BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H19

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHB17741.1|  MYB1                                                    270   2e-87   Actinidia chinensis
gb|AAA33067.1|  MYB1                                                    270   6e-87   Gossypium hirsutum [American cotton]
ref|XP_009623355.1|  PREDICTED: myb-related protein 330-like            268   2e-86   Nicotiana tomentosiformis
ref|XP_009767902.1|  PREDICTED: myb-related protein 330-like            267   1e-85   Nicotiana sylvestris
ref|XP_004241841.1|  PREDICTED: myb-related protein 330                 265   5e-85   Solanum lycopersicum
emb|CDP10649.1|  unnamed protein product                                265   1e-84   Coffea canephora [robusta coffee]
ref|XP_006356500.1|  PREDICTED: myb-related protein 330-like            264   2e-84   Solanum tuberosum [potatoes]
ref|XP_010061981.1|  PREDICTED: transcription repressor MYB6            264   2e-84   Eucalyptus grandis [rose gum]
ref|XP_009600359.1|  PREDICTED: myb-related protein 330-like            263   3e-84   Nicotiana tomentosiformis
gb|KJB81321.1|  hypothetical protein B456_013G139200                    263   6e-84   Gossypium raimondii
gb|AAN28270.1|  myb-like transcription factor 1                         263   7e-84   Gossypium hirsutum [American cotton]
gb|KFK32075.1|  hypothetical protein AALP_AA6G196300                    260   9e-84   Arabis alpina [alpine rockcress]
ref|XP_011096483.1|  PREDICTED: myb-related protein 330                 262   1e-83   Sesamum indicum [beniseed]
gb|AEI83425.1|  transcription factor R2R3-MYB1                          262   1e-83   Camellia sinensis [black tea]
ref|XP_009772294.1|  PREDICTED: myb-related protein 330-like            260   3e-83   Nicotiana sylvestris
ref|XP_002534486.1|  r2r3-myb transcription factor, putative            261   4e-83   Ricinus communis
gb|AGN52078.1|  MYB-related transcription factor                        259   5e-83   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010435778.1|  PREDICTED: transcription repressor MYB6-like...    258   8e-83   Camelina sativa [gold-of-pleasure]
gb|KDP34830.1|  hypothetical protein JCGZ_11192                         259   9e-83   Jatropha curcas
gb|KJB60082.1|  hypothetical protein B456_009G288900                    259   1e-82   Gossypium raimondii
gb|ABR01221.1|  MYB8                                                    259   1e-82   Gossypium hirsutum [American cotton]
ref|XP_010538928.1|  PREDICTED: transcription repressor MYB6-like       256   2e-82   Tarenaya hassleriana [spider flower]
ref|XP_010246045.1|  PREDICTED: myb-related protein 330                 258   3e-82   Nelumbo nucifera [Indian lotus]
ref|XP_008219033.1|  PREDICTED: transcription repressor MYB6-like       259   3e-82   Prunus mume [ume]
ref|XP_006288570.1|  hypothetical protein CARUB_v10001860mg             256   4e-82   Capsella rubella
ref|XP_010455338.1|  PREDICTED: transcription repressor MYB6-like       257   5e-82   
ref|XP_010421847.1|  PREDICTED: transcription repressor MYB6            256   5e-82   Camelina sativa [gold-of-pleasure]
gb|AAS19480.1|  MYB6                                                    256   7e-82   Tradescantia fluminensis [spiderwort]
ref|XP_007131703.1|  hypothetical protein PHAVU_011G034900g             256   1e-81   Phaseolus vulgaris [French bean]
ref|XP_007222954.1|  hypothetical protein PRUPE_ppa008906mg             258   1e-81   Prunus persica
ref|XP_010104477.1|  Transcription factor                               257   1e-81   Morus notabilis
ref|XP_010680433.1|  PREDICTED: transcription repressor MYB6-like       258   1e-81   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG11058.1|  Transcription factor MYB3 -like protein                 256   2e-81   Gossypium arboreum [tree cotton]
ref|XP_009134143.1|  PREDICTED: transcription repressor MYB6            253   3e-81   Brassica rapa
ref|XP_007020033.1|  Myb domain protein 3, putative                     256   3e-81   
ref|XP_009403695.1|  PREDICTED: myb-related protein 308-like            254   3e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002325546.1|  myb family transcription factor family protein     256   3e-81   Populus trichocarpa [western balsam poplar]
ref|XP_002872444.1|  ATMYB6                                             254   3e-81   
gb|EPS61539.1|  hypothetical protein M569_13258                         251   3e-81   Genlisea aurea
gb|AAS19475.1|  MYB1                                                    254   4e-81   Tradescantia fluminensis [spiderwort]
ref|XP_004299892.1|  PREDICTED: transcription repressor MYB6            256   5e-81   Fragaria vesca subsp. vesca
gb|AID23891.1|  R2R3-MYB                                                254   7e-81   Rosa hybrid cultivar
ref|XP_007137818.1|  hypothetical protein PHAVU_009G158200g             256   7e-81   Phaseolus vulgaris [French bean]
ref|XP_009418831.1|  PREDICTED: myb-related protein 308-like            253   8e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009362465.1|  PREDICTED: transcription repressor MYB6-like       255   9e-81   Pyrus x bretschneideri [bai li]
ref|XP_006397190.1|  hypothetical protein EUTSA_v10028861mg             254   9e-81   
ref|XP_004289866.1|  PREDICTED: myb-related protein 308                 253   9e-81   Fragaria vesca subsp. vesca
ref|NP_564176.2|  transcription factor MYB3                             253   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607200.1|  Myb-like transcription factor                      254   1e-80   Medicago truncatula
gb|ACJ84718.1|  unknown                                                 254   1e-80   Medicago truncatula
ref|XP_006411651.1|  hypothetical protein EUTSA_v10025886mg             254   1e-80   Eutrema salsugineum [saltwater cress]
gb|AGO33164.1|  MYB transcription factor                                252   1e-80   Narcissus tazetta subsp. chinensis
gb|AFH03053.1|  R2R3-MYB transcription factor MYB1                      254   1e-80   Epimedium sagittatum
gb|ABQ81931.1|  transcription factor MYB4                               254   2e-80   Brassica rapa var. purpuraria [purple stem mustard]
ref|XP_011004000.1|  PREDICTED: transcription repressor MYB6            254   2e-80   Populus euphratica
emb|CDX72743.1|  BnaC07g47650D                                          254   2e-80   
ref|XP_009101934.1|  PREDICTED: transcription repressor MYB4            254   2e-80   Brassica rapa
gb|KHG10399.1|  Myb-related protein                                     249   2e-80   Gossypium arboreum [tree cotton]
ref|XP_008378762.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    254   3e-80   
ref|XP_006826645.1|  hypothetical protein AMTR_s00139p00079430          252   3e-80   Amborella trichopoda
emb|CDY25747.1|  BnaA07g10350D                                          252   3e-80   Brassica napus [oilseed rape]
ref|XP_002890523.1|  hypothetical protein ARALYDRAFT_472503             252   3e-80   
gb|KHN09677.1|  Myb-related protein 308                                 253   4e-80   Glycine soja [wild soybean]
gb|AEX08668.1|  MYB transcription factor 3                              253   4e-80   Malus domestica [apple tree]
ref|XP_004141649.1|  PREDICTED: transcription repressor MYB6-like       253   4e-80   Cucumis sativus [cucumbers]
gb|AAS19476.1|  MYB2                                                    252   5e-80   Tradescantia fluminensis [spiderwort]
ref|XP_006466200.1|  PREDICTED: myb-related protein 330-like            253   5e-80   Citrus sinensis [apfelsine]
ref|XP_010930777.1|  PREDICTED: myb-related protein 308-like            251   5e-80   Elaeis guineensis
ref|XP_006426418.1|  hypothetical protein CICLE_v10026112mg             253   5e-80   Citrus clementina [clementine]
ref|XP_010912520.1|  PREDICTED: myb-related protein 308-like            251   5e-80   Elaeis guineensis
ref|XP_011001250.1|  PREDICTED: transcription repressor MYB6-like       253   5e-80   Populus euphratica
gb|KHN31220.1|  Myb-related protein 308                                 253   5e-80   Glycine soja [wild soybean]
emb|CDX90285.1|  BnaA08g16990D                                          252   7e-80   
ref|XP_006434585.1|  hypothetical protein CICLE_v10002068mg             252   7e-80   Citrus clementina [clementine]
gb|KHF99993.1|  Myb-related protein                                     248   7e-80   Gossypium arboreum [tree cotton]
ref|XP_008781556.1|  PREDICTED: myb-related protein 308-like            249   8e-80   Phoenix dactylifera
ref|XP_006376251.1|  hypothetical protein POPTR_0013s11360g             252   8e-80   
ref|XP_011001099.1|  PREDICTED: transcription repressor MYB6            252   9e-80   Populus euphratica
gb|AGS48990.1|  R2R3 MYB transcription factor 39                        249   9e-80   Salvia miltiorrhiza [Chinese salvia]
gb|AGN52100.1|  MYB-related transcription factor                        249   1e-79   Salvia miltiorrhiza [Chinese salvia]
gb|KDP29641.1|  hypothetical protein JCGZ_18803                         251   1e-79   Jatropha curcas
gb|ABR01222.1|  MYB10                                                   251   1e-79   Gossypium hirsutum [American cotton]
ref|XP_006473170.1|  PREDICTED: myb-related protein 330-like            251   1e-79   Citrus sinensis [apfelsine]
ref|XP_010543564.1|  PREDICTED: transcription repressor MYB6            251   1e-79   Tarenaya hassleriana [spider flower]
ref|XP_002325733.1|  hypothetical protein POPTR_0019s00750g             252   1e-79   Populus trichocarpa [western balsam poplar]
ref|XP_009103226.1|  PREDICTED: transcription factor MYB3-like          251   1e-79   Brassica rapa
ref|XP_009109540.1|  PREDICTED: transcription repressor MYB4            251   1e-79   Brassica rapa
ref|XP_009414444.1|  PREDICTED: myb-related protein Zm38-like           249   1e-79   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY05057.1|  BnaC03g28550D                                          249   2e-79   
ref|XP_008807672.1|  PREDICTED: myb-related protein 308-like            250   2e-79   Phoenix dactylifera
ref|XP_006645094.1|  PREDICTED: myb-related protein 330-like            250   2e-79   Oryza brachyantha
gb|ACU23165.1|  unknown                                                 251   2e-79   Glycine max [soybeans]
ref|NP_001242477.1|  uncharacterized protein LOC100808083               251   2e-79   
ref|XP_010530161.1|  PREDICTED: transcription repressor MYB6-like       249   2e-79   Tarenaya hassleriana [spider flower]
ref|XP_006359691.1|  PREDICTED: myb-related protein 308-like            249   2e-79   Solanum tuberosum [potatoes]
gb|KEH35662.1|  myb transcription factor                                251   2e-79   Medicago truncatula
ref|XP_010028718.1|  PREDICTED: myb-related protein 308-like            249   3e-79   Eucalyptus grandis [rose gum]
ref|XP_004977234.1|  PREDICTED: myb-related protein Zm38-like           247   3e-79   Setaria italica
gb|ADG46002.1|  MYB4                                                    248   3e-79   Salvia miltiorrhiza [Chinese salvia]
gb|KFK30463.1|  hypothetical protein AALP_AA7G264300                    251   3e-79   Arabis alpina [alpine rockcress]
gb|ADY38393.2|  MYB1                                                    249   3e-79   Leucaena leucocephala [cassie]
ref|XP_011046699.1|  PREDICTED: myb-related protein 308-like            249   3e-79   Populus euphratica
ref|XP_006416177.1|  hypothetical protein EUTSA_v10008456mg             250   3e-79   Eutrema salsugineum [saltwater cress]
gb|AAK19619.1|AF336286_1  GHMYB9                                        249   3e-79   Gossypium hirsutum [American cotton]
gb|KHG25834.1|  Myb-related protein                                     249   3e-79   Gossypium arboreum [tree cotton]
gb|ABH02902.1|  MYB transcription factor MYB179                         248   3e-79   Glycine max [soybeans]
dbj|BAJ34375.1|  unnamed protein product                                250   3e-79   Eutrema halophilum
gb|KJB15797.1|  hypothetical protein B456_002G196700                    249   3e-79   Gossypium raimondii
sp|P81395.1|MYB30_ANTMA  RecName: Full=Myb-related protein 330          250   3e-79   Antirrhinum majus [garden snapdragon]
gb|EYU37946.1|  hypothetical protein MIMGU_mgv1a011787mg                249   3e-79   Erythranthe guttata [common monkey flower]
ref|XP_004977235.1|  PREDICTED: myb-related protein Zm38-like           249   4e-79   Setaria italica
gb|ABP57083.1|  Myb transcription factor                                248   4e-79   Plectranthus scutellarioides
emb|CDO96923.1|  unnamed protein product                                249   4e-79   Coffea canephora [robusta coffee]
ref|XP_007137351.1|  hypothetical protein PHAVU_009G119900g             249   4e-79   Phaseolus vulgaris [French bean]
ref|XP_009418701.1|  PREDICTED: myb-related protein Zm38-like           247   4e-79   
ref|XP_008459665.1|  PREDICTED: transcription repressor MYB6-like       250   5e-79   Cucumis melo [Oriental melon]
gb|KJB59602.1|  hypothetical protein B456_009G263200                    249   5e-79   Gossypium raimondii
ref|XP_002306180.1|  myb family transcription factor family protein     249   5e-79   Populus trichocarpa [western balsam poplar]
ref|XP_009804432.1|  PREDICTED: myb-related protein 308-like            249   5e-79   Nicotiana sylvestris
ref|XP_004231034.1|  PREDICTED: myb-related protein 308-like            248   5e-79   Solanum lycopersicum
ref|XP_011092988.1|  PREDICTED: myb-related protein 308-like            249   6e-79   Sesamum indicum [beniseed]
ref|NP_001235092.1|  transcription factor MYBZ2                         248   6e-79   
ref|XP_006384572.1|  hypothetical protein POPTR_0004s18020g             249   6e-79   
ref|XP_011074956.1|  PREDICTED: myb-related protein 330-like            249   6e-79   Sesamum indicum [beniseed]
ref|XP_010431803.1|  PREDICTED: transcription repressor MYB4-like       250   6e-79   Camelina sativa [gold-of-pleasure]
ref|NP_192684.1|  transcription repressor MYB6                          248   6e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AFI80908.1|  R2R3-type MYB transcription factor                      248   7e-79   Leucaena leucocephala [cassie]
emb|CCU64156.1|  ScMYB4 protein                                         244   7e-79   Saccharum hybrid cultivar Co 86032
ref|XP_009404326.1|  PREDICTED: myb-related protein Zm38-like iso...    246   7e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEM17351.1|  R2R3-MYB transcriptional factor PvMYB4d                 248   7e-79   Panicum virgatum
ref|XP_004147038.1|  PREDICTED: myb-related protein 308-like            248   8e-79   Cucumis sativus [cucumbers]
emb|CDY12092.1|  BnaC03g60080D                                          250   8e-79   Brassica napus [oilseed rape]
ref|XP_006384381.1|  hypothetical protein POPTR_0004s14510g             250   8e-79   Populus trichocarpa [western balsam poplar]
gb|AEM17352.1|  R2R3-MYB transcriptional factor PvMYB4e                 248   8e-79   Panicum virgatum
gb|AEM17348.1|  R2R3-MYB transcriptional factor PvMYB4a                 248   8e-79   Panicum virgatum
gb|KJB47666.1|  hypothetical protein B456_008G035700                    248   8e-79   Gossypium raimondii
ref|XP_008377747.1|  PREDICTED: myb-related protein 308-like            248   8e-79   Malus domestica [apple tree]
ref|XP_004147356.1|  PREDICTED: myb-related protein 330-like            246   8e-79   
ref|XP_008653573.1|  PREDICTED: myb-related protein Hv1 isoform X2      248   8e-79   
gb|EYU22810.1|  hypothetical protein MIMGU_mgv1a010870mg                249   8e-79   Erythranthe guttata [common monkey flower]
ref|XP_009376958.1|  PREDICTED: myb-related protein 308-like            248   9e-79   Pyrus x bretschneideri [bai li]
gb|KHN39881.1|  Myb-related protein 308                                 248   9e-79   Glycine soja [wild soybean]
ref|XP_008653572.1|  PREDICTED: myb-related protein Hv1 isoform X1      248   9e-79   
ref|XP_008653574.1|  PREDICTED: myb-related protein Hv1 isoform X3      247   9e-79   Zea mays [maize]
ref|XP_010436959.1|  PREDICTED: transcription repressor MYB4 isof...    249   9e-79   
gb|AID56314.1|  MYB2                                                    248   9e-79   Eriobotrya japonica [loquat]
gb|AEE81751.1|  MYB transcription factor                                248   9e-79   Morus alba var. multicaulis
ref|XP_004505789.1|  PREDICTED: myb-related protein 308-like            249   9e-79   Cicer arietinum [garbanzo]
ref|XP_010446371.1|  PREDICTED: transcription repressor MYB4-like       249   9e-79   Camelina sativa [gold-of-pleasure]
gb|KHN33675.1|  Myb-related protein 308                                 246   1e-78   Glycine soja [wild soybean]
emb|CBI27689.3|  unnamed protein product                                248   1e-78   Vitis vinifera
gb|AIS39993.1|  MYB2                                                    250   1e-78   Lithospermum erythrorhizon
gb|AHB59595.1|  putative R2R3 MYB protein 7                             250   1e-78   Arachis hypogaea [goober]
ref|XP_008460839.1|  PREDICTED: myb-related protein 330-like            247   1e-78   Cucumis melo [Oriental melon]
gb|AHG99473.1|  MYB16                                                   248   1e-78   Malus hybrid cultivar
gb|ACU19175.1|  unknown                                                 247   1e-78   Glycine max [soybeans]
ref|NP_001268129.1|  flavonoid-related R2R3 MYB 4a repressor tran...    248   1e-78   Vitis vinifera
ref|XP_008457683.1|  PREDICTED: myb-related protein 308-like            248   1e-78   Cucumis melo [Oriental melon]
ref|XP_010521146.1|  PREDICTED: transcription factor MYB3-like          248   1e-78   Tarenaya hassleriana [spider flower]
ref|XP_008783376.1|  PREDICTED: myb-related protein 308-like            248   1e-78   Phoenix dactylifera
emb|CDX91687.1|  BnaC08g06060D                                          246   1e-78   
ref|XP_002866812.1|  hypothetical protein ARALYDRAFT_490626             248   1e-78   
ref|XP_010535219.1|  PREDICTED: transcription factor MYB3               247   2e-78   Tarenaya hassleriana [spider flower]
ref|XP_004144840.1|  PREDICTED: myb-related protein 308-like            247   2e-78   Cucumis sativus [cucumbers]
ref|XP_008363293.1|  PREDICTED: myb-related protein 308-like            247   2e-78   
ref|XP_009379853.1|  PREDICTED: myb-related protein Zm38-like           246   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011088595.1|  PREDICTED: myb-related protein 308                 248   2e-78   Sesamum indicum [beniseed]
ref|XP_007041863.1|  MYB domain class transcription factor              247   2e-78   Theobroma cacao [chocolate]
ref|XP_009631098.1|  PREDICTED: myb-related protein 308-like            248   2e-78   Nicotiana tomentosiformis
ref|NP_001233975.1|  transcription factor                               248   2e-78   Solanum lycopersicum
gb|AIE54279.1|  transcription factor                                    248   2e-78   Nicotiana tabacum [American tobacco]
ref|XP_009416922.1|  PREDICTED: myb-related protein 308-like            248   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAA23337.1|  OSMYB1                                                 246   2e-78   Oryza sativa [red rice]
gb|EEC67791.1|  hypothetical protein OsI_35350                          248   2e-78   Oryza sativa Indica Group [Indian rice]
dbj|BAF46265.1|  putative transcription factor                          248   2e-78   Humulus lupulus [common hop]
ref|XP_002442905.1|  hypothetical protein SORBIDRAFT_08g004720          246   2e-78   Sorghum bicolor [broomcorn]
ref|XP_011007997.1|  PREDICTED: myb-related protein 308-like            249   2e-78   Populus euphratica
ref|XP_006663259.1|  PREDICTED: myb-related protein 330-like            247   2e-78   
sp|P81393.1|MYB08_ANTMA  RecName: Full=Myb-related protein 308          246   2e-78   Antirrhinum majus [garden snapdragon]
ref|NP_001235637.1|  MYB transcription factor MYB48                     246   2e-78   Glycine max [soybeans]
ref|XP_011046315.1|  PREDICTED: myb-related protein 308-like            248   2e-78   Populus euphratica
ref|XP_002444621.1|  hypothetical protein SORBIDRAFT_07g024890          247   2e-78   Sorghum bicolor [broomcorn]
ref|XP_010265977.1|  PREDICTED: myb-related protein 308-like            246   3e-78   Nelumbo nucifera [Indian lotus]
ref|XP_004977237.1|  PREDICTED: myb-related protein Zm38-like           246   3e-78   Setaria italica
ref|XP_006284260.1|  hypothetical protein CARUB_v10005426mg             248   3e-78   Capsella rubella
ref|XP_010910804.1|  PREDICTED: myb-related protein 308-like            247   3e-78   Elaeis guineensis
emb|CDY12520.1|  BnaC07g13600D                                          247   3e-78   Brassica napus [oilseed rape]
ref|XP_009618136.1|  PREDICTED: myb-related protein 308-like            247   3e-78   Nicotiana tomentosiformis
emb|CCC14990.1|  Myb transcription factor                               247   3e-78   Humulus lupulus [common hop]
ref|NP_001235623.1|  MYB transcription factor MYB54                     246   3e-78   Glycine max [soybeans]
gb|ACT82838.1|  transcription factor MYB047                             245   3e-78   Glycine max [soybeans]
ref|XP_009387206.1|  PREDICTED: myb-related protein Zm38-like           244   3e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008447966.1|  PREDICTED: myb-related protein 308-like            246   4e-78   Cucumis melo [Oriental melon]
emb|CCU64153.1|  ScMYB1 protein                                         246   4e-78   Saccharum hybrid cultivar Co 86032
gb|KHN19997.1|  Myb-related protein 308                                 246   4e-78   Glycine soja [wild soybean]
gb|KHN25476.1|  Myb-related protein 308                                 246   4e-78   Glycine soja [wild soybean]
ref|XP_008799190.1|  PREDICTED: myb-related protein 308-like            246   4e-78   Phoenix dactylifera
gb|AGN52027.1|  MYB-related transcription factor                        244   4e-78   Salvia miltiorrhiza [Chinese salvia]
ref|XP_002312966.1|  putative MYB transcription factor family pro...    247   4e-78   Populus trichocarpa [western balsam poplar]
gb|KDP22699.1|  hypothetical protein JCGZ_02792                         248   4e-78   Jatropha curcas
ref|XP_010675151.1|  PREDICTED: transcription repressor MYB6-like       248   5e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_195574.1|  transcription repressor MYB4                          247   5e-78   Arabidopsis thaliana [mouse-ear cress]
gb|EEE51755.1|  hypothetical protein OsJ_33189                          248   5e-78   Oryza sativa Japonica Group [Japonica rice]
gb|AAC83582.1|  putative transcription factor                           247   6e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008808618.1|  PREDICTED: myb-related protein Hv1                 245   6e-78   Phoenix dactylifera
gb|EEE63808.1|  hypothetical protein OsJ_18632                          246   6e-78   Oryza sativa Japonica Group [Japonica rice]
gb|ADT91707.1|  MYB transcription factor                                246   6e-78   Gossypium hirsutum [American cotton]
ref|NP_001174439.1|  Os05g0429900                                       246   6e-78   
ref|XP_010941310.1|  PREDICTED: myb-related protein Hv1-like            245   6e-78   Elaeis guineensis
gb|AHN16572.1|  MYB1                                                    246   6e-78   Malus hybrid cultivar
ref|XP_007200603.1|  hypothetical protein PRUPE_ppa010277mg             246   6e-78   Prunus persica
gb|AAO49417.1|AF485899_1  MYB8                                          244   6e-78   Dendrobium sp. XMW-2002-8
gb|ABR25756.1|  myb related protein hv1                                 245   7e-78   Oryza sativa Indica Group [Indian rice]
gb|AIS35923.1|  MYB transcription factor 6                              246   7e-78   Phalaenopsis equestris
ref|XP_010920127.1|  PREDICTED: myb-related protein 308-like            245   7e-78   Elaeis guineensis
ref|XP_006660900.1|  PREDICTED: myb-related protein Hv1-like            245   7e-78   Oryza brachyantha
ref|NP_001065896.2|  Os11g0180900                                       246   7e-78   
ref|XP_002530824.1|  r2r3-myb transcription factor, putative            246   7e-78   Ricinus communis
ref|XP_002456719.1|  hypothetical protein SORBIDRAFT_03g041360          246   7e-78   Sorghum bicolor [broomcorn]
ref|NP_001044957.1|  Os01g0874300                                       247   7e-78   
ref|XP_006659665.1|  PREDICTED: myb-related protein Zm38-like           245   7e-78   
ref|XP_006856762.1|  hypothetical protein AMTR_s00055p00057500          245   8e-78   Amborella trichopoda
gb|AGN52052.1|  MYB-related transcription factor                        244   8e-78   Salvia miltiorrhiza [Chinese salvia]
gb|AFZ78649.1|  MYB transcription factor                                246   8e-78   Populus tomentosa [Chinese white poplar]
ref|XP_006366980.1|  PREDICTED: myb-related protein 308-like            246   8e-78   Solanum tuberosum [potatoes]
