501
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYY
Sbjct  60   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYY  94



>ref|XP_008798733.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X1 [Phoenix dactylifera]
Length=313

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 101/104 (97%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            +D VP+++ HGNL+EQI+QLMQCKPLSEQEVRVLC+KAKEIL++ESNVQPVKSPVTICGD
Sbjct  3    VDPVPANS-HGNLEEQISQLMQCKPLSEQEVRVLCDKAKEILIEESNVQPVKSPVTICGD  61

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_009603918.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Nicotiana tomentosiformis]
Length=312

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 97/105 (92%), Gaps = 2/105 (2%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+D V SS   GNLDEQIAQLMQCKPLSEQEVR LC KAKEILMDESNVQPVKSPVTICG
Sbjct  2    SLDPVVSS--QGNLDEQIAQLMQCKPLSEQEVRGLCGKAKEILMDESNVQPVKSPVTICG  59

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>ref|XP_009620868.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit [Nicotiana tomentosiformis]
Length=314

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 1/107 (1%)
 Frame = +1

Query  208  MSSMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTI  387
            MSS D V +SA  GNLDEQI+QLMQCKPLSE +VR LCEKAKEILM+ESNVQPVKSPVTI
Sbjct  1    MSSSDLVAASA-QGNLDEQISQLMQCKPLSEPDVRALCEKAKEILMEESNVQPVKSPVTI  59

Query  388  CGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            CGDIHGQFHDLAELFRIGG+CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   CGDIHGQFHDLAELFRIGGQCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_011087915.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Sesamum indicum]
Length=316

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/93 (98%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  429
            NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPV+SPVTICGDIHGQFHDLAEL
Sbjct  16   NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVRSPVTICGDIHGQFHDLAEL  75

Query  430  FRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  76   FRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  108



>ref|XP_003533904.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoformX1 [Glycine max]
 gb|KHN43995.1| Serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Glycine soja]
Length=314

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+PS+ ++ +LDEQI+QLMQCKPLSE +VRVLCEKAKEILM+ESNVQPVKSPVTICGDI
Sbjct  4    NSLPSAESNFDLDEQISQLMQCKPLSEHQVRVLCEKAKEILMEESNVQPVKSPVTICGDI  63

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  64   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>gb|ACU23691.1| unknown [Glycine max]
Length=314

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+PS+ ++ +LDEQI+QLMQCKPLSE +VRVLCEKAKEILM+ESNVQPVKSPVTICGDI
Sbjct  4    NSLPSAESNFDLDEQISQLMQCKPLSEHQVRVLCEKAKEILMEESNVQPVKSPVTICGDI  63

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  64   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>gb|AFW67295.1| putative serine/threonine protein phosphatase superfamily protein 
[Zea mays]
Length=134

 Score =   186 bits (473),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S+ HG LD+QI +LMQCKPL+E EVR LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  2    SSPHGGLDDQIERLMQCKPLAEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFH  61

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  99



>gb|ACO57639.1| protein phosphatase 2A catalytic subunit [Castanea mollissima]
Length=311

 Score =   192 bits (488),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 101/104 (97%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M+SVPS+  HG+LDEQI+QLMQCKPLSEQ+VRVLC+KAKEILM++SNVQPVKSPVTICGD
Sbjct  1    MESVPSNT-HGSLDEQISQLMQCKPLSEQKVRVLCDKAKEILMEKSNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLA+LFRIGGKCPDTNYLFMG+YVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAKLFRIGGKCPDTNYLFMGNYVDRGYYSVETVTLLV  103



>ref|XP_009757229.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Nicotiana sylvestris]
Length=312

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 97/105 (92%), Gaps = 2/105 (2%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S+D V SS   GNLDEQIAQLMQCKPLSEQEVR LC KAKEILM+ESNVQPVKSPVTICG
Sbjct  2    SLDPVVSS--QGNLDEQIAQLMQCKPLSEQEVRGLCGKAKEILMNESNVQPVKSPVTICG  59

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>gb|AID52922.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Carthamus 
tinctorius]
Length=312

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            +S  HGNLDEQI+QLMQCKPL+E EVR LCEKAKEILM ESNVQPVKSPVTICGDIHGQF
Sbjct  6    ASNTHGNLDEQISQLMQCKPLTEPEVRALCEKAKEILMGESNVQPVKSPVTICGDIHGQF  65

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  66   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>ref|XP_009782045.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit [Nicotiana sylvestris]
Length=314

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 98/107 (92%), Gaps = 1/107 (1%)
 Frame = +1

Query  208  MSSMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTI  387
            MSS D V +S   GNLDEQI+QLMQCKPLSE +VR LCEKAKEILM+ESNVQPVKSPVTI
Sbjct  1    MSSSDLVAASI-QGNLDEQISQLMQCKPLSEPDVRALCEKAKEILMEESNVQPVKSPVTI  59

Query  388  CGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            CGDIHGQFHDLAELFRIGG+CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   CGDIHGQFHDLAELFRIGGQCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_004229332.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit [Solanum lycopersicum]
 ref|XP_006359133.1| PREDICTED: serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit-like [Solanum tuberosum]
Length=312

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M S   +  HGNLDEQI+QLMQCKPLSE EVR LCEKAKEILM+ESNVQPVKSPVTICGD
Sbjct  1    MSSDLIANTHGNLDEQISQLMQCKPLSEPEVRALCEKAKEILMEESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGG+CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGQCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>ref|NP_001150187.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG38172.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
Length=232

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S+ HG LD+QI +LMQCKPL+E EVR LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  2    SSPHGGLDDQIERLMQCKPLAEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFH  61

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  99



>pir||T45670 phosphoprotein phosphatase (EC 3.1.3.16) 2A-4 (version 2) [similarity] 
- Arabidopsis thaliana
 emb|CAB68188.1| phosphoprotein phosphatase 2A isoform 4 [Arabidopsis thaliana]
Length=299

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSLPTDATL-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>emb|CDP07661.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 1/107 (1%)
 Frame = +1

Query  208  MSSMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTI  387
            MS  D V +++++GNLD+QI+QLMQCKPLSE EVR LCEKAKEILM+ESNVQPVKSPVTI
Sbjct  1    MSCADLV-TTSSNGNLDDQISQLMQCKPLSEPEVRSLCEKAKEILMEESNVQPVKSPVTI  59

Query  388  CGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            CGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   CGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>gb|EYU27166.1| hypothetical protein MIMGU_mgv1a010409mg [Erythranthe guttata]
Length=313

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            + + +GNLDEQIAQLMQCKPL E EVR LCEKAKEILM+ESNVQPVKSPVTICGDIHGQF
Sbjct  7    AESTNGNLDEQIAQLMQCKPLPESEVRTLCEKAKEILMEESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>gb|KHN00026.1| Serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Glycine soja]
Length=314

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+ S+ +  +LDEQI+QLMQCKPLSE +VRVLCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSLSSAESTLDLDEQISQLMQCKPLSEHQVRVLCEKAKEILMDESNVQPVKSPVTICGDI  63

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  64   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_010907340.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X1 [Elaeis guineensis]
Length=313

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            +D VP+++ HGN++ QI+QLMQCKPLSEQEVRVLC+KAKEIL++ESNVQPVKSPVTICGD
Sbjct  3    VDPVPANS-HGNVEGQISQLMQCKPLSEQEVRVLCDKAKEILIEESNVQPVKSPVTICGD  61

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_003519014.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X1 [Glycine max]
Length=314

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+ S+ +  +LDEQI+QLMQCKPLSE +VRVLCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSLSSAESTLDLDEQISQLMQCKPLSEHQVRVLCEKAKEILMDESNVQPVKSPVTICGDI  63

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  64   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>gb|EPS68420.1| serine/threonine-protein phosphatase [Genlisea aurea]
Length=313

 Score =   190 bits (483),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            +S+A GNLDEQIAQLMQCKPL+E EVR LCEKAKEIL  ESNVQPVKSPVTICGDIHGQF
Sbjct  7    ASSAQGNLDEQIAQLMQCKPLTESEVRGLCEKAKEILTGESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_009142847.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit [Brassica rapa]
 emb|CDY55398.1| BnaA05g34330D [Brassica napus]
 emb|CDY51518.1| BnaC04g02330D [Brassica napus]
Length=313

 Score =   190 bits (482),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A  G LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSIPTDATIG-LDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|NP_567066.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 ref|XP_002878224.1| protein phosphatase 2A-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006291524.1| hypothetical protein CARUB_v10017673mg [Capsella rubella]
 ref|XP_010504806.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Camelina sativa]
 ref|XP_010516501.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit isoform X1 [Camelina sativa]
 ref|XP_010427757.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Camelina sativa]
 sp|P48578.1|PP2A3_ARATH RecName: Full=Serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit; AltName: Full=Protein phosphatase 2A isoform 
3 [Arabidopsis thaliana]
 gb|AAA64941.1| Ser/Thr protein phosphatase [Arabidopsis thaliana]
 gb|AAD10855.1| serine/threonine protein phosphatase 2A-4 catalytic subunit [Arabidopsis 
thaliana]
 gb|AAL07071.1| putative phosphoprotein phosphatase 2A isoform 4 [Arabidopsis 
thaliana]
 gb|AAL14399.1| AT3g58500/F14P22_90 [Arabidopsis thaliana]
 gb|AAM47331.1| AT3g58500/F14P22_90 [Arabidopsis thaliana]
 gb|EFH54483.1| protein phosphatase 2A-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE79790.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 gb|EOA24422.1| hypothetical protein CARUB_v10017673mg [Capsella rubella]
Length=313

 Score =   190 bits (482),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSLPTDATL-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>gb|KJB83434.1| hypothetical protein B456_013G247500 [Gossypium raimondii]
Length=255

 Score =   188 bits (477),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M+S     +H NLD+QI+QLMQCKPLSEQE+++LC+KAKEIL DESNVQPVKSPVTICGD
Sbjct  1    MESSVGLNSHDNLDKQISQLMQCKPLSEQEIKLLCDKAKEILRDESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>gb|ABK24697.1| unknown [Picea sitchensis]
Length=314

 Score =   189 bits (481),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  214  SMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            S + V SS+ +G LD QI QLMQCKPLSEQEVR LCEKAKEILM+ESNVQPVK PVTICG
Sbjct  2    SGEPVSSSSGYGQLDAQIEQLMQCKPLSEQEVRGLCEKAKEILMEESNVQPVKCPVTICG  61

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_009104146.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X1 [Brassica rapa]
Length=311

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 96/104 (92%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M+S P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGD
Sbjct  1    MNSAPTDATL-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGD  59

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   IHGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  103



