BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H15

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36508.1|  hypothetical protein MIMGU_mgv1a008665mg                187   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_011074175.1|  PREDICTED: uncharacterized methyltransferase...    180   8e-52   Sesamum indicum [beniseed]
emb|CDP01043.1|  unnamed protein product                                172   2e-48   Coffea canephora [robusta coffee]
ref|XP_003522802.1|  PREDICTED: uncharacterized methyltransferase...    165   4e-46   Glycine max [soybeans]
gb|AFK47008.1|  unknown                                                 164   8e-46   Lotus japonicus
ref|XP_002285799.1|  PREDICTED: uncharacterized methyltransferase...    163   2e-45   Vitis vinifera
ref|XP_007136240.1|  hypothetical protein PHAVU_009G030200g             162   7e-45   Phaseolus vulgaris [French bean]
ref|XP_008219673.1|  PREDICTED: uncharacterized methyltransferase...    161   1e-44   Prunus mume [ume]
gb|KHN19749.1|  Putative methyltransferase, chloroplastic               160   2e-44   Glycine soja [wild soybean]
ref|XP_007222212.1|  hypothetical protein PRUPE_ppa007824mg             159   6e-44   Prunus persica
ref|XP_002302290.2|  hypothetical protein POPTR_0002s09570g             159   7e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006386404.1|  hypothetical protein POPTR_0002s09570g             159   9e-44   
ref|XP_004500619.1|  PREDICTED: uncharacterized methyltransferase...    158   1e-43   Cicer arietinum [garbanzo]
ref|XP_011016296.1|  PREDICTED: uncharacterized methyltransferase...    155   3e-42   Populus euphratica
gb|KEH34908.1|  S-adenosylmethionine-dependent methyltransferase        154   6e-42   Medicago truncatula
gb|KDO80936.1|  hypothetical protein CISIN_1g018003mg                   150   1e-41   Citrus sinensis [apfelsine]
ref|XP_010059991.1|  PREDICTED: uncharacterized methyltransferase...    153   2e-41   Eucalyptus grandis [rose gum]
ref|XP_010269234.1|  PREDICTED: uncharacterized methyltransferase...    153   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_006434006.1|  hypothetical protein CICLE_v10001682mg             150   4e-41   
gb|KDO80930.1|  hypothetical protein CISIN_1g018003mg                   150   1e-40   Citrus sinensis [apfelsine]
ref|XP_006434005.1|  hypothetical protein CICLE_v10001682mg             150   2e-40   
gb|KDO80931.1|  hypothetical protein CISIN_1g018003mg                   150   2e-40   Citrus sinensis [apfelsine]
ref|XP_006472620.1|  PREDICTED: uncharacterized methyltransferase...    150   3e-40   
gb|KDO80933.1|  hypothetical protein CISIN_1g018003mg                   150   4e-40   Citrus sinensis [apfelsine]
ref|XP_008391080.1|  PREDICTED: uncharacterized methyltransferase...    147   2e-39   
ref|XP_008348560.1|  PREDICTED: uncharacterized methyltransferase...    148   4e-39   
ref|XP_004299641.1|  PREDICTED: uncharacterized methyltransferase...    145   2e-38   Fragaria vesca subsp. vesca
ref|XP_010064389.1|  PREDICTED: uncharacterized methyltransferase...    139   4e-36   
ref|XP_010042876.1|  PREDICTED: uncharacterized methyltransferase...    134   5e-36   
ref|XP_008374425.1|  PREDICTED: uncharacterized methyltransferase...    137   2e-35   
ref|XP_008374562.1|  PREDICTED: uncharacterized methyltransferase...    136   3e-35   
gb|KDP41368.1|  hypothetical protein JCGZ_15775                         136   5e-35   Jatropha curcas
ref|XP_009394965.1|  PREDICTED: uncharacterized methyltransferase...    135   7e-35   
ref|XP_007018799.1|  S-adenosylmethionine-dependent methyltransfe...    135   7e-35   
ref|XP_009394966.1|  PREDICTED: uncharacterized methyltransferase...    134   1e-34   
ref|XP_009373157.1|  PREDICTED: uncharacterized methyltransferase...    134   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_009394964.1|  PREDICTED: uncharacterized methyltransferase...    134   3e-34   
ref|XP_010061813.1|  PREDICTED: uncharacterized methyltransferase...    132   1e-33   Eucalyptus grandis [rose gum]
ref|XP_010064206.1|  PREDICTED: uncharacterized methyltransferase...    132   2e-33   Eucalyptus grandis [rose gum]
ref|XP_002889176.1|  predicted protein                                  132   2e-33   
ref|XP_006390018.1|  hypothetical protein EUTSA_v10018789mg             130   5e-33   Eutrema salsugineum [saltwater cress]
ref|XP_002513908.1|  S-adenosylmethionine-dependent methyltransfe...    129   2e-32   
ref|XP_006300528.1|  hypothetical protein CARUB_v10020572mg             129   2e-32   
ref|XP_008356589.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    127   3e-32   
gb|AAG52104.1|AC012680_15  hypothetical protein; 38642-36701            128   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008374488.1|  PREDICTED: uncharacterized methyltransferase...    128   5e-32   
ref|NP_565170.1|  S-adenosyl-L-methionine-dependent methyltransfe...    128   5e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KJB59929.1|  hypothetical protein B456_009G281700                    127   8e-32   Gossypium raimondii
gb|KCW67137.1|  hypothetical protein EUGRSUZ_F00926                     126   1e-31   Eucalyptus grandis [rose gum]
ref|XP_010472019.1|  PREDICTED: uncharacterized methyltransferase...    126   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010534072.1|  PREDICTED: uncharacterized methyltransferase...    125   2e-31   
ref|XP_010472020.1|  PREDICTED: uncharacterized methyltransferase...    126   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010534070.1|  PREDICTED: uncharacterized methyltransferase...    125   4e-31   Tarenaya hassleriana [spider flower]
ref|XP_010534071.1|  PREDICTED: uncharacterized methyltransferase...    125   5e-31   
ref|XP_009128280.1|  PREDICTED: uncharacterized methyltransferase...    125   6e-31   Brassica rapa
ref|XP_010428930.1|  PREDICTED: uncharacterized methyltransferase...    125   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010428929.1|  PREDICTED: uncharacterized methyltransferase...    125   7e-31   Camelina sativa [gold-of-pleasure]
emb|CDY26853.1|  BnaA02g18780D                                          124   8e-31   Brassica napus [oilseed rape]
ref|XP_010937469.1|  PREDICTED: uncharacterized methyltransferase...    124   1e-30   Elaeis guineensis
ref|XP_010416782.1|  PREDICTED: uncharacterized methyltransferase...    124   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010416783.1|  PREDICTED: uncharacterized methyltransferase...    124   2e-30   Camelina sativa [gold-of-pleasure]
gb|KHG01878.1|  hypothetical protein F383_23026                         124   2e-30   Gossypium arboreum [tree cotton]
ref|XP_008808068.1|  PREDICTED: uncharacterized methyltransferase...    122   9e-30   Phoenix dactylifera
emb|CDY14625.1|  BnaC02g24880D                                          121   1e-29   Brassica napus [oilseed rape]
gb|KJB14720.1|  hypothetical protein B456_002G140100                    122   1e-29   Gossypium raimondii
emb|CDX88421.1|  BnaC06g38650D                                          120   5e-29   
gb|KJB59930.1|  hypothetical protein B456_009G281700                    118   6e-29   Gossypium raimondii
gb|KJB59931.1|  hypothetical protein B456_009G281700                    118   2e-28   Gossypium raimondii
ref|XP_006472621.1|  PREDICTED: uncharacterized methyltransferase...    117   3e-28   
ref|XP_008790838.1|  PREDICTED: uncharacterized methyltransferase...    117   4e-28   Phoenix dactylifera
ref|XP_008790837.1|  PREDICTED: uncharacterized methyltransferase...    117   4e-28   
ref|XP_009595293.1|  PREDICTED: uncharacterized methyltransferase...    113   4e-28   Nicotiana tomentosiformis
ref|XP_009595292.1|  PREDICTED: uncharacterized methyltransferase...    113   4e-28   Nicotiana tomentosiformis
emb|CBI25578.3|  unnamed protein product                                116   1e-27   Vitis vinifera
ref|XP_002268200.1|  PREDICTED: uncharacterized methyltransferase...    116   1e-27   Vitis vinifera
ref|XP_010656529.1|  PREDICTED: uncharacterized methyltransferase...    116   1e-27   Vitis vinifera
ref|XP_008466034.1|  PREDICTED: uncharacterized methyltransferase...    116   1e-27   Cucumis melo [Oriental melon]
emb|CDP10502.1|  unnamed protein product                                115   2e-27   Coffea canephora [robusta coffee]
ref|XP_009106463.1|  PREDICTED: uncharacterized methyltransferase...    115   2e-27   
ref|XP_009363912.1|  PREDICTED: uncharacterized methyltransferase...    114   7e-27   Pyrus x bretschneideri [bai li]
ref|XP_006473930.1|  PREDICTED: uncharacterized methyltransferase...    113   1e-26   
gb|KJB53959.1|  hypothetical protein B456_009G013400                    111   2e-26   Gossypium raimondii
ref|XP_011017926.1|  PREDICTED: uncharacterized methyltransferase...    112   2e-26   Populus euphratica
ref|XP_009106462.1|  PREDICTED: uncharacterized methyltransferase...    112   3e-26   Brassica rapa
emb|CDX87473.1|  BnaA07g34000D                                          112   3e-26   
ref|XP_006453728.1|  hypothetical protein CICLE_v10008875mg             111   4e-26   Citrus clementina [clementine]
gb|KDO59315.1|  hypothetical protein CISIN_1g019950mg                   111   4e-26   Citrus sinensis [apfelsine]
gb|KJB53958.1|  hypothetical protein B456_009G013400                    112   4e-26   Gossypium raimondii
ref|XP_008391145.1|  PREDICTED: uncharacterized methyltransferase...    110   5e-26   
gb|KDO59317.1|  hypothetical protein CISIN_1g019950mg                   111   5e-26   Citrus sinensis [apfelsine]
gb|KDO59316.1|  hypothetical protein CISIN_1g019950mg                   111   5e-26   Citrus sinensis [apfelsine]
gb|KDO59313.1|  hypothetical protein CISIN_1g019950mg                   111   5e-26   Citrus sinensis [apfelsine]
gb|KDO59312.1|  hypothetical protein CISIN_1g019950mg                   111   6e-26   Citrus sinensis [apfelsine]
gb|ABR16838.1|  unknown                                                 111   7e-26   Picea sitchensis
gb|EPS57983.1|  hypothetical protein M569_16834                         105   9e-26   Genlisea aurea
ref|XP_009802104.1|  PREDICTED: uncharacterized methyltransferase...    110   9e-26   Nicotiana sylvestris
ref|XP_004136403.1|  PREDICTED: uncharacterized methyltransferase...    110   1e-25   
ref|XP_008788786.1|  PREDICTED: uncharacterized methyltransferase...    110   1e-25   
ref|XP_006359517.1|  PREDICTED: uncharacterized methyltransferase...    110   2e-25   Solanum tuberosum [potatoes]
ref|XP_004161765.1|  PREDICTED: uncharacterized methyltransferase...    110   2e-25   
ref|XP_008336951.1|  PREDICTED: uncharacterized methyltransferase...    110   2e-25   
ref|XP_004242718.1|  PREDICTED: uncharacterized methyltransferase...    109   3e-25   Solanum lycopersicum
gb|KJB27062.1|  hypothetical protein B456_004G275300                    109   3e-25   Gossypium raimondii
gb|KJB27061.1|  hypothetical protein B456_004G275300                    109   3e-25   Gossypium raimondii
ref|XP_010105909.1|  putative methyltransferase                         108   3e-25   
ref|XP_009358530.1|  PREDICTED: uncharacterized methyltransferase...    108   4e-25   
ref|XP_006852799.1|  hypothetical protein AMTR_s00033p00159870          108   4e-25   
ref|XP_009338403.1|  PREDICTED: uncharacterized methyltransferase...    108   4e-25   Pyrus x bretschneideri [bai li]
gb|AFW76187.1|  hypothetical protein ZEAMMB73_680706                    106   4e-25   
gb|KDP30197.1|  hypothetical protein JCGZ_16979                         108   5e-25   Jatropha curcas
ref|XP_009338401.1|  PREDICTED: uncharacterized methyltransferase...    108   5e-25   Pyrus x bretschneideri [bai li]
ref|XP_010939635.1|  PREDICTED: uncharacterized methyltransferase...    108   6e-25   Elaeis guineensis
ref|XP_006359516.1|  PREDICTED: uncharacterized methyltransferase...    108   6e-25   Solanum tuberosum [potatoes]
ref|XP_010687777.1|  PREDICTED: uncharacterized methyltransferase...    108   7e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK46366.1|  unknown                                                 108   7e-25   Medicago truncatula
gb|ACJ84583.1|  unknown                                                 108   8e-25   Medicago truncatula
ref|XP_004242719.1|  PREDICTED: uncharacterized methyltransferase...    107   1e-24   Solanum lycopersicum
ref|XP_006659389.1|  PREDICTED: uncharacterized methyltransferase...    107   1e-24   
ref|XP_008389527.1|  PREDICTED: uncharacterized methyltransferase...    107   2e-24   
ref|XP_003546595.1|  PREDICTED: uncharacterized methyltransferase...    107   2e-24   Glycine max [soybeans]
ref|XP_002324579.2|  methyltransferase-related family protein           107   2e-24   
ref|XP_010099510.1|  putative methyltransferase                         107   2e-24   Morus notabilis
gb|KHG26587.1|  hypothetical protein F383_01046                         107   2e-24   Gossypium arboreum [tree cotton]
ref|XP_004973409.1|  PREDICTED: uncharacterized methyltransferase...    107   2e-24   Setaria italica
ref|XP_002988667.1|  hypothetical protein SELMODRAFT_46133              106   2e-24   
ref|XP_011470680.1|  PREDICTED: uncharacterized methyltransferase...    107   2e-24   Fragaria vesca subsp. vesca
ref|XP_011078555.1|  PREDICTED: uncharacterized methyltransferase...    107   2e-24   Sesamum indicum [beniseed]
gb|KHG21340.1|  hypothetical protein F383_03824                         107   2e-24   Gossypium arboreum [tree cotton]
ref|XP_011020252.1|  PREDICTED: uncharacterized methyltransferase...    106   3e-24   Populus euphratica
gb|KHN28439.1|  Putative methyltransferase, chloroplastic               106   3e-24   Glycine soja [wild soybean]
ref|XP_002268107.1|  PREDICTED: uncharacterized methyltransferase...    106   3e-24   Vitis vinifera
ref|NP_001132053.1|  uncharacterized LOC100193465                       106   4e-24   Zea mays [maize]
ref|XP_002531454.1|  phosphatidylethanolamine n-methyltransferase...    105   4e-24   
gb|ACG27569.1|  S-adenosylmethionine-dependent methyltransferase        106   4e-24   Zea mays [maize]
gb|ACF85541.1|  unknown                                                 106   4e-24   Zea mays [maize]
ref|XP_010667997.1|  PREDICTED: uncharacterized methyltransferase...    106   4e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004965743.1|  PREDICTED: uncharacterized methyltransferase...    105   6e-24   Setaria italica
ref|XP_010928267.1|  PREDICTED: uncharacterized methyltransferase...    105   6e-24   Elaeis guineensis
ref|XP_004287240.1|  PREDICTED: uncharacterized methyltransferase...    105   7e-24   Fragaria vesca subsp. vesca
ref|XP_004965742.1|  PREDICTED: uncharacterized methyltransferase...    105   7e-24   Setaria italica
ref|XP_011470644.1|  PREDICTED: uncharacterized methyltransferase...    105   8e-24   Fragaria vesca subsp. vesca
ref|XP_002986403.1|  hypothetical protein SELMODRAFT_235009             105   8e-24   Selaginella moellendorffii
ref|XP_010533098.1|  PREDICTED: uncharacterized methyltransferase...    105   9e-24   Tarenaya hassleriana [spider flower]
ref|XP_010928269.1|  PREDICTED: uncharacterized methyltransferase...    105   9e-24   
ref|XP_004488470.1|  PREDICTED: uncharacterized methyltransferase...    105   1e-23   Cicer arietinum [garbanzo]
ref|NP_001242875.1|  uncharacterized protein LOC100798970               105   1e-23   
ref|XP_004974685.1|  PREDICTED: uncharacterized methyltransferase...    105   1e-23   
gb|KJB53960.1|  hypothetical protein B456_009G013400                    104   1e-23   Gossypium raimondii
ref|XP_010250394.1|  PREDICTED: uncharacterized protein LOC104592660    107   1e-23   
ref|XP_007202300.1|  hypothetical protein PRUPE_ppa007882mg             104   2e-23   Prunus persica
ref|XP_009141962.1|  PREDICTED: uncharacterized methyltransferase...    104   2e-23   Brassica rapa
ref|XP_002438745.1|  hypothetical protein SORBIDRAFT_10g025400          104   2e-23   Sorghum bicolor [broomcorn]
dbj|BAF93193.1|  putative methyltransferase-like                        101   2e-23   Hordeum vulgare [barley]
emb|CDY57579.1|  BnaC04g56820D                                          104   2e-23   Brassica napus [oilseed rape]
dbj|BAJ94151.1|  predicted protein                                      103   3e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007013645.1|  S-adenosyl-L-methionine-dependent methyltran...    103   4e-23   
gb|EMT00494.1|  Putative methyltransferase                              104   4e-23   
dbj|BAJ91607.1|  predicted protein                                      103   4e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003574470.1|  PREDICTED: uncharacterized methyltransferase...    103   7e-23   Brachypodium distachyon [annual false brome]
ref|XP_006411367.1|  hypothetical protein EUTSA_v10016844mg             103   7e-23   Eutrema salsugineum [saltwater cress]
gb|EMT07919.1|  Putative methyltransferase                              102   9e-23   
ref|XP_006381066.1|  methyltransferase-related family protein           102   1e-22   
gb|AAD12007.1|  hypothetical protein                                    101   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003563313.1|  PREDICTED: uncharacterized methyltransferase...    102   1e-22   Brachypodium distachyon [annual false brome]
gb|EMT30153.1|  Putative methyltransferase                              102   1e-22   
gb|EYU34934.1|  hypothetical protein MIMGU_mgv1a009522mg                102   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_002445476.1|  hypothetical protein SORBIDRAFT_07g020130          102   2e-22   Sorghum bicolor [broomcorn]
gb|AEJ88263.1|  putative S-adenosylmethionine-dependent methyltra...    100   2e-22   Wolffia arrhiza
ref|XP_009386973.1|  PREDICTED: uncharacterized methyltransferase...    101   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006293382.1|  hypothetical protein CARUB_v10023510mg             101   3e-22   Capsella rubella
ref|NP_181637.2|  uncharacterized methyltransferase                     100   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505866.1|  PREDICTED: uncharacterized methyltransferase...    100   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010508773.1|  PREDICTED: uncharacterized methyltransferase...    100   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010050326.1|  PREDICTED: uncharacterized methyltransferase...    100   5e-22   Eucalyptus grandis [rose gum]
ref|XP_006586686.1|  PREDICTED: uncharacterized protein LOC100798...    100   5e-22   Glycine max [soybeans]
gb|ACF86599.1|  unknown                                               97.8    6e-22   Zea mays [maize]
ref|XP_010517586.1|  PREDICTED: uncharacterized methyltransferase...    100   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_001778776.1|  predicted protein                                99.8    8e-22   
ref|XP_004167998.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.8    9e-22   
ref|XP_010928268.1|  PREDICTED: uncharacterized methyltransferase...  99.8    9e-22   
ref|XP_008456627.1|  PREDICTED: uncharacterized methyltransferase...  99.8    1e-21   Cucumis melo [Oriental melon]
ref|XP_004287239.1|  PREDICTED: uncharacterized methyltransferase...  99.0    1e-21   Fragaria vesca subsp. vesca
ref|XP_008456635.1|  PREDICTED: uncharacterized methyltransferase...  99.4    1e-21   Cucumis melo [Oriental melon]
dbj|BAC99645.1|  hypothetical protein                                 99.0    1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010928270.1|  PREDICTED: uncharacterized methyltransferase...  99.0    1e-21   
emb|CDY06948.1|  BnaA04g23670D                                          102   2e-21   
ref|NP_001058196.1|  Os06g0646000                                     99.0    2e-21   
ref|XP_006657188.1|  PREDICTED: uncharacterized methyltransferase...  99.0    2e-21   
gb|EEC83568.1|  hypothetical protein OsI_29220                        99.0    2e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001061786.1|  Os08g0411200                                     99.0    2e-21   
gb|EEE68668.1|  hypothetical protein OsJ_27281                        98.6    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KCW45297.1|  hypothetical protein EUGRSUZ_L01041                   97.1    3e-21   Eucalyptus grandis [rose gum]
ref|XP_004139262.1|  PREDICTED: uncharacterized methyltransferase...  97.8    4e-21   Cucumis sativus [cucumbers]
gb|KGN60753.1|  hypothetical protein Csa_2G009410                     97.8    4e-21   Cucumis sativus [cucumbers]
emb|CDP12319.1|  unnamed protein product                              94.4    4e-21   Coffea canephora [robusta coffee]
ref|NP_001150427.1|  S-adenosylmethionine-dependent methyltransfe...  97.8    4e-21   Zea mays [maize]
gb|KCW79027.1|  hypothetical protein EUGRSUZ_C00449                   97.4    5e-21   Eucalyptus grandis [rose gum]
ref|XP_010047200.1|  PREDICTED: uncharacterized methyltransferase...  97.4    6e-21   Eucalyptus grandis [rose gum]
ref|XP_010040339.1|  PREDICTED: uncharacterized methyltransferase...  96.7    6e-21   Eucalyptus grandis [rose gum]
gb|KCW79026.1|  hypothetical protein EUGRSUZ_C00449                   97.1    7e-21   Eucalyptus grandis [rose gum]
gb|KFK36957.1|  hypothetical protein AALP_AA4G194500                  97.1    7e-21   Arabis alpina [alpine rockcress]
ref|XP_002879904.1|  hypothetical protein ARALYDRAFT_903411           97.1    8e-21   
gb|KGN60338.1|  hypothetical protein Csa_3G895840                     94.0    1e-20   Cucumis sativus [cucumbers]
ref|XP_008336947.1|  PREDICTED: uncharacterized methyltransferase...  93.2    1e-19   
ref|XP_008336950.1|  PREDICTED: uncharacterized methyltransferase...  93.2    1e-19   
ref|XP_008242913.1|  PREDICTED: uncharacterized methyltransferase...  85.1    8e-17   
ref|XP_006826926.1|  hypothetical protein AMTR_s00010p00172800        82.4    5e-16   
ref|XP_006473932.1|  PREDICTED: uncharacterized methyltransferase...  80.5    7e-16   Citrus sinensis [apfelsine]
ref|XP_006474605.1|  PREDICTED: uncharacterized methyltransferase...  80.1    1e-15   Citrus sinensis [apfelsine]
gb|EMT14235.1|  Putative methyltransferase                            83.2    2e-15   
ref|XP_002306577.1|  hypothetical protein POPTR_0005s17000g           74.7    7e-14   
ref|XP_002306578.1|  methyltransferase-related family protein         76.3    9e-14   
ref|XP_002968407.1|  hypothetical protein SELMODRAFT_89857            76.6    1e-13   
gb|KEH37884.1|  S-adenosylmethionine-dependent methyltransferase      75.5    2e-13   Medicago truncatula
ref|XP_005643537.1|  S-adenosyl-L-methionine-dependent methyltran...  76.6    2e-13   Coccomyxa subellipsoidea C-169
ref|XP_005842697.1|  hypothetical protein CHLNCDRAFT_136276           73.2    6e-13   Chlorella variabilis
gb|KDO80932.1|  hypothetical protein CISIN_1g018003mg                 70.5    8e-12   Citrus sinensis [apfelsine]
ref|XP_006434004.1|  hypothetical protein CICLE_v10001682mg           70.1    9e-12   
ref|XP_002954755.1|  hypothetical protein VOLCADRAFT_106536           70.9    2e-11   Volvox carteri f. nagariensis
ref|XP_001694737.1|  predicted protein                                66.6    3e-10   Chlamydomonas reinhardtii
ref|XP_010040340.1|  PREDICTED: uncharacterized methyltransferase...  64.3    5e-10   
gb|KCW45298.1|  hypothetical protein EUGRSUZ_L01042                   63.9    7e-10   Eucalyptus grandis [rose gum]
emb|CAN77779.1|  hypothetical protein VITISV_004172                   67.4    7e-10   Vitis vinifera
ref|XP_008344066.1|  PREDICTED: uncharacterized methyltransferase...  64.7    2e-09   
ref|XP_003056709.1|  predicted protein                                58.5    4e-07   Micromonas pusilla CCMP1545
gb|KHN03912.1|  Putative methyltransferase, chloroplastic             56.6    5e-07   Glycine soja [wild soybean]
ref|XP_003527908.1|  PREDICTED: uncharacterized methyltransferase...  57.0    7e-07   
dbj|BAH19476.1|  AT2G41040                                            55.1    8e-07   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA49105.1|  TPA: hypothetical protein ZEAMMB73_519956            53.9    2e-06   
ref|XP_002960327.1|  hypothetical protein SELMODRAFT_402502           55.1    6e-06   
ref|XP_007510827.1|  predicted protein                                52.8    3e-05   Bathycoccus prasinos
ref|XP_002967385.1|  hypothetical protein SELMODRAFT_408369           51.2    1e-04   
gb|EWM24600.1|  phosphatidylethanolamine n                            50.4    2e-04   Nannochloropsis gaditana
ref|XP_005855405.1|  hypothetical protein NGA_2005920                 48.5    7e-04   Nannochloropsis gaditana CCMP526