ref|NP_001063796.1|  Os09g0538400                                       245   9e-78   
emb|CBI37882.3|  unnamed protein product                                244   9e-78   Vitis vinifera
ref|XP_008800133.1|  PREDICTED: myb-related protein Hv1-like            245   9e-78   Phoenix dactylifera
gb|EPS68365.1|  hypothetical protein M569_06408                         241   1e-77   Genlisea aurea
ref|NP_001106037.1|  transcription factor MYB8                          244   1e-77   Zea mays [maize]
dbj|BAM71805.1|  R2R3-MYB transcription factor                          245   1e-77   Gentiana triflora
ref|XP_011097098.1|  PREDICTED: myb-related protein 308-like            246   1e-77   Sesamum indicum [beniseed]
ref|XP_009406085.1|  PREDICTED: myb-related protein 308-like            245   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009603939.1|  PREDICTED: myb-related protein 308-like            245   1e-77   Nicotiana tomentosiformis
ref|XP_010266817.1|  PREDICTED: myb-related protein 308-like            244   1e-77   Nelumbo nucifera [Indian lotus]
ref|XP_004978868.1|  PREDICTED: transcription repressor MYB4-like       246   1e-77   Setaria italica
gb|ABQ51221.1|  R2R3-MYB transcription factor MYB5                      245   1e-77   Picea glauca
gb|AEX92833.1|  MYB42                                                   245   1e-77   Saccharum hybrid cultivar Co 86032
gb|AJD79907.1|  MYB1                                                    245   2e-77   Punica granatum [granado]
gb|AEM17349.1|  R2R3-MYB transcriptional factor PvMYB4b                 245   2e-77   Panicum virgatum
ref|XP_008236005.1|  PREDICTED: myb-related protein 308-like            245   2e-77   Prunus mume [ume]
tpg|DAA38957.1|  TPA: putative MYB DNA-binding domain superfamily...    245   2e-77   
ref|XP_010933337.1|  PREDICTED: myb-related protein Hv1-like            244   2e-77   Elaeis guineensis
gb|ADX33331.1|  R2R3-MYB transcription factor                           245   2e-77   Petunia x hybrida [garden petunia]
gb|AIS35924.1|  MYB transcription factor 7                              244   2e-77   Phalaenopsis equestris
ref|XP_009764613.1|  PREDICTED: myb-related protein 308-like            245   2e-77   Nicotiana sylvestris
ref|NP_001236232.1|  uncharacterized protein LOC100306265               243   2e-77   
ref|XP_006422616.1|  hypothetical protein CICLE_v10028908mg             246   2e-77   Citrus clementina [clementine]
ref|XP_004957488.1|  PREDICTED: myb-related protein Hv1-like            244   2e-77   Setaria italica
gb|KFK44357.1|  hypothetical protein AALP_AA1G246900                    244   2e-77   Arabis alpina [alpine rockcress]
gb|AEM17350.1|  R2R3-MYB transcriptional factor PvMYB4c                 244   2e-77   Panicum virgatum
gb|KDO68040.1|  hypothetical protein CISIN_1g021503mg                   246   2e-77   Citrus sinensis [apfelsine]
ref|XP_006486752.1|  PREDICTED: myb-related protein 308-like            246   2e-77   Citrus sinensis [apfelsine]
ref|XP_009393912.1|  PREDICTED: myb-related protein Hv1-like            243   2e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393441.1|  PREDICTED: myb-related protein 308-like            244   2e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGT17220.1|  myb domain protein 4                                    244   2e-77   Saccharum hybrid cultivar R570
dbj|BAM71804.1|  R2R3-MYB transcription factor                          244   3e-77   Gentiana triflora
ref|XP_010526552.1|  PREDICTED: transcription repressor MYB4            245   3e-77   Tarenaya hassleriana [spider flower]
ref|XP_009414620.1|  PREDICTED: myb-related protein 308-like            244   3e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU31566.1|  hypothetical protein MIMGU_mgv1a013684mg                243   3e-77   Erythranthe guttata [common monkey flower]
gb|AEO27497.1|  MYB1                                                    245   3e-77   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACF83817.1|  unknown                                                 244   3e-77   Zea mays [maize]
gb|ADL18407.1|  P1 transcription factor                                 244   3e-77   Eremochloa ophiuroides
ref|XP_002891188.1|  hypothetical protein ARALYDRAFT_473681             242   4e-77   Arabidopsis lyrata subsp. lyrata
dbj|BAJ86668.1|  predicted protein                                      244   4e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009115618.1|  PREDICTED: transcription factor MYB3               244   4e-77   Brassica rapa
ref|XP_010090332.1|  Myb-related protein 308                            244   4e-77   Morus notabilis
ref|XP_002462743.1|  hypothetical protein SORBIDRAFT_02g031190          244   4e-77   Sorghum bicolor [broomcorn]
emb|CDY04798.1|  BnaC05g17910D                                          244   4e-77   
ref|XP_003576234.1|  PREDICTED: myb-related protein 308                 244   4e-77   Brachypodium distachyon [annual false brome]
ref|XP_006298307.1|  hypothetical protein CARUB_v10014371mg             244   4e-77   Capsella rubella
tpg|DAA38956.1|  TPA: putative MYB DNA-binding domain superfamily...    244   5e-77   
ref|XP_008808405.1|  PREDICTED: myb-related protein Hv1-like            243   5e-77   Phoenix dactylifera
dbj|BAJ92735.1|  predicted protein                                      244   5e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006664389.1|  PREDICTED: myb-related protein 330-like            244   5e-77   
ref|NP_001131856.1|  uncharacterized protein LOC100193234               244   5e-77   Zea mays [maize]
ref|XP_006383085.1|  hypothetical protein POPTR_0005s11410g             243   5e-77   
ref|NP_001105949.1|  transcription factor MYB31                         244   6e-77   
ref|XP_004970740.1|  PREDICTED: myb-related protein 308-like            244   6e-77   Setaria italica
ref|XP_008657016.1|  PREDICTED: myb-related protein 308                 243   6e-77   
ref|XP_010555232.1|  PREDICTED: transcription repressor MYB4-like       244   8e-77   
ref|XP_009390070.1|  PREDICTED: myb-related protein 308-like            242   8e-77   
gb|KHG01332.1|  Myb-related protein                                     242   8e-77   
gb|AIS35925.1|  MYB transcription factor 8                              242   8e-77   
ref|XP_008788440.1|  PREDICTED: myb-related protein Hv1-like            242   8e-77   
emb|CBI17347.3|  unnamed protein product                                243   9e-77   
ref|XP_010935101.1|  PREDICTED: myb-related protein Hv1-like            242   9e-77   
gb|ADK12668.1|  emission of benzenoids III                              243   1e-76   
tpg|DAA56596.1|  TPA: putative MYB DNA-binding domain superfamily...    245   1e-76   
gb|AAL84619.1|AF474122_1  typical P-type R2R3 Myb protein               241   1e-76   
gb|AEC32977.1|  transcription factor MYB3                               241   1e-76   
ref|XP_010516381.1|  PREDICTED: transcription factor MYB32-like         243   1e-76   
gb|KJB32654.1|  hypothetical protein B456_005G254000                    242   1e-76   
gb|AEC32978.1|  transcription factor MYB3                               241   1e-76   
dbj|BAM05596.1|  MYB transcription factor 1                             243   1e-76   
gb|AAO49419.1|AF485901_1  MYB10                                         241   1e-76   
gb|AIS35922.1|  MYB transcription factor 5                              239   1e-76   
ref|NP_001267938.1|  R2R3 MYB 4b transcription factor                   242   2e-76   
ref|XP_010066271.1|  PREDICTED: myb-related protein 308-like            242   2e-76   
emb|CAE09058.1|  MYB transcription factor                               242   2e-76   
ref|XP_008677677.1|  PREDICTED: uncharacterized protein LOC100384...    243   2e-76   
gb|ACG36029.1|  hypothetical protein                                    241   2e-76   
gb|AEV91143.1|  R2R3-MYB protein                                        242   2e-76   
ref|XP_010467401.1|  PREDICTED: transcription factor MYB32-like         243   2e-76   
ref|XP_006409406.1|  hypothetical protein EUTSA_v10022799mg             243   2e-76   
gb|EAZ07904.1|  hypothetical protein OsI_30160                          242   2e-76   
gb|KFK40077.1|  hypothetical protein AALP_AA3G327100                    242   2e-76   
ref|XP_004961985.1|  PREDICTED: myb-related protein Hv1-like            242   2e-76   
gb|AAL84628.1|AF474138_1  typical P-type R2R3 Myb protein               241   2e-76   
ref|XP_010460022.1|  PREDICTED: transcription factor MYB3-like          243   2e-76   
ref|XP_010477522.1|  PREDICTED: transcription factor MYB3               243   2e-76   
gb|EMS68045.1|  Transcription repressor MYB4                            242   2e-76   
ref|NP_179263.1|  myb domain protein 7                                  242   2e-76   
gb|AEV91151.1|  R2R3-MYB protein                                        243   2e-76   
ref|XP_010498742.1|  PREDICTED: transcription factor MYB3 isoform X1    243   2e-76   
ref|XP_009399305.1|  PREDICTED: myb-related protein 308-like            242   2e-76   
ref|XP_007046650.1|  MYB domain class transcription factor              241   2e-76   
gb|AGE09589.1|  MYB83-like protein                                      241   2e-76   
gb|ACB12238.1|  MYB-like protein MYB5d8                                 242   2e-76   
ref|NP_001062438.1|  Os08g0549000                                       241   2e-76   
ref|XP_010027479.1|  PREDICTED: myb-related protein 308-like            244   2e-76   
sp|P20025.1|MYB38_MAIZE  RecName: Full=Myb-related protein Zm38         242   3e-76   
gb|AIU39031.1|  myb transcription factor 2                              241   3e-76   
ref|NP_001176813.1|  Os12g0175400                                       242   3e-76   
ref|XP_010690379.1|  PREDICTED: myb-related protein 308                 242   3e-76   
ref|XP_010489241.1|  PREDICTED: transcription factor MYB32-like         242   3e-76   
ref|XP_009420186.1|  PREDICTED: myb-related protein 308-like            241   3e-76   
ref|XP_011043175.1|  PREDICTED: myb-related protein 308-like            241   3e-76   
ref|XP_008664600.1|  PREDICTED: myb-related protein Zm38                241   4e-76   
ref|XP_002886068.1|  hypothetical protein ARALYDRAFT_899987             242   4e-76   
dbj|BAJ99931.1|  predicted protein                                      241   5e-76   
emb|CAA50221.1|  MybHv5                                                 241   5e-76   
ref|NP_001146153.1|  uncharacterized protein LOC100279722               241   6e-76   
ref|XP_010447013.1|  PREDICTED: transcription factor MYB32-like         242   6e-76   
ref|XP_003564745.1|  PREDICTED: myb-related protein 308-like            241   6e-76   
gb|ABK25787.1|  unknown                                                 241   6e-76   
dbj|BAJ33514.1|  R2R3-MYB transcriptional factor                        243   7e-76   
gb|AEG64799.1|  R2R3 MYB transcriptional factor                         240   7e-76   
gb|AGO33166.1|  MYB transcription factor                                239   8e-76   
dbj|BAJ89618.1|  predicted protein                                      240   8e-76   
ref|XP_006305372.1|  hypothetical protein CARUB_v10009761mg             243   9e-76   
gb|AIU39727.1|  MYB transcription factor 32-1                           241   9e-76   
ref|XP_009138333.1|  PREDICTED: transcription factor MYB32-like         241   1e-75   
emb|CAD98762.1|  MYB transcription factor R2R3 type                     241   1e-75   
ref|XP_010437544.1|  PREDICTED: transcription factor MYB32-like         241   1e-75   
gb|AFW78196.1|  putative MYB DNA-binding domain superfamily protein     240   1e-75   
emb|CCU64174.1|  ScMYB22 protein                                        238   2e-75   
gb|EPS69277.1|  hypothetical protein M569_05492                         237   2e-75   
gb|AAF13100.1|U26933_1  DNA-binding protein                             240   2e-75   
ref|XP_006303828.1|  hypothetical protein CARUB_v10012451mg             238   2e-75   
ref|NP_195225.1|  transcription factor MYB32                            240   2e-75   
ref|XP_003578527.1|  PREDICTED: myb-related protein Hv1                 239   2e-75   
gb|AIO09658.1|  MYB transcription factor                                241   2e-75   
emb|CDX72510.1|  BnaC07g45320D                                          240   2e-75   
gb|AEV91152.1|  R2R3-MYB protein                                        239   2e-75   
ref|XP_009136324.1|  PREDICTED: transcription factor MYB32              240   2e-75   
emb|CDY02243.1|  BnaA03g39240D                                          240   3e-75   
emb|CDY72116.1|  BnaCnng76050D                                          240   3e-75   
ref|XP_004974147.1|  PREDICTED: myb-related protein Zm38-like           239   3e-75   
gb|AFW65671.1|  putative MYB DNA-binding domain superfamily protein     239   3e-75   
ref|NP_001106009.1|  transcription factor MYB42                         239   3e-75   
ref|XP_006284274.1|  hypothetical protein CARUB_v10005438mg             240   3e-75   
gb|AIS39994.1|  MYB3                                                    239   3e-75   
gb|ABN42495.1|  MYB protein                                             238   4e-75   
gb|ABQ51226.1|  R2R3-MYB transcription factor MYB10                     237   5e-75   
ref|XP_009382726.1|  PREDICTED: myb-related protein Zm38-like           236   5e-75   
emb|CDX75478.1|  BnaA01g02240D                                          239   5e-75   
gb|AAT37167.1|  transcription factor Myb1                               239   6e-75   
emb|CDX69102.1|  BnaC01g03510D                                          239   7e-75   
ref|XP_003568394.1|  PREDICTED: myb-related protein Zm38-like           237   7e-75   
ref|XP_009786709.1|  PREDICTED: myb-related protein 308-like            238   7e-75   
ref|XP_009107363.1|  PREDICTED: transcription factor MYB32-like         239   7e-75   
gb|EMS61792.1|  Myb-related protein Hv1                                 238   7e-75   
ref|XP_009402646.1|  PREDICTED: myb-related protein 308-like            238   8e-75   
gb|EMT18797.1|  Myb-related protein Hv1                                 238   8e-75   
gb|AAN28273.1|  myb-like transcription factor 1                         238   8e-75   
gb|KFK30137.1|  hypothetical protein AALP_AA7G221700                    238   1e-74   
ref|XP_010432359.1|  PREDICTED: transcription factor MYB32-like         238   1e-74   
sp|P20026.1|MYB1_HORVU  RecName: Full=Myb-related protein Hv1           238   1e-74   
emb|CDM85224.1|  unnamed protein product                                238   1e-74   
dbj|BAJ93190.1|  predicted protein                                      238   1e-74   
ref|XP_006412165.1|  hypothetical protein EUTSA_v10025926mg             238   1e-74   
gb|KJB43302.1|  hypothetical protein B456_007G192900                    236   1e-74   
ref|XP_004503863.1|  PREDICTED: myb-related protein 330-like isof...    238   2e-74   
ref|XP_010530893.1|  PREDICTED: transcription factor MYB32-like         237   2e-74   
gb|AIS35921.1|  MYB transcription factor 4                              235   2e-74   
ref|XP_010478947.1|  PREDICTED: transcription repressor MYB6-like       234   4e-74   
ref|XP_002867097.1|  AtMYB32                                            237   4e-74   
gb|KHG07216.1|  Myb-related protein                                     235   4e-74   
gb|ABD60287.2|  R2R3-MYB transcription factor MYB10                     233   5e-74   
ref|XP_006383086.1|  hypothetical protein POPTR_0005s11410g             234   1e-73   
gb|ABK24898.1|  unknown                                                 233   2e-73   
ref|NP_849749.1|  R2R3-type MYB transcription factor                    232   4e-73   
gb|AAN28272.1|  myb-like transcription factor 1                         233   1e-72   
ref|XP_009404325.1|  PREDICTED: myb-related protein Zm38-like iso...    231   2e-72   
gb|AAN28271.1|  myb-like transcription factor 1                         232   2e-72   
gb|AAX96198.1|  transposon protein, putative, CACTA, En/Spm sub-c...    251   2e-72   
ref|XP_003630424.1|  Myb-like transcription factor                      232   1e-71   
gb|ABQ51229.1|  R2R3-MYB transcription factor MYB13                     228   1e-71   
dbj|BAA23338.1|  OSMYB2                                                 230   2e-71   
gb|AAL84616.1|AF474119_1  typical P-type R2R3 Myb protein               225   2e-71   
gb|AAF18515.1|AC006551_1  Putative DNA binding protein                  229   3e-71   
ref|XP_008655313.1|  PREDICTED: putative MYB DNA-binding domain s...    227   5e-71   
ref|XP_003578854.1|  PREDICTED: myb-related protein 308-like            228   6e-71   
gb|ABD60279.1|  R2R3-MYB transcription factor MYB14                     225   3e-70   
emb|CBI18519.3|  unnamed protein product                                226   3e-70   
gb|ABK25487.1|  unknown                                                 226   4e-70   
gb|ABK25585.1|  unknown                                                 224   5e-70   
ref|XP_009413581.1|  PREDICTED: myb-related protein Hv1-like            225   6e-70   
ref|XP_010274638.1|  PREDICTED: transcription repressor MYB6-like       224   6e-70   
gb|KJB30829.1|  hypothetical protein B456_005G162600                    224   8e-70   
ref|XP_010665255.1|  PREDICTED: myb-related protein 308-like            224   1e-69   
gb|KHG19549.1|  Transcription repressor MYB4 -like protein              223   2e-69   
gb|EMT24564.1|  Myb-related protein 308                                 226   3e-69   
gb|AAL90628.1|AF470060_1  P-type R2R3 Myb protein                       221   5e-69   
ref|XP_010259378.1|  PREDICTED: transcription repressor MYB4-like       222   6e-69   
ref|XP_009401133.1|  PREDICTED: myb-related protein 308-like            222   1e-68   
ref|XP_002273328.1|  PREDICTED: transcription repressor MYB6            221   2e-68   
ref|XP_002978781.1|  hypothetical protein SELMODRAFT_450007             217   2e-68   
gb|EYU28562.1|  hypothetical protein MIMGU_mgv1a022685mg                219   2e-68   
ref|XP_002315890.2|  hypothetical protein POPTR_0010s12420g             220   3e-68   
gb|AAN28286.1|  myb-like transcription factor 6                         220   4e-68   
gb|KHG22126.1|  Transcription repressor MYB6 -like protein              220   4e-68   
gb|AAN28287.1|  myb-like transcription factor 6                         219   4e-68   
ref|NP_001281006.1|  myb-related protein 308-like                       220   5e-68   
ref|XP_011038671.1|  PREDICTED: transcription repressor MYB6-like       220   5e-68   
ref|XP_007033078.1|  Myb domain protein 6                               219   5e-68   
gb|AAC04720.1|  MYB-like DNA-binding domain protein                     219   6e-68   
ref|XP_002984694.1|  hypothetical protein SELMODRAFT_120788             216   6e-68   
ref|XP_010044170.1|  PREDICTED: transcription repressor MYB4-like       219   7e-68   
gb|KJB43003.1|  hypothetical protein B456_007G179300                    220   7e-68   
emb|CAN80942.1|  hypothetical protein VITISV_012175                     219   8e-68   
ref|XP_008229231.1|  PREDICTED: myb-related protein 308-like            219   9e-68   
ref|XP_007215900.1|  hypothetical protein PRUPE_ppa010716mg             219   1e-67   
gb|ACN12959.1|  R2R3-MYB transcription factor MYB17                     219   1e-67   
ref|NP_001235662.1|  MYB transcription factor MYB56                     221   1e-67   
gb|AHG99475.1|  MYB111                                                  219   1e-67   
gb|ABK23961.1|  unknown                                                 219   2e-67   
ref|XP_007036734.1|  R2R3 MYB C2 repressor 2 protein                    218   2e-67   
ref|XP_009371802.1|  PREDICTED: transcription repressor MYB6-like       218   3e-67   
ref|XP_004297358.1|  PREDICTED: transcription repressor MYB6-like       218   3e-67   
ref|XP_007223871.1|  hypothetical protein PRUPE_ppa010846mg             217   6e-67   
ref|XP_008243345.1|  PREDICTED: transcription repressor MYB4-like       217   7e-67   
ref|XP_010032675.1|  PREDICTED: transcription factor MYB3-like          216   1e-66   
gb|ACM62749.1|  MYB1                                                    216   1e-66   
gb|KHN20933.1|  Transcription repressor MYB4-like protein               215   1e-66   
ref|XP_009393580.1|  PREDICTED: myb-related protein 308-like isof...    215   1e-66   
ref|XP_007045103.1|  R2R3 MYB C2 repressor motif-like1 protein          216   2e-66   
emb|CBI26917.3|  unnamed protein product                                216   2e-66   
ref|NP_001268133.1|  R2R3 Myb transcription factor C2 repressor m...    215   2e-66   
gb|KDP38039.1|  hypothetical protein JCGZ_04682                         216   2e-66   
ref|XP_009398917.1|  PREDICTED: myb-related protein Zm38-like           214   3e-66   
ref|XP_008797850.1|  PREDICTED: myb-related protein 308-like            215   3e-66   
gb|AFH03064.1|  R2R3-MYB transcription factor MYB12                     216   3e-66   
gb|AGI61042.1|  MaMYB3                                                  215   4e-66   
ref|XP_006845300.1|  hypothetical protein AMTR_s00005p00268890          216   4e-66   
ref|XP_009357784.1|  PREDICTED: myb-related protein 308-like            214   8e-66   
ref|XP_010066635.1|  PREDICTED: myb-related protein 308-like            214   9e-66   
ref|XP_010916352.1|  PREDICTED: myb-related protein 308-like            214   9e-66   
gb|KDP22654.1|  hypothetical protein JCGZ_02496                         214   1e-65   
ref|XP_008352913.1|  PREDICTED: myb-related protein 308-like            214   1e-65   
ref|XP_010663664.1|  PREDICTED: transcription repressor MYB6 isof...    211   2e-65   
ref|XP_006448287.1|  hypothetical protein CICLE_v10017654mg             213   2e-65   
gb|AAL84621.1|AF474124_1  typical P-type R2R3 Myb protein               210   2e-65   
ref|XP_002281502.1|  PREDICTED: transcription repressor MYB6 isof...    211   3e-65   
ref|XP_008806257.1|  PREDICTED: myb-related protein 308-like            213   5e-65   
gb|ABW34393.1|  R2R3 MYB transcription factor C2 motif flavonoid ...    211   8e-65   
gb|AJI76863.1|  R2R3 MYB flavonoid repressor protein                    212   9e-65   
gb|ABD60284.2|  R2R3-MYB transcription factor MYB13                     210   9e-65   
emb|CBI18520.3|  unnamed protein product                                210   9e-65   
ref|XP_007159923.1|  hypothetical protein PHAVU_002G279000g             213   9e-65   
ref|XP_002305872.1|  hypothetical protein POPTR_0004s08650g             211   1e-64   
ref|NP_001238116.1|  uncharacterized protein LOC100306391               211   1e-64   
ref|XP_006372586.1|  putative MYB transcription factor family pro...    211   2e-64   
ref|XP_011001591.1|  PREDICTED: transcription repressor MYB6-like       211   2e-64   
gb|AEI83426.1|  transcription factor R2R3-MYB2                          210   2e-64   
ref|XP_011007260.1|  PREDICTED: transcription repressor MYB6-like       211   2e-64   
gb|AAN28289.1|  myb-like transcription factor 6                         207   2e-63   
ref|XP_004490862.1|  PREDICTED: transcription factor MYB3-like          207   2e-63   
dbj|BAI49718.1|  putative MYB transcription factor                      206   2e-63   
ref|XP_008240175.1|  PREDICTED: myb-related protein 308-like            206   2e-63   
ref|XP_006344224.1|  PREDICTED: transcription factor MYB3-like          206   3e-63   
ref|XP_004239398.1|  PREDICTED: transcription factor MYB3-like          206   3e-63   
ref|XP_003528525.1|  PREDICTED: myb-related protein 308-like            207   4e-63   
ref|XP_003532377.1|  PREDICTED: myb-related protein 330-like            207   4e-63   
ref|XP_010463732.1|  PREDICTED: transcription factor MYB3-like          210   4e-63   
ref|XP_010926054.1|  PREDICTED: transcription repressor MYB4-like       207   4e-63   
gb|KJB24551.1|  hypothetical protein B456_004G150800                    208   5e-63   
ref|XP_007209645.1|  hypothetical protein PRUPE_ppa011954mg             206   5e-63   
ref|XP_002882262.1|  MYB107                                             210   5e-63   
emb|CBI15545.3|  unnamed protein product                                206   6e-63   
emb|CAN84079.1|  hypothetical protein VITISV_005933                     207   6e-63   
ref|NP_001280904.1|  myb-related protein 308-like                       206   6e-63   
ref|XP_006408360.1|  hypothetical protein EUTSA_v10022405mg             210   6e-63   
ref|XP_003616388.1|  Myb-like transcription factor                      206   6e-63   
ref|XP_010693797.1|  PREDICTED: transcription repressor MYB6-like       206   7e-63   
ref|XP_004299543.1|  PREDICTED: myb-related protein 308-like            205   7e-63   
ref|XP_009387271.1|  PREDICTED: myb-related protein 308-like            205   8e-63   
ref|NP_001268180.2|  uncharacterized protein LOC100257749               206   8e-63   
ref|NP_186944.1|  putative transcription factor MYB107                  209   9e-63   