>ref|XP_010101089.1| Serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Morus notabilis]
 gb|EXB86901.1| Serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Morus notabilis]
Length=376

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 99/104 (95%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M+S+ +S ++ +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILM+ESNVQPVKSPVTICGD
Sbjct  3    MNSI-TSESNNDLDEQISQLMQCKPLSEQQVRTLCEKAKEILMEESNVQPVKSPVTICGD  61

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_009142071.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Brassica rapa]
 emb|CDY47976.1| BnaA04g24540D [Brassica napus]
Length=313

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 97/104 (93%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            +DS+P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGD
Sbjct  3    VDSIPTDATI-DLDEQISQLMQCKPLSEQQVRSLCEKAKEILMDESNVQPVKSPVTICGD  61

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   IHGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_008813485.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X1 [Phoenix dactylifera]
Length=310

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            + +HGNLDEQI+QLM CKPLSEQEVRVLC KAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  5    ANSHGNLDEQISQLMHCKPLSEQEVRVLCGKAKEILMEESNVQPVKSPVTICGDIHGQFH  64

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGK PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  65   DLAELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLV  102



>gb|KCW48137.1| hypothetical protein EUGRSUZ_K01869 [Eucalyptus grandis]
Length=276

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  229  PSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQ  408
            PSS A  +LD QIAQLMQCKPLSEQ+V+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQ
Sbjct  6    PSSDAGFDLDGQIAQLMQCKPLSEQQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQ  65

Query  409  FHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FHDLAELFRIGG+CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  66   FHDLAELFRIGGECPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_011089122.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Sesamum indicum]
Length=317

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
             +  +GNLD+QIAQLMQCKPLSE E+RVLC+KAKEILM+ESNVQPVKSPVTICGDIHGQF
Sbjct  11   GNRGNGNLDDQIAQLMQCKPLSELEIRVLCQKAKEILMNESNVQPVKSPVTICGDIHGQF  70

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  71   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  109



>gb|KFK35108.1| hypothetical protein AALP_AA5G237100 [Arabis alpina]
Length=313

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ +   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSLPTDSTL-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>emb|CDX98300.1| BnaC06g16610D [Brassica napus]
Length=313

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +SVP+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSVPADATL-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>emb|CDY14840.1| BnaC04g48370D [Brassica napus]
Length=313

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 97/104 (93%), Gaps = 1/104 (1%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            +DS+P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGD
Sbjct  3    VDSLPTDATI-DLDEQISQLMQCKPLSEQQVRSLCEKAKEILMDESNVQPVKSPVTICGD  61

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   IHGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>sp|O04860.1|PP2A5_TOBAC RecName: Full=Serine/threonine-protein phosphatase PP2A-5 catalytic 
subunit [Nicotiana tabacum]
 emb|CAB07807.1| protein phosphatase type 2A [Nicotiana tabacum]
Length=314

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +1

Query  208  MSSMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTI  387
            MSS D V +S   GNLDEQI+QLMQCKPLSE +VR LCEKAKEIL +ESNVQPVKSPVTI
Sbjct  1    MSSSDLVAASI-QGNLDEQISQLMQCKPLSEPDVRALCEKAKEILAEESNVQPVKSPVTI  59

Query  388  CGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            CGDIHGQFHDLAELFRIGG+CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   CGDIHGQFHDLAELFRIGGQCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|NP_565974.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 ref|XP_002881857.1| protein phosphatase 2A-4 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006294640.1| hypothetical protein CARUB_v10023677mg [Capsella rubella]
 sp|Q07100.2|PP2A4_ARATH RecName: Full=Serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit; AltName: Full=Protein phosphatase 2A isoform 
4 [Arabidopsis thaliana]
 gb|AAA64742.1| Ser/Thr protein phosphatase [Arabidopsis thaliana]
 gb|AAD23731.1| serine threonine protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 gb|AAM15383.1| serine/threonine protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 gb|AAQ22635.1| At2g42500/F14N22.23 [Arabidopsis thaliana]
 gb|EFH58116.1| protein phosphatase 2A-4 [Arabidopsis lyrata subsp. lyrata]
 gb|AEC10127.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 gb|EOA27538.1| hypothetical protein CARUB_v10023677mg [Capsella rubella]
 gb|KFK37102.1| hypothetical protein AALP_AA4G213200 [Arabis alpina]
Length=313

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSIPTDATI-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>emb|CDY00569.1| BnaC04g23560D [Brassica napus]
Length=313

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSIPTDATL-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_009138958.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Brassica rapa]
 ref|XP_009116529.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Brassica rapa]
 emb|CDY06035.1| BnaA09g37450D [Brassica napus]
 emb|CDX88988.1| BnaA04g01980D [Brassica napus]
 emb|CDX71949.1| BnaC08g29250D [Brassica napus]
Length=313

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSIPTDATL-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>gb|KJB83435.1| hypothetical protein B456_013G247500 [Gossypium raimondii]
Length=312

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M+S     +H NLD+QI+QLMQCKPLSEQE+++LC+KAKEIL DESNVQPVKSPVTICGD
Sbjct  1    MESSVGLNSHDNLDKQISQLMQCKPLSEQEIKLLCDKAKEILRDESNVQPVKSPVTICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  104



>ref|XP_007145715.1| hypothetical protein PHAVU_007G262200g [Phaseolus vulgaris]
 ref|XP_007145717.1| hypothetical protein PHAVU_007G262200g [Phaseolus vulgaris]
 gb|ESW17709.1| hypothetical protein PHAVU_007G262200g [Phaseolus vulgaris]
 gb|ESW17711.1| hypothetical protein PHAVU_007G262200g [Phaseolus vulgaris]
Length=314

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+PS+ ++ +LDEQI+QLMQCKPLSE +VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSLPSTESNLDLDEQISQLMQCKPLSELQVRALCEKAKEILMDESNVQPVKSPVTICGDI  63

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGK PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  64   HGQFHDLAELFRIGGKFPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_006402781.1| hypothetical protein EUTSA_v10006109mg [Eutrema salsugineum]
 gb|ESQ44234.1| hypothetical protein EUTSA_v10006109mg [Eutrema salsugineum]
Length=313

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ +   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSLPTDSTL-DLDEQISQLMQCKPLSEQQVRSLCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>sp|P23778.2|PP2A_BRANA RecName: Full=Serine/threonine-protein phosphatase PP2A catalytic 
subunit, partial [Brassica napus]
 emb|CAA40687.1| phosphatase 2A [Brassica napus]
Length=309

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = +1

Query  223  SVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIH  402
            S+P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDIH
Sbjct  1    SIPTDATL-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDIH  59

Query  403  GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            GQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   GQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  101



>prf||1702228B protein phosphatase 2A
Length=309

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = +1

Query  223  SVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIH  402
            S+P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDIH
Sbjct  1    SIPTDATL-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDIH  59

Query  403  GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            GQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  60   GQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  101



>gb|AAD10854.1| serine/threonine protein phosphatase 2A-3 catalytic subunit [Arabidopsis 
thaliana]
Length=352

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A   +L+EQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSIPTDATI-DLNEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_007163032.1| hypothetical protein PHAVU_001G200300g [Phaseolus vulgaris]
 gb|ESW35026.1| hypothetical protein PHAVU_001G200300g [Phaseolus vulgaris]
Length=313

 Score =   187 bits (475),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 99/103 (96%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+ S ++H ++D+QI+QLMQCKPLSEQ+VRVLCEKAKEIL+DESNVQPVKSPVTICGDI
Sbjct  4    NSMLSESSH-DVDDQISQLMQCKPLSEQQVRVLCEKAKEILIDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>emb|CDY66916.1| BnaC03g72670D [Brassica napus]
Length=313

 Score =   187 bits (475),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSIPTDATI-DLDEQISQLMQCKPLSEQQVRSLCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_010036522.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Eucalyptus grandis]
 gb|KCW48135.1| hypothetical protein EUGRSUZ_K01869 [Eucalyptus grandis]
 gb|KCW48136.1| hypothetical protein EUGRSUZ_K01869 [Eucalyptus grandis]
Length=313

 Score =   187 bits (475),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  229  PSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQ  408
            PSS A  +LD QIAQLMQCKPLSEQ+V+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQ
Sbjct  6    PSSDAGFDLDGQIAQLMQCKPLSEQQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQ  65

Query  409  FHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FHDLAELFRIGG+CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  66   FHDLAELFRIGGECPDTNYLFMGDYVDRGYYSVETVTLLV  105



>emb|CDY69521.1| BnaCnng63970D [Brassica napus]
Length=313

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A   +LDEQI QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSIPTDATI-DLDEQIGQLMQCKPLSEQQVRSLCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_010550105.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit isoform X1 [Tarenaya hassleriana]
Length=313

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ +   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILM+ESNVQPVKSPVTICGDI
Sbjct  4    NSLPTDSTL-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMEESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_010506078.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit [Camelina sativa]
 ref|XP_010517775.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit [Camelina sativa]
Length=313

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 95/103 (92%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P  A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSIPVDATI-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_004303366.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Fragaria vesca subsp. vesca]
Length=313

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  223  SVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIH  402
            ++ SS +  +L+EQI QLMQCKPLSEQ+VR LCEKAKEILM+ESNVQPVKSPVTICGDIH
Sbjct  4    NLASSDSSNDLNEQIEQLMQCKPLSEQQVRALCEKAKEILMEESNVQPVKSPVTICGDIH  63

Query  403  GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  64   GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_006411507.1| hypothetical protein EUTSA_v10016971mg [Eutrema salsugineum]
 gb|ESQ52960.1| hypothetical protein EUTSA_v10016971mg [Eutrema salsugineum]
Length=313

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A   +LDEQI+QLMQCKPLSEQ+V+ LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSIPTDATI-DLDEQISQLMQCKPLSEQQVKALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|NP_001148686.1| LOC100282302 [Zea mays]
 ref|XP_008643660.1| PREDICTED: LOC100282302 isoform X1 [Zea mays]
 gb|ACG32100.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG32123.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG32449.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG32536.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG32972.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG33076.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG34384.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG34422.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG34946.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG38159.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG38757.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACG41988.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
 gb|ACN34475.1| unknown [Zea mays]
 gb|AFW67296.1| putative serine/threonine protein phosphatase superfamily protein 
isoform 1 [Zea mays]
 gb|AFW67297.1| putative serine/threonine protein phosphatase superfamily protein 
isoform 2 [Zea mays]
Length=307

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S+ HG LD+QI +LMQCKPL+E EVR LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  2    SSPHGGLDDQIERLMQCKPLAEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFH  61