>gb|EYU36508.1| hypothetical protein MIMGU_mgv1a008665mg [Erythranthe guttata]
Length=366

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 120/174 (69%), Gaps = 14/174 (8%)
 Frame = +2

Query  32   MATAGLG----YVSAVLVTRKLGYNS-----KFSFSPLTPKAN---RLFAVKIRALST--  169
            MA AG G     + A L+  +L +N      +   SPL+  A    RLF  K+RA S+  
Sbjct  5    MAIAGTGNNTSSLPAALLPSRLRFNPMPSCLRVVKSPLSIPARIRRRLFTDKVRASSSAA  64

Query  170  TFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYS  349
              +E  P  ++DEKK+ IR N+LACPIC++   WNGD  LSL S+A+S+LEC TC+K YS
Sbjct  65   VVIETTPDPIVDEKKLNIRKNVLACPICFERVIWNGDSNLSLESVARSSLECKTCKKLYS  124

Query  350  GNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            G ++H+DLTI GGGK YGE + ASTELFR PLVSFLYERGWRQSFS+WGGFPGP
Sbjct  125  GKDSHLDLTITGGGKVYGEPMPASTELFRFPLVSFLYERGWRQSFSIWGGFPGP  178



>ref|XP_011074175.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Sesamum indicum]
Length=360

 Score =   180 bits (457),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  134  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  313
            RL   ++RA S   VE KP  ++ E K+ IR N+LACPICY+   WNGDP LSL S+A+S
Sbjct  48   RLLTHEVRASSAATVETKPDPVVKETKLNIRKNILACPICYERLIWNGDPDLSLESVARS  107

Query  314  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  493
             L+CSTCRK YSG  +H+DLTI G GK YG+ +AASTE+FR PLVSFLYERGWRQSFS W
Sbjct  108  TLQCSTCRKTYSGEGSHLDLTITGRGKVYGDPVAASTEIFRSPLVSFLYERGWRQSFSFW  167

Query  494  GGFPGP  511
            GGFPGP
Sbjct  168  GGFPGP  173



>emb|CDP01043.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = +2

Query  107  FSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPG  286
            F P T K N   A +IRA ST  VE KP  ++DEKK++   N LACPICY    +  D  
Sbjct  38   FIPQTIK-NAFAATRIRATSTLLVETKPDTILDEKKLDSCKNTLACPICYTPLIYTADSS  96

Query  287  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  466
                S A+ NL C TCRK YSGN+TH+DLTI  G K YGEA+ ASTELFR P VSFLYER
Sbjct  97   FPADSAARPNLRCRTCRKAYSGNDTHLDLTITSGSKGYGEAMPASTELFRFPFVSFLYER  156

Query  467  GWRQSFSLWGGFPGP  511
            GWRQSFS+WGGFPGP
Sbjct  157  GWRQSFSIWGGFPGP  171



>ref|XP_003522802.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=352

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 99/128 (77%), Gaps = 6/128 (5%)
 Frame = +2

Query  146  VKIRALSTTFV--EDKPVR---LIDEKKVEIRT-NLLACPICYDAFTWNGDPGLSLSSMA  307
            ++ RA ST+F+  E  P     ++ EK V  R+ N LACP+CYD+ TWNGDPG S+ ++ 
Sbjct  38   LQFRASSTSFIDTETNPRESNVVVVEKDVSSRSSNSLACPVCYDSLTWNGDPGFSVDTIT  97

Query  308  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  487
             S+ +CSTC+K Y GN+TH+DLT  GG K+YGE++ ASTELFR+PL+SFLYERGWRQ+FS
Sbjct  98   GSSFQCSTCQKTYIGNQTHLDLTATGGAKSYGESMPASTELFRVPLISFLYERGWRQTFS  157

Query  488  LWGGFPGP  511
            +WGGFPGP
Sbjct  158  VWGGFPGP  165



>gb|AFK47008.1| unknown [Lotus japonicus]
Length=352

 Score =   164 bits (416),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 98/128 (77%), Gaps = 4/128 (3%)
 Frame = +2

Query  140  FAVKIRALSTT--FVEDKPVR--LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  307
            F +++RA ST    V+ KP    ++D+K+V   +N LACP+C+D+ TW GD GLS+ S+ 
Sbjct  38   FPLQLRAFSTASPIVDPKPTDSIVVDDKEVRRSSNSLACPVCFDSLTWTGDSGLSVDSIP  97

Query  308  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  487
             S+L+CSTC+K Y GN+TH+DLT   G K YG+ + ASTELFR+PL+SFLYERGWRQ+FS
Sbjct  98   VSSLQCSTCQKTYVGNQTHLDLTATSGAKNYGDLMPASTELFRVPLISFLYERGWRQTFS  157

Query  488  LWGGFPGP  511
            +WGGFPGP
Sbjct  158  VWGGFPGP  165



>ref|XP_002285799.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Vitis vinifera]
 emb|CBI19149.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 104/153 (68%), Gaps = 6/153 (4%)
 Frame = +2

Query  65   VLVTRKLGYNSKFSFSPL--TPKANRLFAVKIRALST---TFVEDKPVRLIDEKKVEIRT  229
            V V  +LG      F PL   P  N +FA K+RA ST     VE KP  +  EK++ I  
Sbjct  11   VFVPGQLGQPRDPFFKPLFSPPTVNFVFAAKLRASSTPAAVVVETKPDPISVEKEISIGK  70

Query  230  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  409
            ++LACPICY  FTWNGD GLS+ SM  S+  CS+C+K   GNETH+DLT+A G K Y E+
Sbjct  71   SILACPICYQPFTWNGDLGLSVESMPGSSFHCSSCKKACFGNETHLDLTVATGAKEYDES  130

Query  410  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            + A+TE+FR PL+SFLYERGWRQ+F +WGGFPG
Sbjct  131  MPAATEIFRTPLISFLYERGWRQNF-IWGGFPG  162



>ref|XP_007136240.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
 gb|ESW08234.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
Length=376

 Score =   162 bits (411),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 109/163 (67%), Gaps = 4/163 (2%)
 Frame = +2

Query  32   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVE---DKPVRLI  202
            +A AG+  +S  L + K      FS S    K     ++++RA ST  +    +    ++
Sbjct  28   VAVAGMCTLSPTLSSFK-HPTRLFSASDFAAKLRFPPSIRLRASSTAVINTETNSTESVV  86

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
             EK+V    N LACP+CYD+  WNG PGLS+ +++ S+ +C TC+K Y GN+TH+DLT  
Sbjct  87   VEKEVGNSCNSLACPVCYDSLAWNGGPGLSIDTISGSSFQCGTCQKTYVGNQTHIDLTAT  146

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            GG K+YGE + ASTELFR+PL+SFLYERGWRQ+FS+WGGFPGP
Sbjct  147  GGAKSYGETMPASTELFRVPLISFLYERGWRQTFSVWGGFPGP  189



>ref|XP_008219673.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Prunus mume]
Length=354

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 110/169 (65%), Gaps = 11/169 (7%)
 Frame = +2

Query  32   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLF-----AVKIRALSTTFVE----D  184
            MAT  +G ++   +  +LG NS+     L P    +F     A+  RA ST F+E    D
Sbjct  1    MATV-IGNITPAFLLSRLG-NSRPCVVKLRPCTAPVFRRSFAAITARAASTAFIEVESTD  58

Query  185  KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETH  364
                ++  +      N+LACPIC+D F+ + DPGLS++S + S+ +CSTC+K Y GN+TH
Sbjct  59   TNPIVVQNEVTTSSNNILACPICFDQFSSSADPGLSVNSASGSSFQCSTCKKTYFGNQTH  118

Query  365  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            +DLT A G K YGE++  STELFR PLVSFLYERGWRQSFS+WGGFPGP
Sbjct  119  IDLTTASGSKNYGESMPVSTELFRTPLVSFLYERGWRQSFSVWGGFPGP  167



>gb|KHN19749.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=353

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 7/129 (5%)
 Frame = +2

Query  146  VKIRALSTTFV--EDKPVR---LIDEKKVEIRT-NLLACPICYDAFTWNGDPGLSLSSMA  307
            ++ RA ST+F+  E  P     ++ EK V  R+ N LACP+CYD+ TWNGDPG S+ ++ 
Sbjct  38   LQFRASSTSFIDTETNPRESNVVVVEKDVSSRSSNSLACPVCYDSLTWNGDPGFSVDTIT  97

Query  308  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR-LPLVSFLYERGWRQSF  484
             S+ +CSTC+K Y GN+TH+DLT  GG K+YGE++ ASTELFR +PL+SFLYERGWRQ+F
Sbjct  98   GSSFQCSTCQKTYIGNQTHLDLTATGGAKSYGESMPASTELFRQVPLISFLYERGWRQTF  157

Query  485  SLWGGFPGP  511
            S+WGGFPGP
Sbjct  158  SVWGGFPGP  166



>ref|XP_007222212.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
 gb|EMJ23411.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
Length=354

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 4/127 (3%)
 Frame = +2

Query  143  AVKIRALSTTFVEDKPVR----LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQ  310
            A+  RA ST F+E +P      ++  +      N+LACPIC+D F+ + DPGLS++S + 
Sbjct  41   AITARAASTAFIEVEPRDTNPIVVQNEVTTSSNNILACPICFDQFSSSADPGLSVNSASG  100

Query  311  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSL  490
            S+ +CSTC+K Y GN+TH+DLT A G K YGE++  STELFR PLVSFLYERGWRQSFS+
Sbjct  101  SSFQCSTCKKTYFGNQTHIDLTTASGSKNYGESMPVSTELFRTPLVSFLYERGWRQSFSV  160

Query  491  WGGFPGP  511
            WGGFPGP
Sbjct  161  WGGFPGP  167



>ref|XP_002302290.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|EEE81563.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=349

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 110/163 (67%), Gaps = 4/163 (2%)
 Frame = +2

Query  32   MATAGLGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LI  202
            MA+A L  +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++
Sbjct  1    MASAILSNLSSAFLPSQLSKSSRALFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVV  60

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
             EK V    N+LACP+CY+  T  G   LS+ S   S+L+CSTC+K YSG ETH++LT+A
Sbjct  61   VEKDVSSSKNILACPVCYEPVTLIGANVLSVDSARGSSLQCSTCKKTYSGKETHLELTVA  120

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             G KAY +A+  +TE FR P +SFLYERGWRQ+F +WGGFPGP
Sbjct  121  SGSKAYDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGP  162



>ref|XP_006386404.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|ERP64201.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=355

 Score =   159 bits (402),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 110/163 (67%), Gaps = 4/163 (2%)
 Frame = +2

Query  32   MATAGLGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LI  202
            MA+A L  +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++
Sbjct  1    MASAILSNLSSAFLPSQLSKSSRALFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVV  60

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
             EK V    N+LACP+CY+  T  G   LS+ S   S+L+CSTC+K YSG ETH++LT+A
Sbjct  61   VEKDVSSSKNILACPVCYEPVTLIGANVLSVDSARGSSLQCSTCKKTYSGKETHLELTVA  120

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             G KAY +A+  +TE FR P +SFLYERGWRQ+F +WGGFPGP
Sbjct  121  SGSKAYDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGP  162



>ref|XP_004500619.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cicer arietinum]
Length=338

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 99/135 (73%), Gaps = 5/135 (4%)
 Frame = +2

Query  107  FSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPG  286
            F P T K    F ++++A S+T   D      D   V   +N LACPICY++  W  DPG
Sbjct  22   FFPATAK----FPLRLQASSSTAFIDT-TNQTDSVAVTRSSNPLACPICYNSLIWITDPG  76

Query  287  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  466
            LS+ ++ +S+L+CSTC+K Y+GN+TH+DLT+  G K+YGE++ ASTELFR+PL+SFLYER
Sbjct  77   LSVDTIPRSSLQCSTCQKTYNGNQTHLDLTVTSGAKSYGESMPASTELFRMPLISFLYER  136

Query  467  GWRQSFSLWGGFPGP  511
            GWRQ+FS+WGGFPGP
Sbjct  137  GWRQTFSVWGGFPGP  151



>ref|XP_011016296.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Populus euphratica]
Length=379

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 110/163 (67%), Gaps = 4/163 (2%)
 Frame = +2

Query  32   MATAGLGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LI  202
            MA++ LG +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++
Sbjct  31   MASSILGNLSSAFLPSQLSKSSRPLFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVV  90

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
             EK V    N++ACP+CY+  T  G   LS+ S   S+L CSTC+K YSG ETH++LT+A
Sbjct  91   VEKDVSSSKNIVACPVCYEPVTLIGANVLSVDSARGSSLLCSTCKKTYSGKETHLELTVA  150

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             G K+Y +A+  +TE FR P +SFLYERGWRQ+F +WGGFPGP
Sbjct  151  SGSKSYDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGP  192



>gb|KEH34908.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 104/140 (74%), Gaps = 3/140 (2%)
 Frame = +2

Query  95   SKFSFSPLTPKANRLFAVKIRALSTTFVEDKPV-RLIDEKKVEIRTNLLACPICYDAFTW  271
            ++F FSP TPK  +L  ++  + STTF++  P   +I EK++   +N LACP+CY++ TW
Sbjct  18   TRFFFSP-TPKL-QLRLLRASSSSTTFLDTNPTDSVIVEKEITRSSNPLACPVCYNSLTW  75

Query  272  NGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  451
              +P LS+ +++ S+L+CSTC+K Y+ ++TH++LT       YGE++ ASTELFR PLVS
Sbjct  76   TTNPALSIDTISGSSLQCSTCQKTYTSDQTHLELTTISKANNYGESMPASTELFRTPLVS  135

Query  452  FLYERGWRQSFSLWGGFPGP  511
            FLYERGWRQ+FS+WGGFPGP
Sbjct  136  FLYERGWRQTFSVWGGFPGP  155



>gb|KDO80936.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=232

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 96/146 (66%), Gaps = 3/146 (2%)
 Frame = +2

Query  80   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  253
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  254  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  433
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  434  RLPLVSFLYERGWRQSFSLWGGFPGP  511
            R+P +SF+YERGWRQ+F +WGGFPGP
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGP  162



>ref|XP_010059991.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66499.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
 gb|KCW66500.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
Length=364

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 106/170 (62%), Gaps = 16/170 (9%)
 Frame = +2

Query  50   GYVSAVLVTRKLGYNSKFSFSP-LTPKANRLFAVKIRALST-------TFVEDKPVRL--  199
            G +++V   R+ G + +F+  P  T    +L A  +RA S+        FVE K      
Sbjct  8    GGLASVFAPRRRGSSRRFALKPGETSFQRQLLAPNVRASSSSSSSSSSAFVETKQPPSPP  67

Query  200  ------IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  361
                  +D++K+    N+LACPICY+  T+ GD  LS+ S + S LEC TC+K Y GNET
Sbjct  68   SPPEATVDKEKLGSNQNVLACPICYEPLTFTGDLVLSVDSASGSTLECGTCKKTYVGNET  127

Query  362  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            H DLT A G K YGE +A STELFR PLVS+LYERGWRQSFS+WGGFPGP
Sbjct  128  HFDLTAASGTKEYGEPMALSTELFRTPLVSYLYERGWRQSFSVWGGFPGP  177



>ref|XP_010269234.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Nelumbo nucifera]
Length=349

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 95/160 (59%), Gaps = 3/160 (2%)
 Frame = +2

Query  41   AGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVED---KPVRLIDEK  211
            A +  VS V + R++G +      P+       FA  IRA ST    D   KP  ++D  
Sbjct  3    AIISRVSTVFLPRQIGDSRHCFLKPVKTTVRIPFAATIRASSTATSIDFEIKPDVIVDRM  62

Query  212  KVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  391
            +     ++ ACPICYD  TWNGDPGL +     S  +C TC K Y  N+ ++DLT A G 
Sbjct  63   ESSTSKDIFACPICYDPLTWNGDPGLPVKFTPGSRFQCRTCTKTYFNNKQYLDLTAASGA  122