>gb|AHB17741.1| MYB1 [Actinidia chinensis]
Length=260

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 159/203 (78%), Gaps = 12/203 (6%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISL---------DLSSSTPSQEETKCSSGTTSEE  558
            +DPQTHRPL A+ AAA+   A++  ++SL          L +S  S ++ KCSSGTT E 
Sbjct  121  VDPQTHRPLTATTAAANSQFASQVPSLSLTEFALMSQSTLITSGESLDDGKCSSGTTEEA  180

Query  559  SHHQPLKDKQRNDEQMAGLDLSI  627
                P   K   + Q   LDLSI
Sbjct  181  DPQPPPPHK---NCQSVDLDLSI  200



>gb|AAA33067.1| MYB1 [Gossypium hirsutum]
 gb|AAN28269.1| myb-like transcription factor 1 [Gossypium hirsutum]
Length=294

 Score =   270 bits (691),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 163/221 (74%), Gaps = 27/221 (12%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPE---------------NISLDLS-------SSTPSQ  519
            IDPQTHRPL+ +A   +    T+ +               N SLD +       S+T S 
Sbjct  121  IDPQTHRPLNQTANTNTVTAPTELDFRNSPTSVSKSSSIKNPSLDFNYNEFQFKSNTDSL  180

Query  520  EETKC--SSGTTSEESHHQPLKDKQR---NDEQMAGLDLSI  627
            EE  C  SSG T++E   + L  KQ+   ++ Q   L+LSI
Sbjct  181  EEPNCTASSGMTTDEEQQEQLHKKQQYGPSNGQDINLELSI  221



>ref|XP_009623355.1| PREDICTED: myb-related protein 330-like [Nicotiana tomentosiformis]
Length=275

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 166/220 (75%), Gaps = 28/220 (13%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ L+NYIR HGEGCWRSLPKPAGL RCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVNYIRSHGEGCWRSLPKPAGLQRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPL---DasaaaascggaTKPENISLDLSSSTPS------------------QE  522
            +DPQTHRPL    A++ A +   +T  +NI LD+ +++ +                  +E
Sbjct  121  LDPQTHRPLSTTTATSTATATSTSTATKNICLDMRNTSVAATPLSLNDQNSTNYSYSFEE  180

Query  523  ETKCSSGTTSEESHHQPLK-----DKQRNDEQMAGLDLSI  627
            ETKCSS TT  E  H+PL+      ++ + E M  L+LSI
Sbjct  181  ETKCSSSTT--EERHEPLEASAAVTEKSSGEVMINLELSI  218



>ref|XP_009767902.1| PREDICTED: myb-related protein 330-like [Nicotiana sylvestris]
Length=291

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 162/217 (75%), Gaps = 25/217 (12%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR HGEGCWRSLP  AGL RCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPTAAGLQRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLDas----------------------aaaascggaTKPENISLDLSSSTPSQ  519
            IDPQ+HRPL+A+                          +     KP  I+   +++  S 
Sbjct  121  IDPQSHRPLNAAATSTTVAAVTTAISTTTTQHICMDFKNDNVDQKPNIINQSNNTTDSSY  180

Query  520  EETKCSSGTTSEESHHQPLKDKQRNDEQ-MAGLDLSI  627
            +ETKC+SGTT+EE+  +PL+  Q++ +Q M  L+LSI
Sbjct  181  DETKCNSGTTTEET--KPLEIPQKSSQQLMINLELSI  215



>ref|XP_004241841.1| PREDICTED: myb-related protein 330 [Solanum lycopersicum]
Length=279

 Score =   265 bits (677),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 161/209 (77%), Gaps = 16/209 (8%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR HGEGCWRSLPK AGL RCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRAHGEGCWRSLPKAAGLSRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLDasaaaa----scggaTKPENISLDLS-----------SSTPSQEETKCSS  540
            IDPQTHRPL+ +A  +    +   A   +NI+LD +           +++ S +ETKC+S
Sbjct  121  IDPQTHRPLNNNATNSHTTTNITTAVTTKNINLDFTNVDQKQPNIMIATSSSYDETKCNS  180

Query  541  GTTSEESHHQPLKDKQRNDEQMAGLDLSI  627
            GTT EE+    +   +   + M  L+LSI
Sbjct  181  GTT-EETKPLEIIIPKIPSQVMINLELSI  208



>emb|CDP10649.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 158/230 (69%), Gaps = 36/230 (16%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE+IIKLH+LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHNLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD---------asaaaascggaTKPENISLDLSSST----------------  510
            IDPQTHRPL+          +    +   +   +NI LD  SS                 
Sbjct  121  IDPQTHRPLNGGTATTTTTVTPTTTNTDASKTAKNICLDFRSSALPLDNKNGFMNDHGSS  180

Query  511  --------PSQEETKCSSGTTSEESHHQP---LKDKQRNDEQMAGLDLSI  627
                     S E+TKCSSGTT E    Q    L+D+      M  L+LSI
Sbjct  181  KFKLTTDHSSAEDTKCSSGTTEESQAPQGPLLLEDQATTPSVMLDLELSI  230



>ref|XP_006356500.1| PREDICTED: myb-related protein 330-like [Solanum tuberosum]
Length=285

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 162/215 (75%), Gaps = 22/215 (10%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR HGEGCWRSLPK AGL RCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRAHGEGCWRSLPKAAGLSRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLDasaaaa---------scggaTKPENISLDLSSS------------TPSQE  522
            IDPQTHRPL+A+A  +         +    T  +NI++D +++            + S +
Sbjct  121  IDPQTHRPLNATATNSHTTTITTAVTTTTTTTTKNINMDFTNNVDQKQPNIMIAMSSSYD  180

Query  523  ETKCSSGTTSEESHHQPLKDKQRNDEQMAGLDLSI  627
            ETKC+SGTT EE+    +   +   + M  L+LSI
Sbjct  181  ETKCNSGTT-EETKPLEIIIPKIPSQVMINLELSI  214



>ref|XP_010061981.1| PREDICTED: transcription repressor MYB6 [Eucalyptus grandis]
 gb|KCW69028.1| hypothetical protein EUGRSUZ_F02583 [Eucalyptus grandis]
Length=301

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 156/219 (71%), Gaps = 25/219 (11%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIRLHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRLHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPE----NISLDLSS-------------------STPS  516
            IDPQTHRPL+++         + P      ISL  SS                   + P 
Sbjct  121  IDPQTHRPLNSAVPGVPPAATSPPSLPVTEISLISSSLDRRPHGNGYYGREKLEPKAEPL  180

Query  517  QEETKC--SSGTTSEESHHQPLKDKQRNDEQMAGLDLSI  627
            +E+  C  SSGTT++E    P   +Q        L+LSI
Sbjct  181  REDNHCTTSSGTTTDEELKAPRNRQQAQGGSELNLELSI  219



>ref|XP_009600359.1| PREDICTED: myb-related protein 330-like [Nicotiana tomentosiformis]
Length=288