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  99



>ref|NP_001167654.1| putative serine/threonine protein phosphatase superfamily protein 
[Zea mays]
 gb|ACF88272.1| unknown [Zea mays]
 tpg|DAA52016.1| TPA: putative serine/threonine protein phosphatase superfamily 
protein [Zea mays]
Length=307

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S+ HG LD+QI +LMQCKPL+E EVR LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  2    SSPHGGLDDQIERLMQCKPLAEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFH  61

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  99



>ref|XP_004494304.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Cicer arietinum]
Length=313

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+ + + H +LDEQI+QLMQCKPLSEQ+V+ LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSMLTESTH-DLDEQISQLMQCKPLSEQQVKELCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_003554484.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Glycine max]
 gb|KHN43573.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Glycine 
soja]
Length=313

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+ S ++H +LD+QI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSMLSESSH-DLDDQISQLMQCKPLSEQQVRGLCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  63   HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  105



>tpg|DAA43580.1| TPA: putative serine/threonine protein phosphatase superfamily 
protein, partial [Zea mays]
Length=163

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  247  GNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAE  426
            G LD QI QLMQC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFHDL E
Sbjct  12   GGLDAQIEQLMQCRPLAEQEVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVE  71

Query  427  LFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            LFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  72   LFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_003564197.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Brachypodium distachyon]
Length=307

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S+ HG LD+QI +LMQCKPL E EVR LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  2    SSPHGGLDDQIERLMQCKPLPEAEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFH  61

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  99



>ref|XP_006650755.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Oryza brachyantha]
Length=308

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            S + HG LD+QI +LMQCKPL E EVR LCEKAKEILMDESNVQPVKSPVTICGDIHGQF
Sbjct  2    SGSPHGGLDDQIERLMQCKPLPEPEVRGLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  61

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  100



>gb|EAY92250.1| hypothetical protein OsI_13970 [Oryza sativa Indica Group]
Length=287

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S+ HG LD+QI +LMQCKPL E EVR LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  2    SSPHGGLDDQIERLMQCKPLPEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFH  61

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  99



>ref|XP_010524038.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Tarenaya hassleriana]
Length=313

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ +   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILM+ESNVQPVKSPVTICGDI
Sbjct  4    NSLPTESTL-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMEESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELFRIGG+CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFRIGGQCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_008370945.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Malus domestica]
 ref|XP_009335875.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Pyrus x bretschneideri]
Length=313

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            SS  + +L+EQI QLMQCKPLSEQ+VR+LCEKAKEILM ESNVQPVKSPVTICGDIHGQF
Sbjct  7    SSDTNSDLNEQIEQLMQCKPLSEQQVRMLCEKAKEILMGESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_004144671.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Cucumis sativus]
 ref|XP_004168734.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Cucumis sativus]
 gb|KGN54854.1| hypothetical protein Csa_4G551660 [Cucumis sativus]
Length=313

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S A+ +LDEQI+QLMQCKPLSEQ+VR LC+KAKE+LM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  8    SEANSSLDEQISQLMQCKPLSEQQVRALCDKAKEVLMEESNVQPVKSPVTICGDIHGQFH  67

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELF+IGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  68   DLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_008442200.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Cucumis melo]
Length=313

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S A+ +LDEQI+QLMQCKPLSEQ+VR LC+KAKE+LM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  8    SEANSSLDEQISQLMQCKPLSEQQVRALCDKAKEVLMEESNVQPVKSPVTICGDIHGQFH  67

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELF+IGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  68   DLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|NP_001051627.1| Os03g0805300 [Oryza sativa Japonica Group]
 sp|Q10BT5.1|PP2A2_ORYSJ RecName: Full=Serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Oryza sativa Japonica Group]
 sp|A2XN40.2|PP2A2_ORYSI RecName: Full=Serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Oryza sativa Indica Group]
 gb|AAD22116.1| serine/threonine protein phosphatase PP2A-2 catalytic subunit 
[Oryza sativa Indica Group]
 gb|AAS07220.1| serine/threonine protein phosphatase PP2A-2 catalytic subunit 
[Oryza sativa Japonica Group]
 gb|ABF99431.1| Serine/threonine protein phosphatase PP2A catalytic subunit, 
putative, expressed [Oryza sativa Japonica Group]
 gb|ABF99432.1| Serine/threonine protein phosphatase PP2A catalytic subunit, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13541.1| Os03g0805300 [Oryza sativa Japonica Group]
 gb|EAZ28974.1| hypothetical protein OsJ_13018 [Oryza sativa Japonica Group]
 dbj|BAG87595.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94025.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94563.1| unnamed protein product [Oryza sativa Japonica Group]
Length=307

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S+ HG LD+QI +LMQCKPL E EVR LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  2    SSPHGGLDDQIERLMQCKPLPEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFH  61

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  99



>ref|XP_007029090.1| Phosphatase 2A-4 [Theobroma cacao]
 gb|EOY09592.1| Phosphatase 2A-4 [Theobroma cacao]
Length=313

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  429
            +LDEQI+QLMQCKPLSEQ+VR LC+KAKEILM+ESNVQPVKSPVTICGDIHGQFHDLAEL
Sbjct  13   DLDEQISQLMQCKPLSEQQVRALCDKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAEL  72

Query  430  FRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  73   FRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>dbj|BAJ93161.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=307

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S+ HG LD+QI +LMQCKPL E EVR LCEKAKEILM+ESNVQPV+SPVTICGDIHGQFH
Sbjct  2    SSPHGGLDDQIERLMQCKPLPEAEVRALCEKAKEILMEESNVQPVRSPVTICGDIHGQFH  61

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  99



>gb|ACG38746.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea 
mays]
Length=307

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S+ HG LD+QI +LMQCKPL+E EVR LCEKAK+ILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  2    SSPHGGLDDQIERLMQCKPLAEPEVRALCEKAKDILMEESNVQPVKSPVTICGDIHGQFH  61

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  99



>gb|KDO70825.1| hypothetical protein CISIN_1g021077mg [Citrus sinensis]
Length=236

 Score =   182 bits (463),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            S+    +LDEQI+QLMQCKPLSE +V+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQF
Sbjct  7    STDTTTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELF+IGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_008387207.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Malus domestica]
Length=313

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            S+    +L+EQI QLMQCKPLSEQ+VR+LCEKAKEILM ESNVQPVKSPVTICGDIHGQF
Sbjct  7    STDTSSDLNEQIEQLMQCKPLSEQQVRMLCEKAKEILMGESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_004981369.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Setaria italica]
Length=307

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            S+ HG LD+QI +LMQCKPL E EVR LC+KAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  2    SSPHGGLDDQIERLMQCKPLPEPEVRALCDKAKEILMEESNVQPVKSPVTICGDIHGQFH  61

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  99



>gb|KJB16487.1| hypothetical protein B456_002G232300 [Gossypium raimondii]
Length=260

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  429
            +LDEQI+QLMQCKPLSEQ+VR LC+KAKEILM+ESNVQPVK+PVTICGDIHGQFHDL EL
Sbjct  10   DLDEQISQLMQCKPLSEQQVRALCDKAKEILMEESNVQPVKAPVTICGDIHGQFHDLQEL  69

Query  430  FRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  70   FRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  102



>ref|XP_002531165.1| protein phsophatase-2a, putative [Ricinus communis]
 gb|EEF31208.1| protein phsophatase-2a, putative [Ricinus communis]
Length=313

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  229  PSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQ  408
            PSS +  +LDEQI+QLMQCKPLSE +VR L EKAKEILM ESNVQPVKSPVTICGDIHGQ
Sbjct  6    PSSDSISDLDEQISQLMQCKPLSEPQVRALSEKAKEILMQESNVQPVKSPVTICGDIHGQ  65

Query  409  FHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  66   FHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>dbj|BAA92699.1| type 2A protein phosphatase-3 [Vicia faba]
Length=313

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  429
            +L+EQI+QLMQCKPLSEQ+V+ LCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL
Sbjct  13   DLNEQISQLMQCKPLSEQQVKELCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  72

Query  430  FRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  73   FRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_003638109.1| Serine/threonine protein phosphatase [Medicago truncatula]
 sp|Q06009.1|PP2A_MEDSA RecName: Full=Serine/threonine-protein phosphatase PP2A catalytic 
subunit [Medicago sativa]
 emb|CAA49849.1| phosphoprotein phosphatase type 2A [Medicago sativa]
 gb|KEH24330.1| serine/threonine protein phosphatase 2A [Medicago truncatula]
Length=313

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  429
            +L+EQI+QLMQCKPLSEQ+V+ LCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL
Sbjct  13   DLNEQISQLMQCKPLSEQQVKELCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  72

Query  430  FRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  73   FRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>gb|KJB61941.1| hypothetical protein B456_009G392700 [Gossypium raimondii]
Length=313

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  429
            +LDEQI+QLMQCKPLSEQ+VR LC+KAKEILM ESNVQPV+SPVTICGDIHGQFHDLAEL
Sbjct  13   DLDEQISQLMQCKPLSEQQVRALCDKAKEILMKESNVQPVRSPVTICGDIHGQFHDLAEL  72

Query  430  FRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  73   FRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_003558732.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Brachypodium distachyon]
Length=315

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  208  MSSMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTI  387
            M  M    SS+  G LD QI QLMQC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTI
Sbjct  1    MEPMSVDSSSSGCGGLDAQIEQLMQCRPLAEQEVKALCEKAKEILMEESNVQPVKSPVTI  60

Query  388  CGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            CGDIHGQFHDL ELFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  61   CGDIHGQFHDLVELFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  107



>gb|KDP21900.1| hypothetical protein JCGZ_03038 [Jatropha curcas]
Length=313

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            SS +  +LDEQI+QLMQCKPLSE +VR LC+KAKEILM ESNVQPVKSPVTICGDIHGQF
Sbjct  7    SSDSVTDLDEQISQLMQCKPLSETQVRALCDKAKEILMQESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>gb|KDO70826.1| hypothetical protein CISIN_1g021077mg [Citrus sinensis]
Length=239

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            S+    +LDEQI+QLMQCKPLSE +V+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQF
Sbjct  7    STDTTTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELF+IGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_009133540.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Brassica rapa]
Length=313

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A   +LDEQI QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSIPTDATI-DLDEQIGQLMQCKPLSEQQVRSLCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQ HDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQCHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_001766933.1| predicted protein [Physcomitrella patens]
 gb|EDQ68335.1| predicted protein [Physcomitrella patens]
Length=313

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 92/104 (88%), Gaps = 2/104 (2%)
 Frame = +1