Query  392  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            K YGE+   STELFR PLVSFLYERGWRQSFS +GGFPGP
Sbjct  123  KEYGESTPPSTELFRTPLVSFLYERGWRQSFSFFGGFPGP  162



>ref|XP_006434006.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47246.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|KDO80934.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
 gb|KDO80935.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=288

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 96/146 (66%), Gaps = 3/146 (2%)
 Frame = +2

Query  80   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  253
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  254  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  433
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  434  RLPLVSFLYERGWRQSFSLWGGFPGP  511
            R+P +SF+YERGWRQ+F +WGGFPGP
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGP  162



>gb|KDO80930.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=334

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 96/146 (66%), Gaps = 3/146 (2%)
 Frame = +2

Query  80   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  253
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  254  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  433
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  434  RLPLVSFLYERGWRQSFSLWGGFPGP  511
            R+P +SF+YERGWRQ+F +WGGFPGP
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGP  162



>ref|XP_006434005.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 ref|XP_006434007.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47245.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47247.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=349

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 96/146 (66%), Gaps = 3/146 (2%)
 Frame = +2

Query  80   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  253
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  254  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  433
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  434  RLPLVSFLYERGWRQSFSLWGGFPGP  511
            R+P +SF+YERGWRQ+F +WGGFPGP
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGP  162



>gb|KDO80931.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=351

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 96/146 (66%), Gaps = 3/146 (2%)
 Frame = +2

Query  80   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  253
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  254  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  433
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  434  RLPLVSFLYERGWRQSFSLWGGFPGP  511
            R+P +SF+YERGWRQ+F +WGGFPGP
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGP  162



>ref|XP_006472620.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=351

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 95/146 (65%), Gaps = 3/146 (2%)
 Frame = +2

Query  80   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  253
            +LG + + S  P  +P   R F  KIRA ST F+E KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFIETKPSEPSFVENEASTSKNVLACPIC  77

Query  254  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  433
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE +  +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGMGTHFDMTAASGSKDYGELMTPTTEFF  137

Query  434  RLPLVSFLYERGWRQSFSLWGGFPGP  511
            R+P +SF+YERGWRQ+F +WGGFPGP
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGP  162



>gb|KDO80933.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=362

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 96/146 (66%), Gaps = 3/146 (2%)
 Frame = +2

Query  80   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  253
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  254  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  433
            Y   TW GD  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  434  RLPLVSFLYERGWRQSFSLWGGFPGP  511
            R+P +SF+YERGWRQ+F +WGGFPGP
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGP  162



>ref|XP_008391080.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=355

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +2

Query  164  STTFVEDKPVRLIDEKKVEIRTN-LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRK  340
            S   VE +P   I  +   I +N +LACPICYD  + +GDPGLS+ S + S+ +C TC+K
Sbjct  51   SGALVEVEPTEPIVVQNDGISSNNILACPICYDPLSSSGDPGLSVESASGSSFQCGTCKK  110

Query  341  KYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             Y GNETH+DLT A G K YGE++  +TE+FR PLVS+LYERGWRQSF++WGGFPGP
Sbjct  111  TYFGNETHIDLTTASGTKDYGESMPVTTEIFRTPLVSYLYERGWRQSFTVWGGFPGP  167



>ref|XP_008348560.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=433

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +2

Query  164  STTFVEDKPVRLIDEKKVEIRTN-LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRK  340
            S   VE +P   I  +   I +N +LACPICYD F+ +GDPGLS+ S + S+ +C TC+K
Sbjct  51   SGAVVEVEPTEPIVVQNGGISSNNILACPICYDPFSSSGDPGLSVESASGSSFQCGTCKK  110

Query  341  KYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             Y GNETH+DLT A G K YGE++  +TE+FR PLVS+LYERGWRQSF++WGGFPGP
Sbjct  111  TYFGNETHIDLTTASGTKDYGESMPVTTEIFRTPLVSYLYERGWRQSFTVWGGFPGP  167



>ref|XP_004299641.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=345

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 104/166 (63%), Gaps = 14/166 (8%)
 Frame = +2

Query  32   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTP-----KANRLFAVKIRALSTTFVEDKPVR  196
            MAT  L   S + +  +LG +   SF    P     K +    + +RA ST FVE  P  
Sbjct  1    MATTKL--TSNLSLPSQLGNSRPDSFKLSNPFTVSFKRSSFPTITVRASSTAFVETTPSE  58

Query  197  LID-EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  373
             I+ + +  I  +LLACPIC+D F+          S + S+ ECSTC+K YS NETH+DL
Sbjct  59   PIEVQNEATICNDLLACPICFDRFS------SKGESGSGSSFECSTCKKTYSSNETHLDL  112

Query  374  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            T+A G K YGE++ ASTE FR+PL+SFLYERGWRQSFS+WGGFPGP
Sbjct  113  TLASGAKNYGESMPASTEFFRIPLISFLYERGWRQSFSVWGGFPGP  158



>ref|XP_010064389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
Length=354

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 99/160 (62%), Gaps = 6/160 (4%)
 Frame = +2

Query  50   GYVSAVLVTRKLGYNSKFSF-SPLTPKANRLFAVKIRALSTTFVEDKPV-----RLIDEK  211
            G + +V    +LG + +F   S  T    R+ A K+RA S+ ++E +P        + ++
Sbjct  8    GNLVSVFSASQLGSSRRFVLRSGETSFERRVLAPKLRASSSAYIETRPPPPPLESTVRQE  67

Query  212  KVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  391
            K+    N LACPIC++  T+ GDP LS++S + S L+C TC+K Y GNETH DLT  GG 
Sbjct  68   KLGGNQNALACPICFEPLTFTGDPVLSVNSASGSTLQCCTCKKAYVGNETHFDLTTTGGT  127

Query  392  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            K YGE +  ++ELFR PLVS+LYERGWRQ F    G PGP
Sbjct  128  KEYGEPVPFASELFRTPLVSYLYERGWRQYFGSLAGSPGP  167



>ref|XP_010042876.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Eucalyptus grandis]
Length=170

 Score =   134 bits (337),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 86/131 (66%), Gaps = 5/131 (4%)
 Frame = +2

Query  134  RLFAVKIRALSTTFVEDKPV-----RLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLS  298
            R+ A K+RA  + +VE +P        + ++K+    N LACPIC++  T+ GDP LS++
Sbjct  37   RVLAPKLRASYSAYVETRPPPPPLESTVRQEKLGGNQNALACPICFEPLTFTGDPVLSVN  96

Query  299  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  478
            S + S L+C TC+K Y GNETH DLT  GG K YGE +  ++ELFR PLVS+LYERGWRQ
Sbjct  97   SASGSTLQCGTCKKAYVGNETHFDLTTTGGTKEYGEPVPFASELFRTPLVSYLYERGWRQ  156

Query  479  SFSLWGGFPGP  511
             F    G PGP
Sbjct  157  YFESLLGSPGP  167



>ref|XP_008374425.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Malus domestica]
Length=355

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  230  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  409
            N+LACPICYD F+ +GDPGLS+ S + S+  CSTC+K Y GNETH+DLT A G K YGE+
Sbjct  74   NILACPICYDPFSSSGDPGLSVESASGSSFHCSTCKKTYFGNETHIDLTTASGAKXYGES  133

Query  410  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            +   TE+FR PL+S+LYERGWRQSF+   G PGP
Sbjct  134  MPVITEMFRTPLISYLYERGWRQSFTGLIGLPGP  167



>ref|XP_008374562.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Malus domestica]
Length=334

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  227  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  406
             N+LACPICYD F+ +GDPGLS+ S + S+  CSTC+K Y GNETH+DLT A G K YGE
Sbjct  73   NNILACPICYDPFSSSGDPGLSVESASGSSFHCSTCKKTYFGNETHIDLTTASGAKXYGE  132

Query  407  ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            ++   TE+FR PL+S+LYERGWRQSF+   G PGP
Sbjct  133  SMPVITEMFRTPLISYLYERGWRQSFTGLIGLPGP  167



>gb|KDP41368.1| hypothetical protein JCGZ_15775 [Jatropha curcas]
Length=350

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 89/129 (69%), Gaps = 4/129 (3%)
 Frame = +2

Query  131  NRLFAVKIRALSTT-FVEDKPVR-LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSM  304
            +R FA KIRA S T FVE KP   ++ EK+     N+LACPICY+  +  GD  LS+ + 
Sbjct  37   HRNFAAKIRASSATAFVETKPADPVVVEKEANTGKNILACPICYEPLSLIGDSVLSVDT-  95

Query  305  AQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSF  484
            A S L+C  C+K YSG ETH++LT+A G + Y +    +TE FR PL+SFLYERGWRQSF
Sbjct  96   AGSILQCGCCKKSYSGKETHIELTVASGLRTYDDTKPLATEFFRTPLISFLYERGWRQSF  155

Query  485  SLWGGFPGP  511
             +WGGFPGP
Sbjct  156  -IWGGFPGP  163



>ref|XP_009394965.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=352

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 98/169 (58%), Gaps = 15/169 (9%)
 Frame = +2

Query  38   TAGLGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALST-------TFVED  184
            T  LG V  VL+   L +   F F+P   L PK + L   V IRA +T       T   D
Sbjct  2    TTALGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGD  58

Query  185  KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETH  364
                L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N  +
Sbjct  59   SNPDLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNNGIY  118

Query  365  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            +DL +A G K Y E + A TELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  119  LDLAVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGP  166



>ref|XP_007018799.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
 gb|EOY16024.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
Length=366

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 106/182 (58%), Gaps = 22/182 (12%)
 Frame = +2

Query  23   LTTMATAGLGYVSAVLVTRKLGYNSKFSFSPLT-PKANRLFAVKIRALSTTFVEDKPVRL  199
            +TT+ T    +  A+  ++  G +++F F P T P   R    K+RA ST FVE KP   
Sbjct  1    MTTVITGN--FRPAIFPSQLNGNSARFLFRPFTTPVFKRSLTAKVRAFSTAFVETKPTEP  58

Query  200  IDEKKVEIR--TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  373
            + E+K +    +N LACPICYD     G+    + S A SNL+C+TC+K Y GNETH+DL
Sbjct  59   VVEEKEDTGGGSNGLACPICYDPLIRIGESTSYVGSTAGSNLQCNTCKKTYRGNETHLDL  118

Query  374  TIAGGGKAYGEALAASTELF----------------RLPLVSFLYERGWRQSFSLWGGFP  505
              + G K Y E++  +TE+F                + P+VSFLYERGWRQ+F L+GGFP
Sbjct  119  VASSGSKQYDESMPLATEVFSTTWIIYNVALTANVLKTPVVSFLYERGWRQNF-LFGGFP  177

Query  506  GP  511
            GP
Sbjct  178  GP  179



>ref|XP_009394966.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=312

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 100/172 (58%), Gaps = 18/172 (10%)
 Frame = +2

Query  38   TAGLGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALSTTFV--------E  181
            T  LG V  VL+   L +   F F+P   L PK + L   V IRA +T+          +
Sbjct  2    TTALGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGD  58

Query  182  DKPV--RLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  355
              PV   L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N
Sbjct  59   SNPVTQDLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNN  118

Query  356  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
              ++DL +A G K Y E + A TELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  119  GIYLDLAVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGP  169



>ref|XP_009373157.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Pyrus x bretschneideri]
Length=348

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 7/94 (7%)
 Frame = +2

Query  230  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  409
            N+LACPICYD F+ +GD GLS+        +C TC+K Y GNETH+DLT A G K YGE+
Sbjct  74   NILACPICYDPFSSSGDLGLSI-------FQCRTCKKTYFGNETHIDLTTASGAKDYGES  126

Query  410  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
               STE+FR PLVS+LYERGWRQSF++WGGFPGP
Sbjct  127  KPISTEMFRTPLVSYLYERGWRQSFNVWGGFPGP  160



>ref|XP_009394964.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=355

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 100/172 (58%), Gaps = 18/172 (10%)
 Frame = +2

Query  38   TAGLGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALSTTFV--------E  181
            T  LG V  VL+   L +   F F+P   L PK + L   V IRA +T+          +
Sbjct  2    TTALGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGD  58

Query  182  DKPV--RLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  355
              PV   L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N
Sbjct  59   SNPVTQDLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNN  118

Query  356  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
              ++DL +A G K Y E + A TELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  119  GIYLDLAVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGP  169



>ref|XP_010061813.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW68836.1| hypothetical protein EUGRSUZ_F02436 [Eucalyptus grandis]
Length=346

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 102/163 (63%), Gaps = 7/163 (4%)
 Frame = +2

Query  32   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKA---NRLFAVKIRALSTTFVEDKPVRLI  202
            MAT       AV    +LG   + +F+ +   +    R+ A ++RA   T   D P+ ++
Sbjct  1    MATLAGSNFLAVARPSQLGPRRRVAFTSVPGSSIFSRRVHAARVRAAVQTATPD-PI-VV  58

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
            DEK V  +  +LACPICY   T  G P LS+ ++++S L CSTC+K Y GN+TH++L  +
Sbjct  59   DEK-VASKKGILACPICYHPLTHAG-PALSMDNLSESTLLCSTCKKTYLGNKTHLELVAS  116

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             G K Y EA+A +TE FRLPL+S++YERGWRQ FS  GG+PGP
Sbjct  117  SGAKEYTEAMAPATEFFRLPLISYIYERGWRQGFSAVGGWPGP  159



>ref|XP_010064206.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66498.1| hypothetical protein EUGRSUZ_F00305 [Eucalyptus grandis]
Length=354

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 6/160 (4%)
 Frame = +2

Query  50   GYVSAVLVTRKLGYNSKFSF-SPLTPKANRLFAVKIRALSTTFVEDKPV-----RLIDEK  211
            G   +V    +LG + +F   S  T    R+ A K+RA  + +VE +P        + ++
Sbjct  8    GNSVSVFGASQLGSSRQFVLRSGETSFERRVLAPKLRASYSAYVETRPPPPPLESTVRQE  67

Query  212  KVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  391
            K+    N LACPIC++   + GDP LS++S + S L+C TC+K Y GNETH DLT  GG 
Sbjct  68   KLGGNQNALACPICFEPLRFTGDPVLSVNSASGSTLQCGTCKKAYVGNETHFDLTTTGGT  127

Query  392  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            K YGE +  ++ELFR PLVS+LYERGWRQ F    G PGP
Sbjct  128  KEYGEPVPFASELFRTPLVSYLYERGWRQYFESLLGSPGP  167



>ref|XP_002889176.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = +2

Query  197  LIDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDL  373
            +I+++K      +LACPICY++  W   P GL  S+ + + L+C+TC++ YSGNETH+DL
Sbjct  60   VIEKEKTRGEKKVLACPICYNSLAWISQPNGLIESATSGTQLQCNTCKRSYSGNETHLDL  119

Query  374  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  120  AVASGSKTYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  164



>ref|XP_006390018.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
 gb|ESQ27304.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
Length=351

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 77/106 (73%), Gaps = 2/106 (2%)
 Frame = +2

Query  197  LIDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDL  373
            +++++K     N+LACPICY++  W   P GL   + + + L+C+TC+K YSGNETH+DL
Sbjct  58   VVEKEKNRGEKNILACPICYNSLAWISQPNGLVEPTASGTQLQCNTCKKSYSGNETHLDL  117

Query  374  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             +A G   Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  118  AVASGSNQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  162



>ref|XP_002513908.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48491.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=351

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 104/170 (61%), Gaps = 16/170 (9%)
 Frame = +2

Query  32   MATAGLGYVSAVLVTRKLGYNSKFSFSPLT-PKANRL-FAVKIRALST-----TFVEDKP  190
            MA A + Y     +  + G + +F F+P T P   R  FA K+RA S+       +E KP
Sbjct  1    MAAATISY----YLPNQFGNSRQFLFNPYTRPIFKRSNFAAKVRASSSTSTSTALLESKP  56

Query  191  VRLIDEKKVEIR---TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  361
               +  +K E+    TN++ACPICY+  +  GD  LS+  + + +L C +C+K Y G ET
Sbjct  57   ADAVVVEKEEVSRSSTNIIACPICYEPLSLIGDRLLSVD-IGECSLRCGSCKKIYYGKET  115

Query  362  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            H++LT+A G   Y +A+  +TE FRL L+SFLYERGWRQ+F +WGGFPGP
Sbjct  116  HIELTVASGASKYDDAMPLATEFFRLSLISFLYERGWRQNF-IWGGFPGP  164



>ref|XP_006300528.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
 gb|EOA33426.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
Length=348

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +2

Query  233  LLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  409
            +LACPICY++F W   P GL  S  + + L+C+TC++ YSGNETH+DL +A G K Y E 
Sbjct  66   ILACPICYNSFAWISQPNGLVESGASGAQLQCNTCKRSYSGNETHLDLAVASGSKQYSEP  125

Query  410  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            +  +TELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  126  MPLATELFRTPLVSFLYERGWRQNF-VWGGFPGP  158



>ref|XP_008356589.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At1g78140, chloroplastic-like [Malus domestica]
Length=259

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 82/124 (66%), Gaps = 7/124 (6%)
 Frame = +2

Query  149  KIRALSTTFVEDKPVRLIDEKKVE----IRTNLLACPICYDAFTWNGDPGLSLSSMAQSN  316
            ++ A S   VE   V LI+   V+      TN+LA PICYD F+   DPGL + S + S+
Sbjct  16   QLAAASGAVVE---VELIEPIMVQNDGISSTNILAGPICYDPFSSXXDPGLFVESASGSS  72

Query  317  LECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWG  496
             +C TC+K Y GNETH+ LT A   K YGE++  + E+FR PLV +LYE+GWRQSF++WG
Sbjct  73   FQCGTCKKTYFGNETHIXLTTASSAKNYGESMPVAXEMFRTPLVLYLYEKGWRQSFTVWG  132

Query  497  GFPG  508
            GFPG
Sbjct  133  GFPG  136



>gb|AAG52104.1|AC012680_15 hypothetical protein; 38642-36701 [Arabidopsis thaliana]
Length=317

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 4/110 (4%)
 Frame = +2

Query  191  VRLIDEKKVEIR--TNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNET  361
            V  + EKK + R    +LACPICY++  W   P GL  S+ +   ++C+TC++ YSGNET
Sbjct  59   VDFVIEKKDKNRGEKKILACPICYNSLAWISQPNGLIESAASGIQVQCNTCKRSYSGNET  118

Query  362  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            H+DL +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  119  HLDLAVASGSKRYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  167



>ref|XP_008374488.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Malus domestica]
Length=348

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 7/94 (7%)
 Frame = +2

Query  230  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  409
            N+LACPICYD F+ +GDPGLS+         CSTC+K Y GNETH+DLT A G K YGE+
Sbjct  74   NILACPICYDPFSSSGDPGLSV-------FHCSTCKKTYFGNETHIDLTTASGAKXYGES  126

Query  410  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            +   TE+FR PL+S+LYERGWRQSF+   G PGP
Sbjct  127  MPVITEMFRTPLISYLYERGWRQSFTGLIGLPGP  160



>ref|NP_565170.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 sp|Q8LBV4.1|Y1814_ARATH RecName: Full=Uncharacterized methyltransferase At1g78140, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAM64539.1| unknown [Arabidopsis thaliana]
 gb|AAO42148.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50518.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36071.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=355

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 4/110 (4%)
 Frame = +2

Query  191  VRLIDEKKVEIR--TNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNET  361
            V  + EKK + R    +LACPICY++  W   P GL  S+ +   ++C+TC++ YSGNET
Sbjct  59   VDFVIEKKDKNRGEKKILACPICYNSLAWISQPNGLIESAASGIQVQCNTCKRSYSGNET  118

Query  362  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            H+DL +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  119  HLDLAVASGSKRYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  167



>gb|KJB59929.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=349

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 91/150 (61%), Gaps = 11/150 (7%)
 Frame = +2

Query  80   KLGYNS-KFSFSPLTPKA-NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNL----LA  241
            +L  NS +F F P T     R    K+RA    FVE KP   I  +K E         LA
Sbjct  17   QLSKNSARFLFRPFTTLVFTRSLTAKVRA----FVETKPTAPIAVEKEESGGGGGSCGLA  72

Query  242  CPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAAS  421
            CPICY+  T   D  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +
Sbjct  73   CPICYNPLTVISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLA  132

Query  422  TELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            TELFR P+VSFLYERGWRQ+F ++GGFPGP
Sbjct  133  TELFRTPVVSFLYERGWRQNF-VFGGFPGP  161



>gb|KCW67137.1| hypothetical protein EUGRSUZ_F00926, partial [Eucalyptus grandis]
Length=294

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +2

Query  200  IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  379
            + ++K+    N LACPIC++  T+ GDP LS++S + S L+C TC+K Y GNETH DLT 
Sbjct  4    VRQEKLGGNQNALACPICFEPLTFTGDPVLSVNSASGSTLQCCTCKKAYVGNETHFDLTT  63