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 162/216 (75%), Gaps = 25/216 (12%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR HGEGCWRSLP  AGL RCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPTAAGLQRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD------asaaaascggaTKPENISLDL---------------SSSTPSQE  522
            IDPQ+HRPL+       ++A  +    T  +NI +D                +++  S +
Sbjct  121  IDPQSHRPLNAAATNTTASAVTTTISTTTTKNICMDFKNNVDQKPNIINQRNNTTDSSYD  180

Query  523  ETKCSSGTTSEESHHQPLKDKQRNDEQ-MAGLDLSI  627
            ETKC+SGTT E    +PL+  Q++ +Q M  L+LSI
Sbjct  181  ETKCNSGTTEET---KPLEIPQKSSQQLMINLELSI  213



>gb|KJB81321.1| hypothetical protein B456_013G139200 [Gossypium raimondii]
Length=294

 Score =   263 bits (671),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 149/194 (77%), Gaps = 24/194 (12%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPE---------------NISLDLS-------SSTPSQ  519
            IDPQTHRPL+ +A   +    T+ +               N SLD +       S+T S 
Sbjct  121  IDPQTHRPLNQTANTNTVTAPTELDFRNMPTSVSKSSSIKNPSLDFNYNEFQFKSNTDSL  180

Query  520  EETKC--SSGTTSE  555
            EE  C  SSG T++
Sbjct  181  EEPNCTASSGMTTD  194



>gb|AAN28270.1| myb-like transcription factor 1 [Gossypium hirsutum]
Length=294

 Score =   263 bits (671),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 149/194 (77%), Gaps = 24/194 (12%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPE---------------NISLDLS-------SSTPSQ  519
            IDPQTHRPL+ +A   +    T+ +               N SLD +       S+T S 
Sbjct  121  IDPQTHRPLNQTANTNTVTAPTELDFRNTPTSVSKSSSIKNPSLDFNYNEFQFKSNTDSL  180

Query  520  EETKC--SSGTTSE  555
            EE  C  SSG T++
Sbjct  181  EEPNCTTSSGMTTD  194



>gb|KFK32075.1| hypothetical protein AALP_AA6G196300 [Arabis alpina]
Length=236

 Score =   260 bits (664),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR HGEGCWRSLPK AGL RCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRNHGEGCWRSLPKSAGLFRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +ED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFSDEEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISHG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETK-----CSSGTTSEESHHQ  570
            IDPQTHRP++ S    S      P+N +++ S +   + E        +SGTT++E   Q
Sbjct  121  IDPQTHRPINDSKTTPSQSVVVPPQNGAVEYSFAVSPKTENSSDNGVSTSGTTTDEDLRQ  180



>ref|XP_011096483.1| PREDICTED: myb-related protein 330 [Sesamum indicum]
Length=298

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 142/166 (86%), Gaps = 5/166 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE+IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTP--SQEETKCS  537
            IDPQTHRPL+++AA  +   A KP    LD   STP  S+E T  S
Sbjct  121  IDPQTHRPLNSTAATTTTVAAAKP---CLDFRPSTPPSSKENTAAS  163



>gb|AEI83425.1| transcription factor R2R3-MYB1 [Camellia sinensis]
Length=292

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 144/189 (76%), Gaps = 19/189 (10%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+QEDELIIKLHS+LGNKWSLIA RLPGRTDNEIKNYWNT IKRKLI  G
Sbjct  61   LRPDLKRGNFTEQEDELIIKLHSMLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLIVRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSST-------------------PSQEET  528
            +DPQTHRPL+A+A+  +        N S   S+ T                    S ++ 
Sbjct  121  LDPQTHRPLNATASTTTANSKFDFRNASHSYSTLTDIDLTMNQNTFKVIAMADDSSFDDG  180

Query  529  KCSSGTTSE  555
            KC+SGTT E
Sbjct  181  KCNSGTTEE  189



>ref|XP_009772294.1| PREDICTED: myb-related protein 330-like [Nicotiana sylvestris]
Length=270

 Score =   260 bits (664),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 158/218 (72%), Gaps = 25/218 (11%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ L+NYIR HGEGCWRSLPK AGL RCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVNYIRSHGEGCWRSLPKAAGLQRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++ED+LIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPS------------------QEETK  531
            +DP THRPL+ + A  +       +NI LD  +++ +                  +EETK
Sbjct  121  LDPHTHRPLNTATATTAATATAT-KNICLDFRNTSVAATPLSLNDQNPTNYSSSLEEETK  179

Query  532  CSSGTTSE-----ESHHQPLKDKQRND-EQMAGLDLSI  627
            CSS TT E     E    P+   +++  E M  L+LSI
Sbjct  180  CSSSTTEERSPPLEPAAAPVAATEKSSGEVMINLELSI  217



>ref|XP_002534486.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF27899.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=301

 Score =   261 bits (666),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIRLHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>gb|AGN52078.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52188.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=267

 Score =   259 bits (662),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 158/204 (77%), Gaps = 19/204 (9%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTK+EDQ LINYIR HGEG WRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKDEDQRLINYIRAHGEGNWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE+IIKLHSLLGN+WSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHIKRKLISSG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTP----------SQEETKCSSGTTSE  555
            +DPQTHRPL+++AAAA+    T+     LD  +S P          S  +T C+S TT+E
Sbjct  121  VDPQTHRPLNSTAAAAAAATITR-----LDFRNSAPPPPSKEANSSSAHDTNCNS-TTTE  174

Query  556  ESHHQPLKDKQRNDEQMAGLDLSI  627
            ES   P   + R +E    +DL +
Sbjct  175  ESQAPP---RPREEESGDAVDLEL  195



>ref|XP_010435778.1| PREDICTED: transcription repressor MYB6-like isoform X1 [Camelina 
sativa]
 ref|XP_010435785.1| PREDICTED: transcription repressor MYB6-like isoform X2 [Camelina 
sativa]
Length=236

 Score =   258 bits (658),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 142/180 (79%), Gaps = 5/180 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  406  IDPQTHRPLDasaaaascggaTKP---ENISLDLSSSTPSQEETK--CSSGTTSEESHHQ  570
            IDPQTHRP++ +    S      P   + +   LS+    QE +    +SGTT++E   Q
Sbjct  121  IDPQTHRPINDTKTVPSQVVVVGPIQNDAVEYSLSNLAVKQENSSGASTSGTTTDEDLRQ  180



>gb|KDP34830.1| hypothetical protein JCGZ_11192 [Jatropha curcas]
 gb|AIT52254.1| MYB family protein [Jatropha curcas]
Length=294

 Score =   259 bits (663),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPL  432
            IDPQTHRPL
Sbjct  121  IDPQTHRPL  129



>gb|KJB60082.1| hypothetical protein B456_009G288900 [Gossypium raimondii]
Length=284

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIRLHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF++ EDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFSEAEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDPQTH PL+
Sbjct  121  IDPQTHGPLN  130



>gb|ABR01221.1| MYB8 [Gossypium hirsutum]
Length=284

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIRLHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF++ EDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFSEAEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDPQTH PL+
Sbjct  121  IDPQTHGPLN  130



>ref|XP_010538928.1| PREDICTED: transcription repressor MYB6-like [Tarenaya hassleriana]
Length=203

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 141/175 (81%), Gaps = 6/175 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQHLIDYIRKHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++E ELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEVELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEESHHQ  570
            IDPQ+HRP++      +    T P+N +     +  S +    +SGTT++E   Q
Sbjct  121  IDPQSHRPIN------ASAVVTDPKNNAAVNPKTEYSSDNGAATSGTTTDEDLRQ  169



>ref|XP_010246045.1| PREDICTED: myb-related protein 330 [Nelumbo nucifera]
Length=291

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPL  432
            +DPQTHRPL
Sbjct  121  LDPQTHRPL  129



>ref|XP_008219033.1| PREDICTED: transcription repressor MYB6-like [Prunus mume]
Length=314

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  LDPQTHRPLN  130



>ref|XP_006288570.1| hypothetical protein CARUB_v10001860mg [Capsella rubella]
 gb|EOA21468.1| hypothetical protein CARUB_v10001860mg [Capsella rubella]
Length=236

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 143/182 (79%), Gaps = 7/182 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTDDEDQVIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  406  IDPQTHRPLDasaaaascggaTKP-ENISLDLSSST------PSQEETKCSSGTTSEESH  564
            IDPQTHRP++ +    S      P +N +++ S S        S +    +SGTT++E  
Sbjct  121  IDPQTHRPINDTKTTPSQIVIVDPVQNDAVEYSFSNLAVKPENSSDNGASTSGTTTDEDL  180

Query  565  HQ  570
             Q
Sbjct  181  RQ  182



>ref|XP_010455338.1| PREDICTED: transcription repressor MYB6-like [Camelina sativa]
Length=274

 Score =   257 bits (657),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  40   MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  99

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  100  LRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  159

Query  406  IDPQTHRPLDasaaaascggaTKP---ENISLDLSSSTPSQEET--KCSSGTTSEESHHQ  570
            IDPQTHRP++ + A  S      P   + +   LS+    QE +    +SGTT++E   Q
Sbjct  160  IDPQTHRPINDTKAVPSQIVVVGPNQNDAVEYSLSNLAVKQENSSGASTSGTTTDEDLRQ  219



>ref|XP_010421847.1| PREDICTED: transcription repressor MYB6 [Camelina sativa]
Length=235

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 144/180 (80%), Gaps = 5/180 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI++IR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDHIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +ED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTNEEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  406  IDPQTHRPLDasaaaascggaTKP---ENISLDLSSSTPSQEETK--CSSGTTSEESHHQ  570
            IDPQTHRP++ + A  S      P   + +   LS+    QE +    +SGTT++E   Q
Sbjct  121  IDPQTHRPINDTKAVPSQIVVVGPNQNDAVEYSLSNLAVKQENSSGASTSGTTTDEDLRQ  180



>gb|AAS19480.1| MYB6 [Tradescantia fluminensis]
Length=268

 Score =   256 bits (655),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI++HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH+LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHALLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRP++
Sbjct  121  IDPQTHRPIN  130



>ref|XP_007131703.1| hypothetical protein PHAVU_011G034900g [Phaseolus vulgaris]
 gb|ESW03697.1| hypothetical protein PHAVU_011G034900g [Phaseolus vulgaris]
Length=253

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEES  561
            IDP THRPL+ +A++A+        NIS         QE T  S+G+  + S
Sbjct  121  IDPATHRPLNEAASSATVVTVATASNISF----GKQEQETTSSSNGSVVKGS  168



>ref|XP_007222954.1| hypothetical protein PRUPE_ppa008906mg [Prunus persica]
 gb|EMJ24153.1| hypothetical protein PRUPE_ppa008906mg [Prunus persica]
Length=315

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  LDPQTHRPLN  130



>ref|XP_010104477.1| Transcription factor [Morus notabilis]
 gb|EXC01078.1| Transcription factor [Morus notabilis]
Length=305

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  LDPQTHRPLN  130



>ref|XP_010680433.1| PREDICTED: transcription repressor MYB6-like [Beta vulgaris subsp. 
vulgaris]
Length=341

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTK+EDQ LI+YIRLHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKDEDQRLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  LDPQTHRPLN  130



>gb|KHG11058.1| Transcription factor MYB3 -like protein [Gossypium arboreum]
Length=279

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIRLHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF++ EDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFSEAEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDPQ H PL+
Sbjct  121  IDPQNHGPLN  130



>ref|XP_009134143.1| PREDICTED: transcription repressor MYB6 [Brassica rapa]
 emb|CDX90721.1| BnaA03g24010D [Brassica napus]
Length=224

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 153/198 (77%), Gaps = 15/198 (8%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR+HGEG WRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGSWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +ED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFSDEEDKVIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  406  IDPQTHRPL-DasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEESHHQPLKD  582
            IDPQTHRP+ D+ A   S     K EN S +++S          +SGTT++E   Q   D
Sbjct  121  IDPQTHRPIKDSIAVENSFTVRPKTENSSGNVAS----------TSGTTTDEDIRQN-GD  169

Query  583  KQRND---EQMAGLDLSI  627
               ND   E+   LDL++
Sbjct  170  CYYNDNSGEKEVNLDLTL  187



>ref|XP_007020033.1| Myb domain protein 3, putative [Theobroma cacao]
 gb|EOY17258.1| Myb domain protein 3, putative [Theobroma cacao]
Length=306

 Score =   256 bits (654),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHR L+
Sbjct  121  IDPQTHRSLN  130



>ref|XP_009403695.1| PREDICTED: myb-related protein 308-like [Musa acuminata subsp. 
malaccensis]
Length=247

 Score =   254 bits (649),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQKLISYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEE  558
            IDPQTH P++    A +   A  P   ++  +S+T S +ET  S G+  ++
Sbjct  121  IDPQTHGPIN--GGATAAFAAPHPSETAVPKASATDSCDETNSSGGSQDDD  169



>ref|XP_002325546.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE99927.1| myb family transcription factor family protein [Populus trichocarpa]
Length=298

 Score =   256 bits (653),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE+IIKLHSLLGNKWSLIA +LPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHSLLGNKWSLIAGKLPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>ref|XP_002872444.1| ATMYB6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48703.1| ATMYB6 [Arabidopsis lyrata subsp. lyrata]
Length=236

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 142/182 (78%), Gaps = 7/182 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ L++YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +ED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTDEEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  406  IDPQTHRPL-DasaaaascggaTKPENISLDLSS------STPSQEETKCSSGTTSEESH  564
            IDPQTHRP+ D+          ++ + +    S+      +  S +    +SGTT++E  
Sbjct  121  IDPQTHRPINDSKTVPFQTVVPSQNDAVEYSFSNLAVKLKTENSSDNGASTSGTTTDEDL  180

Query  565  HQ  570
             Q
Sbjct  181  RQ  182



>gb|EPS61539.1| hypothetical protein M569_13258, partial [Genlisea aurea]
Length=165

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 140/169 (83%), Gaps = 6/169 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINY++ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYVKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF++ EDE+IIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNT +KRKLIS G
Sbjct  61   LRPDLKRGNFSEDEDEIIIKLHSLLGNKWSMIAGRLPGRTDNEIKNYWNTHLKRKLISRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSS-STPSQEETKCSSGTT  549
            IDPQTHRPL      ++    +K E  ++ + + +T + +   C+S TT
Sbjct  121  IDPQTHRPL-----ISAKIQPSKSEQQTVSIRTPTTENSDNNICTSSTT  164



>gb|AAS19475.1| MYB1 [Tradescantia fluminensis]
Length=270

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI++HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKVHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE+IIKLH+LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDEVIIKLHALLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRP++
Sbjct  121  IDPQTHRPVN  130



>ref|XP_004299892.1| PREDICTED: transcription repressor MYB6 [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  LDPQTHRPLN  130



>gb|AID23891.1| R2R3-MYB [Rosa hybrid cultivar]
Length=258

 Score =   254 bits (648),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 142/182 (78%), Gaps = 7/182 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSS--GTTSEESHHQPLK  579
            IDP THRPL+ +   ++         IS   SS+   +E+ K S+  G    +    P++
Sbjct  121  IDPATHRPLNETPQDSATTT-----TISFAASSAIIKEEDQKISTSIGIVGSKDSKNPVQ  175

Query  580  DK  585
            +K
Sbjct  176  EK  177



>ref|XP_007137818.1| hypothetical protein PHAVU_009G158200g [Phaseolus vulgaris]
 gb|ESW09812.1| hypothetical protein PHAVU_009G158200g [Phaseolus vulgaris]
Length=318

 Score =   256 bits (653),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ LINYI+LHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELII LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFTEDEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>ref|XP_009418831.1| PREDICTED: myb-related protein 308-like [Musa acuminata subsp. 
malaccensis]
Length=241

 Score =   253 bits (646),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 137/172 (80%), Gaps = 8/172 (5%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDQLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEES  561
            +DP THRP++   +  +     KP  I        P QE  K SS   SEES
Sbjct  121  VDPVTHRPINGHGSDTATHFERKPAAIGFG-----PDQESDKISS---SEES  164



>ref|XP_009362465.1| PREDICTED: transcription repressor MYB6-like [Pyrus x bretschneideri]
Length=310

 Score =   255 bits (651),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGR+PCCEKAHTNKGAWTKEEDQ LI++IR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRAPCCEKAHTNKGAWTKEEDQRLIDHIRQHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFTQ+EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTQEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  LDPQTHRPLN  130



>ref|XP_006397190.1| hypothetical protein EUTSA_v10028861mg [Eutrema salsugineum]
 gb|ESQ38643.1| hypothetical protein EUTSA_v10028861mg [Eutrema salsugineum]
Length=286

 Score =   254 bits (649),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 144/185 (78%), Gaps = 10/185 (5%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ L++YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  41   MGRSPCCEKAHTNKGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  100

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +ED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  101  LRPDLKRGNFSDEEDQVIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  160

Query  406  IDPQTHRPLDasaaaascggaTKP-----ENISLDLSSSTPSQEETK-----CSSGTTSE  555
            IDPQTHRP+  S A         P     +N +++ S S   ++E        +SGTT++
Sbjct  161  IDPQTHRPVKDSVAVTDSKTVPSPLTHAHQNGAVEYSFSVRPKKEISSDNGASTSGTTTD  220

Query  556  ESHHQ  570
            E   Q
Sbjct  221  EDLQQ  225



>ref|XP_004289866.1| PREDICTED: myb-related protein 308 [Fragaria vesca subsp. vesca]
Length=266

 Score =   253 bits (647),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSG---TTSEESHHQPL  576
            IDP THRPL+ +    +   AT    IS   SS+   +++   +S     +S +S   P+
Sbjct  121  IDPATHRPLNETTTPTTQDSATTTTTISFAASSAIKEEDQKISTSSIGIVSSRDSLISPV  180

Query  577  KDK  585
            ++K
Sbjct  181  QEK  183



>ref|NP_564176.2| transcription factor MYB3 [Arabidopsis thaliana]
 sp|Q9S9K9.1|MYB3_ARATH RecName: Full=Transcription factor MYB3; AltName: Full=Myb-related 
protein 3; Short=AtMYB3 [Arabidopsis thaliana]
 gb|AAC25522.1| Similar to myb-related transcription factor (THM27) gb|X95296 
from Solanum lycopersicum. ESTs gb|T42000, gb|T04118, gb|AA598042, 
gb|AA394757 and gb|AA598046 come from this gene [Arabidopsis 
thaliana]
 gb|AAL60051.1| At1g22640/F12K8.1 [Arabidopsis thaliana]
 gb|AAN38678.1| At1g22640/F12K8.1 [Arabidopsis thaliana]
 gb|AEE30263.1| transcription factor MYB3 [Arabidopsis thaliana]
Length=257

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 150/202 (74%), Gaps = 15/202 (7%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEEDQLL++YIR HGEGCWRSLP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSST---PSQEETKC-----SSGTTSEES  561
            IDP +HR ++ S  + S       E I LD S      P +EE        SSGTTSE  
Sbjct  121  IDPNSHRLINESVVSPSSLQNDVVETIHLDFSGPVKPEPVREEIGMVNNCESSGTTSE--  178

Query  562  HHQPLKDKQRNDEQMAGLDLSI  627
                 KD    ++ +  L+LS+
Sbjct  179  -----KDYGNEEDWVLNLELSV  195



>ref|XP_003607200.1| Myb-like transcription factor [Medicago truncatula]
 gb|AES89397.1| myb transcription factor [Medicago truncatula]
Length=285

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 152/201 (76%), Gaps = 9/201 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPEN-----ISLDLSSSTPSQEETKCS----SGTTSEE  558
            IDP THRPL+  + + S       +N     I++  S+STP+  +T  +    + +  +E
Sbjct  121  IDPATHRPLNEVSHSQSQSQTLHLQNQEAVTIAVAASTSTPTATKTLPTTISFASSIKQE  180