Query  223  SVP--SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            SVP  SS  HG LD QIAQL+QCKPL E EVR LCEKAKEILM+E+NVQPVK PVTICGD
Sbjct  2    SVPPVSSNVHGQLDAQIAQLIQCKPLPELEVRALCEKAKEILMEENNVQPVKCPVTICGD  61

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   IHGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETATLLV  105



>ref|XP_002966246.1| hypothetical protein SELMODRAFT_270568 [Selaginella moellendorffii]
 ref|XP_002982317.1| hypothetical protein SELMODRAFT_228841 [Selaginella moellendorffii]
 gb|EFJ16562.1| hypothetical protein SELMODRAFT_228841 [Selaginella moellendorffii]
 gb|EFJ32273.1| hypothetical protein SELMODRAFT_270568 [Selaginella moellendorffii]
Length=313

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = +1

Query  217  MDSVP-SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICG  393
            M+  P SS  +G LD QIAQLMQCKPL E EV+ LCEKAKEILM+E+NVQPVK PVTICG
Sbjct  1    MNVAPVSSNGYGQLDAQIAQLMQCKPLVEHEVQALCEKAKEILMEENNVQPVKCPVTICG  60

Query  394  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLV  105



>ref|XP_006364157.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Solanum tuberosum]
Length=306

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 92/104 (88%), Gaps = 6/104 (6%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MDSV      GNLDEQI  LMQCKPLSEQ VR LCEKAKEIL+ ESNVQPVKSPVTICGD
Sbjct  1    MDSV------GNLDEQIGLLMQCKPLSEQAVRGLCEKAKEILVQESNVQPVKSPVTICGD  54

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  55   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  98



>gb|KDO70823.1| hypothetical protein CISIN_1g021077mg [Citrus sinensis]
Length=266

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            S+    +LDEQI+QLMQCKPLSE +V+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQF
Sbjct  7    STDTTTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELF+IGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_002309283.1| hypothetical protein POPTR_0006s21080g [Populus trichocarpa]
 ref|XP_011047094.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Populus euphratica]
 gb|EEE92806.1| hypothetical protein POPTR_0006s21080g [Populus trichocarpa]
Length=313

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            SS +  +LD+QI QLMQCKPLSE +VR LCEKAKEILM ESNVQPVKSPVTICGDIHGQF
Sbjct  7    SSESITDLDQQIEQLMQCKPLSEPQVRTLCEKAKEILMQESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>gb|KJB16486.1| hypothetical protein B456_002G232300 [Gossypium raimondii]
Length=310

 Score =   182 bits (462),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  429
            +LDEQI+QLMQCKPLSEQ+VR LC+KAKEILM+ESNVQPVK+PVTICGDIHGQFHDL EL
Sbjct  10   DLDEQISQLMQCKPLSEQQVRALCDKAKEILMEESNVQPVKAPVTICGDIHGQFHDLQEL  69

Query  430  FRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  70   FRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  102



>ref|XP_001766934.1| predicted protein [Physcomitrella patens]
 gb|EDQ68336.1| predicted protein [Physcomitrella patens]
Length=301

 Score =   182 bits (461),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  223  SVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIH  402
            SVP+ +++G LD QIA+L+QCKPLSE EVR LCEKAKEILM E+NVQPVK PVTICGDIH
Sbjct  2    SVPAVSSNGQLDAQIAELIQCKPLSELEVRGLCEKAKEILMRENNVQPVKCPVTICGDIH  61

Query  403  GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            GQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   GQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETATLLV  103



>ref|XP_003521515.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Glycine max]
 gb|KHN22564.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Glycine 
soja]
Length=313

 Score =   182 bits (461),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  429
            +LD+QI+QLMQCKPLSEQ+VR LCEKAKEIL DESNVQPVKSPVTICGDIHGQFHDLAEL
Sbjct  13   DLDDQISQLMQCKPLSEQQVRGLCEKAKEILTDESNVQPVKSPVTICGDIHGQFHDLAEL  72

Query  430  FRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  73   FRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  105



>ref|XP_001766048.1| predicted protein [Physcomitrella patens]
 gb|EDQ69107.1| predicted protein [Physcomitrella patens]
Length=311

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  223  SVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIH  402
            SVP  +++G LD QIAQL+QCKPLSE EVR LCEKAKEILM E+NVQPVK PVTICGDIH
Sbjct  2    SVPPISSNGQLDTQIAQLIQCKPLSEVEVRGLCEKAKEILMRENNVQPVKCPVTICGDIH  61

Query  403  GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            GQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   GQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETATLLV  103



>ref|XP_011039506.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like isoform X1 [Populus euphratica]
Length=313

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  429
            +LD+QI QLMQCKPLSE +VR LCEKAKEILM ESNVQPVKSPVTICGDIHGQFHDLAEL
Sbjct  13   DLDQQIEQLMQCKPLSEPQVRALCEKAKEILMQESNVQPVKSPVTICGDIHGQFHDLAEL  72

Query  430  FRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  73   FRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_004228954.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Solanum lycopersicum]
Length=306

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 92/104 (88%), Gaps = 6/104 (6%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            MDSV      GNLDE+I  LMQCKPLSEQ VR LCEKAKEIL+ ESNVQPVKSPVTICGD
Sbjct  1    MDSV------GNLDEKIGLLMQCKPLSEQAVRGLCEKAKEILVQESNVQPVKSPVTICGD  54

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  55   IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  98



>ref|XP_002322743.1| hypothetical protein POPTR_0016s06190g [Populus trichocarpa]
 gb|EEF04504.1| hypothetical protein POPTR_0016s06190g [Populus trichocarpa]
Length=313

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAEL  429
            +LD+QI QLMQCKPLSE +VR LCEKAKEILM ESNVQPVKSPVTICGDIHGQFHDLAEL
Sbjct  13   DLDQQIEQLMQCKPLSEPQVRALCEKAKEILMQESNVQPVKSPVTICGDIHGQFHDLAEL  72

Query  430  FRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            FRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  73   FRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_006429942.1| hypothetical protein CICLE_v10012259mg [Citrus clementina]
 gb|ESR43182.1| hypothetical protein CICLE_v10012259mg [Citrus clementina]
Length=313

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            S+    +LDEQI+QLMQCKPLSE +V+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQF
Sbjct  7    STDTTTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELF+IGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_002465801.1| hypothetical protein SORBIDRAFT_01g046020 [Sorghum bicolor]
 gb|EER92799.1| hypothetical protein SORBIDRAFT_01g046020 [Sorghum bicolor]
Length=313

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  247  GNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAE  426
            G LD QI QLMQC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFHDL E
Sbjct  12   GGLDAQIEQLMQCRPLAEQEVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVE  71

Query  427  LFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            LFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  72   LFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_008241162.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Prunus mume]
Length=313

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            SS    +L+EQI QLMQCKPLSE +VR LCEKAKEILM ESNVQPVKSPVTICGDIHGQF
Sbjct  7    SSDTSSDLNEQIEQLMQCKPLSEPQVRGLCEKAKEILMGESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>emb|CAA07471.1| PP2A1 protein [Catharanthus roseus]
Length=314

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 94/102 (92%), Gaps = 3/102 (3%)
 Frame = +1

Query  232  SSAAHGNLDEQ---IAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIH  402
            +S+ +GNLDEQ   I+QLM+CKPLSE EVR LCEKAKEILM+ESNVQPV+SPVTICGDIH
Sbjct  7    ASSTYGNLDEQDEQISQLMRCKPLSETEVRALCEKAKEILMEESNVQPVRSPVTICGDIH  66

Query  403  GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            G FH+LAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   GLFHELAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  108



>ref|XP_006429941.1| hypothetical protein CICLE_v10012259mg [Citrus clementina]
 ref|XP_006481547.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit-like [Citrus sinensis]
 gb|ESR43181.1| hypothetical protein CICLE_v10012259mg [Citrus clementina]
 gb|KDO70819.1| hypothetical protein CISIN_1g021077mg [Citrus sinensis]
Length=313

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            S+    +LDEQI+QLMQCKPLSE +V+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQF
Sbjct  7    STDTTTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELF+IGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|NP_001130096.1| uncharacterized protein LOC100191189 [Zea mays]
 gb|ACF78223.1| unknown [Zea mays]
 gb|AFW89573.1| putative serine/threonine protein phosphatase superfamily protein 
[Zea mays]
Length=313

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +1

Query  235  SAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFH  414
            +   G LD QI QLMQC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFH
Sbjct  8    NGGSGGLDAQIEQLMQCRPLAEQEVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFH  67

Query  415  DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            DL ELFRIGGKCPDTNYLFMGDYVDRGYYSVET T+LV
Sbjct  68   DLVELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTMLV  105



>ref|XP_007202275.1| hypothetical protein PRUPE_ppa008946mg [Prunus persica]
 gb|EMJ03474.1| hypothetical protein PRUPE_ppa008946mg [Prunus persica]
Length=313

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            SS    +L+EQI QLMQCKPLSE +VR LCEKAKEILM ESNVQPVKSPVTICGDIHGQF
Sbjct  7    SSDTSSDLNEQIEQLMQCKPLSEPQVRGLCEKAKEILMGESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|NP_001149212.1| PP2Ac-5 - Phosphatase 2A isoform 5 belonging to family 2 [Zea 
mays]
 gb|ACG34580.1| PP2Ac-5 - Phosphatase 2A isoform 5 belonging to family 2 [Zea 
mays]
Length=313

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  247  GNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAE  426
            G LD QI QLMQC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFHDL E
Sbjct  12   GGLDAQIEQLMQCRPLAEQEVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVE  71

Query  427  LFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            LFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  72   LFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>gb|ACG34764.1| PP2Ac-5 - Phosphatase 2A isoform 5 belonging to family 2 [Zea 
mays]
Length=313

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  247  GNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAE  426
            G LD QI QLMQC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFHDL E
Sbjct  12   GGLDAQIEQLMQCRPLAEQEVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVE  71

Query  427  LFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            LFRIGGKCPDTNYLFMGDYVDRGYYSVET T+LV
Sbjct  72   LFRIGGKCPDTNYLFMGDYVDRGYYSVETVTMLV  105



>ref|XP_004985576.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Setaria italica]
Length=313

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  247  GNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAE  426
            G LD QI QLMQC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFHDL E
Sbjct  12   GGLDAQIEQLMQCRPLAEQEVKSLCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVE  71

Query  427  LFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            LFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  72   LFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  105



>ref|XP_003578345.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like isoform X1 [Brachypodium distachyon]
Length=307