Query  380  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             GG K YGE +  ++ELFR PLVS+LYERGWRQ F    G PGP
Sbjct  64   TGGTKEYGEPVPFASELFRTPLVSYLYERGWRQYFGSLAGSPGP  107



>ref|XP_010472019.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=357

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = +2

Query  206  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  379
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  67   ETKNRGEKKILACPICYNSLAWISQPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  126

Query  380  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  127  ASGTKQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  169



>ref|XP_010534072.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=283

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 101/169 (60%), Gaps = 10/169 (6%)
 Frame = +2

Query  32   MATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTF-VEDKPVR---L  199
            M T   G  S VL+   +  +   SF+ +  +     +  IRA S    +E KP      
Sbjct  3    MLTVIAGRFSPVLLPPGISSSRFSSFNSVARRRTLFVSRSIRASSAAVSIETKPKEDPVP  62

Query  200  IDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQS----NLECSTCRKKYSGNETH  364
            + EK+     N+LACPIC+++      P G+ +  + +S    +L+C TC+K YSG ETH
Sbjct  63   VAEKENIGEKNVLACPICFNSLARVNQPNGIEIWHIRESTLGTSLQCVTCKKNYSGCETH  122

Query  365  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            +DLT+AG  K YGE +  STELFRLPLVSFLYERGWRQSF +WGGFPGP
Sbjct  123  LDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF-IWGGFPGP  170



>ref|XP_010472020.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=356

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = +2

Query  206  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  379
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  66   ETKNRGEKKILACPICYNSLAWISQPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  125

Query  380  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  126  ASGTKQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  168



>ref|XP_010534070.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=356

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 86/129 (67%), Gaps = 10/129 (8%)
 Frame = +2

Query  152  IRALSTTF-VEDKPVR---LIDEKKVEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQS-  313
            IRA S    +E KP      + EK+     N+LACPIC+++      P G+ +  + +S 
Sbjct  43   IRASSAAVSIETKPKEDPVPVAEKENIGEKNVLACPICFNSLARVNQPNGIEIWHIREST  102

Query  314  ---NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSF  484
               +L+C TC+K YSG ETH+DLT+AG  K YGE +  STELFRLPLVSFLYERGWRQSF
Sbjct  103  LGTSLQCVTCKKNYSGCETHLDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF  162

Query  485  SLWGGFPGP  511
             +WGGFPGP
Sbjct  163  -IWGGFPGP  170



>ref|XP_010534071.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=349

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 83/124 (67%), Gaps = 7/124 (6%)
 Frame = +2

Query  152  IRALSTTF-VEDKPVR---LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            IRA S    +E KP      + EK+     N+LACPIC+++      P  +  S   ++L
Sbjct  43   IRASSAAVSIETKPKEDPVPVAEKENIGEKNVLACPICFNSLARVNQP--NGESTLGTSL  100

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            +C TC+K YSG ETH+DLT+AG  K YGE +  STELFRLPLVSFLYERGWRQSF +WGG
Sbjct  101  QCVTCKKNYSGCETHLDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF-IWGG  159

Query  500  FPGP  511
            FPGP
Sbjct  160  FPGP  163



>ref|XP_009128280.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Brassica rapa]
Length=341

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = +2

Query  215  VEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  391
            VE   ++LACPICY++      P GL  S+ + + L+C+TC+K YSGNETH+DL +A G 
Sbjct  54   VEKEKDILACPICYNSLALISKPNGLVGSAASGTQLQCNTCKKSYSGNETHLDLAVASGS  113

Query  392  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
              Y E +  STE+FR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  114  NQYTEPMPLSTEIFRTPLVSFLYERGWRQNF-IWGGFPGP  152



>ref|XP_010428930.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=355

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = +2

Query  206  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  379
            E K      +LACPICY++  W   P   + S   S   L+C+TC++ YSGNETH+DL +
Sbjct  65   ENKNSGEKKILACPICYNSLAWISPPNGFVESTVSSGTQLQCNTCKRSYSGNETHLDLAV  124

Query  380  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  125  ASGTKHYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  167



>ref|XP_010428929.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=356

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = +2

Query  206  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  379
            E K      +LACPICY++  W   P   + S   S   L+C+TC++ YSGNETH+DL +
Sbjct  66   ENKNSGEKKILACPICYNSLAWISPPNGFVESTVSSGTQLQCNTCKRSYSGNETHLDLAV  125

Query  380  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  126  ASGTKHYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  168



>emb|CDY26853.1| BnaA02g18780D [Brassica napus]
Length=341

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = +2

Query  215  VEIRTNLLACPICYDAFTWNGDP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  391
            VE   ++LACPICY++      P GL  S+ + + L+C+TC+K YSGN+TH+DL +A G 
Sbjct  54   VEKEKDILACPICYNSLALISKPNGLVGSAASGTQLQCNTCKKSYSGNDTHLDLAVASGS  113

Query  392  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
              Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  114  NQYTEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  152



>ref|XP_010937469.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=345

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 78/126 (62%), Gaps = 3/126 (2%)
 Frame = +2

Query  140  FAVKIRALS--TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  313
             + +IRA S  T  VE  PV LI + KV    N L CP+CY       +   ++ S A S
Sbjct  31   LSARIRASSSATASVEADPVALIPDAKVSTGINNLGCPVCYYPLISQSNASQTIESTAGS  90

Query  314  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  493
             +EC  C+K Y  N T++DLT+AGG K Y E +   TELFR  LVSFLYERGWRQ+F +W
Sbjct  91   YVECHICKKAYFSNGTYLDLTVAGGSKEYTETMPGGTELFRSQLVSFLYERGWRQNF-IW  149

Query  494  GGFPGP  511
            GGFPGP
Sbjct  150  GGFPGP  155



>ref|XP_010416782.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=360

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = +2

Query  206  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  379
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  70   ETKNRGEKKILACPICYNSLAWISPPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  129

Query  380  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            A G + Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  130  ASGTEQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  172



>ref|XP_010416783.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=359

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = +2

Query  206  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  379
            E K      +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+DL +
Sbjct  69   ETKNRGEKKILACPICYNSLAWISPPNGFVESTASSGTQLQCNTCKRGYSGNETHLDLAV  128

Query  380  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            A G + Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  129  ASGTEQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  171



>gb|KHG01878.1| hypothetical protein F383_23026 [Gossypium arboreum]
Length=349

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 88/145 (61%), Gaps = 10/145 (7%)
 Frame = +2

Query  92   NSKFSFSPLTPKA-NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNL----LACPICY  256
            +++F F P T     R    K+RA    FVE KP   I  +K E         LACPICY
Sbjct  22   SAQFLFRPFTTLVFTRSLTAKVRA----FVETKPTAPIAVEKEESGGGSGSCGLACPICY  77

Query  257  DAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  436
            +      D  + + S   +NL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR
Sbjct  78   NLLMVITDSPIYVGSTVGTNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFR  137

Query  437  LPLVSFLYERGWRQSFSLWGGFPGP  511
             P+VSFLYERGWRQ+F ++GGFPGP
Sbjct  138  TPVVSFLYERGWRQNF-VFGGFPGP  161



>ref|XP_008808068.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Phoenix dactylifera]
Length=339

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 81/132 (61%), Gaps = 3/132 (2%)
 Frame = +2

Query  122  PKANRLFAVKIRALS--TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSL  295
            P A    +V+IRA S  T  VE  PV  I + KV    N L CP+CY       +   ++
Sbjct  23   PSAKPPLSVRIRASSSVTASVEANPVDPIPDAKVSTGMNNLGCPVCYYPLISKSNASQTV  82

Query  296  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  475
            +S A S++EC  C+K Y  N  ++DLT++ G K Y E + A TELFR  LVSFLYERGWR
Sbjct  83   ASPAGSDVECHICKKDYFNNGIYLDLTVSSGSKEYTETVPAGTELFRSQLVSFLYERGWR  142

Query  476  QSFSLWGGFPGP  511
            Q+F +WGGFPGP
Sbjct  143  QNF-IWGGFPGP  153



>emb|CDY14625.1| BnaC02g24880D [Brassica napus]
Length=339

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  215  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  394
            VE   ++LACPICY++      P   L   A + L+C+TC+  YSGNETH+DL +A G  
Sbjct  54   VEKEKDILACPICYNSLALISQPN-GLVGSAGTQLQCNTCKGSYSGNETHLDLAVASGSN  112

Query  395  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGP
Sbjct  113  QYTEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGP  150



>gb|KJB14720.1| hypothetical protein B456_002G140100, partial [Gossypium raimondii]
Length=386

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 81/134 (60%), Gaps = 12/134 (9%)
 Frame = +2

Query  140  FAVKIRALSTTFVEDKPV-----------RLIDEKKVEIRTNLLACPICYDAFTWNGDPG  286
             A K+   ST FVE  P             ++ EK+     N+LACPICYD  TW     
Sbjct  40   LAAKVLVSSTAFVETHPTICKQQNLYQWEPVVVEKEDSGSDNVLACPICYDPLTWTVGSP  99

Query  287  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  466
              + S + SNL+  TC+K Y GN+TH+DL  +GG K Y  ++  +TELFR P+VSFLYER
Sbjct  100  SYVGSKSGSNLQSKTCKKSYFGNQTHLDLVASGGSKQYDNSMPLATELFRTPVVSFLYER  159

Query  467  GWRQSFSLWGGFPG  508
            GWRQ+F ++GGFPG
Sbjct  160  GWRQNF-IFGGFPG  172



>emb|CDX88421.1| BnaC06g38650D [Brassica napus]
Length=353

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 79/124 (64%), Gaps = 6/124 (5%)
 Frame = +2

Query  146  VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT-WNGDPGLSLSSMAQ-SNL  319
            +  RA S +      V  + EK+   + N+LACPICY++       P  S  S A  ++L
Sbjct  40   ISARASSASVETKSSVDYVVEKE---KKNILACPICYNSLAALISQPHESAESPASGTHL  96

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            +C TC K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGWRQ+F +WGG
Sbjct  97   QCKTCNKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGWRQNF-MWGG  155

Query  500  FPGP  511
            FPGP
Sbjct  156  FPGP  159



>gb|KJB59930.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=258

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 87/145 (60%), Gaps = 11/145 (8%)
 Frame = +2

Query  80   KLGYNS-KFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICY  256
            +L  NS +F F P T     +F   + A +   VE       +E      +  LACPICY
Sbjct  17   QLSKNSARFLFRPFT---TLVFTRSLTAKAPIAVEK------EESGGGGGSCGLACPICY  67

Query  257  DAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  436
            +  T   D  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR
Sbjct  68   NPLTVISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFR  127

Query  437  LPLVSFLYERGWRQSFSLWGGFPGP  511
             P+VSFLYERGWRQ+F ++GGFPGP
Sbjct  128  TPVVSFLYERGWRQNF-VFGGFPGP  151



>gb|KJB59931.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=339

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 85/140 (61%), Gaps = 10/140 (7%)
 Frame = +2

Query  92   NSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTW  271
            +++F F P T     +F   + A +   VE       +E      +  LACPICY+  T 
Sbjct  22   SARFLFRPFT---TLVFTRSLTAKAPIAVEK------EESGGGGGSCGLACPICYNPLTV  72

Query  272  NGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  451
              D  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR P+VS
Sbjct  73   ISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFRTPVVS  132

Query  452  FLYERGWRQSFSLWGGFPGP  511
            FLYERGWRQ+F ++GGFPGP
Sbjct  133  FLYERGWRQNF-VFGGFPGP  151



>ref|XP_006472621.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=333

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 81/146 (55%), Gaps = 21/146 (14%)
 Frame = +2

Query  80   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  253
            +LG + + S  P  +P   R F  KIRA ST F+E KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFIETKPSEPSFVENEASTSKNVLACPIC  77

Query  254  YDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  433
            Y   TW GD  LS+                  G  TH D+T A G K YGE +  +TE F
Sbjct  78   YKPLTWIGDSSLSI------------------GMGTHFDMTAASGSKDYGELMTPTTEFF  119

Query  434  RLPLVSFLYERGWRQSFSLWGGFPGP  511
            R+P +SF+YERGWRQ+F +WGGFPGP
Sbjct  120  RMPFMSFIYERGWRQNF-VWGGFPGP  144



>ref|XP_008790838.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=313

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 71/112 (63%), Gaps = 1/112 (1%)
 Frame = +2

Query  176  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  355
            VE  P  LI + KV    N+ ACP+CY +F    D  LS++S A S  EC  C+K Y  N
Sbjct  17   VEANPEDLIPDTKVGTGLNIFACPVCYHSFIDQSDSSLSITSPAGSCFECHACKKAYLNN  76

Query  356  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
              ++DLTIAGG + Y + L   T+ FR  L+S+LYERGWRQSF  WGGFPGP
Sbjct  77   GIYLDLTIAGGLREYDQTLPFLTKFFRGALISYLYERGWRQSFR-WGGFPGP  127



>ref|XP_008790837.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=315

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 71/112 (63%), Gaps = 1/112 (1%)
 Frame = +2

Query  176  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  355
            VE  P  LI + KV    N+ ACP+CY +F    D  LS++S A S  EC  C+K Y  N
Sbjct  17   VEANPEDLIPDTKVGTGLNIFACPVCYHSFIDQSDSSLSITSPAGSCFECHACKKAYLNN  76

Query  356  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
              ++DLTIAGG + Y + L   T+ FR  L+S+LYERGWRQSF  WGGFPGP
Sbjct  77   GIYLDLTIAGGLREYDQTLPFLTKFFRGALISYLYERGWRQSFR-WGGFPGP  127



>ref|XP_009595293.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=169

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 78/128 (61%), Gaps = 4/128 (3%)
 Frame = +2

Query  128  ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  307
            ++R F  +IRA S   VE + +R   +   E    L +CPICY+     G PG +L ++ 
Sbjct  39   SSRGFNSRIRASSAVAVEPE-LRTPAQDATE--AELFSCPICYEPLMRKGPPGFNLPAIY  95

Query  308  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  487
            +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR P+VSFLYERGWRQ+F+
Sbjct  96   RSGFKCRKCNKSYSSKNIYLDLTITSGTKEYSESKPARTELFRSPVVSFLYERGWRQNFN  155

Query  488  LWGGFPGP  511
            L  GFPGP
Sbjct  156  L-SGFPGP  162



>ref|XP_009595292.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=173

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 78/131 (60%), Gaps = 6/131 (5%)
 Frame = +2

Query  128  ANRLFAVKIRALSTTFVED---KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLS  298
            ++R F  +IRA S   VE    K +R   +   E    L +CPICY+     G PG +L 
Sbjct  39   SSRGFNSRIRASSAVAVEPVIAKELRTPAQDATE--AELFSCPICYEPLMRKGPPGFNLP  96

Query  299  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  478
            ++ +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR P+VSFLYERGWRQ
Sbjct  97   AIYRSGFKCRKCNKSYSSKNIYLDLTITSGTKEYSESKPARTELFRSPVVSFLYERGWRQ  156

Query  479  SFSLWGGFPGP  511
            +F+L  GFPGP
Sbjct  157  NFNL-SGFPGP  166



>emb|CBI25578.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 78/124 (63%), Gaps = 4/124 (3%)
 Frame = +2

Query  140  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  34   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  90

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWRQ+F+L  G
Sbjct  91   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNLR-G  149

Query  500  FPGP  511
            FPGP
Sbjct  150  FPGP  153



>ref|XP_002268200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Vitis vinifera]
Length=340

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 78/124 (63%), Gaps = 4/124 (3%)
 Frame = +2

Query  140  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWRQ+F+L  G
Sbjct  93   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNLR-G  151

Query  500  FPGP  511
            FPGP
Sbjct  152  FPGP  155



>ref|XP_010656529.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=343

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 78/124 (63%), Gaps = 4/124 (3%)
 Frame = +2

Query  140  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWRQ+F+L  G
Sbjct  93   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNLR-G  151

Query  500  FPGP  511
            FPGP
Sbjct  152  FPGP  155



>ref|XP_008466034.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Cucumis melo]
Length=356

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 76/105 (72%), Gaps = 2/105 (2%)
 Frame = +2

Query  197  LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  376
            +ID++  +I+ N+LAC IC    T   D GLS+ S     LEC TC+K ++G+E+H+DLT
Sbjct  67   MIDKEVNKIK-NILACSICRGPLTAAADSGLSVESTNGYQLECGTCKKSFTGSESHLDLT  125

Query  377  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            I GG  + GE++ A+TE+FR  LVSFLYERGWRQSFS+  GFPGP
Sbjct  126  ITGGINS-GESMPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGP  169



>emb|CDP10502.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 82/141 (58%), Gaps = 5/141 (4%)
 Frame = +2

Query  89   YNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT  268
            YNS  S  PL   + + F   IRA S   +E  P   I E K  ++ +L ACPICYD   
Sbjct  19   YNS-LSHPPLRCSSPQQFRQIIRATSAVALE--PEAQI-ESKEGLKIDLFACPICYDPLV  74

Query  269  WNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLV  448
              G  G +L ++ +S  +C TC K YS    ++DLT+  G K Y E   A TELFR PLV
Sbjct  75   RKGPSGFNLPAIYRSGFKCRTCNKTYSSKNIYLDLTVTAGSKDYNEFKPAGTELFRSPLV  134

Query  449  SFLYERGWRQSFSLWGGFPGP  511
            SFLYERGWRQ+F+   GFPGP
Sbjct  135  SFLYERGWRQNFN-RSGFPGP  154



>ref|XP_009106463.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=337

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 84/137 (61%), Gaps = 8/137 (6%)
 Frame = +2

Query  113  PLTPKANRLFAVKIRA--LSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT-WNGDP  283
            P+    +RL +VK  A  L  + +    V  + EK+   +  +LACPICY++       P
Sbjct  16   PIGLSVSRLLSVKYAAQRLPVSVLISARVDYVVEKE---KKKILACPICYNSLAALISQP  72

Query  284  GLSLSSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  460
              S    A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLY
Sbjct  73   HESAEYPASGTHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLY  132

Query  461  ERGWRQSFSLWGGFPGP  511
            ERGWRQ+F +WGGFPGP
Sbjct  133  ERGWRQNF-MWGGFPGP  148



>ref|XP_009363912.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=344

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 91/164 (55%), Gaps = 6/164 (4%)
 Frame = +2

Query  32   MATAGLGYVSAVLVTRK---LGYNSKFSFSPLTPKANRLFAVKIRALST-TFVEDKPVRL  199
            MAT     +    ++R    L  NS+F   P     +R  +  IRA ST T   ++  R 
Sbjct  1    MATTPSSALHQTFLSRNYSPLRRNSQFGH-PRLRLPSRHHSHPIRATSTVTLPPERRSRA  59

Query  200  IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  379
             + +   +   LLACP+CY+     G PGL+L ++ +S  +C  C K YS  + ++DLT+
Sbjct  60   EEIQSSGVDLELLACPVCYEPLIRKGPPGLNLRAIYRSGFKCRKCDKSYSSKDVYLDLTV  119

Query  380  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
              G K Y E     TELFR PLVSFLYERGWRQ+F+L  GFPGP
Sbjct  120  TAGLKEYVEVQPIQTELFRSPLVSFLYERGWRQNFNL-SGFPGP  162



>ref|XP_006473930.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=333

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 83/134 (62%), Gaps = 7/134 (5%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  469
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  470  WRQSFSLWGGFPGP  511
            WRQ+F+   GFPGP
Sbjct  139  WRQNFN-RSGFPGP  151



>gb|KJB53959.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=269

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 78/136 (57%), Gaps = 4/136 (3%)
 Frame = +2

Query  110  SPLTPK---ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGD  280
            SP  P    ++R F + +RA S   +E        ++   + T L +CP+CY+     G 
Sbjct  26   SPFRPSLYFSSRPFRLTVRASSAVALEQDLRTQATQQNQTVETELFSCPVCYEPLIRKGP  85

Query  281  PGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  460
            PGL+L ++ +S  +C  C K YS  +  +DLT+  G + Y E     TELFR PLVSFLY
Sbjct  86   PGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTTGLRNYTEVKPVRTELFRSPLVSFLY  145

Query  461  ERGWRQSFSLWGGFPG  508
            ERGWRQ+F+L  GFPG
Sbjct  146  ERGWRQNFNL-SGFPG  160



>ref|XP_011017926.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017927.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017928.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=336

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 80/144 (56%), Gaps = 9/144 (6%)
 Frame = +2

Query  80   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  259
             L +NS FS S L   + R F   IRA S   +E        E   +    + ACP+CY+
Sbjct  20   HLSHNSLFSPSRLRFTSLR-FPSTIRATSAVVLEP-------ELSTQQNQAIFACPVCYE  71

Query  260  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  439
                 G PG +L ++ QS+ +C  C K YS  + ++DLTI  G K Y E     TELFR 
Sbjct  72   PLIRKGPPGFNLPAIYQSSFKCKKCTKTYSSKDNYLDLTITAGMKDYTEINPVRTELFRS  131