Query  559  SHHQPLKDKQRNDEQMAGLDL  621
             +H     ++ N   + GL L
Sbjct  181  QYHHHHHHQEMNTNMVKGLVL  201



>gb|ACJ84718.1| unknown [Medicago truncatula]
 gb|AFK49402.1| unknown [Medicago truncatula]
Length=285

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 152/201 (76%), Gaps = 9/201 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPEN-----ISLDLSSSTPSQEETKCS----SGTTSEE  558
            IDP THRPL+  + + S       +N     I++  S+STP+  +T  +    + +  +E
Sbjct  121  IDPATHRPLNEVSHSQSQSRTLHLQNQEAVTIAVAASTSTPTATKTLPTTISFASSIKQE  180

Query  559  SHHQPLKDKQRNDEQMAGLDL  621
             +H     ++ N   + GL L
Sbjct  181  QYHHHHHHQEMNTNMVKGLVL  201



>ref|XP_006411651.1| hypothetical protein EUTSA_v10025886mg [Eutrema salsugineum]
 dbj|BAJ34516.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53104.1| hypothetical protein EUTSA_v10025886mg [Eutrema salsugineum]
Length=292

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 144/198 (73%), Gaps = 18/198 (9%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPL-------DasaaaascggaTKPENISLDLSSSTPSQE-----------ETK  531
            IDP THRP+       D+         +    NIS   SSSTP  E             K
Sbjct  121  IDPTTHRPIQESSASQDSKPIQLEPITSNNTINISFTSSSSTPKVETFQESISFPGKSEK  180

Query  532  CSSGTTSEESHHQPLKDK  585
             S  T  EE   +P+++K
Sbjct  181  ISMLTFKEEKDERPIEEK  198



>gb|AGO33164.1| MYB transcription factor [Narcissus tazetta var. chinensis]
Length=226

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 139/171 (81%), Gaps = 7/171 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGR+PCCEKAHTNKGAWTKEED LL +YI  HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRTPCCEKAHTNKGAWTKEEDDLLTSYIESHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA  LPGRTDNEIKNYWNT IKRKL+SCG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGSLPGRTDNEIKNYWNTHIKRKLLSCG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEE  558
            +DPQTHRP+  S    +   ATK +         T S E+   SSGT+++E
Sbjct  121  LDPQTHRPVVNSHRRHNQQPATKDQK-------KTDSVEDGHSSSGTSTDE  164



>gb|AFH03053.1| R2R3-MYB transcription factor MYB1 [Epimedium sagittatum]
Length=295

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRTHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  LDPQTHRPLN  130



>gb|ABQ81931.1| transcription factor MYB4 [Brassica rapa var. purpuraria]
Length=294

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 145/191 (76%), Gaps = 6/191 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPLDasaaaasc------ggaTKPENISLDLSSSTPSQEETKCSSGTTSEESHH  567
            IDP THRP+  S+A+            +   NIS   SSSTP  E  + S+    ++   
Sbjct  121  IDPTTHRPIQESSASQDSKPTHLEAITSNTINISFASSSSTPKMEIFQESTSFPGKQEKI  180

Query  568  QPLKDKQRNDE  600
              +  K+  DE
Sbjct  181  SMVTFKEEKDE  191



>ref|XP_011004000.1| PREDICTED: transcription repressor MYB6 [Populus euphratica]
Length=298

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI+YIRLHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE+IIKLH LLGNKWSLIA +LPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHGLLGNKWSLIAGKLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>emb|CDX72743.1| BnaC07g47650D [Brassica napus]
Length=294

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 145/191 (76%), Gaps = 6/191 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPLDasaaaasc------ggaTKPENISLDLSSSTPSQEETKCSSGTTSEESHH  567
            IDP THRP+  S+A+            +   NIS   SSSTP  E  + S+    ++   
Sbjct  121  IDPTTHRPIQESSASQDSKPTHLEAITSNTINISFASSSSTPKMEIFQESTSFPGKQEKI  180

Query  568  QPLKDKQRNDE  600
              +  K+  DE
Sbjct  181  SMVTFKEEKDE  191



>ref|XP_009101934.1| PREDICTED: transcription repressor MYB4 [Brassica rapa]
 gb|ABQ81932.1| transcription factor MYB4 [Brassica rapa subsp. chinensis]
 gb|ADZ98868.1| MYB domain protein 12 [Brassica rapa subsp. rapa]
 emb|CDY22416.1| BnaA06g37380D [Brassica napus]
Length=294

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 145/191 (76%), Gaps = 6/191 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPLDasaaaasc------ggaTKPENISLDLSSSTPSQEETKCSSGTTSEESHH  567
            IDP THRP+  S+A+            +   NIS   SSSTP  E  + S+    ++   
Sbjct  121  IDPTTHRPIQESSASQDSKPTHLEAITSNTINISFASSSSTPKMEIFQESTSFPGKQEKI  180

Query  568  QPLKDKQRNDE  600
              +  K+  DE
Sbjct  181  SMVTFKEEKDE  191



>gb|KHG10399.1| Myb-related protein [Gossypium arboreum]
Length=172

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_008378762.1| PREDICTED: LOW QUALITY PROTEIN: transcription repressor MYB6-like 
[Malus domestica]
Length=308

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGR+PCCEKAHTNKGAW+KEEDQ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRAPCCEKAHTNKGAWSKEEDQRLIDYIRQHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFTQ+EDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT +KR LIS G
Sbjct  61   LRPDLKRGNFTQEEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHVKRNLISRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  LDPQTHRPLN  130



>ref|XP_006826645.1| hypothetical protein AMTR_s00139p00079430 [Amborella trichopoda]
 gb|ERM93882.1| hypothetical protein AMTR_s00139p00079430 [Amborella trichopoda]
Length=259

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPL  432
            +DP THRPL
Sbjct  121  VDPHTHRPL  129



>emb|CDY25747.1| BnaA07g10350D [Brassica napus]
Length=264

 Score =   252 bits (644),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 151/205 (74%), Gaps = 20/205 (10%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEEDQLL++YIR HGEGCWRSLP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSL GNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPEN---ISLDLSSSTPSQEETK--------CSSGTTS  552
            IDP THR ++ SA   S       +N   +  D S   P Q+ T          SSGTTS
Sbjct  121  IDPNTHRSINGSATPPSKTTTPSLQNDEPVRFDFSG--PDQQRTTNNNNINNCTSSGTTS  178

Query  553  EESHHQPLKDKQRNDEQMAGLDLSI  627
            E       KD Q +D+ +  L+LS+
Sbjct  179  E-------KDIQTDDDWVLNLELSV  196



>ref|XP_002890523.1| hypothetical protein ARALYDRAFT_472503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66782.1| hypothetical protein ARALYDRAFT_472503 [Arabidopsis lyrata subsp. 
lyrata]
Length=257

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 153/203 (75%), Gaps = 16/203 (8%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEEDQLL++YIR HGEGCWRSLP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaa-scggaTKPENISLDLSSST---PSQEETK-----CSSGTTSEE  558
            IDP THR ++ SA  + S       E ++LD +      P +EET       SSGTTSE 
Sbjct  121  IDPNTHRLINESAVVSPSSLQKDVVETLNLDFAGKVKPEPVREETGGINNCTSSGTTSE-  179

Query  559  SHHQPLKDKQRNDEQMAGLDLSI  627
                  KD    ++ +  L+LS+
Sbjct  180  ------KDYGNEEDWVLNLELSV  196



>gb|KHN09677.1| Myb-related protein 308 [Glycine soja]
Length=301

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ LINYI+LHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELII LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>gb|AEX08668.1| MYB transcription factor 3 [Malus domestica]
Length=310

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGR+PCCEK+HTNKGAWTKEEDQ LI++IR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRAPCCEKSHTNKGAWTKEEDQRLIDHIRQHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFTQ+EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTQEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  LDPQTHRPLN  130



>ref|XP_004141649.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus]
 ref|XP_004162864.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus]
 gb|KGN52706.1| hypothetical protein Csa_5G651640 [Cucumis sativus]
Length=294

 Score =   253 bits (645),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTK+EDQ LI+YIRLHGEGCWR+LPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKDEDQRLIDYIRLHGEGCWRTLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNT IKRKLI+ G
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLITRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>gb|AAS19476.1| MYB2 [Tradescantia fluminensis]
Length=276

 Score =   252 bits (644),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI +I+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAHIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+++EDELIIKLH++LGNKWSLIA +LPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFSEEEDELIIKLHAMLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEESHHQPLKD  582
            IDPQTHR ++ +            +++ LD +    S +++  +SG T  ++    L D
Sbjct  121  IDPQTHRRMNNTEHCEVSSPQHDTKSVVLDETRKLQSTDQSSETSGVTIADNFEHQLPD  179



>ref|XP_006466200.1| PREDICTED: myb-related protein 330-like [Citrus sinensis]
Length=315

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ LINYI++HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELII  HSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFTEEEDELIINFHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>ref|XP_010930777.1| PREDICTED: myb-related protein 308-like [Elaeis guineensis]
Length=253

 Score =   251 bits (641),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 137/171 (80%), Gaps = 3/171 (2%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEE  558
            +DPQTHRPL+  A  A       P  I+   ++S    +E + S  +  E+
Sbjct  121  LDPQTHRPLNGCATFAGTQQQEAPATIAAKPANSG---DEGRSSGASVDED  168



>ref|XP_006426418.1| hypothetical protein CICLE_v10026112mg [Citrus clementina]
 gb|ESR39658.1| hypothetical protein CICLE_v10026112mg [Citrus clementina]
 gb|KDO58731.1| hypothetical protein CISIN_1g021220mg [Citrus sinensis]
Length=316

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ LINYI++HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELII  HSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFTEEEDELIINFHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>ref|XP_010912520.1| PREDICTED: myb-related protein 308-like [Elaeis guineensis]
Length=254

 Score =   251 bits (641),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH+LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHALLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSQG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQ  519
            +DPQTHRPL   AA A+      P  I+  ++S+   Q
Sbjct  121  LDPQTHRPLQGGAAFATPQQQEAPTAIAKPVNSADEGQ  158



>ref|XP_011001250.1| PREDICTED: transcription repressor MYB6-like [Populus euphratica]
 ref|XP_011015999.1| PREDICTED: transcription repressor MYB6-like [Populus euphratica]
Length=318

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ LINYI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +EDELII LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFSDEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLFSRG  120

Query  406  IDPQTHRPL  432
            IDPQTHRPL
Sbjct  121  IDPQTHRPL  129



>gb|KHN31220.1| Myb-related protein 308 [Glycine soja]
Length=302

 Score =   253 bits (645),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ LINYI+LHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELII LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>emb|CDX90285.1| BnaA08g16990D [Brassica napus]
Length=283

 Score =   252 bits (643),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 139/169 (82%), Gaps = 6/169 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ L  YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPLDasaaaascggaTK-----PENISLDLS-SSTPSQEETKC  534
            IDP THRP+  S++A+     T+       N ++++S +STP  E T C
Sbjct  121  IDPTTHRPVQESSSASQDSKPTQLIEAITSNNTINISFTSTPKMESTSC  169



>ref|XP_006434585.1| hypothetical protein CICLE_v10002068mg [Citrus clementina]
 gb|ESR47825.1| hypothetical protein CICLE_v10002068mg [Citrus clementina]
 gb|KDO83870.1| hypothetical protein CISIN_1g023056mg [Citrus sinensis]
Length=288

 Score =   252 bits (643),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLNRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  LDPQTHRPLN  130



>gb|KHF99993.1| Myb-related protein [Gossypium arboreum]
Length=181

 Score =   248 bits (633),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPL  432
            IDP THRPL
Sbjct  121  IDPATHRPL  129



>ref|XP_008781556.1| PREDICTED: myb-related protein 308-like [Phoenix dactylifera]
Length=217

 Score =   249 bits (636),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEE  558
            +DPQTHRPL+     A       P   +    +S  S +E + S  +  E+
Sbjct  121  LDPQTHRPLNGGGPFAGPQQQEAPGGATAAKPAS--SGDEGRSSGASLDED  169



>ref|XP_006376251.1| hypothetical protein POPTR_0013s11360g [Populus trichocarpa]
 gb|ERP54048.1| hypothetical protein POPTR_0013s11360g [Populus trichocarpa]
Length=301

 Score =   252 bits (644),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEEDQ L++YIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDQRLMDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDE+IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTDEEDEIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPHTHRPLN  130



>ref|XP_011001099.1| PREDICTED: transcription repressor MYB6 [Populus euphratica]
Length=302

 Score =   252 bits (644),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEEDQ L++YIR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDQRLMDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDE+IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTDEEDEIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPHTHRPLN  130



>gb|AGS48990.1| R2R3 MYB transcription factor 39 [Salvia miltiorrhiza]
 gb|AGS55356.1| R2R3 MYB transcription factor 39 [Salvia miltiorrhiza]
Length=230

 Score =   249 bits (637),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 141/187 (75%), Gaps = 16/187 (9%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLVSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPEN---------------ISLDLSSSTPSQEETKCSS  540
            IDP THRP++ + A  +   +    N               ++LDL  S P Q+E    +
Sbjct  121  IDPTTHRPINEAEAQPATTISFNSSNKLLGKEERRSPKCPDLNLDLRISPPYQQE-PFKT  179

Query  541  GTTSEES  561
            GT S  S
Sbjct  180  GTASSSS  186



>gb|AGN52100.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52210.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=230

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 142/187 (76%), Gaps = 16/187 (9%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLVSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPEN---------------ISLDLSSSTPSQEETKCSS  540
            IDP THRP++ + A  +   +    N               ++LDL  S P Q+E    +
Sbjct  121  IDPTTHRPINEAEAQPATTISFNSSNKLLGEEERCSPKCPDLNLDLRISPPYQQE-PFKT  179

Query  541  GTTSEES  561
            GT+S  S
Sbjct  180  GTSSRSS  186



>gb|KDP29641.1| hypothetical protein JCGZ_18803 [Jatropha curcas]
 gb|AIT52253.1| MYB family protein [Jatropha curcas]
Length=268

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTS  552
            IDP THRPL+  A        +K    +  +S S+  QE+   ++ TT+
Sbjct  121  IDPATHRPLNEPAQETVVTTNSKSATAT-TISFSSVKQEKVDSNTKTTN  168



>gb|ABR01222.1| MYB10 [Gossypium hirsutum]
Length=281

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKG WTKEEDQ LI+YIRL GEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGTWTKEEDQRLIDYIRLRGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF++ EDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFSEAEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDPQ H PL+
Sbjct  121  IDPQNHGPLN  130



>ref|XP_006473170.1| PREDICTED: myb-related protein 330-like [Citrus sinensis]
Length=288

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLNRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  LDPQTHRPLN  130



>ref|XP_010543564.1| PREDICTED: transcription repressor MYB6 [Tarenaya hassleriana]
Length=277

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 145/191 (76%), Gaps = 16/191 (8%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRKHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLNRG  120

Query  406  IDPQTHRPL-------DasaaaascggaTKPENISLD-----LSSSTPSQEETK----CS  537
            IDPQTH P+       D     +    A  P+N ++      L++  P  E +      S
Sbjct  121  IDPQTHHPINESAALSDPKTPPSQVTPAAPPQNAAVPSTFPYLNAVKPKTEYSSDNGAAS  180

Query  538  SGTTSEESHHQ  570
            SGTT++E   Q
Sbjct  181  SGTTTDEEIRQ  191



>ref|XP_002325733.1| hypothetical protein POPTR_0019s00750g [Populus trichocarpa]
 gb|EEF00115.1| hypothetical protein POPTR_0019s00750g [Populus trichocarpa]
Length=318

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ LINYI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +EDELII LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFSDEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLFSRG  120

Query  406  IDPQTHRPL  432
            +DPQTHRPL
Sbjct  121  VDPQTHRPL  129



>ref|XP_009103226.1| PREDICTED: transcription factor MYB3-like [Brassica rapa]
 gb|AHN60124.1| MYB transcription factor 3 [Brassica napus]
Length=276

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 148/215 (69%), Gaps = 28/215 (13%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEEDQLL++YIR HGEGCWRSLP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSL GNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHR---------------------PLDasaaaascggaTKPENISLDLSSSTPSQE  522
            IDP THR                     P+    +        KPE + LD   +  +  
Sbjct  121  IDPNTHRSINGSATPPSKTTTPSLQNDEPVRFDFSGPDQQRTVKPEPMLLDREETNNNNI  180

Query  523  ETKCSSGTTSEESHHQPLKDKQRNDEQMAGLDLSI  627
                SSGTTSE       KD Q +D+ +  L+LS+
Sbjct  181  NNCTSSGTTSE-------KDIQTDDDWVLNLELSV  208



>ref|XP_009109540.1| PREDICTED: transcription repressor MYB4 [Brassica rapa]
Length=283

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 153/202 (76%), Gaps = 8/202 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ L  YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPLDasaaaascggaTK-----PENISLDLS-SSTPSQEETKCSSGTTSEESH-  564
            IDP THRP+  S++A+     T+       N ++++S +STP  E T C      + S  
Sbjct  121  IDPTTHRPVQESSSASQDSKPTQLIEAITSNNTINISFTSTPKMESTSCFQVKPEKISML  180

Query  565  -HQPLKDKQRNDEQMAGLDLSI  627
              +  KD+   +E++  L+L +
Sbjct  181  TFKEEKDEFLTEEKLPDLNLEL  202



>ref|XP_009414444.1| PREDICTED: myb-related protein Zm38-like [Musa acuminata subsp. 
malaccensis]
Length=225

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 148/206 (72%), Gaps = 18/206 (9%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSL+GNKWSLIAARLPGRTDNEIKNYWNT I+RKL+  G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLIGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLCRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSE----------  555
            +DP THRP++   +  +     KP  +        P Q+E K SS   S           
Sbjct  121  VDPVTHRPVNRHGSDTTTPSRRKPVVVGFG-----PDQKEEKSSSVEWSPDLNLELRISP  175

Query  556  --ESHHQPLKDKQRNDEQMAGLDLSI  627
              +    P+ +K R+ EQ+ GL L +
Sbjct  176  PFQPQETPVPEK-RDGEQLGGLCLGL  200



>emb|CDY05057.1| BnaC03g28550D [Brassica napus]
Length=227

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 150/199 (75%), Gaps = 14/199 (7%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR+HGEG WRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGSWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +ED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFSDEEDKVIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLRSHG  120

Query  406  IDPQTHRPL--DasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEESHHQPLK  579
            IDPQTHRP+    +  A       +P+    D+SS     +    +SGTT++E   Q   
Sbjct  121  IDPQTHRPIKDSIANGAVDNSFTVRPKT---DISS-----DNVASTSGTTTDEDLRQN-G  171

Query  580  DKQRND---EQMAGLDLSI  627
            D   ND   E+   LDL++
Sbjct  172  DCYYNDNSGEKEVNLDLTL  190



>ref|XP_008807672.1| PREDICTED: myb-related protein 308-like [Phoenix dactylifera]
Length=256

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 139/171 (81%), Gaps = 5/171 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH+LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHALLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSQG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEE  558
            +DPQTHRP+  +A  A       P  ++  ++S+   Q     S GT+ +E
Sbjct  121  LDPQTHRPVRCAAPFAIPQQQEAPTAVAKPVNSADEGQ-----SCGTSLDE  166