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  244  HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLA  423
            HG LDEQI QL+QCKPL+E E+R LC KAKE+LM+ESNVQPV+SPVTICGDIHGQFHDLA
Sbjct  5    HGGLDEQIEQLLQCKPLAEPELRALCGKAKEVLMEESNVQPVRSPVTICGDIHGQFHDLA  64

Query  424  ELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            ELFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  65   ELFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  99



>gb|ABO16371.1| serine/threonine-protein phosphatase PP2A-1 catalytic subunit 
[Triticum aestivum]
Length=313

 Score =   179 bits (455),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = +1

Query  223  SVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIH  402
            SV SS   G LD QI QL+QC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTICGDIH
Sbjct  5    SVDSSGC-GGLDAQIEQLLQCRPLAEQEVKALCEKAKEILMEESNVQPVKSPVTICGDIH  63

Query  403  GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            GQFHDL ELFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  64   GQFHDLVELFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  105



>ref|NP_001049084.1| Os03g0167700 [Oryza sativa Japonica Group]
 gb|ABF94175.1| Serine/threonine protein phosphatase PP2A-4 catalytic subunit, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10998.1| Os03g0167700 [Oryza sativa Japonica Group]
 dbj|BAG91656.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92783.1| unnamed protein product [Oryza sativa Japonica Group]
Length=314

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +1

Query  223  SVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIH  402
            SV      G LD QI QLMQC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTICGDIH
Sbjct  5    SVDGGGGCGGLDTQIEQLMQCRPLAEQEVKALCEKAKEILMEESNVQPVKSPVTICGDIH  64

Query  403  GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            GQFHDL ELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  65   GQFHDLVELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|NP_001189732.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
 gb|AEC10129.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit 
[Arabidopsis thaliana]
Length=171

 Score =   174 bits (442),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 94/106 (89%), Gaps = 4/106 (4%)
 Frame = +1

Query  220  DSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDI  399
            +S+P+ A   +LDEQI+QLMQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDI
Sbjct  4    NSIPTDATI-DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDI  62

Query  400  HGQFHDLAELFRI---GGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HGQFHDLAELF +     +CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   HGQFHDLAELFLLIFSFLQCPDTNYLFMGDYVDRGYYSVETVTLLV  108



>ref|XP_006649459.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Oryza brachyantha]
Length=314

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +1

Query  223  SVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIH  402
            SV      G LD QI QLMQC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTICGDIH
Sbjct  5    SVDGGGGCGGLDTQIEQLMQCRPLAEQEVKALCEKAKEILMEESNVQPVKSPVTICGDIH  64

Query  403  GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            GQFHDL ELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  65   GQFHDLVELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>gb|EMT31063.1| Serine/threonine-protein phosphatase PP2A-4 catalytic subunit 
[Aegilops tauschii]
Length=321

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  247  GNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAE  426
            G LD QI QL+QC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFHDL E
Sbjct  12   GGLDAQIEQLLQCRPLAEQEVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVE  71

Query  427  LFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            LFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  72   LFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  105



>gb|KCW52394.1| hypothetical protein EUGRSUZ_J01802 [Eucalyptus grandis]
Length=228

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  247  GNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAE  426
              +D  ++QL+QCKPLSEQ+VRVLCEKAKEILM+E NVQPVKSPVTICGDIHGQFHDLAE
Sbjct  13   AGIDGHVSQLLQCKPLSEQQVRVLCEKAKEILMEEDNVQPVKSPVTICGDIHGQFHDLAE  72

Query  427  LFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            LFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  73   LFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  106



>gb|EMS59938.1| Serine/threonine-protein phosphatase PP2A-4 catalytic subunit 
[Triticum urartu]
Length=375

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = +1

Query  223  SVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIH  402
            SV SS   G LD QI QL+QC+PL+EQEV+ LCEKAKEILM+ESNVQPVKSPVTICGDIH
Sbjct  59   SVDSSGC-GGLDAQIEQLLQCRPLAEQEVKALCEKAKEILMEESNVQPVKSPVTICGDIH  117

Query  403  GQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            GQFHDL ELFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  118  GQFHDLVELFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  159



>gb|KCW52395.1| hypothetical protein EUGRSUZ_J01802 [Eucalyptus grandis]
Length=251

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  247  GNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAE  426
              +D  ++QL+QCKPLSEQ+VRVLCEKAKEILM+E NVQPVKSPVTICGDIHGQFHDLAE
Sbjct  13   AGIDGHVSQLLQCKPLSEQQVRVLCEKAKEILMEEDNVQPVKSPVTICGDIHGQFHDLAE  72

Query  427  LFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            LFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  73   LFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  106



>gb|EMS47396.1| Serine/threonine-protein phosphatase PP2A-2 catalytic subunit 
[Triticum urartu]
Length=262

 Score =   176 bits (446),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  247  GNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAE  426
            G LDEQI QL+QCKPL E E++ LCEKAKEILM+ESNVQPV+SPVTICGDIHGQFHDLAE
Sbjct  6    GGLDEQIEQLLQCKPLVEPELKALCEKAKEILMEESNVQPVRSPVTICGDIHGQFHDLAE  65

Query  427  LFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            LFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  66   LFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  99



>ref|XP_004983161.1| PREDICTED: putative serine/threonine-protein phosphatase PP2A-4 
catalytic subunit-like [Setaria italica]
Length=315

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  253  LDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF  432
            LD QI QLM+C+PL E EVR LCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL ELF
Sbjct  16   LDAQIEQLMECRPLPETEVRALCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLVELF  75

Query  433  RIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            RIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  76   RIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  107



>ref|XP_010032900.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Eucalyptus grandis]
 gb|KCW52392.1| hypothetical protein EUGRSUZ_J01802 [Eucalyptus grandis]
Length=314

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  247  GNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAE  426
              +D  ++QL+QCKPLSEQ+VRVLCEKAKEILM+E NVQPVKSPVTICGDIHGQFHDLAE
Sbjct  13   AGIDGHVSQLLQCKPLSEQQVRVLCEKAKEILMEEDNVQPVKSPVTICGDIHGQFHDLAE  72

Query  427  LFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            LFRIGGKCPDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  73   LFRIGGKCPDTNYLFMGDYVDRGYYSVETVSLLV  106



>sp|P0C5D7.1|PP2A4_ORYSI RecName: Full=Putative serine/threonine-protein phosphatase PP2A-4 
catalytic subunit [Oryza sativa Indica Group]
 gb|AAD48068.1|AF173881_1 serine/threonine protein phosphatase PP2A-4 catalytic subunit 
[Oryza sativa Indica Group]
Length=315

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  253  LDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF  432
            LD QI QLM+C+PLSE EV+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFHDL ELF
Sbjct  16   LDAQIEQLMECRPLSETEVKTLCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVELF  75

Query  433  RIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            RIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  76   RIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  107



>ref|NP_001064578.1| Os10g0410600 [Oryza sativa Japonica Group]
 sp|A3C4N5.2|PP2A4_ORYSJ RecName: Full=Serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit [Oryza sativa Japonica Group]
 gb|ABB47590.1| Serine/threonine protein phosphatase PP2A-4 catalytic subunit, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26492.1| Os10g0410600 [Oryza sativa Japonica Group]
 dbj|BAG94218.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50943.1| hypothetical protein OsJ_31490 [Oryza sativa Japonica Group]
Length=314

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  253  LDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF  432
            LD QI QLM+C+PLSE EV+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFHDL ELF
Sbjct  15   LDAQIEQLMECRPLSEPEVKTLCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVELF  74

Query  433  RIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            RIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  75   RIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_006661767.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic 
subunit-like [Oryza brachyantha]
Length=314

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  253  LDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF  432
            LD QI QLM+C+PLSE EV+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFHDL ELF
Sbjct  15   LDAQIEQLMECRPLSEPEVKTLCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVELF  74

Query  433  RIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            RIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  75   RIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  106



>ref|XP_002467261.1| hypothetical protein SORBIDRAFT_01g022230 [Sorghum bicolor]
 gb|EER94259.1| hypothetical protein SORBIDRAFT_01g022230 [Sorghum bicolor]
Length=315

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  253  LDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF  432
            LD QI QLM+C+PL+E EV+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFHDL ELF
Sbjct  16   LDAQIEQLMECRPLAETEVKTLCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVELF  75

Query  433  RIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            RIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  76   RIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  107



>gb|KDO70820.1| hypothetical protein CISIN_1g021077mg [Citrus sinensis]
Length=317

 Score =   175 bits (443),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 92/103 (89%), Gaps = 4/103 (4%)
 Frame = +1

Query  232  SSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQF  411
            S+    +LDEQI+QLMQCKPLSE +V+ LCEKAKEILM+ESNVQPVKSPVTICGDIHGQF
Sbjct  7    STDTTTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQF  66

Query  412  HDLAELFRIGGK----CPDTNYLFMGDYVDRGYYSVETXTLLV  528
            HDLAELF+IGGK    CPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  67   HDLAELFQIGGKCPQECPDTNYLFMGDYVDRGYYSVETVTLLV  109



>ref|NP_001150190.1| PP2Ac-4 - Phosphatase 2A isoform 4 belonging to family 2 [Zea 
mays]
 gb|ACG38181.1| PP2Ac-4 - Phosphatase 2A isoform 4 belonging to family 2 [Zea 
mays]
 tpg|DAA50020.1| TPA: putative serine/threonine protein phosphatase superfamily 
protein [Zea mays]
Length=315

 Score =   174 bits (441),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  208  MSSMDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTI  387
            M  + S       G LD QI QLM+C+PL E EV+ LCEKAKEILM+ESNVQPVKSPVTI
Sbjct  1    MEDLASSRGGGGCGGLDAQIEQLMECRPLPETEVKTLCEKAKEILMEESNVQPVKSPVTI  60

Query  388  CGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            CGDIHGQFHDL ELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   CGDIHGQFHDLLELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  107



>gb|KHG30742.1| Serine/threonine-protein phosphatase PP2A-4 catalytic subunit 
-like protein [Gossypium arboreum]
Length=364

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 98/156 (63%), Gaps = 52/156 (33%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQE------------------------------  306
            M+S   S +HGNLDEQI+QLMQCKPLSEQE                              
Sbjct  1    MESSVGSNSHGNLDEQISQLMQCKPLSEQEQLVLNPPVKKFASVGKSHLNGGDSKGTDLS  60

Query  307  ----------------------VRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
                                  VR LC+KAKEILMDESNVQPVKSPVTICGDIHGQFHDL
Sbjct  61   ICSTYFNFCTITSNALAPVASKVRALCDKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  120

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            AELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  121  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLV  156