Query  440  PLVSFLYERGWRQSFSLWGGFPGP  511
            PLVSFLYERGWRQSF+   GFPGP
Sbjct  132  PLVSFLYERGWRQSFN-QSGFPGP  154



>ref|XP_009106462.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=348

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 84/133 (63%), Gaps = 9/133 (7%)
 Frame = +2

Query  128  ANRL-FAVKIRALSTTF-VEDKP-VRLIDEKKVEIRTNLLACPICYDAFT-WNGDPGLSL  295
            A RL  +V I A   +F VE K  V  + EK+   +  +LACPICY++       P  S 
Sbjct  31   AQRLPVSVLISARVCSFAVETKSSVDYVVEKE---KKKILACPICYNSLAALISQPHESA  87

Query  296  SSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  472
               A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGW
Sbjct  88   EYPASGTHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGW  147

Query  473  RQSFSLWGGFPGP  511
            RQ+F +WGGFPGP
Sbjct  148  RQNF-MWGGFPGP  159



>emb|CDX87473.1| BnaA07g34000D [Brassica napus]
Length=356

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 84/133 (63%), Gaps = 9/133 (7%)
 Frame = +2

Query  128  ANRL-FAVKIRALSTTF-VEDKP-VRLIDEKKVEIRTNLLACPICYDAFT-WNGDPGLSL  295
            A RL  +V I A   +F VE K  V  + EK+   +  +LACPICY++       P  S 
Sbjct  31   AQRLPVSVLISARVCSFAVETKSSVDYVVEKE---KKKILACPICYNSLAALISQPHESA  87

Query  296  SSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  472
               A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGW
Sbjct  88   EYPASATHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGW  147

Query  473  RQSFSLWGGFPGP  511
            RQ+F +WGGFPGP
Sbjct  148  RQNF-MWGGFPGP  159



>ref|XP_006453728.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
 gb|ESR66968.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
Length=333

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 7/134 (5%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  469
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCNKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  470  WRQSFSLWGGFPGP  511
            WRQ+F+   GFPGP
Sbjct  139  WRQNFN-RSGFPGP  151



>gb|KDO59315.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=304

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 7/134 (5%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  469
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  470  WRQSFSLWGGFPGP  511
            WRQ+F+   GFPGP
Sbjct  139  WRQNFN-RSGFPGP  151



>gb|KJB53958.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=343

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 78/136 (57%), Gaps = 4/136 (3%)
 Frame = +2

Query  110  SPLTPK---ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGD  280
            SP  P    ++R F + +RA S   +E        ++   + T L +CP+CY+     G 
Sbjct  26   SPFRPSLYFSSRPFRLTVRASSAVALEQDLRTQATQQNQTVETELFSCPVCYEPLIRKGP  85

Query  281  PGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  460
            PGL+L ++ +S  +C  C K YS  +  +DLT+  G + Y E     TELFR PLVSFLY
Sbjct  86   PGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTTGLRNYTEVKPVRTELFRSPLVSFLY  145

Query  461  ERGWRQSFSLWGGFPG  508
            ERGWRQ+F+L  GFPG
Sbjct  146  ERGWRQNFNL-SGFPG  160



>ref|XP_008391145.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=291

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  299  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  478
            S++ S+ +C TC+K Y GNETH+DLT A G K YGE+   STE+FR PLVS+LYERGWRQ
Sbjct  33   SVSGSSFQCRTCKKTYFGNETHIDLTTASGAKDYGESKPVSTEMFRTPLVSYLYERGWRQ  92

Query  479  SFSLWGGFPGP  511
            SF++WGGFPGP
Sbjct  93   SFTVWGGFPGP  103



>gb|KDO59317.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=319

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 7/134 (5%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  469
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  470  WRQSFSLWGGFPGP  511
            WRQ+F+   GFPGP
Sbjct  139  WRQNFN-RSGFPGP  151



>gb|KDO59316.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=314

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 7/134 (5%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  469
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  470  WRQSFSLWGGFPGP  511
            WRQ+F+   GFPGP
Sbjct  139  WRQNFN-RSGFPGP  151



>gb|KDO59313.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
 gb|KDO59314.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=333

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 7/134 (5%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  469
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  470  WRQSFSLWGGFPGP  511
            WRQ+F+   GFPGP
Sbjct  139  WRQNFN-RSGFPGP  151



>gb|KDO59312.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=328

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 7/134 (5%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  469
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  470  WRQSFSLWGGFPGP  511
            WRQ+F+   GFPGP
Sbjct  139  WRQNFN-RSGFPGP  151



>gb|ABR16838.1| unknown [Picea sitchensis]
Length=326

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 5/120 (4%)
 Frame = +2

Query  152  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  331
            IRA +T    D  V    +  VE   ++L+CPICY      G  GL++S +++S  +C  
Sbjct  57   IRAAATVEAPDVKV----DSNVETTVDVLSCPICYKPLIRKGPSGLNMSFISRSGFQCGN  112

Query  332  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            C+K YS  + ++DLT+  G   Y E    +TELFR PLVSF+YERGWRQ+F+  GGFPGP
Sbjct  113  CKKAYSTRDVYIDLTVTAGSSEYDEYRPLTTELFRSPLVSFVYERGWRQNFA-SGGFPGP  171



>gb|EPS57983.1| hypothetical protein M569_16834, partial [Genlisea aurea]
Length=96

 Score =   105 bits (262),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = +2

Query  233  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  412
            L ACPIC+      G PG +L ++ +S  +CS+C K YS    ++DLTI  G K Y E +
Sbjct  2    LFACPICHLPLIRKGPPGFNLEAIYRSAFKCSSCNKSYSSKNIYLDLTITAGTKEYNEFV  61

Query  413  AASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             A TELFR PLVSFLYERGWRQ+F+   GFPGP
Sbjct  62   PARTELFRSPLVSFLYERGWRQNFNR-SGFPGP  93



>ref|XP_009802104.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Nicotiana sylvestris]
Length=345

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 77/128 (60%), Gaps = 4/128 (3%)
 Frame = +2

Query  128  ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  307
            ++R F  +IRA S   VE +  R + +   E  T L ACPICY+     G  G ++ ++ 
Sbjct  40   SSRGFTSRIRASSAIAVEPES-RTLGQDATE--TELFACPICYEPLMRKGPSGFNVPAIY  96

Query  308  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  487
            +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR PLVSFLYERGWRQ+F+
Sbjct  97   RSGFKCRKCNKSYSSKSIYLDLTITSGTKEYSESKPARTELFRSPLVSFLYERGWRQAFN  156

Query  488  LWGGFPGP  511
               GFPGP
Sbjct  157  R-SGFPGP  163



>ref|XP_004136403.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=313

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +2

Query  230  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  409
            N+LAC IC+   T     GL + S     LEC TC+K ++G+E+H+DLTI GG  + GE+
Sbjct  34   NILACSICHGPLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTITGGTDS-GES  92

Query  410  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            + A+TE+FR  LVSFLYERGWRQSFS+  GFPGP
Sbjct  93   MPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGP  126



>ref|XP_008788786.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Phoenix dactylifera]
Length=348

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 79/132 (60%), Gaps = 6/132 (5%)
 Frame = +2

Query  116  LTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSL  295
            L+P + R F ++  A + T   D  V     K+  +  +LLACPICY+  T  G  GL+L
Sbjct  35   LSPPSLRGFRLRATAAALTVEPDTQV-----KQDSLELDLLACPICYEPLTRKGPSGLNL  89

Query  296  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  475
             ++ +S  +C  C K +S  + ++DLTI  G K Y E     TELFR P+VSFLYERGWR
Sbjct  90   PAIYRSGFKCLKCNKSFSSKDVYLDLTITSGTKEYNEFKPTRTELFRSPIVSFLYERGWR  149

Query  476  QSFSLWGGFPGP  511
            Q+F+   GFPGP
Sbjct  150  QNFN-RSGFPGP  160



>ref|XP_006359517.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=345

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 83/151 (55%), Gaps = 6/151 (4%)
 Frame = +2

Query  59   SAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLL  238
            S V + R +  NSK      T  ++  +  +IRA S   VE +   L    +V     L 
Sbjct  19   SLVPIQRGVSLNSKIRVP--TRFSSNGYTSRIRATSAVAVEPE---LRTPAQVVTEAELF  73

Query  239  ACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAA  418
            ACPICY+     G  G ++ ++ +S  +C  C K YS    ++DLT+  G K Y E+   
Sbjct  74   ACPICYEPLIRKGPSGFNVPAIYRSGFKCRKCNKSYSSKNIYLDLTVTSGTKEYNESKPT  133

Query  419  STELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             TELFR P+VSFLYERGWRQSF+  GGFPGP
Sbjct  134  GTELFRSPVVSFLYERGWRQSFN-RGGFPGP  163



>ref|XP_004161765.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=376

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 72/103 (70%), Gaps = 2/103 (2%)
 Frame = +2

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
            D +  +I+ N+LAC IC+   T     GL + S     LEC TC+K ++G+E+H+DLTI 
Sbjct  89   DNEDNKIK-NILACSICHGPLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTIT  147

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            GG  + GE++ A+TE+FR  LVSFLYERGWRQSFS+  GFPGP
Sbjct  148  GGTDS-GESMPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGP  189



>ref|XP_008336951.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
 ref|XP_008336952.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=348

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 85/144 (59%), Gaps = 3/144 (2%)
 Frame = +2

Query  83   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVE-IRTNLLACPICYD  259
            L +N++F   P     +R  +  IRA ST  ++ +     +E +   +   LLACP+CY+
Sbjct  25   LHHNTQFR-PPHLCLTSRHSSHPIRATSTVTLQPERRSTAEEGQSSGVDLELLACPVCYE  83

Query  260  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  439
                 G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  84   PLIRKGPPGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  143

Query  440  PLVSFLYERGWRQSFSLWGGFPGP  511
            P+VSFLYERGWRQ+F+   GFPGP
Sbjct  144  PIVSFLYERGWRQNFNRR-GFPGP  166



>ref|XP_004242718.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum lycopersicum]
Length=339

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 73/124 (59%), Gaps = 4/124 (3%)
 Frame = +2

Query  140  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            F  +IRA S    E +   L    +  +   L ACPICY+  T  G  G ++ ++ +S  
Sbjct  38   FTSRIRATSAVVAEPE---LRTPAQDSMEAELFACPICYEPLTRKGPSGFNVPAIYRSGF  94

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            +C  C K YS  + ++DLT+  G K Y E   A +ELFR P+VSFLYERGWRQ+F+L  G
Sbjct  95   KCRKCNKSYSSKDIYLDLTVTSGTKQYNEVKPARSELFRSPIVSFLYERGWRQNFNL-SG  153

Query  500  FPGP  511
            FPGP
Sbjct  154  FPGP  157



>gb|KJB27062.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=337

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 4/126 (3%)
 Frame = +2

Query  134  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  313
            R F    RA ST  +E     L  +K     T+L +CP+CY+     G PGL+L+++ +S
Sbjct  34   RPFRFTARASSTVSLETD---LSIQKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRS  90

Query  314  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  493
              +C  C K YS  +T++DLT+  G + Y E   A TELFR P VSF+YERGWRQ+F+  
Sbjct  91   GFKCKQCDKSYSSKDTYLDLTVTAGLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFN-R  149

Query  494  GGFPGP  511
             GFPGP
Sbjct  150  RGFPGP  155



>gb|KJB27061.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=332

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 4/126 (3%)
 Frame = +2

Query  134  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  313
            R F    RA ST  +E     L  +K     T+L +CP+CY+     G PGL+L+++ +S
Sbjct  34   RPFRFTARASSTVSLETD---LSIQKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRS  90

Query  314  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  493
              +C  C K YS  +T++DLT+  G + Y E   A TELFR P VSF+YERGWRQ+F+  
Sbjct  91   GFKCKQCDKSYSSKDTYLDLTVTAGLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFN-R  149

Query  494  GGFPGP  511
             GFPGP
Sbjct  150  RGFPGP  155



>ref|XP_010105909.1| putative methyltransferase [Morus notabilis]
 gb|EXC06728.1| putative methyltransferase [Morus notabilis]
Length=266

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  469
            S  S++ S+L+CSTCRK Y G ETH++LT A G K YGE +  +TELFR  LVSFLYERG
Sbjct  6    SRESVSGSSLQCSTCRKTYFGIETHLELTAASGAKNYGEPMPIATELFRTQLVSFLYERG  65

Query  470  WRQSFSLWGGFPGP  511
            WRQSFS+WGGFPGP
Sbjct  66   WRQSFSVWGGFPGP  79



>ref|XP_009358530.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=345

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 3/144 (2%)
 Frame = +2

Query  83   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  259
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPRRRSPAEESQSSGGDLELLACPICYE  80

Query  260  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  439
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  440  PLVSFLYERGWRQSFSLWGGFPGP  511
            PLVSFLYERGWRQ+F+   GFPGP
Sbjct  141  PLVSFLYERGWRQNFNRR-GFPGP  163



>ref|XP_006852799.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
 gb|ERN14266.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
Length=343

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +2

Query  221  IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  400
            ++ NL ACPICY+     G  GL+L ++ +S  +C TCRK YS  +  +DLT+  G K Y
Sbjct  42   LQYNLFACPICYEPLIRKGPSGLTLPAVYRSGFKCQTCRKSYSSKDVFLDLTVTSGTKDY  101

Query  401  GEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             E     TELFR PLVSFLYERGWRQ+FS   GFPGP
Sbjct  102  NEFKPPRTELFRSPLVSFLYERGWRQTFS-GSGFPGP  137



>ref|XP_009338403.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=345

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 3/144 (2%)
 Frame = +2

Query  83   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  259
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPERRAAAEESQSSGGDLELLACPICYE  80

Query  260  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  439
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  440  PLVSFLYERGWRQSFSLWGGFPGP  511
            PLVSFLYERGWRQ+F+   GFPGP
Sbjct  141  PLVSFLYERGWRQNFNRR-GFPGP  163



>gb|AFW76187.1| hypothetical protein ZEAMMB73_680706 [Zea mays]
Length=187

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 67/102 (66%), Gaps = 1/102 (1%)
 Frame = +2

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  66   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  125

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  126  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFNR-SGFPG  166



>gb|KDP30197.1| hypothetical protein JCGZ_16979 [Jatropha curcas]
Length=345

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 3/143 (2%)
 Frame = +2

Query  83   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDA  262
            L  NS+  F P    ++  F   IRA S   +E + +   +E+   +  +  ACPICY+ 
Sbjct  22   LSRNSRI-FHPRLQFSSLRFHSTIRATSAVALE-RDLGKQEEQSQTLEVDPFACPICYEP  79

Query  263  FTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLP  442
                G PG +LS++ +S  +C  C K Y+  + ++DLTI    K Y E   A +ELFR P
Sbjct  80   LIRKGPPGFNLSAIYRSGFKCKKCNKTYTSKDKYLDLTITAAMKEYTEVKPARSELFRSP  139

Query  443  LVSFLYERGWRQSFSLWGGFPGP  511
            LVSFLYERGWRQ+F+   GFPGP
Sbjct  140  LVSFLYERGWRQNFNR-SGFPGP  161



>ref|XP_009338401.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=350

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 3/144 (2%)
 Frame = +2

Query  83   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  259
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPERRAAAEESQSSGGDLELLACPICYE  80

Query  260  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  439
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  440  PLVSFLYERGWRQSFSLWGGFPGP  511
            PLVSFLYERGWRQ+F+   GFPGP
Sbjct  141  PLVSFLYERGWRQNFNR-RGFPGP  163



>ref|XP_010939635.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=313

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 70/115 (61%), Gaps = 1/115 (1%)
 Frame = +2

Query  164  STTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKK  343
            S+  VE  P  LI + KV    N+LACPICY +F    +  LS++S   S +EC  C+K 
Sbjct  13   SSPAVEANPEDLIPDTKVGTGLNILACPICYRSFIDQNNSSLSITSPDGSCIECHGCKKA  72

Query  344  YSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            Y  N  ++DLTI GG K Y + L   T  FR   +S+LYERGWRQSF  WGGFPG
Sbjct  73   YLNNGIYLDLTITGGLKEYDQTLPFLTGFFRSSWISYLYERGWRQSFR-WGGFPG  126



>ref|XP_006359516.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=343

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 75/124 (60%), Gaps = 4/124 (3%)
 Frame = +2

Query  140  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            +  +IRA S   VE + +R   +   E    L ACPICY+     G  G ++ ++ +S  
Sbjct  42   YTSRIRATSAVAVEPE-LRTPAQDATE--AELFACPICYEPLIRKGPSGFNVPAIYRSGF  98

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            +CS C K YS  + ++DLT+  G K Y E   A +ELFR P+VSFLYERGWRQ+F+L  G
Sbjct  99   KCSKCNKSYSSKDIYLDLTVTSGTKQYNEVKPARSELFRSPIVSFLYERGWRQNFNL-SG  157

Query  500  FPGP  511
            FPGP
Sbjct  158  FPGP  161



>ref|XP_010687777.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=339

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  221  IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  400
            ++ +LLACPIC++     G PGL+L ++ +S  +C TC K YS    ++DLT+  G + Y
Sbjct  62   VQNDLLACPICFETLMRRGPPGLNLEAIYRSGFKCQTCNKSYSSKNVYLDLTVTAGSEEY  121

Query  401  GEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             E    STELFR P+VSFLYERGWRQ+F+   GFPG
Sbjct  122  SENKPTSTELFRSPVVSFLYERGWRQNFN-RSGFPG  156



>gb|AFK46366.1| unknown [Medicago truncatula]
Length=342

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +2

Query  152  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  331
            IRA S   V D P+ L  +K    + +L ACPICY+     G  GL+L ++ +S  +C  
Sbjct  43   IRATSAVVV-DSPLDLSTKKDQGTQVDLFACPICYEPLIRKGPIGLNLPAIYRSGFKCKR  101

Query  332  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  102  CQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQNFR-QSGFPGP  160



>gb|ACJ84583.1| unknown [Medicago truncatula]
 gb|KEH37883.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +2

Query  152  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  331
            IRA S   V D P+ L  +K    + +L ACPICY+     G  GL+L ++ +S  +C  
Sbjct  43   IRATSAVVV-DSPLDLSTKKDQGTQVDLFACPICYEPLIRKGPIGLNLPAIYRSGFKCKR  101

Query  332  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  102  CQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQNFR-QSGFPGP  160



>ref|XP_004242719.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Solanum lycopersicum]
Length=341

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 74/127 (58%), Gaps = 10/127 (8%)
 Frame = +2

Query  140  FAVKIRALSTTFVEDK---PVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQ  310
            F  +IRA S   VE +   P + + E +      L ACPICY+     G  G ++ ++ +
Sbjct  40   FTSRIRATSAVAVEPELRTPAQDVAEAE------LFACPICYEPLIRKGPSGFNVPAVYR  93

Query  311  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSL  490
            S  +C  C K YS    ++DLT+  G K Y E+    TELFR P+VSFLYERGWRQSF+ 
Sbjct  94   SGFKCRKCNKSYSSKNIYLDLTVTSGTKEYNESKPTGTELFRSPVVSFLYERGWRQSFN-  152

Query  491  WGGFPGP  511
             GGFPGP
Sbjct  153  RGGFPGP  159



>ref|XP_006659389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Oryza brachyantha]
Length=358

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 78/133 (59%), Gaps = 8/133 (6%)
 Frame = +2

Query  128  ANRLFAVKIRA-LSTTFVEDKPVRLIDEKKVEI----RTNLLACPICYDAFTWNGDPGLS  292
            A R+    +RA  S   V   P  ++ E  VE     + + LACPICY     + D  L 
Sbjct  43   AKRVLRSSLRASASPDVVSTVPDEVVAEPSVEPEAEKKLSKLACPICYYPLASSSDQSLP  102

Query  293  LSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  472
            L+    S+L+CSTC+K Y     + D+T+A G   Y E+   STELFR PLVSFLYERGW
Sbjct  103  LN--VASSLQCSTCKKFYPNRGDYWDMTVAVGSTVYSESTTVSTELFRTPLVSFLYERGW  160

Query  473  RQSFSLWGGFPGP  511
            RQ+F +WGGFPGP
Sbjct  161  RQNF-IWGGFPGP  172



>ref|XP_008389527.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=304

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 75/123 (61%), Gaps = 6/123 (5%)
 Frame = +2

Query  152  IRALSTTFVEDKPVRLIDEKKVE---IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLE  322
            IRA ST  V   P R    ++++   +   +LACPICY+     G PGL+L ++ +S  +
Sbjct  43   IRATST--VALPPERRSRAEEIQSSGVDLEVLACPICYEPLIRRGPPGLNLRAIYRSGFK  100