>ref|XP_006645094.1| PREDICTED: myb-related protein 330-like [Oryza brachyantha]
Length=262

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 143/177 (81%), Gaps = 7/177 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT ++DELIIKLH+LLGNKWSLIA +LPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTDEDDELIIKLHALLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaa------ascggaTKP-ENISLDLSSSTPSQEETKCSSGTTSE  555
            IDPQTHRP+ A ++A            T P  N+S   ++++P  E+   SSG +++
Sbjct  121  IDPQTHRPVSAGSSAXXXXXXXXXXVHTAPSSNVSFARAATSPPSEDGHSSSGGSTD  177



>gb|ACU23165.1| unknown [Glycine max]
Length=302

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK H NKGAWTKEED+ LINYI+LHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHANKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELII LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>ref|NP_001242477.1| uncharacterized protein LOC100808083 [Glycine max]
 gb|ACU21306.1| unknown [Glycine max]
Length=303

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ LINYI+LHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELII LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  406  IDPQTHRPLD  435
            IDP+THRPL+
Sbjct  121  IDPRTHRPLN  130



>ref|XP_010530161.1| PREDICTED: transcription repressor MYB6-like [Tarenaya hassleriana]
Length=247

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L +YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDLRLTDYIRKHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDELIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRP++
Sbjct  121  IDPQTHRPIN  130



>ref|XP_006359691.1| PREDICTED: myb-related protein 308-like [Solanum tuberosum]
Length=254

 Score =   249 bits (637),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPTTHRPVN  130



>gb|KEH35662.1| myb transcription factor [Medicago truncatula]
Length=297

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ LINYI+LHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+QED+LII LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFTEQEDDLIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHR L+
Sbjct  121  VDPQTHRSLN  130



>ref|XP_010028718.1| PREDICTED: myb-related protein 308-like [Eucalyptus grandis]
 gb|KCW55514.1| hypothetical protein EUGRSUZ_I01406 [Eucalyptus grandis]
Length=256

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_004977234.1| PREDICTED: myb-related protein Zm38-like [Setaria italica]
Length=197

 Score =   247 bits (631),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++ED+LIIKLH +LGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTEEEDDLIIKLHQILGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  406  IDPQTHRPL  432
            IDPQTH+PL
Sbjct  121  IDPQTHQPL  129



>gb|ADG46002.1| MYB4 [Salvia miltiorrhiza]
Length=230

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 142/187 (76%), Gaps = 16/187 (9%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGR+PCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRAPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLVSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPEN---------------ISLDLSSSTPSQEETKCSS  540
            IDP THRP++ + A  +   +    N               ++LDL  S P Q+E    +
Sbjct  121  IDPTTHRPINEAEAQPATTISFNSSNKLLGKEERCSPKCPDLNLDLRISPPHQQE-PFKT  179

Query  541  GTTSEES  561
            GT+S  S
Sbjct  180  GTSSRSS  186



>gb|KFK30463.1| hypothetical protein AALP_AA7G264300 [Arabis alpina]
Length=288

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 134/165 (81%), Gaps = 6/165 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPLDasaaaascg------gaTKPENISLDLSSSTPSQE  522
            IDP THRP+  S+ +            +   NIS   SS+TP  E
Sbjct  121  IDPTTHRPIQESSTSQDSKPTQLEPNTSNTINISFTSSSTTPKVE  165



>gb|ADY38393.2| MYB1 [Leucaena leucocephala]
Length=235

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNE+KNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEMKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPTTHRPLN  130



>ref|XP_011046699.1| PREDICTED: myb-related protein 308-like [Populus euphratica]
Length=268

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_006416177.1| hypothetical protein EUTSA_v10008456mg [Eutrema salsugineum]
 gb|ESQ34530.1| hypothetical protein EUTSA_v10008456mg [Eutrema salsugineum]
Length=273

 Score =   250 bits (638),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 154/213 (72%), Gaps = 26/213 (12%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEEDQLL++YIR HGEGCWRSLP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENI---SLDLSSSTPSQEET---------------K  531
            IDP THRP++ S  A S    +    +   S+    + P ++ T                
Sbjct  121  IDPNTHRPINESTNAPSKATPSLQTGVVDESVKFDFAGPDKQPTVKPEPGVQNREEGYNN  180

Query  532  C-SSGTTSEESHHQPLKDKQRNDEQMAGLDLSI  627
            C SSGTT+E       KD Q +D+ +  L+LS+
Sbjct  181  CSSSGTTTE-------KDIQTDDDWVLNLELSV  206



>gb|AAK19619.1|AF336286_1 GHMYB9 [Gossypium hirsutum]
 gb|ACI23564.1| MYB-like protein 3 [Gossypium barbadense]
Length=264

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>gb|KHG25834.1| Myb-related protein [Gossypium arboreum]
Length=260

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR+HGEG WRSLPK AGLLRCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIHYIRVHGEGSWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  406  IDPQTHRPLD  435
            IDPQ+HRPL+
Sbjct  121  IDPQSHRPLN  130



>gb|ABH02902.1| MYB transcription factor MYB179 [Glycine max]
Length=217

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>dbj|BAJ34375.1| unnamed protein product [Thellungiella halophila]
Length=273

 Score =   250 bits (638),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 154/213 (72%), Gaps = 26/213 (12%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEEDQLL++YIR HGEGCWRSLP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENI---SLDLSSSTPSQEET---------------K  531
            IDP THRP++ S  A S    +    +   S+    + P ++ T                
Sbjct  121  IDPNTHRPINESTNAPSKATPSLQTGVVDESVKFDFAGPDKQPTVKPEPGVQNREEGYNN  180

Query  532  C-SSGTTSEESHHQPLKDKQRNDEQMAGLDLSI  627
            C SSGTT+E       KD Q +D+ +  L+LS+
Sbjct  181  CSSSGTTTE-------KDIQTDDDWVLNLELSV  206



>gb|KJB15797.1| hypothetical protein B456_002G196700 [Gossypium raimondii]
Length=265

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>sp|P81395.1|MYB30_ANTMA RecName: Full=Myb-related protein 330 [Antirrhinum majus]
Length=274

 Score =   250 bits (638),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE+IIKLHSLLGNKWSLIA  LPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHSLLGNKWSLIAGALPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHR L+
Sbjct  121  IDPQTHRSLN  130



>gb|EYU37946.1| hypothetical protein MIMGU_mgv1a011787mg [Erythranthe guttata]
Length=271

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPTTHRPIN  130



>ref|XP_004977235.1| PREDICTED: myb-related protein Zm38-like [Setaria italica]
Length=250

 Score =   249 bits (635),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 143/172 (83%), Gaps = 4/172 (2%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++ED+LIIKLH +LGNKWS IA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTEEEDDLIIKLHQILGNKWSQIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEES  561
            IDP+THRPL    AAA+   +++PE+     SS +P   ET  +S ++ EES
Sbjct  121  IDPKTHRPLS-VTAAAAAAPSSRPEDQPAARSSCSP---ETSGASNSSDEES  168



>gb|ABP57083.1| Myb transcription factor [Solenostemon scutellarioides]
 gb|ABP57084.1| Myb transcription factor [Solenostemon scutellarioides]
Length=244

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  2    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  61

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  62   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLVSQG  121

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  122  IDPTTHRPIN  131



>emb|CDO96923.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPL  432
            IDP THRP+
Sbjct  121  IDPTTHRPI  129



>ref|XP_007137351.1| hypothetical protein PHAVU_009G119900g [Phaseolus vulgaris]
 gb|ESW09345.1| hypothetical protein PHAVU_009G119900g [Phaseolus vulgaris]
Length=259

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 129/160 (81%), Gaps = 5/160 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEE  525
            IDP THRPL+ S        +     IS       P QEE
Sbjct  121  IDPATHRPLNDSPRQNQVQESGGAATISF-----APKQEE  155



>ref|XP_009418701.1| PREDICTED: myb-related protein Zm38-like [Musa acuminata subsp. 
malaccensis]
Length=196

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 138/178 (78%), Gaps = 4/178 (2%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCE+AHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCERAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA +LPGRTDNEIKNYWNT I++KL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGKLPGRTDNEIKNYWNTHIRKKLLSMG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEESHHQPLK  579
            +DP THRP+  SAA  +     + E  +         ++E      T++   HH+P K
Sbjct  121  VDPATHRPIHDSAATITAVSVGRTEEKAAGFG----REQERSGEEETSARRQHHRPPK  174



>ref|XP_008459665.1| PREDICTED: transcription repressor MYB6-like [Cucumis melo]
Length=293

 Score =   250 bits (638),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTK+EDQ LI+YIRLHGEGCWR+LPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKDEDQRLIDYIRLHGEGCWRTLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELII+LHSLLGNKWS+IA +LPGRTDNEIKNYWNT IKRKLI+ G
Sbjct  61   LRPDLKRGNFTEDEDELIIRLHSLLGNKWSVIAGKLPGRTDNEIKNYWNTHIKRKLITRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>gb|KJB59602.1| hypothetical protein B456_009G263200 [Gossypium raimondii]
Length=260

 Score =   249 bits (635),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR+HGEG WRSLPK AGLLRCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIHYIRVHGEGSWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  406  IDPQTHRPLD  435
            IDPQ+HRPL+
Sbjct  121  IDPQSHRPLN  130



>ref|XP_002306180.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE86691.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|ACN97176.1| MYB transcription factor [Populus trichocarpa]
Length=268

 Score =   249 bits (636),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_009804432.1| PREDICTED: myb-related protein 308-like [Nicotiana sylvestris]
Length=258

 Score =   249 bits (635),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIRNHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPTTHRPVN  130



>ref|XP_004231034.1| PREDICTED: myb-related protein 308-like [Solanum lycopersicum]
Length=252

 Score =   248 bits (634),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI+YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIKTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPTTHRPVN  130



>ref|XP_011092988.1| PREDICTED: myb-related protein 308-like [Sesamum indicum]
Length=273

 Score =   249 bits (636),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 135/160 (84%), Gaps = 5/160 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEE  525
            IDP THRP++ +A  AS    T     ++  S+++ S+EE
Sbjct  121  IDPTTHRPINEAAVPASQESIT-----TISFSATSNSKEE  155



>ref|NP_001235092.1| transcription factor MYBZ2 [Glycine max]
 gb|ABI73970.1| transcription factor MYBZ2 [Glycine max]
Length=247

 Score =   248 bits (634),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_006384572.1| hypothetical protein POPTR_0004s18020g [Populus trichocarpa]
 gb|ERP62369.1| hypothetical protein POPTR_0004s18020g [Populus trichocarpa]
Length=266

 Score =   249 bits (635),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_011074956.1| PREDICTED: myb-related protein 330-like [Sesamum indicum]
Length=263

 Score =   249 bits (635),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 135/171 (79%), Gaps = 7/171 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAW+KEED+ LINYIR HGEG WRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWSKEEDERLINYIRAHGEGNWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDE+IIKLHSLLGNKWSLIA RL GRTDNEIKNYWNT IKRKLI+ G
Sbjct  61   LRPDLKRGNFTPEEDEIIIKLHSLLGNKWSLIAGRLAGRTDNEIKNYWNTHIKRKLINSG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEE  558
            IDPQTHRPL+          A  P     DL +STP       S+ +T+ +
Sbjct  121  IDPQTHRPLN-------SNAAASPNITCSDLRNSTPPLSNDNTSTISTNHQ  164



>ref|XP_010431803.1| PREDICTED: transcription repressor MYB4-like [Camelina sativa]
Length=292

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPL  432
            IDP THRP+
Sbjct  121  IDPTTHRPI  129



>ref|NP_192684.1| transcription repressor MYB6 [Arabidopsis thaliana]
 sp|Q38851.1|MYB6_ARATH RecName: Full=Transcription repressor MYB6; AltName: Full=Myb-related 
protein 6; Short=AtMYB6 [Arabidopsis thaliana]
 gb|AAA98761.1| DNA-binding protein [Arabidopsis thaliana]
 emb|CAB78069.1| DNA-binding protein [Arabidopsis thaliana]
 gb|AAM63862.1| DNA-binding protein [Arabidopsis thaliana]
 gb|AAO42191.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAO50618.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAS10074.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE82750.1| transcription repressor MYB6 [Arabidopsis thaliana]
Length=236

 Score =   248 bits (632),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 141/183 (77%), Gaps = 9/183 (5%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ L++YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSST--------PSQEETKCSSGTTSEES  561
            IDPQTHR ++  +   S       +N +++ S S          S +    +SGTT++E 
Sbjct  121  IDPQTHRQIN-ESKTVSSQVVVPIQNDAVEYSFSNLAVKPKTENSSDNGASTSGTTTDED  179

Query  562  HHQ  570
              Q
Sbjct  180  LRQ  182



>gb|AFI80908.1| R2R3-type MYB transcription factor [Leucaena leucocephala]
Length=235

 Score =   248 bits (632),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPTTHRPLN  130



>emb|CCU64156.1| ScMYB4 protein [Saccharum hybrid cultivar Co 86032]
Length=148

 Score =   244 bits (624),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSKG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPVTHRPIN  130



>ref|XP_009404326.1| PREDICTED: myb-related protein Zm38-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   246 bits (629),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI+YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDEKLISYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+  G
Sbjct  61   LRPDLKRGNFTAAEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTTIKRKLLGRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRP++
Sbjct  121  LDPQTHRPIE  130



>gb|AEM17351.1| R2R3-MYB transcriptional factor PvMYB4d [Panicum virgatum]
Length=256

 Score =   248 bits (634),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 129/160 (81%), Gaps = 11/160 (7%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED+LI+KLHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEE  525
            IDP THRP+           A    N+++      PSQ++
Sbjct  121  IDPVTHRPI-----------ADAARNVTISFQPDAPSQQQ  149



>ref|XP_004147038.1| PREDICTED: myb-related protein 308-like [Cucumis sativus]
 ref|XP_004172908.1| PREDICTED: LOW QUALITY PROTEIN: myb-related protein 308-like 
[Cucumis sativus]
Length=256

 Score =   248 bits (634),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPVTHRPIN  130



>emb|CDY12092.1| BnaC03g60080D [Brassica napus]
Length=304

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 138/169 (82%), Gaps = 6/169 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L  YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  23   MGRSPCCEKAHTNKGAWTKEEDARLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  82

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  83   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  142

Query  406  IDPQTHRPLDasaaaascggaTK-----PENISLDLS-SSTPSQEETKC  534
            IDP THRP+  S++A+     T+       N ++++S ++TP  E T C
Sbjct  143  IDPTTHRPVQESSSASQDSKPTQLAEAITSNNTINISFTNTPKMESTSC  191



>ref|XP_006384381.1| hypothetical protein POPTR_0004s14510g [Populus trichocarpa]
 gb|ERP62178.1| hypothetical protein POPTR_0004s14510g [Populus trichocarpa]
Length=319

 Score =   250 bits (639),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ L+NYI+  GEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLVNYIKAQGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +EDELII LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL + G
Sbjct  61   LRPDLKRGNFSDEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLFTRG  120

Query  406  IDPQTHRPL  432
            IDPQTHRPL
Sbjct  121  IDPQTHRPL  129



>gb|AEM17352.1| R2R3-MYB transcriptional factor PvMYB4e, partial [Panicum virgatum]
Length=255

 Score =   248 bits (633),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 129/160 (81%), Gaps = 11/160 (7%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED+LI+KLHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEE  525
            IDP THRP+           A    N+++      PSQ++
Sbjct  121  IDPVTHRPI-----------ADAARNVTISFQPDAPSQQQ  149



>gb|AEM17348.1| R2R3-MYB transcriptional factor PvMYB4a [Panicum virgatum]
Length=258

 Score =   248 bits (634),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 129/160 (81%), Gaps = 11/160 (7%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED+LI+KLHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEE  525
            IDP THRP+           A    N+++      PSQ++
Sbjct  121  IDPVTHRPI-----------ADAARNVTISFQPDAPSQQQ  149



>gb|KJB47666.1| hypothetical protein B456_008G035700 [Gossypium raimondii]
Length=257

 Score =   248 bits (633),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_008377747.1| PREDICTED: myb-related protein 308-like [Malus domestica]
Length=255

 Score =   248 bits (633),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPTTHRPLN  130



>ref|XP_004147356.1| PREDICTED: myb-related protein 330-like, partial [Cucumis sativus]
 ref|XP_004170999.1| PREDICTED: myb-related protein 330-like, partial [Cucumis sativus]
Length=198

 Score =   246 bits (628),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEEDQ LINYI++HG+GCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKQHTNKGAWTKEEDQRLINYIQIHGDGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +ED++II LH+LLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFTAEEDQIIINLHTLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  406  IDPQTHRPL  432
            IDPQTHRPL
Sbjct  121  IDPQTHRPL  129



>ref|XP_008653573.1| PREDICTED: myb-related protein Hv1 isoform X2 [Zea mays]
Length=262

 Score =   248 bits (634),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 7/167 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YI+ HGEGCWRSLPK AGL+RCGKSCRLRWINY
Sbjct  45   MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLVRCGKSCRLRWINY  104

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  105  LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  164

Query  406  IDPQTHRPLDasaaaascg-------gaTKPENISLDLSSSTPSQEE  525
            IDP THRP++   +  +          A K  +++LDL  S P QEE
Sbjct  165  IDPVTHRPINEHTSNITISFEDWGQGKALKCPDLNLDLCISPPCQEE  211



>gb|EYU22810.1| hypothetical protein MIMGU_mgv1a010870mg [Erythranthe guttata]
Length=299

 Score =   249 bits (637),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LINYIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +ED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTDEEDDIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            IDP THR ++
Sbjct  121  IDPHTHRSVN  130



>ref|XP_009376958.1| PREDICTED: myb-related protein 308-like [Pyrus x bretschneideri]
 ref|XP_009376962.1| PREDICTED: myb-related protein 308-like [Pyrus x bretschneideri]
Length=255

 Score =   248 bits (633),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 145/182 (80%), Gaps = 10/182 (5%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCS--SGTTSEESHHQPLK  579
            IDP THRPL+ +   ++         IS   +S+   +E+ K S  SG   ++S + P++
Sbjct  121  IDPTTHRPLNETPQESAT-------TISFAAASANIKEEDQKISITSGLVCKDSKN-PVQ  172

Query  580  DK  585
            ++
Sbjct  173  ER  174



>gb|KHN39881.1| Myb-related protein 308 [Glycine soja]
Length=246

 Score =   248 bits (632),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_008653572.1| PREDICTED: myb-related protein Hv1 isoform X1 [Zea mays]
Length=263

 Score =   248 bits (634),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 7/167 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YI+ HGEGCWRSLPK AGL+RCGKSCRLRWINY
Sbjct  46   MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLVRCGKSCRLRWINY  105

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  106  LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  165

Query  406  IDPQTHRPLDasaaaascg-------gaTKPENISLDLSSSTPSQEE  525
            IDP THRP++   +  +          A K  +++LDL  S P QEE
Sbjct  166  IDPVTHRPINEHTSNITISFEDWGQGKALKCPDLNLDLCISPPCQEE  212



>ref|XP_008653574.1| PREDICTED: myb-related protein Hv1 isoform X3 [Zea mays]
 tpg|DAA64349.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05021.1| MYB transcription factor, partial [Zea mays]
Length=218