>gb|AAQ67227.1| protein phosphatase 2A catalytic subunit [Nicotiana benthamiana]
Length=109

 Score =   167 bits (423),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +HG+LD+QIAQLM+CKPLSE EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHGDLDQQIAQLMECKPLSEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_009794958.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Nicotiana sylvestris]
Length=123

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +HG+LD QIAQLM+CKPLSE EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHGDLDRQIAQLMECKPLSEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_010524846.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Tarenaya hassleriana]
Length=292

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  277  MQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELFRIGGKCPD  456
            MQCKPLSEQ+VR LCEKAKEILM+ESNVQPVKSPVTICGDIHGQFHDLAELFRIGGKCPD
Sbjct  1    MQCKPLSEQQVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFRIGGKCPD  60

Query  457  TNYLFMGDYVDRGYYSVETXTLLV  528
            TNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   TNYLFMGDYVDRGYYSVETVTLLV  84



>gb|ACT53402.1| protein phosphatase 2Ac [Brassica juncea]
Length=292

 Score =   171 bits (434),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  277  MQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELFRIGGKCPD  456
            MQCKPLSEQ+VR LCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELFRIGG CPD
Sbjct  1    MQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELFRIGGMCPD  60

Query  457  TNYLFMGDYVDRGYYSVETXTLLV  528
            TNYLFMGDYVDRGYYSVET TLLV
Sbjct  61   TNYLFMGDYVDRGYYSVETVTLLV  84



>gb|EPS58516.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=126

 Score =   163 bits (413),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
             HG+L+ QI QLM+CKPLSE EV++LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    GHGDLERQIEQLMECKPLSEAEVKILCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_775087.1| hypothetical protein CNBE3610 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL20440.1| hypothetical protein CNBE3610 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=308

 Score =   169 bits (427),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  238  AAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHD  417
            AA+ ++D  IAQLMQCKPLSE EV+ LC+KA+E+LM+ESNVQPV+ PVT+CGDIHGQFHD
Sbjct  2    AANDDVDAWIAQLMQCKPLSEPEVKKLCDKAREVLMEESNVQPVRCPVTVCGDIHGQFHD  61

Query  418  LAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            L+ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   LSELFRIGGNSPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_570929.1| protein phosphatase type 2A [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|AAW43622.1| protein phosphatase type 2A, putative [Cryptococcus neoformans 
var. neoformans JEC21]
 gb|AFR95643.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
neoformans var. grubii H99]
Length=306

 Score =   169 bits (427),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  238  AAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHD  417
            AA+ ++D  IAQLMQCKPLSE EV+ LC+KA+E+LM+ESNVQPV+ PVT+CGDIHGQFHD
Sbjct  2    AANDDVDAWIAQLMQCKPLSEPEVKKLCDKAREVLMEESNVQPVRCPVTVCGDIHGQFHD  61

Query  418  LAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            L+ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   LSELFRIGGNSPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KHG29677.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Gossypium 
arboreum]
Length=262

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +HG+LD QI  LMQCKPLSE EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHGDLDRQIEHLMQCKPLSETEVKTLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGHAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|EYU28672.1| hypothetical protein MIMGU_mgv1a0106401mg, partial [Erythranthe 
guttata]
Length=123

 Score =   162 bits (411),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
             HG+LD Q+ QLM+CKPLSE EV++LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    GHGDLDRQLEQLMECKPLSEAEVKILCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  63   IELFRIGGNTPDTNYLFMGDYVDRGYYSVETVSLLV  98



>ref|XP_006439708.1| hypothetical protein CICLE_v100212822mg, partial [Citrus clementina]
 gb|ESR52948.1| hypothetical protein CICLE_v100212822mg, partial [Citrus clementina]
Length=177

 Score =   164 bits (415),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 86/101 (85%), Gaps = 3/101 (3%)
 Frame = +1

Query  226  VPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHG  405
            +PS A   +LD QI  LMQCKPL EQEV++LCE+A+ IL++E NVQPVK PVT+CGDIHG
Sbjct  1    MPSQA---DLDRQIEHLMQCKPLPEQEVKILCEQARAILVEEWNVQPVKCPVTVCGDIHG  57

Query  406  QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            QFHDL ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  58   QFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_003194363.1| serine/threonine protein phosphatase 2A, catalytic subunit [Cryptococcus 
gattii WM276]
 gb|ADV22576.1| Serine/threonine protein phosphatase 2A, catalytic subunit, putative 
[Cryptococcus gattii WM276]
 gb|KGB79483.1| protein phosphatase type 2A [Cryptococcus gattii R265]
 gb|KIR29054.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii LA55]
 gb|KIR34755.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii MMRL2647]
 gb|KIR38215.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii Ram5]
 gb|KIR46055.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii CA1280]
 gb|KIR51657.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii Ru294]
 gb|KIR58917.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii CA1873]
 gb|KIR73646.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii CA1014]
 gb|KIR78334.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii EJB2]
 gb|KIR93136.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii CBS 10090]
 gb|KIR99600.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii 2001/935-1]
 gb|KIY33139.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii E566]
 gb|KIY58207.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii 99/473]
 gb|KJE02848.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii NT-10]
Length=306

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  238  AAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHD  417
            +A+ ++D  IAQLMQCKPLSE EV+ LC+KA+E+LM+ESNVQPV+ PVT+CGDIHGQFHD
Sbjct  2    SANDDVDAWIAQLMQCKPLSEPEVKKLCDKAREVLMEESNVQPVRCPVTVCGDIHGQFHD  61

Query  418  LAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            L+ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   LSELFRIGGNSPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KIR84922.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Cryptococcus 
gattii IND107]
Length=306

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +1

Query  238  AAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHD  417
            +A+ ++D  IAQLMQCKPLSE EV+ LC+KA+E+LM+ESNVQPV+ PVT+CGDIHGQFHD
Sbjct  2    SANDDVDAWIAQLMQCKPLSEPEVKKLCDKAREVLMEESNVQPVRCPVTVCGDIHGQFHD  61

Query  418  LAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            L+ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   LSELFRIGGNSPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KDO69851.1| hypothetical protein CISIN_1g021898mg [Citrus sinensis]
Length=185

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +1

Query  226  VPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHG  405
            +PS A   +LD QI  LMQCKPL EQEV +LCE+A+ IL++E NVQPVK PVT+CGDIHG
Sbjct  1    MPSQA---DLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHG  57

Query  406  QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            QFHDL ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  58   QFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_009617643.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Nicotiana tomentosiformis]
Length=306

 Score =   166 bits (420),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +HG+LD QIAQLM+CKPLSE EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHGDLDRQIAQLMECKPLSEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KJB39864.1| hypothetical protein B456_007G034300 [Gossypium raimondii]
Length=262

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +HG+LD QI  LMQCKPLS  EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHGDLDRQIEHLMQCKPLSVAEVKTLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGHAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|AAQ67228.1| protein phosphatase 2A catalytic subunit [Nicotiana benthamiana]
Length=93

 Score =   158 bits (400),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +HG+LD QIAQLM+CKPL+E EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHGDLDRQIAQLMECKPLAEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVET  513
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET
Sbjct  63   IELFRIGGTAPDTNYLFMGDYVDRGYYSVET  93



>gb|KJB39865.1| hypothetical protein B456_007G034300 [Gossypium raimondii]
Length=311

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +HG+LD QI  LMQCKPLS  EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHGDLDRQIEHLMQCKPLSVAEVKTLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGHAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|AAL84295.1|AC073556_12 serine/threonine protein phosphatase PP2A-4 catalytic subunit 
[Oryza sativa Japonica Group]
 gb|EEC74589.1| hypothetical protein OsI_10169 [Oryza sativa Indica Group]
Length=340

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 90/128 (70%), Gaps = 26/128 (20%)
 Frame = +1

Query  223  SVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQ-------------  363
            SV      G LD QI QLMQC+PL+EQEV+ LCEKAKEILM+ESNVQ             
Sbjct  5    SVDGGGGCGGLDTQIEQLMQCRPLAEQEVKALCEKAKEILMEESNVQIAHSMCTYNSAKT  64

Query  364  -------------PVKSPVTICGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYS  504
                         PVKSPVTICGDIHGQFHDL ELFRIGGKCPDTNYLFMGDYVDRGYYS
Sbjct  65   FSKYLHVLFHGNLPVKSPVTICGDIHGQFHDLVELFRIGGKCPDTNYLFMGDYVDRGYYS  124

Query  505  VETXTLLV  528
            VET TLLV
Sbjct  125  VETVTLLV  132



>gb|KDP31176.1| hypothetical protein JCGZ_11552 [Jatropha curcas]
Length=306

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +HG+LD QI  LMQCKPL E EV+ LCE+A+ +L++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHGDLDRQIEHLMQCKPLPEGEVKTLCEQARAVLVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGGK P+TNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGKAPNTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_011086438.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Sesamum indicum]
Length=306

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
             HG+LD QI QLM+CKPLSE EV++LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    VHGDLDRQIEQLMECKPLSEAEVKILCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KDO69850.1| hypothetical protein CISIN_1g021898mg [Citrus sinensis]
Length=250

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +1

Query  226  VPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHG  405
            +PS A   +LD QI  LMQCKPL EQEV +LCE+A+ IL++E NVQPVK PVT+CGDIHG
Sbjct  1    MPSQA---DLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHG  57

Query  406  QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            QFHDL ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  58   QFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KJB39863.1| hypothetical protein B456_007G034300 [Gossypium raimondii]
Length=306

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +HG+LD QI  LMQCKPLS  EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHGDLDRQIEHLMQCKPLSVAEVKTLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGHAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KHG01412.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Gossypium 
arboreum]
 gb|KJB50848.1| hypothetical protein B456_008G189700 [Gossypium raimondii]
 gb|KJB50849.1| hypothetical protein B456_008G189700 [Gossypium raimondii]
Length=306

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +HG+LD QI  LMQCKPL E EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHGDLDRQIEHLMQCKPLPEVEVKTLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KJB14785.1| hypothetical protein B456_002G142800 [Gossypium raimondii]
Length=228

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            + G+LD QI  LM+CKPLSE EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SQGDLDRQIEHLMECKPLSEAEVKALCEQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>dbj|BAO57273.1| protein phosphatase 2A [Ipomoea nil]
Length=306

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI QLM CKPL+EQEV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHADLDRQIEQLMDCKPLTEQEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGGK PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGKAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_007099755.1| Phosphatase 2A-2 isoform 2 [Theobroma cacao]
 gb|EOY20300.1| Phosphatase 2A-2 isoform 2 [Theobroma cacao]
Length=285