Query  323  CSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGF  502
            C  C K YS  + ++DLT+  G K Y E     TELFR PLVSFLYERGWRQ+F+   GF
Sbjct  101  CRKCDKXYSSKDXYLDLTVTAGLKEYVEVQPXXTELFRSPLVSFLYERGWRQNFN-RSGF  159

Query  503  PGP  511
            PGP
Sbjct  160  PGP  162



>ref|XP_003546595.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Glycine max]
 gb|KHN41316.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = +2

Query  152  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  331
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDQAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  332  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  101  CKKSYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  159



>ref|XP_002324579.2| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEF03144.2| methyltransferase-related family protein [Populus trichocarpa]
Length=332

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 65/107 (61%), Gaps = 1/107 (1%)
 Frame = +2

Query  191  VRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVD  370
            +R      +E    + ACP+CY+     G PG +L ++ +S+ +C  C K YS  + ++D
Sbjct  45   IRATSAVALEPNQAIFACPVCYEPLIRKGPPGFNLPAIYRSSFKCKKCTKTYSSKDNYLD  104

Query  371  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            LTI  G K Y E     TELFR PLVSFLYERGWRQSF+   GFPGP
Sbjct  105  LTITAGMKDYTEINPVRTELFRSPLVSFLYERGWRQSFN-QSGFPGP  150



>ref|XP_010099510.1| putative methyltransferase [Morus notabilis]
 gb|EXB79361.1| putative methyltransferase [Morus notabilis]
Length=346

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +2

Query  152  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  331
            IRA S+  +  +P   ++E +    + + ACP+CY+     G  GL+L ++ +S  +C  
Sbjct  47   IRATSSV-IALEPSSSVEENRSSEVSEVFACPVCYEPLIRKGPSGLNLEAIYRSGFKCKK  105

Query  332  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            C K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F+   GFPGP
Sbjct  106  CNKSYSSKDIYLDLTVTAGLRDYTEVKPAGTELFRSPLVSFLYERGWRQNFN-RSGFPGP  164



>gb|KHG26587.1| hypothetical protein F383_01046 [Gossypium arboreum]
Length=337

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 67/102 (66%), Gaps = 1/102 (1%)
 Frame = +2

Query  206  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  385
            +K     T+L +CP+CY+     G PGL+L+++ +S  +C  C K YS  +T++DLT+  
Sbjct  55   QKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRSGFKCKQCDKSYSSKDTYLDLTVTA  114

Query  386  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            G + Y E   A TELFR P VSF+YERGWRQ+F+   GFPGP
Sbjct  115  GLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFN-RRGFPGP  155



>ref|XP_004973409.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Setaria italica]
Length=350

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 66/101 (65%), Gaps = 6/101 (6%)
 Frame = +2

Query  206  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  385
            E   E + + LACPICY  F    DP     S   S+LECSTC+K Y   + + DLT+A 
Sbjct  69   EPAPETKLSKLACPICYYPFVSASDP-----SGDASSLECSTCKKVYPNKQDYWDLTVAV  123

Query  386  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            G   Y E+  A+TE+FR PLVSFLYERGWRQ+F +WGGFPG
Sbjct  124  GSTEYSESKPAATEIFRTPLVSFLYERGWRQNF-IWGGFPG  163



>ref|XP_002988667.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
 gb|EFJ10178.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
Length=269

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +2

Query  230  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  409
             LLACPIC+DA    G PG++  ++A+S  +CSTC++ +S    ++DLT+  G K Y E 
Sbjct  1    ELLACPICFDALLRKGPPGINQFAIAKSGFQCSTCKRSFSSRNEYLDLTVTSGAKDYVEV  60

Query  410  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
                TELFR PLVS +YERGWRQ+F    GFPGP
Sbjct  61   PPTGTELFRNPLVSLIYERGWRQNFE-RSGFPGP  93



>ref|XP_011470680.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=336

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 81/144 (56%), Gaps = 10/144 (7%)
 Frame = +2

Query  80   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  259
            +L +NS      L+P   R  ++ IRA + T  +    +      +E     L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQSSSTQKSQSSGIE----FLSCPVCYE  70

Query  260  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  439
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  71   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  130

Query  440  PLVSFLYERGWRQSFSLWGGFPGP  511
            PLVSFLYERGWRQ+FS   GFPGP
Sbjct  131  PLVSFLYERGWRQNFS-SSGFPGP  153



>ref|XP_011078555.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Sesamum indicum]
Length=338

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 83/159 (52%), Gaps = 13/159 (8%)
 Frame = +2

Query  62   AVLVTRKLGYNSKFSFSPLTPKANR---------LFAVKIRALSTTFVEDKPVRLIDEKK  214
            AV     L +    +F P  P+  R         + + +IRA S   +E +   L  E +
Sbjct  2    AVAAQASLRFYQNSAFFPRNPRLFRDSRLRPPPGVCSARIRASSAVALEPE---LTTEAQ  58

Query  215  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  394
                 +L ACPICY+     G  G +L ++ +S  +C  C K YS    ++DLT+  G K
Sbjct  59   DTTDVDLFACPICYEPLIRKGPSGFNLPAIYRSGFKCRKCNKSYSSKNIYLDLTVTSGTK  118

Query  395  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             Y E   A TELFR PLVSF+YERGWRQ+F+   GFPGP
Sbjct  119  EYNEFKPAGTELFRSPLVSFVYERGWRQNFN-RSGFPGP  156



>gb|KHG21340.1| hypothetical protein F383_03824 [Gossypium arboreum]
Length=394

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 86/165 (52%), Gaps = 1/165 (1%)
 Frame = +2

Query  14   PGELTTMATAGLGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPV  193
            P  L  +A   L  +   L  +   ++    F P    +++ F + +RA S   +E    
Sbjct  48   PFSLMAIAPPSLRPLHKSLFPKYPSFSHDSPFRPSLHFSSKPFRLTVRASSAVALEQDLR  107

Query  194  RLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  373
                ++   + T L +CP+CY+     G  GL+L ++ +S  +C  C K +S  +  +DL
Sbjct  108  TQGTQQNQTVETELFSCPVCYEPLIRKGPLGLNLDAIYRSGFKCKKCNKSFSSKDVFLDL  167

Query  374  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            T+  G + Y E     TELFR PLVSFLYERGWRQ+F+L  GFPG
Sbjct  168  TVTAGLRNYTEVKPVRTELFRSPLVSFLYERGWRQNFNL-SGFPG  211



>ref|XP_011020252.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=338

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 80/144 (56%), Gaps = 5/144 (3%)
 Frame = +2

Query  80   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  259
             L +NS+F  + L     R F   IRA S   +E +   L  ++   +  +  ACPICY 
Sbjct  18   HLFHNSRFPATRLRFTYLR-FPSTIRATSAVSLEPE---LSTQQSQTLEVDPFACPICYQ  73

Query  260  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  439
                 G  G +L ++ +S  +C+ C K YS  E ++DLTI  G K Y E     TELFR 
Sbjct  74   PLIRKGPTGFNLPAIYRSGFKCNRCNKTYSSKENYLDLTITAGMKDYTEVKPVRTELFRS  133

Query  440  PLVSFLYERGWRQSFSLWGGFPGP  511
            PLVSFLYERGWRQ+F+   GFPGP
Sbjct  134  PLVSFLYERGWRQNFN-QSGFPGP  156



>gb|KHN28439.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = +2

Query  152  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  331
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  332  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  101  CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  159



>ref|XP_002268107.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Vitis vinifera]
 emb|CBI25579.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 74/123 (60%), Gaps = 4/123 (3%)
 Frame = +2

Query  140  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            F  +IRA S   +E +    ++     +  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRIRASSAVALEPESSTQLNNG---LEFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            +C +C K YS  + ++DLTI  G K Y E     TELFR PLVSFLYERGWRQ+F+   G
Sbjct  93   KCRSCNKSYSSKDMYLDLTITAGSKDYNELQPNRTELFRSPLVSFLYERGWRQNFN-QSG  151

Query  500  FPG  508
            FPG
Sbjct  152  FPG  154



>ref|NP_001132053.1| uncharacterized LOC100193465 [Zea mays]
 gb|ACF80738.1| unknown [Zea mays]
 gb|AFW76186.1| LOW QUALITY PROTEIN: S-adenosylmethionine-dependent methyltransferase 
[Zea mays]
Length=356

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 67/102 (66%), Gaps = 1/102 (1%)
 Frame = +2

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  66   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  125

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  126  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  166



>ref|XP_002531454.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
 gb|EEF30941.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
Length=290

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +2

Query  230  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  409
            ++ ACP+CY+     G PG +LS++ +S  +C  C K YS  + ++DLTI    K Y E 
Sbjct  14   DVFACPVCYEPLIRKGPPGFNLSAIYRSGFKCKKCNKTYSSKDNYLDLTITASMKEYTEV  73

Query  410  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
              A TELFR PLVSFLYERGWRQ+F+   GFPGP
Sbjct  74   KPARTELFRSPLVSFLYERGWRQNFN-QSGFPGP  106



>gb|ACG27569.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=344

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 67/102 (66%), Gaps = 1/102 (1%)
 Frame = +2

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  54   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  113

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  114  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  154



>gb|ACF85541.1| unknown [Zea mays]
 gb|ACF88073.1| unknown [Zea mays]
Length=346

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 67/102 (66%), Gaps = 1/102 (1%)
 Frame = +2

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  56   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  115

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  116  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  156



>ref|XP_010667997.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=349

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = +2

Query  146  VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLEC  325
            +++R  S   +E  P  +  +K  +   ++L CPICY+  TW+GD  LS+ +++ + L+ 
Sbjct  42   LRLRVSSIAVIETTPESVTTDKNSDTNKSILGCPICYEPLTWSGDSTLSIETVSGTTLQS  101

Query  326  STCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFP  505
             T +K Y  N+   DLT + G K Y E++   TE F  P +S+LYERGWRQ+F L GG+P
Sbjct  102  QTSKKTYYENKFIFDLTTSSGAKDYVESMPLVTEFFSTPFMSYLYERGWRQNFGL-GGYP  160

Query  506  G  508
            G
Sbjct  161  G  161



>ref|XP_004965743.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Setaria italica]
Length=299

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = +2

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
            D++     T + ACP+CY+A    G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  9    DQQNSISETEVFACPVCYEALIRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  68

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  69   SGTKEYTEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  109



>ref|XP_010928267.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=355

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 73/126 (58%), Gaps = 6/126 (5%)
 Frame = +2

Query  134  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  313
            R F ++  A + T   D  V     K+  +  NLLACPICY+     G  GL+L ++ +S
Sbjct  48   RGFPLRATAAALTVEPDTQV-----KQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRS  102

Query  314  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  493
              +C  C K +S  + ++DLTI  G K Y E     TELFR P VSFLYERGWRQ+F+  
Sbjct  103  GFKCLKCNKSFSSKDVYLDLTITSGTKEYNELKPTRTELFRSPFVSFLYERGWRQNFN-R  161

Query  494  GGFPGP  511
             GFPGP
Sbjct  162  SGFPGP  167



>ref|XP_004287240.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=338

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 82/144 (57%), Gaps = 8/144 (6%)
 Frame = +2

Query  80   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  259
            +L +NS      L+P   R  ++ IRA + T  +++       +   I    L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQEQSSSTQKSQSSGI--EFLSCPVCYE  72

Query  260  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  439
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  73   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  132

Query  440  PLVSFLYERGWRQSFSLWGGFPGP  511
            PLVSFLYERGWRQ+FS   GFPGP
Sbjct  133  PLVSFLYERGWRQNFS-SSGFPGP  155



>ref|XP_004965742.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Setaria italica]
Length=354

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = +2

Query  203  DEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  382
            D++     T + ACP+CY+A    G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  64   DQQNSISETEVFACPVCYEALIRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  123

Query  383  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  124  SGTKEYTEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  164



>ref|XP_011470644.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=337

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 82/144 (57%), Gaps = 8/144 (6%)
 Frame = +2

Query  80   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  259
            +L +NS      L+P   R  ++ IRA + T  +++       +   I    L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQEQSSSTQKSQSSGI--EFLSCPVCYE  72

Query  260  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  439
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  73   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  132

Query  440  PLVSFLYERGWRQSFSLWGGFPGP  511
            PLVSFLYERGWRQ+FS   GFPGP
Sbjct  133  PLVSFLYERGWRQNFS-SSGFPGP  155



>ref|XP_002986403.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
 gb|EFJ12612.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
Length=340

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +2

Query  230  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  409
             LLACPIC+DA    G PG++  ++A+S  +CSTC++ +S    ++DLT+  G K Y E 
Sbjct  71   ELLACPICFDALLRKGPPGINQFAIAKSGFQCSTCKRSFSSRNEYLDLTVTSGAKDYVEV  130

Query  410  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
                TELFR PLVS +YERGWRQ+F    GFPGP
Sbjct  131  PPTGTELFRNPLVSLIYERGWRQNFE-RSGFPGP  163



>ref|XP_010533098.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Tarenaya hassleriana]
Length=345

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = +2

Query  197  LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  376
            LI  K   + T++ ACP+CY+     G PG++L ++ +S  +C  C K YS  + ++DLT
Sbjct  60   LITPKTQTLETDIFACPVCYEPLVRKGPPGINLQAIYRSGFKCRECEKTYSSKDGYLDLT  119

Query  377  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            +      + E    +TELFR PLVSFLYERGWRQ+F+   GFPGP
Sbjct  120  VTADSGNFDEVKPITTELFRSPLVSFLYERGWRQNFN-RSGFPGP  163



>ref|XP_010928269.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X3 [Elaeis guineensis]
Length=315

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 68/110 (62%), Gaps = 6/110 (5%)
 Frame = +2

Query  197  LIDEKKVEIR-----TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  361
            L+D +  +++      NLLACPICY+     G  GL+L ++ +S  +C  C K +S  + 
Sbjct  19   LLDIQDTQVKQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRSGFKCLKCNKSFSSKDV  78

Query  362  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            ++DLTI  G K Y E     TELFR P VSFLYERGWRQ+F+   GFPGP
Sbjct  79   YLDLTITSGTKEYNELKPTRTELFRSPFVSFLYERGWRQNFN-RSGFPGP  127



>ref|XP_004488470.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cicer arietinum]
Length=346

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 71/120 (59%), Gaps = 3/120 (3%)
 Frame = +2

Query  152  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  331
            IRA S   V +    L  +  +  + +L ACPICY+     G  G +LS++ +S  +C  
Sbjct  48   IRATSAAVVVESD--LTTQHDLNTQVDLFACPICYEPLIRKGPVGFNLSAIYRSGFKCKR  105

Query  332  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  106  CQKAYTSKDGYLDLTVTSGLRDYTEVQPVRTELFRSPLVSFLYERGWRQNFR-QSGFPGP  164



>ref|NP_001242875.1| uncharacterized protein LOC100798970 [Glycine max]
 gb|ACU18789.1| unknown [Glycine max]
Length=341

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = +2

Query  152  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  331
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  332  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFL+ERGWRQ+F    GFPGP
Sbjct  101  CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLHERGWRQNFR-QSGFPGP  159



>ref|XP_004974685.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Setaria italica]
Length=323

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 70/110 (64%), Gaps = 6/110 (5%)
 Frame = +2

Query  179  EDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNE  358
            +++   L+ E   E++ + LACPICY  F    D      S   S+LECSTC+K Y   +
Sbjct  34   DEEVAELLVETVPEMKLSKLACPICYYPFVSASD-----QSGDASSLECSTCKKVYPNKQ  88

Query  359  THVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             + DLT+A G   Y E++ A+TELFR  LVSFLYERGWRQ+F  WGGFPG
Sbjct  89   DYWDLTVAVGSTEYTESMPAATELFRTSLVSFLYERGWRQTFR-WGGFPG  137



>gb|KJB53960.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=300

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = +2

Query  206  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  385
            ++   + T L +CP+CY+     G PGL+L ++ +S  +C  C K YS  +  +DLT+  
Sbjct  18   QQNQTVETELFSCPVCYEPLIRKGPPGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTT  77

Query  386  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            G + Y E     TELFR PLVSFLYERGWRQ+F+L  GFPG
Sbjct  78   GLRNYTEVKPVRTELFRSPLVSFLYERGWRQNFNL-SGFPG  117



>ref|XP_010250394.1| PREDICTED: uncharacterized protein LOC104592660 [Nelumbo nucifera]
Length=795

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = +2

Query  149  KIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECS  328
            +IRA S   V  +PV    +        + ACP+CY+     G PGL+L ++ +S  +C 
Sbjct  40   RIRASSA--VATEPVTSTQQNNA-FEFEVFACPVCYEPLIRKGPPGLNLPAIYRSGFQCQ  96

Query  329  TCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             C KKYS  + ++DLT+  G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  97   RCNKKYSSRDIYLDLTVIAGTKEYTEFKPARTELFRSPLVSFLYERGWRQNFNR-SGFPG  155

Query  509  P  511
            P
Sbjct  156  P  156



>ref|XP_007202300.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
 gb|EMJ03499.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
Length=352

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = +2

Query  233  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  412
            LLACP+CY+     G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E  
Sbjct  79   LLACPVCYEPLIRKGPPGLNLQAIYRSAFKCKKCDKSYSSKDIYLDLTVIAGLKEYVEVK  138

Query  413  AASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  139  PAGTELFRNPLVSFLYERGWRQNFN-RSGFPG  169



>ref|XP_009141962.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brassica rapa]
Length=355

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 2/104 (2%)
 Frame = +2

Query  203  DEKKVE-IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  379
            D+K+ E + T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+
Sbjct  70   DKKETETVETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTV  129

Query  380  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
              G  ++ E    +TELFR PLVSFLYERGWRQ+F+   GFPGP
Sbjct  130  TAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFAR-SGFPGP  172



>ref|XP_002438745.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
 gb|EER90112.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
Length=352

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  221  IRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  400
            + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y
Sbjct  68   METEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVTAGTKEY  127

Query  401  GEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  128  SEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  162



>dbj|BAF93193.1| putative methyltransferase-like [Hordeum vulgare]
Length=165

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +2

Query  224  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  403
            +T + ACP+CY+     G PG++L ++ +S  +C  C K ++  +  +DLT+  G K Y 
Sbjct  18   KTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCPKCNKSFTSKDVFLDLTVTSGMKQYS  77

Query  404  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  78   ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  111



>emb|CDY57579.1| BnaC04g56820D [Brassica napus]
Length=353

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 77/128 (60%), Gaps = 3/128 (2%)
 Frame = +2

Query  131  NRLFAVKIRALSTT-FVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  307
            +R  +  IRA++    + + P   I E +  + T + ACP+CY+     G  G++L ++ 
Sbjct  45   SRFTSASIRAVALEPELNETPSSDIKETET-VETQVFACPVCYEPLMRKGPSGINLQAIY  103

Query  308  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  487
            +S  +C  C K YS  + ++DLT+  G  ++ E    +TELFR PLVSFLYERGWRQ+F+
Sbjct  104  RSGFKCGQCNKTYSSKDEYLDLTVTAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFA  163

Query  488  LWGGFPGP  511
               GFPGP
Sbjct  164  R-SGFPGP  170



>dbj|BAJ94151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +2

Query  224  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  403
            +T + ACPICY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y 
Sbjct  65   KTEVFACPICYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFLDLTVTSGMKQYS  124

Query  404  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  125  ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  158



>ref|XP_007013645.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY31264.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=340

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 71/120 (59%), Gaps = 4/120 (3%)
 Frame = +2

Query  152  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  331
            +RA S   +E     L  ++   + T+L +CP+CY+     G  GL+L ++ +S  +C  
Sbjct  43   VRASSAVALEPD---LSSQRNQTVDTDLFSCPVCYEPLIRKGPSGLNLEAIYRSGFKCKK  99

Query  332  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            C K YS  + ++DLTI  G + Y E     TELFR P VSF+YERGWRQ+F+   GFPGP
Sbjct  100  CNKSYSSKDVYLDLTITAGLRDYTEVKPVGTELFRSPFVSFVYERGWRQNFN-RSGFPGP  158



>gb|EMT00494.1| Putative methyltransferase [Aegilops tauschii]
Length=493

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 75/126 (60%), Gaps = 11/126 (9%)
 Frame = +2

Query  131  NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQ  310
            +RLFA+      T F E K   L D  K E+     ACP+CY+     G PG++L ++ +
Sbjct  196  SRLFAI-----VTEFQEIK-TELNDASKTEV----FACPVCYEPLIRKGPPGMNLPAIYR  245

Query  311  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSL  490
            S  +CS C K ++  +  +DLT+  G K Y E   A TELFR PLVSFLYERGWRQ+F+ 
Sbjct  246  SGFKCSKCNKSFTSKDVFLDLTVTSGIKEYSELKPARTELFRSPLVSFLYERGWRQNFNR  305

Query  491  WGGFPG  508
              GFPG
Sbjct  306  -SGFPG  310



>dbj|BAJ91607.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +2

Query  224  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  403
            +T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y 
Sbjct  65   KTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFLDLTVTSGMKQYS  124

Query  404  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  125  ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  158



>ref|XP_003574470.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
 ref|XP_010235114.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
Length=361

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 80/135 (59%), Gaps = 14/135 (10%)
 Frame = +2

Query  110  SPLTPKANRLFAVKI--RALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDP  283
            S L   A++ F   +   A++   VE +PV  + +         LACPICY     + D 
Sbjct  52   SALRASASQAFTAGVPDEAVAEPLVEAEPVAELGK---------LACPICYYPLVSSLDQ  102

Query  284  GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYE  463
              S  S + S+LEC TC+K YS  + + DLT+A G   Y E++ A+TELFR  LVSFLYE
Sbjct  103  --SAPSKSDSSLECPTCKKVYSDEDGYWDLTVAVGSTEYSESMPAATELFRTQLVSFLYE  160

Query  464  RGWRQSFSLWGGFPG  508
            RGWRQ+F +WGGFPG
Sbjct  161  RGWRQNF-IWGGFPG  174



>ref|XP_006411367.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
 gb|ESQ52820.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
Length=363

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 77/132 (58%), Gaps = 8/132 (6%)
 Frame = +2

Query  134  RLFAVKIRALSTTFVEDKPVRLIDEKK-----VEIR-TNLLACPICYDAFTWNGDPGLSL  295
            R  ++ IRA++    E    R  D+K+     +EI  T + ACP+CY+     G  G++L
Sbjct  51   RFPSLAIRAVALE-SESNETRSSDQKENQTQSIEIEETQVFACPVCYEPLMRKGPSGINL  109

Query  296  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  475
             ++ +S  +C  C K YS  + ++DLT+      Y E    +TELFR PLVSFLYERGWR
Sbjct  110  KAIYRSGFKCGQCNKTYSSKDEYLDLTVTADLDDYNEVKPITTELFRSPLVSFLYERGWR  169

Query  476  QSFSLWGGFPGP  511
            Q+FS   GFPGP
Sbjct  170  QNFSR-SGFPGP  180



>gb|EMT07919.1| Putative methyltransferase [Aegilops tauschii]
Length=358

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +2

Query  224  RTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  403
            +T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y 
Sbjct  75   KTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFLDLTVTSGMKEYS  134

Query  404  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  135  ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  168



>ref|XP_006381066.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|ERP58863.1| methyltransferase-related family protein [Populus trichocarpa]
Length=308

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 63/105 (60%), Gaps = 1/105 (1%)
 Frame = +2

Query  197  LIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  376
            L  ++   +  +  ACPICY      G  G +L ++ +S  +C+ C K YS  E ++DLT
Sbjct  23   LSTQQSQTLEVDPFACPICYQPLIRKGPKGFNLPAIYRSGFKCNRCNKTYSSKENYLDLT  82

Query  377  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            I  G K Y E     TELFR PLVSFLYERGWRQ+F+   GFPGP
Sbjct  83   ITAGMKDYTEVKPVRTELFRSPLVSFLYERGWRQNFNQ-SGFPGP  126



>gb|AAD12007.1| hypothetical protein [Arabidopsis thaliana]
Length=262

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 2/101 (2%)
 Frame = +2

Query  212  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  388
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  68   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  127

Query  389  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  128  LDDYNEVKPITTELFRSPLVSFLYERGWRQAFK-RSGFPGP  167



>ref|XP_003563313.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brachypodium distachyon]
Length=356

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = +2

Query  233  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  412
            + ACP+CY+     G PG++L ++ +S  +CS C+K ++  +  +DLT+  G K Y E  
Sbjct  76   VFACPVCYEPLIRKGPPGINLPAIYRSGFKCSKCKKSFTSKDIFLDLTVTSGTKEYSELK  135

Query  413  AASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  136  PARTELFRSPLVSFLYERGWRQNFN-RSGFPG  166



>gb|EMT30153.1| Putative methyltransferase [Aegilops tauschii]
Length=416

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 1/108 (1%)
 Frame = +2

Query  185  KPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETH  364
            +P     E+     T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  
Sbjct  120  EPAETKTEQNDTSETEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVF  179

Query  365  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            +DLT+  G K Y E   A TELFR PLVS+LYERGWRQ+F+   GFPG
Sbjct  180  LDLTVTSGMKEYSELKPARTELFRSPLVSYLYERGWRQNFNR-SGFPG  226



>gb|EYU34934.1| hypothetical protein MIMGU_mgv1a009522mg [Erythranthe guttata]
Length=339

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 82/159 (52%), Gaps = 13/159 (8%)
 Frame = +2

Query  62   AVLVTRKLGYNSKFSFSPLTPKANRLFAVK---------IRALSTTFVEDKPVRLIDEKK  214
            AV +   L ++    F P +P  +R   ++         IRA S   ++ +  R   E +
Sbjct  2    AVALQPSLRFHHNSPFFPKSPHLSRNSQIRPNPSFATASIRASSAVALDTESSR---EAQ  58

Query  215  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  394
                  L AC ICY+     G  G +L ++ +S  +C  C K YS    ++DLT+  G K
Sbjct  59   STSDVELFACAICYEPLIRKGPSGFNLQAIYRSGFKCRNCNKSYSSKNLYLDLTVTSGTK  118

Query  395  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             Y E   A TELFR PLVSF+YERGWRQ+F+   GFPGP
Sbjct  119  EYNEFQPAGTELFRSPLVSFVYERGWRQNFN-SRGFPGP  156



>ref|XP_002445476.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
 gb|EES14971.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
Length=352

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 6/101 (6%)
 Frame = +2

Query  206  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  385
            E   E +   LACPICY         G S  S   S+LECSTC+K Y   + + DLT++ 
Sbjct  71   EPAAETKLRKLACPICYYPLA-----GSSDQSDDASSLECSTCKKSYPNKQDYWDLTVSV  125

Query  386  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            G   Y E++ A+TELFR PLVSFLYERGWRQ+F +WGGFPG
Sbjct  126  GSIEYSESMPAATELFRTPLVSFLYERGWRQNF-IWGGFPG  165



>gb|AEJ88263.1| putative S-adenosylmethionine-dependent methyltransferase [Wolffia 
arrhiza]
Length=274

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 65/107 (61%), Gaps = 7/107 (7%)
 Frame = +2

Query  206  EKKVEIRTN------LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHV  367
            EK+ E R N        +CP+CY      G PGL+LS++ +S   C +C K +S   T++
Sbjct  63   EKESESRGNETSESDKFSCPVCYRPLIRTGPPGLNLSAIYRSGFLCKSCNKPFSSRNTYL  122

Query  368  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            DLT+  G K Y E+  + TELFR P VSFLYERGWRQ+F    GFPG
Sbjct  123  DLTVTSGAKEYNESKPSRTELFRSPFVSFLYERGWRQNFR-NSGFPG  168



>ref|XP_009386973.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=353

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 79/129 (61%), Gaps = 6/129 (5%)
 Frame = +2

Query  122  PKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSS  301
            P+++R   +++ A +   VE +  R+     ++++  LLACPICY+     G  GL++ S
Sbjct  42   PRSSR--GLRVSATAALSVEQE-TRVQHNDSMDLQ--LLACPICYEPLIRKGPAGLNVPS  96

Query  302  MAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQS  481
            + +S  +C  C K ++  + ++DLTI  G   Y E   A TELFR PLVSFLYERGWRQ+
Sbjct  97   IYRSGFKCQKCNKSFTSKDVYLDLTITSGTTEYSEFKPARTELFRSPLVSFLYERGWRQN  156

Query  482  FSLWGGFPG  508
            F+   GFPG
Sbjct  157  FN-RSGFPG  164



>ref|XP_006293382.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
 gb|EOA26280.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
Length=356

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 2/101 (2%)
 Frame = +2

Query  212  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  388
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  74   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  133

Query  389  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  134  LDDYNEVKPITTELFRSPLVSFLYERGWRQNFQ-RSGFPGP  173



>ref|NP_181637.2| uncharacterized methyltransferase [Arabidopsis thaliana]
 sp|Q0WPT7.1|Y2104_ARATH RecName: Full=Uncharacterized methyltransferase At2g41040, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAF00862.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09918.1| uncharacterized methyltransferase [Arabidopsis thaliana]
Length=352

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 2/101 (2%)
 Frame = +2

Query  212  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  388
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  70   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  129

Query  389  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  130  LDDYNEVKPITTELFRSPLVSFLYERGWRQAFK-RSGFPGP  169



>ref|XP_010505866.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=355

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = +2

Query  212  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  388
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  73   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  132

Query  389  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             + Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  133  LEDYDEVKPITTELFRSPLVSFLYERGWRQNFK-RSGFPGP  172



>ref|XP_010508773.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=356

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = +2

Query  212  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  388
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  74   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGRCNKTYSSKDEYLDLTVTAD  133

Query  389  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             + Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  134  LEDYDEVKPITTELFRSPLVSFLYERGWRQNFKR-SGFPGP  173



>ref|XP_010050326.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=350

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 1/101 (1%)
 Frame = +2

Query  206  EKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  385
            +K   + + + +CPICY++    G  GL+L +M  S  +C+ C+K YS N   +DLT+  
Sbjct  68   QKDQTLESEIFSCPICYESLIRRGPSGLNLEAMHGSGFKCNRCKKSYSSNGNFLDLTLTA  127

Query  386  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            G + Y E     TELFR PLVSFLYERGWRQ+F    GFPG
Sbjct  128  GLRNYIEVKPRQTELFRSPLVSFLYERGWRQNFK-HSGFPG  167



>ref|XP_006586686.1| PREDICTED: uncharacterized protein LOC100798970 isoform X1 [Glycine 
max]
Length=336

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 69/120 (58%), Gaps = 9/120 (8%)
 Frame = +2

Query  152  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECST  331
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+LS        C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLSGFM-----CKR  95

Query  332  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  96   CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  154



>gb|ACF86599.1| unknown [Zea mays]
 tpg|DAA49106.1| TPA: hypothetical protein ZEAMMB73_519956 [Zea mays]
 tpg|DAA49107.1| TPA: hypothetical protein ZEAMMB73_519956 [Zea mays]
Length=186

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +2

Query  218  EIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  397
            E +   LACPICY     + D     +S     LEC TC+K Y   + + DLT++ G   
Sbjct  71   ETKLRKLACPICYYPLASSSDQLDDATS-----LECPTCKKCYPNKQDYWDLTVSVGSTE  125

Query  398  YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            Y E++  +TELFR PLVSFLYERGWRQ+F +WGGFPG
Sbjct  126  YSESMPVATELFRTPLVSFLYERGWRQNF-IWGGFPG  161



>ref|XP_010517586.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Camelina sativa]
Length=355

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 2/101 (2%)
 Frame = +2

Query  212  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  388
            ++EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  73   QIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  132

Query  389  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  133  LDDYNEVKPITTELFRSPLVSFLYERGWRQNFKR-SGFPGP  172



>ref|XP_001778776.1| predicted protein [Physcomitrella patens]
 gb|EDQ56362.1| predicted protein [Physcomitrella patens]
Length=309

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = +2

Query  176  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN  355
            +  +P   +D ++    + LL CPIC+      G  GL+ +++  S   C +CR+K+S  
Sbjct  12   LRQEPRSNLDREEENSTSELLCCPICHKPLQRTGPSGLTQNAIRSSGFSCHSCRRKFSNR  71

Query  356  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
              +VDLTI  G + Y E   A  E+FR P+VSF+YERGWRQ+F+   GFPGP
Sbjct  72   GDYVDLTILDGTRVYDENTTAGAEIFRSPVVSFVYERGWRQNFAR-AGFPGP  122



>ref|XP_004167998.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At2g41040, chloroplastic-like [Cucumis sativus]
Length=338

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 73/133 (55%), Gaps = 4/133 (3%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  469
            +LS++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLSAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  470  WRQSFSLWGGFPG  508
            WRQ+F+   GFPG
Sbjct  144  WRQNFN-QSGFPG  155



>ref|XP_010928268.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=354

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 72/126 (57%), Gaps = 7/126 (6%)
 Frame = +2

Query  134  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  313
            R F ++  A + T   D  V     K+  +  NLLACPICY+     G  GL+L ++ +S
Sbjct  48   RGFPLRATAAALTVEPDTQV-----KQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRS  102

Query  314  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  493
              +C  C K +S  + ++DLTI  G K Y E     TELF  P VSFLYERGWRQ+F+  
Sbjct  103  GFKCLKCNKSFSSKDVYLDLTITSGTKEYNELKPTRTELFS-PFVSFLYERGWRQNFN-R  160

Query  494  GGFPGP  511
             GFPGP
Sbjct  161  SGFPGP  166



>ref|XP_008456627.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Cucumis melo]
Length=339

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 76/142 (54%), Gaps = 5/142 (4%)
 Frame = +2

Query  83   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDA  262
            L  N +F + PL     R F   IRA S   +E       D+     + ++ +CP+C++ 
Sbjct  19   LSRNIQFRY-PLRLSTPRSFLSTIRASSALVLESDSGTQQDQNS---KIDVFSCPVCFEP  74

Query  263  FTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLP  442
                G PG +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR P
Sbjct  75   LLRKGPPGFNLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSP  134

Query  443  LVSFLYERGWRQSFSLWGGFPG  508
            LVS+LYERGWRQ+F+   GFPG
Sbjct  135  LVSYLYERGWRQNFN-QSGFPG  155



>ref|XP_004287239.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=289

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 67/104 (64%), Gaps = 3/104 (3%)
 Frame = +2

Query  200  IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  379
            ++E   E+   LL+CP+CY+  T  G PGL L ++ +S+ EC  C K YS  + ++DLT+
Sbjct  8    LNESSAEVE--LLSCPVCYEPLTRVGPPGLILQAICRSSFECKKCYKSYSSKKNYLDLTV  65

Query  380  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
              G K Y EA    TELFR  ++SF+YE+G+RQ F  + GFPGP
Sbjct  66   TAGLKKYVEAKPIGTELFRSIIMSFIYEKGYRQCFKRY-GFPGP  108



>ref|XP_008456635.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Cucumis melo]
Length=338

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 76/142 (54%), Gaps = 5/142 (4%)
 Frame = +2

Query  83   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDA  262
            L  N +F + PL     R F   IRA S   +E       D+     + ++ +CP+C++ 
Sbjct  19   LSRNIQFRY-PLRLSTPRSFLSTIRASSALVLESDSGTQQDQNS---KIDVFSCPVCFEP  74

Query  263  FTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLP  442
                G PG +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR P
Sbjct  75   LLRKGPPGFNLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSP  134

Query  443  LVSFLYERGWRQSFSLWGGFPG  508
            LVS+LYERGWRQ+F+   GFPG
Sbjct  135  LVSYLYERGWRQNFN-QSGFPG  155



>dbj|BAC99645.1| hypothetical protein [Oryza sativa Japonica Group]
Length=323

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 7/123 (6%)
 Frame = +2

Query  158  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  500  FPG  508
            FPG
Sbjct  169  FPG  171



>ref|XP_010928270.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X4 [Elaeis guineensis]
Length=314

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +2

Query  197  LIDEKKVEIR-----TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNET  361
            L+D +  +++      NLLACPICY+     G  GL+L ++ +S  +C  C K +S  + 
Sbjct  19   LLDIQDTQVKQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRSGFKCLKCNKSFSSKDV  78

Query  362  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            ++DLTI  G K Y E     TELF  P VSFLYERGWRQ+F+   GFPGP
Sbjct  79   YLDLTITSGTKEYNELKPTRTELFS-PFVSFLYERGWRQNFN-RSGFPGP  126



>emb|CDY06948.1| BnaA04g23670D [Brassica napus]
Length=800

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 75/124 (60%), Gaps = 3/124 (2%)
 Frame = +2

Query  143  AVKIRALS-TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            +  IRA++    + + P   I E +  + T + ACP+CY+     G  G++L ++ +S  
Sbjct  496  SASIRAVALEPELNETPSSDIKETET-VETQVFACPVCYEPLMRKGPSGINLQAIYRSGF  554

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            +C  C K YS  + ++DLT+  G  ++ E    +TELFR PLVSFLYERGWRQ+F+   G
Sbjct  555  KCGQCNKTYSSKDEYLDLTVTAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFAR-SG  613

Query  500  FPGP  511
            FPGP
Sbjct  614  FPGP  617



>ref|NP_001058196.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAD37452.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAD37605.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAF20110.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAG91023.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81074.1| hypothetical protein OsI_23892 [Oryza sativa Indica Group]
Length=345

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 64/105 (61%), Gaps = 5/105 (5%)
 Frame = +2

Query  206  EKKVEIRTN----LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  373
            E KV    N    + ACP+CY+     G  G++L S+ +S  +CS C K ++  +  +DL
Sbjct  53   ENKVPQSNNSEAEVFACPVCYEPLIRKGPSGINLPSIYRSGFKCSKCNKSFTSKDIFLDL  112

Query  374  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            T+  G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  113  TVTSGTKEYSELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  156



>ref|XP_006657188.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Oryza brachyantha]
Length=353

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +2

Query  227  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  406
            T + ACP+CY+     G  G++L ++ +S  +CS C K ++  +  +DLT+  G K Y E
Sbjct  71   TEVFACPVCYEPLIRKGPSGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVTSGTKEYSE  130

Query  407  ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
               A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  131  LKPARTELFRSPLVSFLYERGWRQNFN-RSGFPG  163



>gb|EEC83568.1| hypothetical protein OsI_29220 [Oryza sativa Indica Group]
Length=352

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 7/123 (6%)
 Frame = +2

Query  158  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  52   SVTPEFVTASPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  111

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  112  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  170

Query  500  FPG  508
            FPG
Sbjct  171  FPG  173



>ref|NP_001061786.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAF23700.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAH00216.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 7/123 (6%)
 Frame = +2

Query  158  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  500  FPG  508
            FPG
Sbjct  169  FPG  171



>gb|EEE68668.1| hypothetical protein OsJ_27281 [Oryza sativa Japonica Group]
Length=369

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 7/123 (6%)
 Frame = +2

Query  158  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGDPGLSLSSMAQSNL  319
            +++  FV   P   ++E  VE       +   LACPICY     + D    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  320  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  499
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  500  FPG  508
            FPG
Sbjct  169  FPG  171



>gb|KCW45297.1| hypothetical protein EUGRSUZ_L01041 [Eucalyptus grandis]
Length=239

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 78/147 (53%), Gaps = 15/147 (10%)
 Frame = +2

Query  101  FSFSPLTPKANRL-----FA------VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  247
            F+  PL P+  RL     F+        +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPPFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  248  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  427
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  428  LFRLPLVSFLYERGWRQSFSLWGGFPG  508
            LFR P+VSFLYERGWRQ+F+   GFPG
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPG  153



>ref|XP_004139262.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cucumis sativus]
Length=338

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  469
            +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  470  WRQSFSLWGGFPG  508
            WRQ+F+   GFPG
Sbjct  144  WRQNFN-QSGFPG  155



>gb|KGN60753.1| hypothetical protein Csa_2G009410 [Cucumis sativus]
Length=339

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  469
            +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  470  WRQSFSLWGGFPG  508
            WRQ+F+   GFPG
Sbjct  144  WRQNFN-QSGFPG  155



>emb|CDP12319.1| unnamed protein product [Coffea canephora]
Length=134

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +2

Query  227  TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  406
            +NL+   IC D     G  G S+ ++ +S  +C  C K YS    ++DLT+  G K Y E
Sbjct  23   SNLIFNTICDDPLVRRGPSGFSVPAIYRSGFKCRVCNKTYSSKNIYLDLTVTAGSKDYNE  82

Query  407  ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
               A TELFR PLVSFLYERGWRQ+F+   GFPGP
Sbjct  83   LKPAGTELFRSPLVSFLYERGWRQNFNC-SGFPGP  116



>ref|NP_001150427.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 gb|ACG39054.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 tpg|DAA49108.1| TPA: S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=348

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = +2

Query  218  EIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  397
            E +   LACPICY     + D     +S     LEC TC+K Y   + + DLT++ G   
Sbjct  71   ETKLRKLACPICYYPLASSSDQLDDATS-----LECPTCKKCYPNKQDYWDLTVSVGSTE  125

Query  398  YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            Y E++  +TELFR PLVSFLYERGWRQ+F +WGGFPG
Sbjct  126  YSESMPVATELFRTPLVSFLYERGWRQNF-IWGGFPG  161



>gb|KCW79027.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=304

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 77/147 (52%), Gaps = 15/147 (10%)
 Frame = +2

Query  101  FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  247
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  248  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  427
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  428  LFRLPLVSFLYERGWRQSFSLWGGFPG  508
            LFR P+VSFLYERGWRQ+F+   GFPG
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPG  153



>ref|XP_010047200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW79025.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=336

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 77/147 (52%), Gaps = 15/147 (10%)
 Frame = +2