 Score =   247 bits (630),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 7/167 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YI+ HGEGCWRSLPK AGL+RCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLVRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascgg-------aTKPENISLDLSSSTPSQEE  525
            IDP THRP++   +  +          A K  +++LDL  S P QEE
Sbjct  121  IDPVTHRPINEHTSNITISFEDWGQGKALKCPDLNLDLCISPPCQEE  167



>ref|XP_010436959.1| PREDICTED: transcription repressor MYB4 isoform X1 [Camelina 
sativa]
 ref|XP_010436960.1| PREDICTED: transcription repressor MYB4 isoform X2 [Camelina 
sativa]
Length=291

 Score =   249 bits (636),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPL  432
            IDP THRP+
Sbjct  121  IDPTTHRPI  129



>gb|AID56314.1| MYB2 [Eriobotrya japonica]
Length=255

 Score =   248 bits (633),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPTTHRPLN  130



>gb|AEE81751.1| MYB transcription factor [Morus alba var. multicaulis]
Length=260

 Score =   248 bits (633),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_004505789.1| PREDICTED: myb-related protein 308-like [Cicer arietinum]
Length=286

 Score =   249 bits (636),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPATHRPIN  130



>ref|XP_010446371.1| PREDICTED: transcription repressor MYB4-like [Camelina sativa]
Length=292

 Score =   249 bits (636),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPL  432
            IDP THRP+
Sbjct  121  IDPTTHRPI  129



>gb|KHN33675.1| Myb-related protein 308 [Glycine soja]
Length=210

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 134/161 (83%), Gaps = 6/161 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDHRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTLEEDQLIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEET  528
            IDP THRPL+            +  +++L+L+ S P Q ++
Sbjct  121  IDPATHRPLNDDKVLE------RCPDLNLELTISPPRQPQS  155



>emb|CBI27689.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 138/183 (75%), Gaps = 8/183 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEEDQ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDQRLIAYIKTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDELII LHS  GNKWSLIA RLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFTDEEDELIINLHSFFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  406  IDPQTHRPLDasaa--------aascggaTKPENISLDLSSSTPSQEETKCSSGTTSEES  561
            IDPQTHRPL ++A+          S    +  +N S   S +  +   +  SSG T+EE 
Sbjct  121  IDPQTHRPLSSAASTAATSATINNSKRSNSTSKNTSNSESEAAKTPPYSNSSSGVTTEEL  180

Query  562  HHQ  570
            + Q
Sbjct  181  YPQ  183



>gb|AIS39993.1| MYB2 [Lithospermum erythrorhizon]
Length=318

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 133/160 (83%), Gaps = 4/160 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK+HTNKGAWTKEED+ LINYIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKSHTNKGAWTKEEDERLINYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++ED++IIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDDIIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLDas----aaaascggaTKPENISLDLSSSTP  513
            IDPQTHR L+ +             +   NI LD SS++P
Sbjct  121  IDPQTHRLLNGATTTTTTNHDITTTSTTTNICLDYSSTSP  160



>gb|AHB59595.1| putative R2R3 MYB protein 7 [Arachis hypogaea]
Length=317

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_008460839.1| PREDICTED: myb-related protein 330-like [Cucumis melo]
Length=229

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEEDQ LINYI++HG+GCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKQHTNKGAWTKEEDQRLINYIQIHGDGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +ED++II LH+LLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFTAEEDQIIINLHTLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSQG  120

Query  406  IDPQTHRPL  432
            IDPQTHRPL
Sbjct  121  IDPQTHRPL  129



>gb|AHG99473.1| MYB16 [Malus hybrid cultivar]
Length=255

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPTTHRPLN  130



>gb|ACU19175.1| unknown [Glycine max]
Length=246

 Score =   247 bits (631),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCE+AHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEEAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|NP_001268129.1| flavonoid-related R2R3 MYB 4a repressor transcription factor 
[Vitis vinifera]
 gb|ABL61515.1| R2R3 Myb4a C2 repressor motif protein [Vitis vinifera]
Length=251

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 140/181 (77%), Gaps = 11/181 (6%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSS-GTTSEESHHQPLKD  582
            IDP THRP++             P+  ++  +++   +E+   SS G    ++   P+ +
Sbjct  121  IDPSTHRPIN----------EPSPDVTTISFAAAVKEEEKINISSTGGFGCKTEKNPVTE  170

Query  583  K  585
            K
Sbjct  171  K  171



>ref|XP_008457683.1| PREDICTED: myb-related protein 308-like [Cucumis melo]
Length=257

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPVTHRPIN  130



>ref|XP_010521146.1| PREDICTED: transcription factor MYB3-like [Tarenaya hassleriana]
 ref|XP_010521147.1| PREDICTED: transcription factor MYB3-like [Tarenaya hassleriana]
Length=254

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEED+LLI+YIR HGEGCWRSLPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDKLLIDYIRTHGEGCWRSLPKAAGLQRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDELIIKLHS+ GNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSMFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPL  432
            IDPQTHRP+
Sbjct  121  IDPQTHRPI  129



>ref|XP_008783376.1| PREDICTED: myb-related protein 308-like [Phoenix dactylifera]
Length=262

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ HGEGCWR+LPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRTLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE+IIKLH +LGNKWS+IA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDEVIIKLHGMLGNKWSIIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPL  432
            +DPQTHRPL
Sbjct  121  LDPQTHRPL  129



>emb|CDX91687.1| BnaC08g06060D [Brassica napus]
Length=225

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 147/214 (69%), Gaps = 27/214 (13%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK+H NKGAW KEEDQLL++YIR HGEGCWRSLP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKSHMNKGAWIKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasa--------------------aaascggaTKPENISLDLSSSTPSQEE  525
            IDP THR ++ S                     A        KPE + +D          
Sbjct  121  IDPNTHRTINESTIPLPKTAAFLLNDEHVKFGFAGPDEQRTIKPEPMVVDREEYNNKNNN  180

Query  526  TKCSSGTTSEESHHQPLKDKQRNDEQMAGLDLSI  627
               SSGTTSE       KD + +D+ +  L+LS+
Sbjct  181  NCTSSGTTSE-------KDIETDDDYVLNLELSV  207



>ref|XP_002866812.1| hypothetical protein ARALYDRAFT_490626 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43071.1| hypothetical protein ARALYDRAFT_490626 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPL  432
            IDP THRP+
Sbjct  121  IDPTTHRPI  129



>ref|XP_010535219.1| PREDICTED: transcription factor MYB3 [Tarenaya hassleriana]
Length=251

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEEDQLLI+YIR HGEGCWRSLPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDQLLIDYIRRHGEGCWRSLPKSAGLQRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +ED+LIIKLHS+ GNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTHEEDDLIIKLHSMFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPL  432
            IDPQTHRP+
Sbjct  121  IDPQTHRPI  129



>ref|XP_004144840.1| PREDICTED: myb-related protein 308-like [Cucumis sativus]
 ref|XP_004162908.1| PREDICTED: myb-related protein 308-like [Cucumis sativus]
Length=248

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 131/162 (81%), Gaps = 5/162 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFTQ ED+LIIKLHSLLGN+WSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTQHEDDLIIKLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETK  531
            IDP THRP+     + S    T    IS   +S+   QE+ K
Sbjct  121  IDPTTHRPI-----SDSSSVKTPATTISFASNSALEDQEDRK  157



>ref|XP_008363293.1| PREDICTED: myb-related protein 308-like [Malus domestica]
 gb|ADL36756.1| MYB domain class transcription factor [Malus domestica]
 gb|AHG99474.1| MYB17 [Malus hybrid cultivar]
 gb|AHG99478.1| MYB17 [Malus hybrid cultivar]
Length=255

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPTTHRPLN  130



>ref|XP_009379853.1| PREDICTED: myb-related protein Zm38-like [Musa acuminata subsp. 
malaccensis]
Length=217

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI+YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDEKLISYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +ED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTAEEDDLIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLD  435
            +DP+THRP+D
Sbjct  121  LDPKTHRPID  130



>ref|XP_011088595.1| PREDICTED: myb-related protein 308 [Sesamum indicum]
Length=270

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPTTHRPIN  130



>ref|XP_007041863.1| MYB domain class transcription factor [Theobroma cacao]
 gb|EOX97694.1| MYB domain class transcription factor [Theobroma cacao]
Length=250

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 140/180 (78%), Gaps = 9/180 (5%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEESHHQPLKDK  585
            IDP THRPL+  AA          +  ++  S +   +E+    SG  + +    P++++
Sbjct  121  IDPATHRPLNEPAAQ---------DVTTISFSGAKEEKEKMNNPSGFANIDEKKNPVQER  171



>ref|XP_009631098.1| PREDICTED: myb-related protein 308-like [Nicotiana tomentosiformis]
Length=260

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPL  432
            IDP THRP+
Sbjct  121  IDPTTHRPM  129



>ref|NP_001233975.1| transcription factor [Solanum lycopersicum]
 emb|CAA64614.1| transcription factor [Solanum lycopersicum]
Length=273

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THR ++
Sbjct  121  IDPTTHRSIN  130



>gb|AIE54279.1| transcription factor [Nicotiana tabacum]
Length=262

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPL  432
            IDP THRP+
Sbjct  121  IDPTTHRPM  129



>ref|XP_009416922.1| PREDICTED: myb-related protein 308-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI  HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQKLITYIAAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+  G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLGRG  120

Query  406  IDPQTHRPL  432
            IDPQTHRP+
Sbjct  121  IDPQTHRPI  129



>dbj|BAA23337.1| OSMYB1 [Oryza sativa]
Length=239

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YIR HGEGCWRSLPK AGLLRCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  EDELII+LHSLLGNKWSLIA +LPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTDDEDELIIRLHSLLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  406  IDPQTHRPL  432
            IDPQTHRPL
Sbjct  121  IDPQTHRPL  129



>gb|EEC67791.1| hypothetical protein OsI_35350 [Oryza sativa Indica Group]
Length=295

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ +GEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKANGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHELLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  VDPQTHRPLN  130



>dbj|BAF46265.1| putative transcription factor [Humulus lupulus]
Length=265

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_002442905.1| hypothetical protein SORBIDRAFT_08g004720 [Sorghum bicolor]
 gb|EES16743.1| hypothetical protein SORBIDRAFT_08g004720 [Sorghum bicolor]
Length=215

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFTQ+EDELIIKLH +LGNKWSLIA RLPGRTDNEIKNYWNT IKRKLI+ G
Sbjct  61   LRPDLKRGNFTQEEDELIIKLHQILGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLIARG  120

Query  406  IDPQTHRP  429
            IDP+TH+P
Sbjct  121  IDPRTHQP  128



>ref|XP_011007997.1| PREDICTED: myb-related protein 308-like [Populus euphratica]
Length=309

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ L++YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLVSYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +EDELII LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL S G
Sbjct  61   LRPDLKRGNFSDEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLFSRG  120

Query  406  IDPQTHRPL  432
            IDP THRPL
Sbjct  121  IDPLTHRPL  129



>ref|XP_006663259.1| PREDICTED: myb-related protein 330-like [Oryza brachyantha]
Length=256

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ +GEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKANGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHELLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  VDPQTHRPLN  130



>sp|P81393.1|MYB08_ANTMA RecName: Full=Myb-related protein 308 [Antirrhinum majus]
Length=232

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 7/162 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETK  531
            IDP THR ++        G A++ +  ++  S++   +E+TK
Sbjct  121  IDPTTHRSIN-------DGTASQDQVTTISFSNANSKEEDTK  155



>ref|NP_001235637.1| MYB transcription factor MYB48 [Glycine max]
 gb|ABH02823.1| MYB transcription factor MYB48 [Glycine max]
Length=235

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDHRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFSLEEDQLIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_011046315.1| PREDICTED: myb-related protein 308-like [Populus euphratica]
Length=271

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEAEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_002444621.1| hypothetical protein SORBIDRAFT_07g024890 [Sorghum bicolor]
 gb|EES14116.1| hypothetical protein SORBIDRAFT_07g024890 [Sorghum bicolor]
Length=258

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGL+RCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLMRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT I+RKL+  G
Sbjct  61   LRPDLKRGNFTADEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLGRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSS  540
            IDP THRP+  + A      + +P   +  +++  P  +  K  +
Sbjct  121  IDPVTHRPIADAGAGTVTTISFQPNKPNAAVAAQAPQHQPIKAVA  165



>ref|XP_010265977.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
Length=244

 Score =   246 bits (629),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI +IR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAHIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPL  432
            IDP THRPL
Sbjct  121  IDPATHRPL  129



>ref|XP_004977237.1| PREDICTED: myb-related protein Zm38-like [Setaria italica]
Length=220

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++ED+LIIKLH +LGNKWS IA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTEEEDDLIIKLHQILGNKWSQIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKC  534
            IDP+THRPL    AAA+   +++PE+     SS +P      C
Sbjct  121  IDPKTHRPLS-VTAAAAAAPSSRPEDQPAARSSCSPETSGACC  162



>ref|XP_006284260.1| hypothetical protein CARUB_v10005426mg [Capsella rubella]
 gb|EOA17158.1| hypothetical protein CARUB_v10005426mg [Capsella rubella]
Length=285

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPL  432
            IDP THRP+
Sbjct  121  IDPTTHRPI  129



>ref|XP_010910804.1| PREDICTED: myb-related protein 308-like [Elaeis guineensis]
Length=260

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ HGEGCWR+LPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRTLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH +LGNKWSLIA RLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGMLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPLD  435
            +DP THRPL+
Sbjct  121  LDPLTHRPLN  130



>emb|CDY12520.1| BnaC07g13600D [Brassica napus]
Length=272

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 148/216 (69%), Gaps = 34/216 (16%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEEDQLL++YIR HGEGCWRSLP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF ++EDELIIKLHSL GNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFAEEEDELIIKLHSLFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHR---------------------PLDasaaaascggaTKPENISLDLSSSTPSQE  522
            IDP THR                     P+    +        KPE + LD   +     
Sbjct  121  IDPNTHRSINGSTTPPPKTTKSSLQNDEPVRFEISGPDQQRIVKPEPMVLDREDAN----  176

Query  523  ETKC-SSGTTSEESHHQPLKDKQRNDEQMAGLDLSI  627
              KC SSGTTSE       KD Q +D+ +  L+LS+
Sbjct  177  -NKCTSSGTTSE-------KDIQTDDDWVLNLELSV  204



>ref|XP_009618136.1| PREDICTED: myb-related protein 308-like [Nicotiana tomentosiformis]
Length=258

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THR ++
Sbjct  121  IDPTTHRAVN  130



>emb|CCC14990.1| Myb transcription factor [Humulus lupulus]
Length=265

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|NP_001235623.1| MYB transcription factor MYB54 [Glycine max]
 gb|ABH02822.1| MYB transcription factor MYB54 [Glycine max]
Length=253

 Score =   246 bits (629),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>gb|ACT82838.1| transcription factor MYB047 [Glycine max]
Length=210

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 134/161 (83%), Gaps = 6/161 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDHRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFSLEEDQLIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEET  528
            IDP THRPL+            +  +++L+L+ S P Q ++
Sbjct  121  IDPATHRPLNDDKVLE------RCPDLNLELTISPPRQPQS  155



>ref|XP_009387206.1| PREDICTED: myb-related protein Zm38-like, partial [Musa acuminata 
subsp. malaccensis]
Length=198

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ L++YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  23   MGRSPCCEKAHTNKGAWTKEEDEKLVSYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  82

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE IIKLH +LGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+  G
Sbjct  83   LRPDLKRGNFTEEEDEHIIKLHGVLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLGRG  142

Query  406  IDPQTHRPL  432
            IDPQTHRP+
Sbjct  143  IDPQTHRPI  151



>ref|XP_008447966.1| PREDICTED: myb-related protein 308-like [Cucumis melo]
Length=250

 Score =   246 bits (628),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 129/162 (80%), Gaps = 5/162 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFTQ ED+LIIKLHSLLGN+WSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTQHEDDLIIKLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETK  531
            IDP THRP+       S    T    IS   +S    QE+ K
Sbjct  121  IDPTTHRPI-----TDSSSVKTPATTISFASNSGLEDQEDRK  157



>emb|CCU64153.1| ScMYB1 protein [Saccharum hybrid cultivar Co 86032]
Length=245

 Score =   246 bits (628),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT I+RKL+  G
Sbjct  61   LRPDLKRGNFTADEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLGRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSS  540
            IDP THRP+  + A  +      P N +  +++ TP  +  +  +
Sbjct  121  IDPVTHRPIAGAGAVTNISFQPSP-NAAGAVAAQTPQHQPIRAEA  164



>gb|KHN19997.1| Myb-related protein 308 [Glycine soja]
Length=240

 Score =   246 bits (628),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 134/161 (83%), Gaps = 6/161 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  31   MGRSPCCEKAHTNKGAWTKEEDHRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  90

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  91   LRPDLKRGNFSLEEDQLIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  150

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEET  528
            IDP THRPL+            +  +++L+L+ S P Q ++
Sbjct  151  IDPATHRPLNDDKVLE------RCPDLNLELTISPPRQPQS  185



>gb|KHN25476.1| Myb-related protein 308 [Glycine soja]
Length=250

 Score =   246 bits (628),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_008799190.1| PREDICTED: myb-related protein 308-like [Phoenix dactylifera]
Length=258

 Score =   246 bits (629),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCC++AHTNKGAWTKEEDQ LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCDRAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLH LLGNKWSLIA +LPGRTDNEIKNYWNT I+RKLIS G
Sbjct  61   LRPDLKRGNFTEKEDELIIKLHGLLGNKWSLIAGQLPGRTDNEIKNYWNTHIRRKLISRG  120

Query  406  IDPQTHRPL  432
            +DP THRPL
Sbjct  121  LDPNTHRPL  129



>gb|AGN52027.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52137.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=184

 Score =   244 bits (622),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 143/194 (74%), Gaps = 16/194 (8%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ LI +I+LHGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLIKHIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELII LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIISLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLMSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEESHHQPLKDK  585
            IDPQTHR L+             P  +S+     T  + +        ++ +H   L D+
Sbjct  121  IDPQTHRLLNPHNQ--------NPRIVSMHTDHPTMMRNDVGFKVIAAADRAH--VLCDE  170

Query  586  QRNDEQMAGLDLSI  627
            Q N      LDLSI
Sbjct  171  QIN------LDLSI  178



>ref|XP_002312966.1| putative MYB transcription factor family protein [Populus trichocarpa]
 gb|EEE86921.1| putative MYB transcription factor family protein [Populus trichocarpa]
 gb|ACN97177.1| MYB transcription factor [Populus trichocarpa]
Length=271

 Score =   247 bits (630),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEAEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>gb|KDP22699.1| hypothetical protein JCGZ_02792 [Jatropha curcas]
 gb|AIT52252.1| MYB family protein [Jatropha curcas]
Length=307

 Score =   248 bits (633),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ L+NYI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLVNYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELII LHSLLG KWSLIAARLPGRTDNEIKNYWNT I+RKL S G
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGTKWSLIAARLPGRTDNEIKNYWNTHIRRKLYSRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHRPL+
Sbjct  121  IDPQTHRPLN  130



>ref|XP_010675151.1| PREDICTED: transcription repressor MYB6-like [Beta vulgaris subsp. 
vulgaris]
Length=322

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED  L+NYI+ HGEGCWRSLPK AGL RCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDDRLVNYIKSHGEGCWRSLPKAAGLQRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELII LHSLLGNKWSLIAA+LPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGNKWSLIAAKLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDPQTHR L+
Sbjct  121  IDPQTHRVLN  130