 Score =   163 bits (413),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI  LMQCKPLSE EV  LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHSDLDRQIEHLMQCKPLSEAEVMTLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_007005885.1| hypothetical protein TREMEDRAFT_74197 [Tremella mesenterica DSM 
1558]
 gb|EIW68184.1| hypothetical protein TREMEDRAFT_74197 [Tremella mesenterica DSM 
1558]
Length=305

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  253  LDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF  432
            +D  IAQLM CKPLSE++V++LC KA+E+LMDESNVQPV+ PVT+CGDIHGQFHDL+ELF
Sbjct  6    VDGWIAQLMLCKPLSEEQVKMLCTKAREVLMDESNVQPVRCPVTVCGDIHGQFHDLSELF  65

Query  433  RIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            RIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  66   RIGGNSPDTNYLFMGDYVDRGYYSVETVTLLV  97



>ref|XP_011042637.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Populus euphratica]
Length=306

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI  LMQCKPL+E EV+ LCE+A+ +L++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHADLDRQIEHLMQCKPLAEAEVKALCEQARAVLVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_007099754.1| Phosphatase 2A-2 isoform 1 [Theobroma cacao]
 gb|EOY20299.1| Phosphatase 2A-2 isoform 1 [Theobroma cacao]
Length=306

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI  LMQCKPLSE EV  LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHSDLDRQIEHLMQCKPLSEAEVMTLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|EEE58392.1| hypothetical protein OsJ_09554 [Oryza sativa Japonica Group]
Length=403

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 90/128 (70%), Gaps = 26/128 (20%)
 Frame = +1

Query  223  SVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQ-------------  363
            SV      G LD QI QLMQC+PL+EQEV+ LCEKAKEILM+ESNVQ             
Sbjct  2    SVDGGGGCGGLDTQIEQLMQCRPLAEQEVKALCEKAKEILMEESNVQIAHSMCTYNSAKT  61

Query  364  -------------PVKSPVTICGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYS  504
                         PVKSPVTICGDIHGQFHDL ELFRIGGKCPDTNYLFMGDYVDRGYYS
Sbjct  62   FSKYLHVLFHGNLPVKSPVTICGDIHGQFHDLVELFRIGGKCPDTNYLFMGDYVDRGYYS  121

Query  505  VETXTLLV  528
            VET TLLV
Sbjct  122  VETVTLLV  129



>ref|XP_002511484.1| protein phsophatase-2a, putative [Ricinus communis]
 gb|EEF52086.1| protein phsophatase-2a, putative [Ricinus communis]
Length=306

 Score =   163 bits (413),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI  LMQCKPLSE EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHVDLDRQIEHLMQCKPLSEGEVKALCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_002314628.1| type 2A protein phosphtase-II [Populus trichocarpa]
 gb|EEF00799.1| type 2A protein phosphtase-II [Populus trichocarpa]
Length=307

 Score =   163 bits (413),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 2/101 (2%)
 Frame = +1

Query  226  VPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHG  405
            +PSS  HG+LD QI QLM+CKPL E EV+ LC++A+ IL++E NVQPVK PVTICGDIHG
Sbjct  1    MPSS--HGDLDRQIEQLMECKPLGEAEVKTLCDQARAILVEEWNVQPVKCPVTICGDIHG  58

Query  406  QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            QF+DL ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  59   QFYDLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  99



>ref|XP_010272152.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Nelumbo nucifera]
Length=306

 Score =   163 bits (413),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI  LM+CKPLSE EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHADLDRQIEHLMECKPLSEAEVKALCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_010548215.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit isoform X1 [Tarenaya hassleriana]
Length=306

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +1

Query  238  AAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHD  417
            +A+G+LD QI QLM+CKPLSE EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+D
Sbjct  2    SANGDLDRQIEQLMECKPLSEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYD  61

Query  418  LAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            L ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   LIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KFM58898.1| hypothetical protein X975_00926, partial [Stegodyphus mimosarum]
Length=105

 Score =   157 bits (396),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  238  AAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHD  417
            +A   LD  I QL +CK L+E +V+ LCEKAKEIL  ESNVQ VK PVT+CGD+HGQFHD
Sbjct  5    SALKELDSWIEQLNECKQLTENQVKTLCEKAKEILAKESNVQEVKCPVTVCGDVHGQFHD  64

Query  418  LAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            L ELFRIGGK PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  65   LMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLV  101



>gb|ACO09577.1| Serine/threonine-protein phosphatase 2A catalytic subunit beta 
isoform [Osmerus mordax]
Length=116

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +1

Query  253  LDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF  432
            LD+ + QL +CK LSE +VR LCEKAKEIL  ESNVQ V+ PVT+CGD+HGQFHDL ELF
Sbjct  10   LDQWVEQLNECKQLSENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELF  69

Query  433  RIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            RIGGK PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  70   RIGGKSPDTNYLFMGDYVDRGYYSVETVTLLV  101



>ref|XP_011043021.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Populus euphratica]
Length=307

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 87/101 (86%), Gaps = 2/101 (2%)
 Frame = +1

Query  226  VPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHG  405
            +PSS  HG+LD QI QLM+CKPL E EV+ LC++A+ IL++E NVQPVK PVT+CGDIHG
Sbjct  1    MPSS--HGDLDRQIEQLMECKPLGEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHG  58

Query  406  QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            QF+DL ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  59   QFYDLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  99



>ref|XP_011034152.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Populus euphratica]
Length=307

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 2/101 (2%)
 Frame = +1

Query  226  VPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHG  405
            +PSS  HG+LD QI QLM+CKPL+E EV+ LC++A+ IL++E NVQPVK PVT+CGDIHG
Sbjct  1    MPSS--HGDLDRQIEQLMECKPLAEGEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHG  58

Query  406  QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            QF+DL ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  59   QFYDLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  99



>ref|XP_002980611.1| hypothetical protein SELMODRAFT_178363 [Selaginella moellendorffii]
 gb|EFJ18262.1| hypothetical protein SELMODRAFT_178363 [Selaginella moellendorffii]
Length=306

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI QL +CKPLSE EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHNDLDRQIEQLWECKPLSELEVKNLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGGK PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGKAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_002976892.1| hypothetical protein SELMODRAFT_175936 [Selaginella moellendorffii]
 gb|EFJ22002.1| hypothetical protein SELMODRAFT_175936 [Selaginella moellendorffii]
Length=308

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI QL +CKPLSE EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHNDLDRQIEQLWECKPLSELEVKNLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGGK PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGKAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_002311784.1| type 2A protein phosphtase-II [Populus trichocarpa]
 gb|EEE89151.1| type 2A protein phosphtase-II [Populus trichocarpa]
Length=307

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 2/101 (2%)
 Frame = +1

Query  226  VPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHG  405
            +PSS  HG+LD QI QLM+CKPL+E EV+ LC++A+ IL++E NVQPVK PVT+CGDIHG
Sbjct  1    MPSS--HGDLDRQIEQLMECKPLAEGEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHG  58

Query  406  QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            QF+DL ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  59   QFYDLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  99



>ref|XP_009369391.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Pyrus x bretschneideri]
 ref|XP_009346731.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Pyrus x bretschneideri]
Length=306

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +1

Query  244  HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLA  423
            H +LD QI  LMQCKPL E EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL 
Sbjct  4    HADLDRQIEHLMQCKPLPEAEVKTLCEQARTILVEEWNVQPVKCPVTVCGDIHGQFHDLV  63

Query  424  ELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  64   ELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_008374500.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Malus domestica]
Length=306

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +1

Query  244  HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLA  423
            H +LD QI  LMQCKPL E EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL 
Sbjct  4    HADLDRQIEHLMQCKPLPEAEVKTLCEQARTILVEEWNVQPVKCPVTVCGDIHGQFHDLV  63

Query  424  ELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  64   ELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|NP_001046300.1| Os02g0217600 [Oryza sativa Japonica Group]
 sp|Q0E2S4.1|PP2A3_ORYSJ RecName: Full=Serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Oryza sativa Japonica Group]
 sp|A2X2G3.2|PP2A3_ORYSI RecName: Full=Serine/threonine-protein phosphatase PP2A-3 catalytic 
subunit [Oryza sativa Indica Group]
 gb|AAD41126.1|AF159061_1 serine/threonine protein phosphatase PP2A-3 catalytic subunit 
[Oryza sativa Indica Group]
 dbj|BAD17174.1| Serine/threonine protein phosphatase PP2A-3 catalytic subunit 
[Oryza sativa Japonica Group]
 dbj|BAF08214.1| Os02g0217600 [Oryza sativa Japonica Group]
 dbj|BAG93094.1| unnamed protein product [Oryza sativa Japonica Group]
Length=307

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 2/101 (2%)
 Frame = +1

Query  226  VPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHG  405
            +PSS  HG+LD QIAQL +CK L+E EVR LCE+AK ILM+E NVQPV+ PVT+CGDIHG
Sbjct  1    MPSS--HGDLDRQIAQLRECKHLAEGEVRALCEQAKAILMEEWNVQPVRCPVTVCGDIHG  58

Query  406  QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            QF+DL ELFRIGG+ PDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  59   QFYDLIELFRIGGEAPDTNYLFMGDYVDRGYYSVETVSLLV  99



>ref|XP_006476703.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like isoform X1 [Citrus sinensis]
Length=306

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +1

Query  226  VPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHG  405
            +PS A   +LD QI  LMQCKPL EQEV +LCE+A+ IL++E NVQPVK PVT+CGDIHG
Sbjct  1    MPSQA---DLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHG  57

Query  406  QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            QFHDL ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  58   QFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KDO69849.1| hypothetical protein CISIN_1g021898mg [Citrus sinensis]
Length=306

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +1

Query  226  VPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHG  405
            +PS A   +LD QI  LMQCKPL EQEV +LCE+A+ IL++E NVQPVK PVT+CGDIHG
Sbjct  1    MPSQA---DLDRQIEHLMQCKPLPEQEVNILCEQARAILVEEWNVQPVKCPVTVCGDIHG  57

Query  406  QFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            QFHDL ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  58   QFHDLVELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KJB61146.1| hypothetical protein B456_009G346100 [Gossypium raimondii]
Length=228

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            + G+L+ QI QLM+CKPLSE EV+ LCE+A+ +L++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SQGDLERQIEQLMECKPLSEAEVKALCEQARAVLVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVSLLV  98



>ref|XP_011028671.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit-like [Populus euphratica]
Length=306