Query  101  FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  247
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  248  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  427
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  428  LFRLPLVSFLYERGWRQSFSLWGGFPG  508
            LFR P+VSFLYERGWRQ+F+   GFPG
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPG  153



>ref|XP_010040339.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=269

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 78/147 (53%), Gaps = 15/147 (10%)
 Frame = +2

Query  101  FSFSPLTPKANRL-----FA------VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  247
            F+  PL P+  RL     F+        +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPPFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  248  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  427
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  428  LFRLPLVSFLYERGWRQSFSLWGGFPG  508
            LFR P+VSFLYERGWRQ+F+   GFPG
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPG  153



>gb|KCW79026.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=305

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 77/147 (52%), Gaps = 15/147 (10%)
 Frame = +2

Query  101  FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  247
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  248  ICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  427
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  428  LFRLPLVSFLYERGWRQSFSLWGGFPG  508
            LFR P+VSFLYERGWRQ+F+   GFPG
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPG  153



>gb|KFK36957.1| hypothetical protein AALP_AA4G194500 [Arabis alpina]
Length=343

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 73/127 (57%), Gaps = 8/127 (6%)
 Frame = +2

Query  131  NRLFAVKIRALS-TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMA  307
            +R  +  IRA++  + V + P  +I+E      T + ACP+CY+     G  G++L S+ 
Sbjct  40   SRFTSASIRAVALQSDVNESPSTVIEE------TQVFACPVCYEPLLRKGPSGINLQSIY  93

Query  308  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  487
            +S  +C  C K YS  + ++DLT+      + E    +TELFR PLVSFLYERGWR +F 
Sbjct  94   RSGFKCGQCNKTYSSKDEYLDLTVTADLANFNEVKPITTELFRSPLVSFLYERGWRDNFK  153

Query  488  LWGGFPG  508
               GFPG
Sbjct  154  -RSGFPG  159



>ref|XP_002879904.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56163.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 67/119 (56%), Gaps = 2/119 (2%)
 Frame = +2

Query  158  ALSTTFVEDKPVRLIDEKKVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTC  334
            A  +T   +  +   +  K++I    + ACP+CY      G  G++L ++ +S  +C  C
Sbjct  50   AAISTVAPESDINKNETPKIKIEEAQVFACPVCYQPLMRKGPSGINLQAIYRSGFKCGQC  109

Query  335  RKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
             K YS  + ++DLT+      Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  110  NKTYSSKDEYLDLTVTADLDDYNEVKPITTELFRSPLVSFLYERGWRQAFK-RSGFPGP  167



>gb|KGN60338.1| hypothetical protein Csa_3G895840 [Cucumis sativus]
Length=180

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 74/132 (56%), Gaps = 2/132 (2%)
 Frame = +2

Query  83   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRT-NLLACPICYD  259
              ++S  S SP         +      ++T V+     +ID    + +  N+LAC IC+ 
Sbjct  24   FNFHSTLSISPRLSLLTLRSSSAPPMETSTNVQPSDSVMIDNDNEDNKIKNILACSICHG  83

Query  260  AFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  439
              T     GL + S     LEC TC+K ++G+E+H+DLTI GG  + GE++ A+TE+FR 
Sbjct  84   PLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTITGGTDS-GESMPAATEIFRT  142

Query  440  PLVSFLYERGWR  475
             LVSFLYERGWR
Sbjct  143  RLVSFLYERGWR  154



>ref|XP_008336947.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336948.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336949.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
Length=325

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 61/100 (61%), Gaps = 7/100 (7%)
 Frame = +2

Query  230  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN------ETHVDLTIAGGG  391
             LLACP+CY+     G PGL+L ++ +S  EC  C K Y+ +      + ++DLT++GG 
Sbjct  33   ELLACPVCYEPLIRKGPPGLNLQAIFRSAFECKICHKLYNSSSKSKEKDIYLDLTVSGGL  92

Query  392  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            + Y     A T+ FR  LVSFLYERGWRQ F    GFPGP
Sbjct  93   REYIAPXPAGTDFFRYRLVSFLYERGWRQYFG-QSGFPGP  131



>ref|XP_008336950.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Malus domestica]
Length=324

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 61/100 (61%), Gaps = 7/100 (7%)
 Frame = +2

Query  230  NLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGN------ETHVDLTIAGGG  391
             LLACP+CY+     G PGL+L ++ +S  EC  C K Y+ +      + ++DLT++GG 
Sbjct  33   ELLACPVCYEPLIRKGPPGLNLQAIFRSAFECKICHKLYNSSSKSKEKDIYLDLTVSGGL  92

Query  392  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            + Y     A T+ FR  LVSFLYERGWRQ F    GFPGP
Sbjct  93   REYIAPXPAGTDFFRYRLVSFLYERGWRQYFG-QSGFPGP  131



>ref|XP_008242913.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic, 
partial [Prunus mume]
Length=263

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +2

Query  272  NGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  451
             G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E     TELFR PLVS
Sbjct  3    KGPPGLNLQAIYRSAFKCKKCDKSYSSKDIYLDLTVIAGLKEYVEVKPVGTELFRSPLVS  62

Query  452  FLYERGWRQSFSLWGGFPG  508
            FLYERGWRQ+F+   GFPG
Sbjct  63   FLYERGWRQNFNR-SGFPG  80



>ref|XP_006826926.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
 gb|ERM94163.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
Length=215

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 56/98 (57%), Gaps = 1/98 (1%)
 Frame = +2

Query  215  VEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  394
            V  R + LACPICY     N      + S    N  C  C+K YS  E ++DL++     
Sbjct  8    VVTRLDSLACPICYQPLIRNSGANPKILSPRGLNFRCQNCQKAYSNYEEYIDLSVTDDSN  67

Query  395  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
             Y  A+ ++TE+FR PLVS+LYERG+ ++F+ W GF G
Sbjct  68   EYVGAMPSATEVFRNPLVSYLYERGYGKNFT-WSGFSG  104



>ref|XP_006473932.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=139

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 6/112 (5%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPL  445
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR PL
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRTPL  130



>ref|XP_006474605.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=160

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (58%), Gaps = 8/121 (7%)
 Frame = +2

Query  110  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGL  289
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  290  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLV--SFLYE  463
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR  LV  +F +E
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRCVLVILAFFHE  138

Query  464  R  466
            +
Sbjct  139  K  139



>gb|EMT14235.1| Putative methyltransferase [Aegilops tauschii]
Length=465

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 58/107 (54%), Gaps = 16/107 (15%)
 Frame = +2

Query  188  PVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHV  367
            P + I  +    +T + ACP+CY+     G PG++LS               ++  +  +
Sbjct  51   PFQEIKTEHDASKTEVFACPVCYEPLIRKGPPGMNLS---------------FTSKDVFL  95

Query  368  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            DLT+  G K Y E   A TELFR PLV FLYERGWRQ+F+   GFPG
Sbjct  96   DLTVTSGMKEYSELKPARTELFRSPLVPFLYERGWRQNFN-RSGFPG  141



>ref|XP_002306577.1| hypothetical protein POPTR_0005s17000g [Populus trichocarpa]
 gb|EEE93573.1| hypothetical protein POPTR_0005s17000g [Populus trichocarpa]
Length=122

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = +2

Query  119  TPKANRL-FAVKIRALSTTFVEDKPVRLID-EKKVEIRTNLLACPICYDAFTWNGDPGLS  292
            TP   R  FA KIRA ST F E KP   +  EK V    N+LACP+CY+  T  G   LS
Sbjct  29   TPTFKRTSFATKIRASSTAFAETKPTGPVTVEKDVRSSKNILACPVCYEPVTLIGATVLS  88

Query  293  LSSMAQSNLECSTCRKKYSGNETHV  367
            + S   S+L+CSTC+K YSG ET +
Sbjct  89   VYSARGSSLQCSTCKKTYSGKETQL  113



>ref|XP_002306578.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEE93574.1| methyltransferase-related family protein [Populus trichocarpa]
Length=244

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 2/53 (4%)
 Frame = +2

Query  356  ETHVDLTIAGGGKAYGE-ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            ETH++LT+A G K YG+ A+  +TE FR P +SFLYERGWRQ+F +WGGFPGP
Sbjct  6    ETHLELTVASGSKGYGDIAMPLATEFFRTPFMSFLYERGWRQNF-VWGGFPGP  57



>ref|XP_002968407.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
 gb|EFJ30661.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
Length=315

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (57%), Gaps = 1/92 (1%)
 Frame = +2

Query  236  LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALA  415
            LACP C +  + +G  G + +++A+S L C TC K +  + T +DLT+      + E L 
Sbjct  26   LACPTCLEPLSRHGPQGFNRAAIAKSILRCQTCSKDFPSDGTFIDLTLGANRSTWQETLP  85

Query  416  ASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
                LFR   +S +YE  WR+SF  + GFPGP
Sbjct  86   IGVRLFRTKWISLIYEENWRKSFEKF-GFPGP  116



>gb|KEH37884.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=277

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query  299  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  478
            ++ +S  +C  C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ
Sbjct  26   AIYRSGFKCKRCQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQ  85

Query  479  SFSLWGGFPGP  511
            +F    GFPGP
Sbjct  86   NFRQ-SGFPGP  95



>ref|XP_005643537.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE18993.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=357

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 65/127 (51%), Gaps = 8/127 (6%)
 Frame = +2

Query  134  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  313
            RL  V  RA +   +  +P+    E+  +      ACPIC    T       S   +AQ+
Sbjct  42   RLRVVPCRATAQP-ISARPLGTDSERVKDSVEYNFACPIC---LTTEFSIQKSNQGLAQA  97

Query  314  NLECSTCRKKYSGNETHVDLTIAGGGKA--YGEALAASTELFRLPLVSFLYERGWRQSFS  487
             L C  C + +S NE  VDLT   G  A  Y ++    T++FR PLVSF YERGWR SF+
Sbjct  98   -LHCDRCARTFSANEKSVDLTSTSGAPARVYKQSFWGGTQIFRSPLVSFAYERGWRSSFT  156

Query  488  LWGGFPG  508
             W GFPG
Sbjct  157  -WAGFPG  162



>ref|XP_005842697.1| hypothetical protein CHLNCDRAFT_136276 [Chlorella variabilis]
 gb|EFN50565.1| hypothetical protein CHLNCDRAFT_136276 [Chlorella variabilis]
Length=190

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 7/93 (8%)
 Frame = +2

Query  236  LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG--GKAYGEA  409
            LACPIC         P  +       +L C  C + ++   T+ DLT+  G   KAY ++
Sbjct  81   LACPICLS----TKLPLRNTQGRPTGSLSCPRCNRTFASTPTYADLTLTSGIQQKAYQQS  136

Query  410  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
                T +FR PLVSF+YERGWRQ F+ W GFPG
Sbjct  137  WWGGTTIFRSPLVSFVYERGWRQGFA-WAGFPG  168



>gb|KDO80932.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=235

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +2

Query  371  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            +T A G K YGE ++ +TE FR+P +SF+YERGWRQ+F +WGGFPGP
Sbjct  1    MTAASGSKDYGELMSPATEFFRMPFMSFIYERGWRQNF-VWGGFPGP  46



>ref|XP_006434004.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47244.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=233

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = +2

Query  371  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            +T A G K YGE ++ +TE FR+P +SF+YERGWRQ+F +WGGFPGP
Sbjct  1    MTAASGSKDYGELMSPATEFFRMPFMSFIYERGWRQNF-VWGGFPGP  46



>ref|XP_002954755.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
 gb|EFJ44161.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
Length=369

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 51/93 (55%), Gaps = 12/93 (13%)
 Frame = +2

Query  242  CPICYDAFTWNGDPGLSLSSMAQSN--LECSTCRKKYSGNETHVDLTIAGG--GKAYGEA  409
            CPIC            SLSSM   +  L C  C++ +  +  ++DLT+  G   + Y + 
Sbjct  82   CPICLQTH-------FSLSSMPTQSGGLSCVRCQRTFPSSPAYLDLTLTSGVRQRVYKQR  134

Query  410  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
                TELFR PLVSF YERGWRQ F+ W GFPG
Sbjct  135  SWGGTELFRNPLVSFAYERGWRQGFA-WAGFPG  166



>ref|XP_001694737.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02321.1| predicted protein [Chlamydomonas reinhardtii]
Length=275

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = +2

Query  314  NLECSTCRKKYSGNETHVDLTIAGG--GKAYGEALAASTELFRLPLVSFLYERGWRQSFS  487
             L C+ C + +  + +++DLT+  G   K Y +     TELFR PLVSF+YERGWRQ F+
Sbjct  10   GLYCNRCVRTFPASPSYLDLTLTAGIKQKVYNQRSWGGTELFRSPLVSFVYERGWRQGFA  69

Query  488  LWGGFPG  508
             W GFPG
Sbjct  70   -WAGFPG  75



>ref|XP_010040340.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=134

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 11/139 (8%)
 Frame = +2

Query  29   TMATAG---LGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRL  199
            TMA++    L +    L+ R      +  FS +     RL +  +RA S   VE      
Sbjct  2    TMASSSMHQLSFARHPLLPRNSRVQPRPQFSSV-----RLPSFTVRASSVLAVEPD---T  53

Query  200  IDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  379
              +K   +   + +CPICY+     G  GL+L ++ +S  +C  C K YS     +DLT+
Sbjct  54   GTQKDQTLEVEIFSCPICYEPLIRRGPSGLNLEAVYRSGFKCKNCNKSYSSKNNFLDLTL  113

Query  380  AGGGKAYGEALAASTELFR  436
              G + Y E   A +ELFR
Sbjct  114  TAGLRDYVEVKPARSELFR  132



>gb|KCW45298.1| hypothetical protein EUGRSUZ_L01042 [Eucalyptus grandis]
Length=132

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 3/101 (3%)
 Frame = +2

Query  134  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGDPGLSLSSMAQS  313
            RL +  +RA S   VE        +K   +   + +CPICY+     G  GL+L ++ +S
Sbjct  33   RLPSFTVRASSVLAVEPD---TGTQKDQTLEVEIFSCPICYEPLIRRGPSGLNLEAVYRS  89

Query  314  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  436
              +C  C K YS     +DLT+  G + Y E   A +ELFR
Sbjct  90   GFKCKNCNKSYSSKNNFLDLTLTAGLRDYVEVKPARSELFR  130



>emb|CAN77779.1| hypothetical protein VITISV_004172 [Vitis vinifera]
Length=714

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 10/79 (13%)
 Frame = +2

Query  230  NLLACPICYDAFTWNGDPGLSLSSMA----------QSNLECSTCRKKYSGNETHVDLTI  379
            +L +CP+CY+     G PGL+L  +           +S  +C TC K YS  + ++DLTI
Sbjct  232  DLFSCPVCYEXLIRKGPPGLNLXCLKNYTICRPAIYRSGFKCKTCNKSYSSKDMYLDLTI  291

Query  380  AGGGKAYGEALAASTELFR  436
              G KAY EA    TELFR
Sbjct  292  TAGSKAYNEAQPVRTELFR  310


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 35/63 (56%), Gaps = 15/63 (24%)
 Frame = +2

Query  362  HVDLTIAGGGKAYGEALAASTELFR--------------LPLVSFLYERGWRQSFSLWGG  499
            ++DLTI  G K Y E     TELFR               PLVSFLYERGWRQ+F+   G
Sbjct  2    YLDLTITAGSKDYNELQPNRTELFRNCPCLIFGXFAIVRSPLVSFLYERGWRQNFNX-SG  60

Query  500  FPG  508
            FPG
Sbjct  61   FPG  63



>ref|XP_008344066.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=327

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query  362  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  511
            ++DLT+  G K Y E     TELFR PLVSFLYERGWRQ+F+   GFPGP
Sbjct  97   YLDLTVTAGLKEYVEVQPTRTELFRSPLVSFLYERGWRQNFN-RSGFPGP  145



>ref|XP_003056709.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58354.1| predicted protein [Micromonas pusilla CCMP1545]
Length=384

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 47/95 (49%), Gaps = 17/95 (18%)
 Frame = +2

Query  233  LLACPICYDAFTWNGDPGLSLSSMAQSNLECSTC-RKKYSGNETHVDLTIAGGGKA--YG  403
            LLACPIC             L+     +L C+ C R  Y   +  +DL +   G A  Y 
Sbjct  63   LLACPIC-------------LTPFPAGSLRCARCARDAYPTKDGILDLCLDANGAAGAYA  109

Query  404  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            E   + T LF+  ++S  YE GWRQSF+ W GFPG
Sbjct  110  EPQRSGTRLFQSDVISAAYENGWRQSFA-WAGFPG  143



>gb|KHN03912.1| Putative methyltransferase, chloroplastic, partial [Glycine soja]
Length=213

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +2

Query  434  RLPLVSFLYERGWRQSFSLWGGFPGP  511
            R+PL+SFL+ERGWRQ+FS+WGGFPGP
Sbjct  2    RVPLISFLHERGWRQTFSVWGGFPGP  27



>ref|XP_003527908.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=248

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +2

Query  434  RLPLVSFLYERGWRQSFSLWGGFPGP  511
            R+PL+SFL+ERGWRQ+FS+WGGFPGP
Sbjct  36   RVPLISFLHERGWRQTFSVWGGFPGP  61



>dbj|BAH19476.1| AT2G41040 [Arabidopsis thaliana]
Length=141

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +2

Query  212  KVEIR-TNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  388
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  70   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  129

Query  389  GKAYGEALAAST  424
               Y E    +T
Sbjct  130  LDDYNEVKPITT  141



>tpg|DAA49105.1| TPA: hypothetical protein ZEAMMB73_519956 [Zea mays]
Length=138

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 5/73 (7%)
 Frame = +2

Query  218  EIRTNLLACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  397
            E +   LACPICY     + D     +S     LEC TC+K Y   + + DLT++ G   
Sbjct  71   ETKLRKLACPICYYPLASSSDQLDDATS-----LECPTCKKCYPNKQDYWDLTVSVGSTE  125

Query  398  YGEALAASTELFR  436
            Y E++  +TELFR
Sbjct  126  YSESMPVATELFR  138



>ref|XP_002960327.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
 gb|EFJ37866.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
Length=604

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 8/105 (8%)
 Frame = +2

Query  203  DEKKVEIRTNL--LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKY-SGNETHVDL  373
            +E++ + RT L  LACPIC      + +  +S+ + A ++  C+ CR+ Y S +   ++L
Sbjct  52   NEQEDDARTTLKSLACPICLQPLWTSSNESVSVENAASTSFRCNGCRRSYHSSSRGIINL  111

Query  374  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            TI G   A G  L+AS  +F  P+V+  Y++ +R       GFPG
Sbjct  112  TIPG---ACGVPLSAS--VFENPIVARFYDKSYRDQVFQLVGFPG  151



>ref|XP_007510827.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18360.1| predicted protein [Bathycoccus prasinos]
Length=390

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +2

Query  362  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            + DL I+    ++ EA  + T LF  P+VS  YERGWR SF+ W GFPG
Sbjct  115  YTDLEISRNANSFREAKLSGTSLFETPIVSNAYERGWRDSFA-WAGFPG  162



>ref|XP_002967385.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
 gb|EFJ31984.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
Length=776

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 56/105 (53%), Gaps = 8/105 (8%)
 Frame = +2

Query  203  DEKKVEIRTNL--LACPICYDAFTWNGDPGLSLSSMAQSNLECSTCRKKY-SGNETHVDL  373
            +E+  + RT L  LACPIC      + +  +S+ + A ++  C+ CR+ Y S +   ++L
Sbjct  224  NEQDDDARTTLKSLACPICLQPLWTSSNESVSVENAASTSFRCNGCRRSYHSSSRGIINL  283

Query  374  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            TI G   A G  L+AS  +F   +V+  Y++ +R       GFPG
Sbjct  284  TIPG---ACGVPLSAS--VFENSIVARFYDKSYRDQVFQLVGFPG  323



>gb|EWM24600.1| phosphatidylethanolamine n [Nannochloropsis gaditana]
Length=387

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 33/59 (56%), Gaps = 4/59 (7%)
 Frame = +2

Query  341  KYSGNETHVDLTIAGGGKA---YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            KY  NE ++DL  A        +  +   + ELFR PL SFLYERGWR +F    GFPG
Sbjct  136  KYPANEVYMDLVPAEERMQVPFFSPSAIVTQELFRSPLTSFLYERGWRDNFKT-AGFPG  193



>ref|XP_005855405.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
 ref|XP_005855816.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20544.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20954.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
Length=387

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 32/59 (54%), Gaps = 4/59 (7%)
 Frame = +2

Query  341  KYSGNETHVDLTIAGGGKA---YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  508
            KY  NE ++DL           +  +   + ELFR PL SFLYERGWR +F    GFPG
Sbjct  136  KYPANEVYMDLVPVEERMQVPFFSPSAIVTQELFRSPLTSFLYERGWRDNFKT-AGFPG  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115