>ref|NP_195574.1| transcription repressor MYB4 [Arabidopsis thaliana]
 sp|Q9SZP1.1|MYB4_ARATH RecName: Full=Transcription repressor MYB4; AltName: Full=Myb-related 
protein 4; Short=AtMYB4 [Arabidopsis thaliana]
 emb|CAB37518.1| putative transcription factor (MYB4) [Arabidopsis thaliana]
 emb|CAB80526.1| putative transcription factor (MYB4) [Arabidopsis thaliana]
 gb|AAL49837.1| putative transcription factor MYB4 [Arabidopsis thaliana]
 gb|AAM67537.1| putative transcription factor MYB4 [Arabidopsis thaliana]
 gb|AAM98178.1| putative transcription factor MYB4 [Arabidopsis thaliana]
 gb|AAP13410.1| At4g38620 [Arabidopsis thaliana]
 gb|AAS10085.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE86955.1| transcription repressor MYB4 [Arabidopsis thaliana]
Length=282

 Score =   247 bits (631),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPL  432
            IDP +HRP+
Sbjct  121  IDPTSHRPI  129



>gb|EEE51755.1| hypothetical protein OsJ_33189 [Oryza sativa Japonica Group]
Length=295

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ +GEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKANGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE IIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTEEEDEFIIKLHELLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  VDPQTHRPLN  130



>gb|AAC83582.1| putative transcription factor [Arabidopsis thaliana]
Length=282

 Score =   247 bits (630),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKLI+ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  406  IDPQTHRPL  432
            IDP +HRP+
Sbjct  121  IDPTSHRPI  129



>ref|XP_008808618.1| PREDICTED: myb-related protein Hv1 [Phoenix dactylifera]
Length=229

 Score =   245 bits (625),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI +IR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAHIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            +DP THRP+ 
Sbjct  121  LDPTTHRPIS  130



>gb|EEE63808.1| hypothetical protein OsJ_18632 [Oryza sativa Japonica Group]
Length=260

 Score =   246 bits (628),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YIR HGEGCWRSLPK AGLLRCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  EDELII+LHSLLGNKWSLIA +LPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTDDEDELIIRLHSLLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  406  IDPQTHRPL  432
            IDPQTHRPL
Sbjct  121  IDPQTHRPL  129



>gb|ADT91707.1| MYB transcription factor [Gossypium hirsutum]
Length=257

 Score =   246 bits (628),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MG SPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGSSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|NP_001174439.1| Os05g0429900 [Oryza sativa Japonica Group]
 gb|AAV59423.1| putative myb protein [Oryza sativa Japonica Group]
 gb|EAY98145.1| hypothetical protein OsI_20061 [Oryza sativa Indica Group]
 gb|ACF60464.1| myb transcription factor [Oryza sativa Japonica Group]
 dbj|BAG96391.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90147.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93928.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93167.1| Os05g0429900 [Oryza sativa Japonica Group]
Length=260

 Score =   246 bits (628),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YIR HGEGCWRSLPK AGLLRCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  EDELII+LHSLLGNKWSLIA +LPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTDDEDELIIRLHSLLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  406  IDPQTHRPL  432
            IDPQTHRPL
Sbjct  121  IDPQTHRPL  129



>ref|XP_010941310.1| PREDICTED: myb-related protein Hv1-like [Elaeis guineensis]
Length=233

 Score =   245 bits (626),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI +IR+HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAHIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            +DP THRP++
Sbjct  121  LDPTTHRPIN  130



>gb|AHN16572.1| MYB1 [Malus hybrid cultivar]
 gb|AIW63284.1| MYB16 [Malus hybrid cultivar]
Length=252

 Score =   246 bits (627),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRG+FT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGSFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPTTHRPLN  130



>ref|XP_007200603.1| hypothetical protein PRUPE_ppa010277mg [Prunus persica]
 gb|ADY15315.1| R2R3-MYB transcription factor [Prunus avium]
 gb|EMJ01802.1| hypothetical protein PRUPE_ppa010277mg [Prunus persica]
Length=256

 Score =   246 bits (628),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  406  IDPQTHRPLD  435
            IDP THR L+
Sbjct  121  IDPTTHRALN  130



>gb|AAO49417.1|AF485899_1 MYB8 [Dendrobium sp. XMW-2002-8]
Length=216

 Score =   244 bits (624),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ L+ YI++HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAYIKVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RL GRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLQGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPL  432
            IDP THRPL
Sbjct  121  IDPTTHRPL  129



>gb|ABR25756.1| myb related protein hv1 [Oryza sativa Indica Group]
Length=235

 Score =   245 bits (625),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPVTHRPIN  130



>gb|AIS35923.1| MYB transcription factor 6 [Phalaenopsis equestris]
Length=262

 Score =   246 bits (628),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ +GEGCWRSLPK A LLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKANGEGCWRSLPKAASLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKLIS G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  406  IDPQTHRPL  432
            IDP THRPL
Sbjct  121  IDPATHRPL  129



>ref|XP_010920127.1| PREDICTED: myb-related protein 308-like [Elaeis guineensis]
Length=237

 Score =   245 bits (625),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPL  432
            IDP THRP+
Sbjct  121  IDPATHRPI  129



>ref|XP_006660900.1| PREDICTED: myb-related protein Hv1-like [Oryza brachyantha]
Length=248

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPVTHRPIN  130



>ref|NP_001065896.2| Os11g0180900 [Oryza sativa Japonica Group]
 dbj|BAF27741.2| Os11g0180900 [Oryza sativa Japonica Group]
Length=261

 Score =   246 bits (628),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ +GEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKANGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE IIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTEEEDEFIIKLHELLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  406  IDPQTHRPLD  435
            +DPQTHRPL+
Sbjct  121  VDPQTHRPLN  130



>ref|XP_002530824.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF31564.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=266

 Score =   246 bits (628),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_002456719.1| hypothetical protein SORBIDRAFT_03g041360 [Sorghum bicolor]
 gb|EES01839.1| hypothetical protein SORBIDRAFT_03g041360 [Sorghum bicolor]
Length=269

 Score =   246 bits (628),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  +DE+IIKLH+LLGNKWSLIA +LPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTDDDDEIIIKLHALLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPL  432
            IDPQTHRPL
Sbjct  121  IDPQTHRPL  129



>ref|NP_001044957.1| Os01g0874300 [Oryza sativa Japonica Group]
 dbj|BAB86217.1| putative myb-related protein [Oryza sativa Japonica Group]
 dbj|BAB89293.1| putative myb2 [Oryza sativa Japonica Group]
 dbj|BAB92433.1| putative myb2 [Oryza sativa Japonica Group]
 dbj|BAF06871.1| Os01g0874300 [Oryza sativa Japonica Group]
 gb|EAY76672.1| hypothetical protein OsI_04627 [Oryza sativa Indica Group]
 gb|EAZ14337.1| hypothetical protein OsJ_04260 [Oryza sativa Japonica Group]
 dbj|BAG87538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=287

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  +DELIIKLH+LLGNKWSLIA +LPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTDDDDELIIKLHALLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPL  432
            IDPQTHRP+
Sbjct  121  IDPQTHRPV  129



>ref|XP_006659665.1| PREDICTED: myb-related protein Zm38-like [Oryza brachyantha]
Length=247

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 137/176 (78%), Gaps = 5/176 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ L++YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLVSYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT I+RKL+  G
Sbjct  61   LRPDLKRGNFTADEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLGRG  120

Query  406  IDPQTHRPLDasaaaascgg-----aTKPENISLDLSSSTPSQEETKCSSGTTSEE  558
            IDP THRP++A+AAA           T PE   LD     P      C S  +S+E
Sbjct  121  IDPVTHRPVNAAAAATISFQPQAPPPTSPEKEQLDKPPRCPDLNLDLCISPPSSQE  176



>ref|XP_006856762.1| hypothetical protein AMTR_s00055p00057500 [Amborella trichopoda]
 gb|ERN18229.1| hypothetical protein AMTR_s00055p00057500 [Amborella trichopoda]
Length=233

 Score =   245 bits (625),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI++IR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISHIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            +DP THRP++
Sbjct  121  VDPLTHRPIN  130



>gb|AGN52052.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52162.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=219

 Score =   244 bits (624),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLISYIRAHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDE+IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+  G
Sbjct  61   LRPDLKRGNFTEEEDEVIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLRRG  120

Query  406  IDPQTHRPLD  435
            +DPQTHR ++
Sbjct  121  MDPQTHRQIN  130



>gb|AFZ78649.1| MYB transcription factor [Populus tomentosa]
Length=269

 Score =   246 bits (628),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEAEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_006366980.1| PREDICTED: myb-related protein 308-like [Solanum tuberosum]
Length=268

 Score =   246 bits (628),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFSEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THR ++
Sbjct  121  IDPTTHRSIN  130



>ref|NP_001063796.1| Os09g0538400 [Oryza sativa Japonica Group]
 dbj|BAD34380.1| putative Myb-related protein Zm38 [Oryza sativa Japonica Group]
 dbj|BAF25710.1| Os09g0538400 [Oryza sativa Japonica Group]
 gb|EAZ09902.1| hypothetical protein OsI_32196 [Oryza sativa Indica Group]
 gb|EAZ45501.1| hypothetical protein OsJ_30158 [Oryza sativa Japonica Group]
 dbj|BAG96655.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96699.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99491.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60239.1| MYB transcription factor [Oryza sativa Japonica Group]
Length=251

 Score =   245 bits (626),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPVTHRPIN  130



>emb|CBI37882.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   244 bits (623),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 134/172 (78%), Gaps = 6/172 (3%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEES  561
            IDP THRP++  +            N+ L +S     Q ET   +G  S  +
Sbjct  121  IDPSTHRPINEPSPDCPDL------NLELRISPPYQPQAETPLKTGGRSSST  166



>ref|XP_008800133.1| PREDICTED: myb-related protein Hv1-like [Phoenix dactylifera]
Length=236

 Score =   245 bits (625),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLVNRG  120

Query  406  IDPQTHRPL  432
            IDP THRP+
Sbjct  121  IDPATHRPI  129



>gb|EPS68365.1| hypothetical protein M569_06408, partial [Genlisea aurea]
Length=129

 Score =   241 bits (615),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI Y++ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLITYVKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+++ED++IIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNT +KR+LIS G
Sbjct  61   LRPDLKRGNFSEEEDDIIIKLHSLLGNKWSMIAGRLPGRTDNEIKNYWNTHLKRRLISRG  120

Query  406  IDPQTHRPL  432
            +DPQTHR +
Sbjct  121  VDPQTHRAI  129



>ref|NP_001106037.1| transcription factor MYB8 [Zea mays]
 emb|CAJ42201.1| transcription factor MYB8 [Zea mays]
 gb|ADX60104.1| ZmMYB8 transcription factor [Zea mays]
 tpg|DAA55533.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=226

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFTQ+ED++IIKLH +LGNKWSLIAA+LPGRTDNEIKNYWNT IKRKLI+ G
Sbjct  61   LRPDLKRGNFTQEEDDVIIKLHQVLGNKWSLIAAQLPGRTDNEIKNYWNTHIKRKLIARG  120

Query  406  IDPQTHRP  429
            IDP+TH+P
Sbjct  121  IDPRTHQP  128



>dbj|BAM71805.1| R2R3-MYB transcription factor [Gentiana triflora]
Length=247

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 139/182 (76%), Gaps = 7/182 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHINKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFTQ ED+LII LHS LGNKWSLIA +LPGRTDNEIKNYWNT I+RKL+  G
Sbjct  61   LRPDLKRGNFTQDEDDLIINLHSFLGNKWSLIAGKLPGRTDNEIKNYWNTHIRRKLLRQG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSEESHHQPLKDK  585
            IDP THRP++  +             I L+ ++ST ++E +   +  +S + HH   +D+
Sbjct  121  IDPATHRPINELSKKEYKTT------IILN-TTSTSNEEASNFDTHDSSPDDHHNNKEDE  173

Query  586  QR  591
            +R
Sbjct  174  KR  175



>ref|XP_011097098.1| PREDICTED: myb-related protein 308-like [Sesamum indicum]
Length=274

 Score =   246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK HTNKGAWTKEED+ L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLVKYIKQHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDE+II LHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL+  G
Sbjct  61   LRPDLKRGNFTDEEDEIIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLGRG  120

Query  406  IDPQTHRPL  432
            IDPQTHRP+
Sbjct  121  IDPQTHRPV  129



>ref|XP_009406085.1| PREDICTED: myb-related protein 308-like [Musa acuminata subsp. 
malaccensis]
Length=257

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEEDQ LI YI+ HGEGCWRSLP  AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQKLIAYIKAHGEGCWRSLPSAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++ED LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDALIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRP  429
            IDPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_009603939.1| PREDICTED: myb-related protein 308-like [Nicotiana tomentosiformis]
Length=264

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 139/181 (77%), Gaps = 10/181 (6%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEK+HTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKSHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSSGTTSE-ESHHQPLKD  582
            IDP THR ++ S+              S+  +S    +   K   GT  E E   +P+K+
Sbjct  121  IDPTTHRAINESSTQKV---------TSISFASGNDEKINIKAEFGTIKEDEISSRPVKE  171

Query  583  K  585
            +
Sbjct  172  E  172



>ref|XP_010266817.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
Length=241

 Score =   244 bits (624),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI +IR +GEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAHIRAYGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_004978868.1| PREDICTED: transcription repressor MYB4-like [Setaria italica]
Length=280

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCE+AHTNKGAWTKEEDQ LI YI+ HGEGCWRSLP+ AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEQAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPRAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIK H L GNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKFHELFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLVARG  120

Query  406  IDPQTHRPL  432
            IDPQTHRP+
Sbjct  121  IDPQTHRPI  129



>gb|ABQ51221.1| R2R3-MYB transcription factor MYB5 [Picea glauca]
Length=257

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 145/196 (74%), Gaps = 7/196 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI +IR HGEGCWRSLPK AGL+RCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAHIRAHGEGCWRSLPKAAGLMRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFSEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLNKG  120

Query  406  IDPQTHRPLDasaaaasc-ggaTKPENISLDLSSS-TPSQEETKCSSGTTSEESHHQPLK  579
            +DPQ+HRPL    ++ +       PE+  L   S  TP     + +     E S   P++
Sbjct  121  LDPQSHRPLGQVHSSNTTCSSLPAPEHEILAFQSPRTP-----EIADFFQYERSESSPIE  175

Query  580  DKQRNDEQMAGLDLSI  627
                 DE+   L+L +
Sbjct  176  PAASKDEEYPDLNLEL  191



>gb|AEX92833.1| MYB42 [Saccharum hybrid cultivar Co 86032]
Length=260

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT I+RKL+  G
Sbjct  61   LRPDLKRGNFTADEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLGRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEETKCSS  540
            IDP THRP+  + A  +      P N +  +++ TP  +  +  +
Sbjct  121  IDPVTHRPIAGAGAVTNISFQPSP-NAAGAVAAQTPQHQPIRAEA  164



>gb|AJD79907.1| MYB1 [Punica granatum]
Length=263

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPSTHRPIN  130



>gb|AEM17349.1| R2R3-MYB transcriptional factor PvMYB4b [Panicum virgatum]
Length=256

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 128/160 (80%), Gaps = 11/160 (7%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNK AWTKEED  L+ YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKCAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT  ED+LI+KLHSLLGNKWSLIAARLPGRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEE  525
            IDP THRP+           A    N+++      PSQ++
Sbjct  121  IDPVTHRPI-----------ADAARNVTISFQPDAPSQQQ  149



>ref|XP_008236005.1| PREDICTED: myb-related protein 308-like [Prunus mume]
Length=256

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  406  IDPQTHRPLD  435
            IDP THR L+
Sbjct  121  IDPTTHRALN  130



>tpg|DAA38957.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=269

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCE+AHTNKGAWTKEEDQ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEQAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+++EDELIIK H L GNKWSLIA RLPGRTDNEIKNYWNT IKRKL++ G
Sbjct  61   LRPDLKRGNFSEEEDELIIKFHELFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  406  IDPQTHRPL  432
            +DPQTHRPL
Sbjct  121  MDPQTHRPL  129



>ref|XP_010933337.1| PREDICTED: myb-related protein Hv1-like [Elaeis guineensis]
Length=229

 Score =   244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTKEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPL  432
            IDP THRP+
Sbjct  121  IDPATHRPI  129



>gb|ADX33331.1| R2R3-MYB transcription factor [Petunia x hybrida]
Length=258

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT+ EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THR ++
Sbjct  121  IDPTTHRIMN  130



>gb|AIS35924.1| MYB transcription factor 7 [Phalaenopsis equestris]
Length=249

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ L  +I+ +GEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLTAHIKAYGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLMSSG  120

Query  406  IDPQTHRPL  432
            IDP THRPL
Sbjct  121  IDPATHRPL  129



>ref|XP_009764613.1| PREDICTED: myb-related protein 308-like [Nicotiana sylvestris]
Length=262

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED+ LI YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THR ++
Sbjct  121  IDPTTHRLMN  130



>ref|NP_001236232.1| uncharacterized protein LOC100306265 [Glycine max]
 gb|ACU14367.1| unknown [Glycine max]
Length=210

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 133/161 (83%), Gaps = 6/161 (4%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI+YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDHRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNF+ +ED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFSLEEDQLIIKLHRLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascggaTKPENISLDLSSSTPSQEET  528
            IDP THRPL+            +  +++L+L+ S P Q ++
Sbjct  121  IDPATHRPLNDDKVLE------RCPDLNLELTISPPRQPQS  155



>ref|XP_006422616.1| hypothetical protein CICLE_v10028908mg [Citrus clementina]
 gb|ESR35856.1| hypothetical protein CICLE_v10028908mg [Citrus clementina]
Length=307

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  LI YIR HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT +EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL++ G
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  406  IDPQTHRPLD  435
            IDP THRPL+
Sbjct  121  IDPATHRPLN  130



>ref|XP_004957488.1| PREDICTED: myb-related protein Hv1-like [Setaria italica]
Length=246

 Score =   244 bits (623),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAHTNKGAWTKEED  L+ YI+ HGEGCWRSLPK AGLLRCGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNT I+RKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  406  IDPQTHRPLD  435
            IDP THRP++
Sbjct  121  IDPVTHRPIN  130



>gb|KFK44357.1| hypothetical protein AALP_AA1G246900 [Arabis alpina]
Length=251

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 138/185 (75%), Gaps = 14/185 (8%)
 Frame = +1

Query  46   MGRSPCCEKAHTNKGAWTKEEDQLLINYIRLHGEGCWRSLPKPAGLLRCGKSCRLRWINY  225
            MGRSPCCEKAH NKGAWTKEEDQLL++YIR HGEGCWRSLP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNY  60

Query  226  LRPDLKRGNFTQQEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTQIKRKLISCG  405
            LRPDLKRGNFT++EDELIIKLHSLLGNKWSLIA RL GRTDNEIKNYWNT IKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLAGRTDNEIKNYWNTHIKRKLLSRG  120

Query  406  IDPQTHRPLDasaaaascgg--------------aTKPENISLDLSSSTPSQEETKCSSG  543
            IDP  HRP++ S++                      KPE + LD      +      SSG
Sbjct  121  IDPNNHRPINESSSPNDVVEPPQVDFSTGPDQQITIKPEPVVLDREVVNNNNNNNCTSSG  180

Query  544  TTSEE  558
            TTS++
Sbjct  181  TTSDD  185



Lambda      K        H        a         alpha
   0.315    0.133    0.415    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250