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI  LMQCKPL+E EV+ LCE+A+ +L++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHVDLDRQIEHLMQCKPLAEAEVKALCEQARAVLVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_002318007.1| type 2A protein phosphatase-2 [Populus trichocarpa]
 ref|XP_006376828.1| hypothetical protein POPTR_0012s07510g [Populus trichocarpa]
 gb|EEE96227.1| type 2A protein phosphatase-2 [Populus trichocarpa]
 gb|ERP54625.1| hypothetical protein POPTR_0012s07510g [Populus trichocarpa]
Length=306

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI  LMQCKPL+E EV+ LCE+A+ +L++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHVDLDRQIEHLMQCKPLAEAEVKALCEQARAVLVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_002321547.1| type 2A protein phosphatase-2 [Populus trichocarpa]
 gb|EEF05674.1| type 2A protein phosphatase-2 [Populus trichocarpa]
Length=306

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI  LMQCKPL+E EV+ LCE+A+ +L++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHVDLDRQIEHLMQCKPLAEAEVKALCEQARAVLVEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   VELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_007209386.1| hypothetical protein PRUPE_ppa009100mg [Prunus persica]
 ref|XP_008239681.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Prunus mume]
 gb|EMJ10585.1| hypothetical protein PRUPE_ppa009100mg [Prunus persica]
Length=306

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +1

Query  244  HGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLA  423
            H +LD QI  LMQCKPL E EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL 
Sbjct  4    HADLDRQIEHLMQCKPLPEPEVKTLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDLV  63

Query  424  ELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  64   ELFRIGGSAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KJB14786.1| hypothetical protein B456_002G142800 [Gossypium raimondii]
Length=250

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            + G+LD QI  LM+CKPLSE EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SQGDLDRQIEHLMECKPLSEAEVKALCEQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KIZ04641.1| protein phosphatase 2 (formerly 2A), catalytic subunit, partial 
[Monoraphidium neglectum]
Length=455

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  229  PSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQ  408
            P S +  +LD QIAQLMQC+PLSE +VR LC KAKEILM E+NVQPV+ PVT+CGDIHGQ
Sbjct  331  PLSTSDDDLDAQIAQLMQCRPLSEDQVRSLCAKAKEILMQEANVQPVRCPVTVCGDIHGQ  390

Query  409  FHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            F DL ELF+IGG  PDTNYLFMGDYVDRGY+SVET +LLV
Sbjct  391  FSDLLELFKIGGNSPDTNYLFMGDYVDRGYHSVETASLLV  430



>ref|XP_010795259.1| PREDICTED: serine/threonine-protein phosphatase 2A catalytic 
subunit beta isoform-like [Notothenia coriiceps]
Length=123

 Score =   156 bits (395),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +1

Query  253  LDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF  432
            LD+ I QL +CK LSE +VR LCEKAKEIL  ESNVQ V+ PVT+CGD+HGQFHDL ELF
Sbjct  10   LDQWIEQLNECKQLSENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELF  69

Query  433  RIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            +IGGK PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  70   KIGGKSPDTNYLFMGDYVDRGYYSVETVTLLV  101



>ref|XP_010683355.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Beta vulgaris subsp. vulgaris]
Length=306

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI QLM+CKPLSE EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHADLDRQIEQLMECKPLSEGEVKTLCDQARAILLEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_010044680.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Eucalyptus grandis]
 gb|KCW86777.1| hypothetical protein EUGRSUZ_B03386 [Eucalyptus grandis]
Length=306

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI QLM+CKPLSE EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHADLDRQIEQLMECKPLSEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_001430431.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK63033.1| unnamed protein product [Paramecium tetraurelia]
Length=177

 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  217  MDSVPSSAAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGD  396
            M S  ++    NLD QI  L QCKPL EQ+V+ +CEKAKEIL++ESNVQPV++PV ICGD
Sbjct  1    MASKLNTVEATNLDHQIQHLYQCKPLPEQDVKQICEKAKEILIEESNVQPVRAPVIICGD  60

Query  397  IHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            IHGQFHDL ELF+IGGK PDTNYLFMGDYVDRG++SVE  TLLV
Sbjct  61   IHGQFHDLMELFKIGGKAPDTNYLFMGDYVDRGHHSVECVTLLV  104



>gb|EAW63433.1| protein phosphatase 2 (formerly 2A), catalytic subunit, beta 
isoform, isoform CRA_a [Homo sapiens]
Length=128

 Score =   156 bits (395),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +1

Query  238  AAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHD  417
            A    LD+ + QL +CK L+E +VR LCEKAKEIL  ESNVQ V+ PVT+CGD+HGQFHD
Sbjct  5    AFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHD  64

Query  418  LAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            L ELFRIGGK PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  65   LMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLV  101



>ref|XP_009623853.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Nicotiana tomentosiformis]
 ref|XP_009623854.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit [Nicotiana tomentosiformis]
Length=306

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H ++D QI QLM+CKPLSE EV++LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHADVDRQIEQLMECKPLSEAEVKILCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_010552612.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Tarenaya hassleriana]
Length=306

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            A G+LD QI QLM+CKPLSE EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    ATGDLDRQIEQLMECKPLSEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   LELFRIGGAAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_010532914.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Tarenaya hassleriana]
Length=306

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            A G+LD QI QL+QCKPLSE EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    ATGDLDRQIEQLLQCKPLSEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   LELFRIGGAAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_010087741.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Morus 
notabilis]
 gb|EXB29774.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Morus 
notabilis]
Length=307

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI  LMQCKPL E EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQFHDL
Sbjct  4    SHSDLDRQIEHLMQCKPLPEAEVKTLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFHDL  63

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  64   VELFRIGGSAPDTNYLFMGDYVDRGYYSVETVSLLV  99



>ref|XP_006843155.1| hypothetical protein AMTR_s00146p00037590 [Amborella trichopoda]
 gb|ERN04830.1| hypothetical protein AMTR_s00146p00037590 [Amborella trichopoda]
Length=306

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI  LM+CK L E EV+ LCE+A+ ILM+E NVQPVK PVT+CGDIHGQFHDL
Sbjct  3    SHADLDRQIEHLMECKFLPESEVKALCEQARAILMEEWNVQPVKCPVTVCGDIHGQFHDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGGK PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGKAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_002888746.1| hypothetical protein ARALYDRAFT_476122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65005.1| hypothetical protein ARALYDRAFT_476122 [Arabidopsis lyrata subsp. 
lyrata]
Length=307

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            A G++D QI QLM+CKPLSE EV++LCE+AK IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  4    ATGDIDRQIEQLMECKPLSETEVKMLCEQAKTILVEEYNVQPVKCPVTVCGDIHGQFYDL  63

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  64   IELFRIGGSAPDTNYLFMGDYVDRGYYSVETVSLLV  99



>ref|XP_010418840.1| PREDICTED: serine/threonine-protein phosphatase PP2A-1 catalytic 
subunit-like [Camelina sativa]
Length=278

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            ++G+LD QI QLM+CKPL E +VR+LC++AK IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SNGDLDRQIEQLMECKPLGEADVRILCDQAKAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVSLLV  98



>gb|KJB77098.1| hypothetical protein B456_012G120200 [Gossypium raimondii]
Length=306

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +1

Query  238  AAHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHD  417
            ++ G+LD QI QLM+CKPLSE+EV+ LCE+A+ +L++E NVQPVK PVT+CGDIHGQF+D
Sbjct  2    SSTGDLDLQIEQLMKCKPLSEEEVKALCEQARAVLVEELNVQPVKCPVTVCGDIHGQFYD  61

Query  418  LAELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
            L ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  62   LVELFRIGGNVPDTNYLFMGDYVDRGYYSVETATLLV  98



>ref|XP_006302599.1| hypothetical protein CARUB_v10020704mg [Capsella rubella]
 gb|EOA35497.1| hypothetical protein CARUB_v10020704mg [Capsella rubella]
Length=307

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            A G++D QI QLM+CKPLSE EV+ LCE+AK IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  4    ATGDIDRQIEQLMECKPLSEAEVKTLCEQAKTILVEEYNVQPVKCPVTVCGDIHGQFYDL  63

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  64   IELFRIGGSAPDTNYLFMGDYVDRGYYSVETVSLLV  99



>ref|XP_010255666.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic 
subunit [Nelumbo nucifera]
Length=306

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI  LM+CKPLSE EV+ LCE+A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHADLDRQIEHLMECKPLSEAEVKALCEQARTILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|KDO82671.1| hypothetical protein CISIN_1g021866mg [Citrus sinensis]
Length=272

 Score =   160 bits (405),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +HG+LD QI  LM+CKPL E EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHGDLDRQIEHLMECKPLPEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|AJC01347.1| serine/threonine-protein phosphatase, partial [Myrciaria dubia]
Length=306

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI QLM+CKPL+E EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHADLDRQIEQLMECKPLTEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_010511000.1| PREDICTED: serine/threonine-protein phosphatase PP2A-1 catalytic 
subunit [Camelina sativa]
Length=306

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            ++G+LD QI QLM+CKPL E +VR+LC++AK IL++E NVQPVK PVTICGDIHGQF+DL
Sbjct  3    SNGDLDRQIEQLMECKPLGEADVRILCDQAKAILVEEWNVQPVKCPVTICGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET +LLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVSLLV  98



>emb|CDP00244.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI QLM+CKPL+E EV+ LC++A+ IL++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    SHADLDRQIEQLMECKPLTEAEVKTLCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>ref|XP_010551478.1| PREDICTED: serine/threonine-protein phosphatase PP2A-2 catalytic 
subunit-like [Tarenaya hassleriana]
Length=306

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            A G+LD QI QLM+CKPLSE EV+ LC++A+ +L++E NVQPVK PVT+CGDIHGQF+DL
Sbjct  3    ATGDLDRQIEQLMECKPLSEAEVKTLCDQARAVLVEEWNVQPVKCPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   LELFRIGGAAPDTNYLFMGDYVDRGYYSVETVTLLV  98



>gb|AAA91806.1| protein phosphatase 2A [Oryza sativa Indica Group]
Length=306

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  241  AHGNLDEQIAQLMQCKPLSEQEVRVLCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDL  420
            +H +LD QI+QL +CK L E EVR LCE+AK ILM+E NVQPV+SPVT+CGDIHGQF+DL
Sbjct  3    SHADLDRQISQLRECKFLGEAEVRALCEQAKAILMEEWNVQPVRSPVTVCGDIHGQFYDL  62

Query  421  AELFRIGGKCPDTNYLFMGDYVDRGYYSVETXTLLV  528
             ELFRIGG  PDTNYLFMGDYVDRGYYSVET TLLV
Sbjct  63   IELFRIGGDSPDTNYLFMGDYVDRGYYSVETVTLLV  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400